5I3OA

Crystal structure of bmp-2-inducible kinase in complex with an indazole inhibitor
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
302
structure length
302
Chain Sequence
RVFAVGRHQVTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAAADCPVSNINNSSIPSALPEPMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords BMP-2-inducible protein kinase
publication title Crystal Structure of BMP-2-inducible kinase in complex with an Indazole inhibitor
rcsb
source organism Homo sapiens
total genus 86
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5i3oA00
1R3CA 4O0VA 4UV0A 3VUMA 3Q60A 3RWQA 5DI1A 5DR6A 4DEGA 5KE0A 2ZV9A 3H0ZA 3EIDA 3ERKA 1Q5KA 3OWKA 1JQHA 3BKBA 4DFZE 3SXRA 3LHJA 3SOAA 3W1FA 1B6CB 3DK3A 2X9EA 3FLZA 3DY7A 4FSQA 4KB8A 4UZHA 2WQNA 3VS0A 2A1AB 2ITNA 2GS2A 4WHZA 4XP0A 2CGXA 3GC0A 3FI2A 3W2SA 4EOKA 4Q9ZA 2W06A 2G2IA 3HMIA 3LFNA 4M66A 3OEZA 4O2ZA 4EUUA 3FY2A 1TQPA 3FWQA 5JQ5A 5EG3A 2O2UA 4HVDA 4AT4A 3C7QA 3R02A 3ZUTA 3KRLA 3C4ZA 2BR1A 2WFYA 2G01A 2WTWA 3WE8A 4CFVA 1O6LA 2OZAB 4XBUA 5CTPA 4E4XA 2OW3A 5KMLA 3VS3A 4EOPA 3COHA 2OH4A 3UVRA 3MB6A 5JQ8A 3NNWA 1XWSA 3ETAA 4I23A 3WF8A 1YVJA 4HZRA 4C57A 2LGCA 4G3DA 4WNKA 3TZ7A 1GZ8A 4I5PA 2R3NA 3AG9A 4J53A 1GZNA 3NW7A 4H3QA 2GQGA 4XG2A 4L9IA 3KK9A 5EI8A 4BRXA 3ZM4A 1M2QA 4P90A 4X2GA 4JDHA 3R8LA 4S34A 3L9PA 4D2SA 5LVMA 4GU6A 3RPRA 3IDCA 2HW7A 3MFUA 4TT7A 3CJFA 3PVGA 2OICA 3A60A 4BN1A 4NW5A 3VUGA 3R8UA 2J51A 4F7NA 4MQ1A 2G15A 4ZEGA 3ET7A 1URCA 4EL9A 3QTQA 3DA6A 4FV2A 3WYXA 4HVSA 4ANNA 3DDPA 3TCPA 3TG1A 4RFZA 3G0FA 5BYYA 4XRLA 3CS9A 3VBWA 3QC4A 4QTBA 3C0GA 4XV2A 4IZYA 4YJOA 1FMKA 2ITYA 5ANKA 4FT7A 4J97A 4J8MA 1PXNA 3PWYA 5TE0A 2ZB1A 3A7HA 4TYEA 3V8WA 4B9DA 3SKCA 1MRYA 2YEXA 2EXEA 3IW8A 2UW4A 2V7AA 4AF3A 3RHXA 1FQ1B 1W83A 1GZOA 1ZXEA 3CJGA 1FPUA 3QZGA 1Y57A 4FZAB 5CWZA 2PZPA 1CM8A 3Q3BA 5KMKA 3BE9A 3JUHA 3OC1A 4IANA 3WYYA 4AA0A 2WOUA 3QTIA 4OTQA 3MY1A 4I93A 4ZTNA 4CYJA 5AM6A 1JSTA 3HV5A 4I0SA 4PL3A 2VWZA 1UNHA 2OKRA 4RRVA 3QHRA 2UZUE 5FP6A 2PVLA 4OR5A 2WMVA 4OTRA 3PXKA 4RVKA 4Y72A 4AZEA 4OBQA 4U79A 3DFAA 5D41A 1GIHA 2X8IA 2RFSA 4V04A 4AUAA 3PP1A 3VQHA 5AP5A 2J0IA 4W4XA 2W5AA 3C4EA 4CZTA 4PUZA 4G5PA 4G5JA 3DS6A 4O6LA 4DG3E 3LLTA 3KRRA 3CY2A 3COMA 5HTIA 4TN6A 4IX4A 1UU9A 1OGUA 3PWDA 3RGFA 4C4GA 2PVJA 4LRMA 4Z55A 2KTYA 5C27A 1GY3A 3NYXA 3KMMA 4FUXA 4U45A 4D2TA 4KIPA 1MP8A 3G2FA 3QYZA 2OGVA 4WSYA 4Y5HA 4C0TA 2XYNA 2OIBA 2AYPA 4FOBA 4CQGA 3F2AA 3HMNA 4NUSA 1KOBA 2UZDA 5HE1A 4NM7A 5CVFA 4PMPA 3FKLA 3KA0A 4G17A 2JDTA 5D7AA 3W10A 3PXQA 5M57A 3TUBA 5GZ9A 1IEPA 2R3GA 2UW0A 5J79A 3CXWA 3LFAA 5CANA 4JBVA 3P08A 5E8ZA 3WARA 2W5HA 2R3JA 4MAOA 5ETAA 2QCSA 2XK3A 5FQDC 2B55A 3ULIA 3I5NA 4F1TA 5C9CA 2YJRA 4CTBA 4KINA 4L45A 3AC2A 3ZSIA 2XNPA 4UXQA 3MIAA 3KULA 3EQCA 4UYAA 4BWXA 3IK3A 2QONA 2JDSA 3G9LX 3PXFA 2BRNA 2IZTA 2XYUA 5EM7A 5CYIA 1NY3A 4FNZA 4NFMA 4JXFA 3GNIB 2I0YA 2J4ZA 4NW6A 2IVVA 2NP8A 2QOHA 3QQKA 2EB3A 4BDCA 5AUYA 2PMLX 1IASA 5DR9A 3S2PA 4UX9A 5GZAA 3BHUA 3OY3A 3MB7A 4FIIA 3COIA 3GC9A 2FSMX 2OU7A 4MXCA 1UU8A 4IHPA 3MVJA 3MY0A 2VX1A 4O1PA 4ACHA 4YZNA 2UW9A 5A46A 2WMAA 3DLSA 4GYGA 4XV1A 4F7JA 2CGVA 4JT3A 3DKCA 4G6OA 5K0KA 2BUJA 1KE9A 5FM3A 2PZYA 4GVAA 2GS6A 4RT7A 3SXSA 4ZTMA 3UMWA 2G2HA 3NAXA 2C0TA 3W55A 1WVWA 3MYGA 3MN3A 2XIZA 3P7CA 4NEUA 4FVRA 1YXVA 2YLEA 4X3JA 3VUKA 2CMWA 3CPCA 2CPKE 5CSVA 2HENA 5DLSA 5HE0A 4UN0C 3A61A 2VGOA 3NIZA 1ZLTA 5EHOA 4L67A 4BDJA 2JBOA 4YTFA 5M53A 1UU3A 4C7TA 4F0GA 5A6NA 2O5KA 3MH1A 2GNGA 3PY3A 4KNBA 5AEPA 4DEHA 4IX6A 1OZ1A 4RSSA 4FTIA 3RP9A 3LM5A 5K0XA 4OTGA 4PNKA 2WTIA 2WU6A 5AR3A 2AC5A 1Q8TA 3ROCA 4AACA 2QOCA 2ZV2A 3P9JA 3R01A 4MNFA 2C6DA 2HWPA 4DFNA 3ZEPA 2HOGA 4FV1A 3R9HA 4F0FA 2IZSA 4FK3A 3QTZA 1T46A 3D4QA 1F5QA 4PMSA 3VAPA 3CTHA 2YERA 2X6DA 1XJDA 4F9BA 3GI3A 1ATPE 3PPKA 3R7VA 2E9PA 1YW2A 3HMOA 3F69A 3ZXZA 3CPBA 4ACGA 4L42A 4GUBA 2XEYA 4ANOA 4QTEA 3PE1A 1W98A 3BWFA 3S1HA 4AOIA 5DNRA 2X8EA 4BZOA 2R3KA 4FZ7A 2BRMA 4FT0A 4ZTSA 3QD0A 2JDOA 3EL7A 1PYXA 3A7GA 3NUNA 4ZOGA 4X7QA 2QNJA 3DBEA 3BV2A 3CIKA 5AV1A 2XIYA 3GT8A 3HV6A 3QWJA 3R63A 4OBOA 4QMZA 2J9MA 4XV9A 2Z7QA 4UB7A 2PSQA 4CMOA 4F08A 2BALA 4LMNA 3ZONA 4IAFA 1NVRA 2V5QA 4FYNA 4AT3A 2Y7JA 1W7HA 5H8BA 3UC3A 2DS1A 3DU8A 4LUDA 4BBMA 5CF8A 2XBAA 3VBTA 5L2IA 5CF4A 4BL1A 3LCKA 4QTDA 3UOKA 1B39A 4X2JA 3PJ8A 2R0UA 4QT1A 5AR2A 4AGCA 5E7RA 2YCFA 3DQXA 5A3XA 3D9VA 4GSBA 1ZOEA 3OXIA 5HOAA 4U3YA 4EHGA 1Q8WA 4YSMA 5HTCA 2B9JA 3FPMA 4PX6A 1M2PA 2WQBA 4EH6A 3DCVA 5IH6A 4O2PA 3CQWA 4JJRA 5AUZA 4V05A 3PPJA 2PVRA 3F3ZA 3PRIA 4QMMA 4GUEA 1OI9A 1YI3A 3TKIA 2C0IA 3UIUA 4AFJA 5ANEA 5AA8A 1OL5A 1Q61A 4BTFA 4FKTA 2VD5A 3IW6A 3Q52A 3HKOA 2XMYA 4NTTA 5FG8A 3QX4A 4GK4A 1WMKA 2X2LA 4A06A 3SD0A 5A4TA 4J98A 4JL9A 4D5HA 4UWCA 3RCDA 5JEBA 3KRXA 4I5HA 3Q6WA 1SNXA 3QX2A 4JIAA 5E92A 4ZLOA 4YTIA 4WD5A 2B54A 5D1JA 3F3VA 3VRYA 5HGIA 5JGDA 1Q41A 2FYSA 5EW8A 4EH2A 2HZNA 2XJ0A 3UYSA 5L2TA 3TEIA 5D11A 4BZDA 4EK5A 2F49A 1K3AA 2FGIA 4AZVA 2RGPA 1ZYJA 4C34A 4GFGA 4KBCA 3U87A 4GG7A 2YM3A 3AC5A 3VWAA 2YM5A 3EFKA 3UVPA 3PIZA 3POZA 1W0XC 1Y6AA 4HNFA 3FY0A 4H1MA 5CS6A 4A9SA 4WRSA 4ZTQA 5EKNA 1J1CA 2WD1A 3ZBXA 4EONA 3QF9A 3DNEA 2ESMA 2O8YA 4LQMA 5CU3A 4GK2A 3VBVA 3GU7A 4BI0A 5HICA 3Q9WA 4AE6A 5JMSA 4FTQA 3RM7A 1VZOA 1XH8A 2WZJA 1TKIA 3NNXA 4IX3A 4BYJA 4LMUA 5ACBC 2J0MB 3DV3A 4L44A 4BDIA 4FZDB 4YTCA 2B4SB 4FVPA 3KK8A 3OY1A 4IADA 4V0GA 4AZTA 4E93A 3OD6X 4ASDA 2BRGA 2O0UA 4RPVA 4UBAA 2XZSA 2PVNA 5HORA 2XK4A 2C68A 3QTUA 4GRBA 3QCQA 3ZMMA 5EK7A 4EWHA 2H9VA 4F0IA 5HHWA 3D14A 2OBJA 3QHWA 1NVSA 2XM9A 3FHRA 3NCGA 4RFYA 3QRKA 3D2KA 3OP5A 3GU5A 2RFEA 2Q0NA 4FTKA 4NCTC 4O1OA 4QYEA 4FKQA 5CU0A 3SA0A 3DTCA 5ETFA 3OF0A 1OIQA 3BHHA 3TT0A 2XP2A 4RLKA 5AR4A 4YP8A 2W1HA 3F5PA 3RPYA 1DI8A 3MIYA 5DFPA 1HCKA 5AP3A 1Q8ZA 1PKGA 4S32A 2R2PA 1U59A 1KV2A 4FTNA 3TNHA 3FL5A 4I3ZA 4GIHA 2FB8A 2W1CA 3P78A 4YZCA 1OKVA 2BZIB 2UVXA 3E5AA 2XM8A 4G3EA 4DCEA 4O0TA 1EH4A 3LFFA 5IEXA 4UMPA 1V1KA 4Y85A 4RIYB 3RPVA 3E64A 3G0EA 3QD4A 2GPHA 3DBFA 2PUUA 4AW5A 4UZDA 4ZAUA 4C4HA 4ZLYA 3E3BX 4WRGA 5HG9A 3OBJA 4ZJIA 2OZOA 3VRZA 5E90A 3Q6UA 2OJ9A 2B7AA 2ZV7A 3RWPA 4DBNA 1R0PA 3H30A 3G6GA 2C6TA 4R1YA 1WBNA 2QR8A 3FI4A 3DJ6A 4U3ZA 2RIOA 4O0WA 4QMWA 4DC2A 5B2KA 4E20A 4FTJA 1UKHA 4QRCA 2BILB 2BFYA 1OPKA 2GSFA 3KN5A 3Q5IA 4LYNA 3W8QA 5L8JA 4MBLA 2WB8A 5EDPA 4DG0E 2ZM1A 3EQIA 4QMLA 4EEVA 3UQCA 3GFEA 4CFWA 5A4QA 2PTKA 5A6OA 2WNTA 3RTPA 3O17A 3TUCA 2J50A 3MVLA 5M44A 5KMJA 4QMSA 5L6PA 4QP3A 1Q24A 2XNBA 3SHEA 4I92A 3GENA 4WOVA 5G1XA 3W2OA 2BHHA 5F20A 3ZC5A 2V22A 3I1AA 3VW6A 4L01A 3FMEA 5EI6A 4BCJA 4U42A 3G90X 2EUFB 4I4FA 4C4JA 5C26A 1XHAA 4ENXA 4IAKA 3C4CA 3OUKA 4MBJA 3ZDUA 4EZ5A 3R22A 4IE9A 4DLIA 5BUIA 5GZ8A 4RBLA 5L6OA 4E5WA 1XBBA 1R0EA 3ZO4A 2IN6A 2C4GA 4PMMA 3A7FA 3GUBA 3L9MA 4D2VA 2X1NA 4EOLA 3MVHA 2OH0E 1PMUA 2GDOA 3QTWA 2F4JA 3QALE 3UVQA 3NZ0A 5CX9A 4Z7GA 3W2PA 3DAEA 5DMZA 4EQMA 1QPJA 2P55A 3QTXA 4TNBA 4R1VA 2XRUA 3R1YA 4TYGA 4RJ8A 4XP2A 4Y83A 5HG5A 3ORXA 3UIMA 5KMMA 4YHTA 1CKIA 2BDJA 4K77A 3IQ7A 3QKMA 3VS5A 3FDNA 4P7EA 2UW6A 1XBCA 2ITWA 3EN7A 4LL5A 4OLIA 3ZU7A 2CHLA 5D9HA 5DHJA 4K18A 2R3IA 3AMAA 3MTLA 4EBWA 3V3VA 2WPAA 2VZ6A 1OECA 4AGDA 3SVVA 3A99A 2OIQA 3M42A 4J71A 5HKMA 3RAHA 1LUFA 4Y5QA 1BLXA 4KRDA 2X2KA 3W33A 3UC4A 2RG6A 4IAZA 2A2AA 1JPAA 1F0QA 3QBNA 4M13A 3R9NA 4FSNA 4FZFB 4HYHA 4JS8A 3ZHPC 1W82A 4F9YA 5H8GA 1VYWA 2OXDA 5JRSA 3GCVA 4YNOA 5DT3A 3IPHA 5I9VA 3O50A 4BDDA 1REKA 5CVGA 2XJ2A 3FMNA 4U40A 4EQUA 4R7HA 3EWHA 4G9RA 3O7LD 3AMYA 2VTIA 3BEAA 4QQTA 4WG5A 3DXNA 2BTSA 4FA2A 5CVHA 2ACXA 3Q9XA 3U9NA 2KULA 2QKWB 4GH2A 4BKZA 2YCRA 5AX9A 2CN8A 4QYYA 5IZFA 4GYIA 4F63A 4D4RA 4NK9A 3MY5A 3CQUA 3TV6A 1VR2A 2WTVA 4KIQA 4HYIA 4IXPA 4U8ZA 3ZO1A 1ZMVA 1ZRZA 4LGDA 5ETCA 5EH0A 4KSQA 4RQKA 1QMZA 3BX5A 2UUEA 4R3RA 3UNZA 3E63A 4GIIA 4FKIA 1UWHA 4QMXA 4G9CA 4D4VA 4YU2A 4GW8A 4RIXA 3HDNA 4YJRA 1YOMA 5IA4A 3OCTA 1BX6A 4FKWA 5M55A 5L3AA 2XIRA 4MCVA 3MS9A 4GCJA 5AUUA 1YXTA 4BI1A 4WBOA 1U46A 1BL7A 2WMTA 3GQLA 2WTCA 4RJ7A 3QQJA 3BGQA 2UW8A 4RWLA 3PPZA 4EC9A 2QC6A 4BDAA 1H0WA 4LUEA 1VEBA 2JKOA 3QTSA 3SAYA 4BDGA 4MXZA 4YO4A 4J1RA 4IDTA 1TQMA 4C3PA 1PYEA 5L6WL 5C8MA 3OTVA 3HX4A 3O96A 3EB0A 5CEOA 4JQ8A 5DEYA 1ZYCA 3LFSA 2P3GX 3FXWA 4RC4A 2BHEA 2OFVA 5E8WA 4TWPA 5FDPA 1K2PA 3OEFX 1OKYA 3FLSA 3FXZA 4U81A 5LCJA 5AIKA 1XH6A 3HL7A 4GT5A 3HDMA 4HGTA 4D9TA 4HPTE 1P14A 1Q3DA 1STCE 1S9IA 1XQZA 4BBEA 1PJKA 4CQEA 4MD8E 4DGLC 3UO5A 4UWYA 2P4IA 1SYKA 1UVRA 4TPTA 2WMQA 5TKDA 2JFMA 4FG8A 3DNDA 5ANIA 3F3WA 4WA9A 3ROYA 3CKWA 5IU2A 4IZ5A 4ALWA 5CNNA 3EL8A 2C0OA 3V5TA 2ZM3A 3G33A 2UZOA 3QQGA 4C2VA 3I0OA 4M84A 4X3FC 4FUYA 4F6UA 1RQQA 4DEAA 3KY2A 4KD1A 3IDBA 3ZCLA 2G2FA 3ZZWA 3K3IA 3PJ2A 3OHTA 2F9GA 1XR1A 2C5NA 3RZBA 4CTCA 3BYUA 4LV8A 4ZK5A 3RCJA 4QMNA 5HG8A 1ERKA 4O27B 4YBKA 5KMNA 5KUPA 3KQ7A 4QP6A 4PMTA 3KXMA 3PLSA 2VX3A 3DFCB 5D7VA 3FZPA 1SVHA 1OIRA 4KIKA 5BYZA 5AM7A 5DPVA 5I3RA 1ZOHA 4RFMA 1JKTA 5CSXA 3EOCA 3I4BA 3E8CA 5BVWA 3E8NA 3VHEA 3U4WA 3MFRA 4R3PA 4DEIA 4DEBA 1M7QA 4YPDA 4FTLA 3CLYA 4FIFA 3H3CA 3R73A 4F6WA 5L8LA 2EXCX 4WNMA 1OIUA 3RKBA 3DJ7A 3LPBA 2CKEA 3GQIA 1YDTE 3N9XA 2C69A 3V5WA 2BRBA 3EH9A 3GU6A 4FYOA 3LXPA 4F7LA 2BRHA 5AV2A 3ALNA 4RJ4A 3PY1A 5CAQA 1P2AA 3RINA 4IWQA 1JKLA 5EM5A 5ICPA 3HV7A 2ERZE 4JAJA 3IG7A 1HCLA 3LJ2A 2ERKA 5I9ZA 1SM2A 3ZFXA 4CFFA 4JG8A 2HCKA 4C37A 2CCIA 3R2BA 3OOMA 3LIJA 3SRVB 4OTFA 1UKIA 4AZSA 4OTPA 3VW8A 3EQFA 2YM6A 4X2KA 3FMDA 4EJNA 3VF9A 3D15A 3ZUVA 3A8WA 5JRQA 2E9UA 3D7TB 2UZNA 1WBWA 4TRLA 3FKNA 2XKEA 4M97A 1Y6BA 5EOBA 3RM6A 3VJOA 3BRBA 2FVDA 4NTSA 4Y46A 5L2WA 4HOKA 4KKGA 4CFMA 1RW8A 2ITUA 4XMOA 4UYNA 1E1VA 1AGWA 2YN8A 3V8SA 4BYIA 2CJMA 4KBAA 3R8MA 3FHIA 2HY0A 4BCOA 2C3IB 3UJGA 4NM0A 5AR5A 1Y8GA 5KHXA 2HW6A 3F6XA 3U6HA 4D4SA 5FGKA 4QMOA 5HLWA 3TNPC 4YLKA 3IW4A 5HVYA 5HI2A 3RHKA 2FUMA 3R7OA 4RVLA 5EHYA 3VJNA 4BGGA 1PXKA 3K3JA 3O8PA 4FGBA 1XH5A 4YLJA 2F7EE 4ARKA 3GFWA 3IOKA 4HCVA 1AQ1A 4FTAA 3T9TA 4EBVA 4E73A 5EFQA 3M1SA 3EFLA 4FG9A 3HVCA 3H9FA 3MWUA 3BU3A 5GNKA 3FXXA 3EYHA 3ORLA 3Q4CA 3MPMA 5I5ZA 1OUYA 5E1EA 1J1BA 2IO6A 5FXSA 4IBMA 4RVTA 5HESA 4CNHA 3NUPA 4KKHA 4DFXE 3A62A 4E4LA 1PF8A 5FRIA 3IECA 3W2CA 3BGPA 4F65A 3AD6A 3BU6A 3AXWA 4N6ZA 1TQIA 2YIYA 5BMSA 4FIEA 2BVAA 3R9OA 3F3TA 2WTJA 2GHMA 5HE3A 3P23A 3EQHA 5DR2A 3VIDA 1JKSA 3C4WA 3RBWA 1XBAA 1FINA 4B7TA 1OB3A 4FTTA 5DGZA 3QZIA 4QP8A 3KCKA 3KXZA 4AQCA 4RIOA 4JAIA 2G9XA 4PPCA 4IEBA 2NRYA 5BMMA 2X39A 2PVKA 4MXOA 3UOHA 5AP7A 3AD4A 1H25A 4IFGA 3DKOA 1WBOA 1PXOA 3KU2A 1V0PA 4BB4A 1XH7A 1BUHA 5A4LA 4IMYA 2XNOA 4K1BA 4RWIA 3UP2A 4QQCA 3PA5A 5AADA 4JG7A 4EOMA 3UDBA 5FP5A 2EU9A 3RK9A 2YCQA 5CSHA 4BCHA 4RIWB 4W9XA 3LXKA 5CEQA 3KN6A 2R7BA 5CEPA 3VBYA 2CGWA 3FSFA 2OI4X 2Y4IB 2J0LA 2VTLA 2C6OA 4X2FA 5I3OA 3RNYA 5K4JA 4FIHA 3EN9A 2GHGA 4IX5A 3GVUA 3UMXA 1U54B 4FG7A 4DGGA 5A4CA 5JKGA 4EOOA 3NYOA 1ZY4A 5K3YA 2JGZA 2O65A 4EYMA 5HBJA 3E92A 4CT2A 2PMOX 2WMWA 1M17A 2QURA 4JBOA 2YHVA 3KCFA 4FIJA 3TIZA 2WTKB 5CSWA 3OXTA 2Q0BA 3OCSA 3CY3A 4FSMA 4IVCA 3HZTA 4USEA 1KWPA 3RK7A 3OFMA 4L6QA 3R7EA 4E3CA 5BVFA 5CU2A 3QQUA 5DOSA 3V5LA 3ZO3A 4D4YA 2ZM4A 3D5WA 5EDRA 4DFYA 3NLBA 1UV5A 5KKRC 4L43A 1DAWA 3KKVA 4RQVA 3PSDA 4FTOA 1SZMA 4XOZA 4XYFA 3QC9A 4FKJA 4MTAA 2W4JA 3DZQA 4BCQA 4EQCA 3UOJA 4CSVA 3MTFA 3LFBA 4BFMA 1Q3WA 4W9WA 2C6KA 4IDVA 3ZRLA 3ZC6A 4ZJVA 3BQRA 4MNEA 3MVMA 4RA5A 5GJGA 3KVWA 3FMKA 4J8NA 4OTHA 2W7XA 1WBSA 4RJ5A 1HOWA 4G3CA 4I1ZA 2WMRA 3PZEA 4DH5A 5K9IA 5CNOA 2VN9A 2J7TA 2Y6MA 4Y95A 3MFTA 1CDKA 3FSKA 3ZLYA 4D2PA 1DM2A 2UW7A 4AN9A 1JNKA 4DHFA 3UGCA 2ZAZA 2XNNA 4X3FA 4YC6A 4C62A 3KB7A 4FKVA 3GC7A 5IA3A 4M12A 3NNUA 5I4NA 2WXVA 2YISA 4FTMA 3FLWA 4YNEA 4FVQA 5IA2A 3V51A 4N0SA 2R0IA 4O0RA 4TWOA 4I4EA 4XBRA 3VS2A 4WKQA 3TZ8A 2QOBA 4HYUA 3R7IA 1SVGA 2W9ZB 3NIEA 1QPCA 4H3PA 5CAPA 4EHEA 2Y9QA 1H1SA 3F7ZA 5B2LA 2Z60A 1OL2A 4D9UA 5FD2A 4MF1A 2BAKA 2OFUA 3QA0A 3B2TA 3RNIA 3BYMA 3RI1A 4A4OA 3ZRKA 2XNMA 5HD7A 2FSLX 1KV1A 2UVYA 4I0RA 3ODZX 5CAUA 3SX9A 2JIUA 3R7YA 4E4NA 4GG5A 4EOSA 3KXXA 3DQWA 2C6IA 5DT4A 4RA4A 3POOA 1O6YA 4J7BA 4OT6A 2VTMA 2PZ5A 4O96A 4FICA 4M14A 4MHAA 3QTRA 4B0GA 3VULA 4WO5A 3VS4A 2QI8A 1OPLA 4LGHA 4ITJA 2PMNX 4L53A 4M69A 3GCQA 4ZXTA 2R3RA 4I6BA 4R6VA 4UEUA 2YM7A 5HTBA 5HE2A 4BCFA 5HO7A 4C3FA 3UPZA 2E2BA 1KSWA 1KE7A 2VTQA 2R4BA 2OJIA 2PHKA 4PY1A 3EYGA 3QUPA 3S3IA 1KE6A 3R2YA 4BCMA 1OKWA 2B1PA 4JOAA 2GTMA 4TYIA 4AX8A 3EQBA 4IJPA 3LM0A 3R8VA 4XHKB 2E9VA 5M4IA 1YWVA 3E8EA 4WUNA 5B0XA 3OVVA 2X81A 4XJ0A 2J5EA 5DE2A 2GNHA 4ITIA 2XK6A 2O63A 3TTIA 2Z8CA 4FOCA 4CFXA 5FM2A 5BNJA 5KNJA 4MXAA 3LOKA 5J9YA 3AQVA 3VC4A 3RK5A 5AMNA 3PJCA 2J5FA 2C3LA 1UU7A 3AGMA 3L8SA 3PXRA 5DVRA 5BPYA 4BI2A 5LCKA 5ANJA 3A2CA 3B8RA 4AG8A 4XS2A 4FV4A 3BHYA 4FL1A 1R39A 4ZY4A 2ONLC 3P7AA 3MSSA 3HECA 4JLCA 4JX7A 2JAMA 3VUHA 4ALVA 3DB6A 4RC3A 3CGFA 4BWKA 5CEKA 5HD4A 4HW7A 1CKPA 3ZUUA 4CMUA 3HRFA 2GNLA 2A0CX 4ZY5A 3IOPA 4X21A 3TKHA 3L8XA 3PJ3A 2C6LA 4HGSA 1P4OA 1ZWSA 3CKXA 3SXFA 3BYSA 3T8OA 3LXNA 3VUDA 3VS6A 4TZRA 1Q62A 1H24A 3BPRA 3G6HA 1M7NA 4ZLZA 3Q04A 2A27A 4OTWA 3T3UA 2V0DA 5EOLA 2PK9A 3V5JA 1WAKA 3HNGA 1VJYA 3GXLA 4QP2A 4BF2A 2VO0A 4ZZOA 3FYKX 3P1AA 4BWPA 4KAOA 4CFNA 2IW8A 5AUVA 5J9LA 4G16A 4R5YA 1BI7A 5AP6A 3W2RA 3DT1A 1DS5A 3RZFA 1A06A 3GEQA 3PTGA 4FKRA 3SLSA 3REPA 3KF4A 2OJFE 4W4WA 4C8BA 1J91A 5KZIA 3GOKA 3K2LA 4D1XA 4W8DA 2SRCA 2YABA 5EI2A 1RJBA 3FMHA 2DQ7X 1BKXA 3L9NA 5EYCA 2QOIA 3IW5A 3Q32A 3W16A 4XLIA 1RDQE 3AMBA 1JBPE 3BIZA 5E8UA 3H10A 1H1PA 2I1MA 2EVAA 2UZTA 4X2NA 4FNYA 4IQ6A 3R8PA 4D28A 5IH5A 5KO1A 4DINA 4FSTA 4MXYA 1MUOA 4G2FA 5EW9A 3D5UA 3DAJA 4C61A 3MW1A 2R3MA 3KULB 4IVDA 4DH8A 2DYLA 3JY9A 4OTDA 5HBHA 2CSNA 4GK3A 4AA5A 1AD5A 5CEIA 3SW7A 4HCUA 4PDPA 1YOJA 3D7ZA 3ORNA 4JG6A 4JR3A 4ENYA 5KBRA 1MQ4A 4FKPA 2GCDA 3GU4A 1QPEA 4XG3A 4TYHA 4G1WA 5IISA 2CCHA 3D2IA 1CMKE 2WOTA 3KRWA 4MVFA 3O8TA 5AAFA 3ZEWA 1I09A 4Y73A 1FVRA 4NZWB 5HCZA 4HVHA 2YM4A 3EN4A 2YIWA 3QA8A 5KCVA 5BUJA 1PMVA 1U4DA 1ZMWA 1CKJA 2OF2A 3CD3A 4CKJA 4LOQA 3RPOA 4WNOA 4PPBA 3QKKA 1XH9A 3DKFA 5DIAA 5D12A 2W1FA 3DPKA 4H58A 3P7BA 4OUCA 4QMYA 4BTMA 2HK5A 4MX9A 4QP4A 1JKKA 5FTOA 3JS2A 3EKKA 4BCNA 4QP1A 5CXHA 3WF6A 4P5ZA 4O0YA 2Y8OA 4WSQA 3ZS5A 2ITXA 3ELJA 4JI9A 2HWOA 3ZXTA 2CLQA 2RF9A 3Q4ZA 5LWNA 2VTSA 3GP0A 4CYIA 5DBXA 4CCBA 2FH9A 5CF6A 3AD5A 4DLJA 4XUFA 4ZSJA 3H9RA 5CY3A 2XEZA 5L8KA 3QLFA 5CI7A 3U8WA 3QRJA 5BVKA 3RMFA 4IC8A 2ZYBA 4MBIA 4BHZA 1UNGA 5AAEA 4IB0A 3VS7A 5E8TA 4CRLA 1H8FA 1M52A 3R28A 4IB5A 4C36A 4YUQA 4AWIA 2HELA 2J2IB 2NRUA 2QO7A 3AOXA 2BROA 4FR4A 4E7WA 5CAVA 3EJ1A 4KBKA 4L3PA 2BIYA 2VWUA 2VTJA 4ZP5A 4AGUA 3ENMA 4EH7A 5J5TA 2ITVA 4O0UA 5HZNA 2W5BA 4YJQA 2VRXA 2C5VA 2QKRA 3II5A 1H08A 5FDXA 2YLFA 4BDHA 4ZIMA 5G6VA 3KL8A 4BCGA 3O8UA 3VN9A 4B4LA 5JZNA 1TVOA 3JVRA 2QD9A 4RZWA 4BGHA 4CZYB 3KXNA 2UZLA 4E4MA 2XK9A 2IVSA 2REIA 5A14A 1YHVA 3O71A 5KMOA 5A54A 3PA4A 5CENA 4ERKA 3LCTA 2JBPA 4AFEA 2R3FA 3OOGA 1ZY5A 4QPSA 4IACA 5T68A 4CEGA 4FBXA 3HYHA 2E9OA 5AUXA 5BQ0A 4PL4A 2CGUA 4CVAA 3O0GA 2X9FA 2PL0A 1LP4A 2F2UA 3IGGA 2F7XE 3F82A 2WHBA 4K33A 5JFWA 2XKFA 4E1ZA 2ZB0A 2W0JA 1WBTA 1YWNA 3D0EA 3MPAA 5T6KA 2JKMA 3V6SA 3TV7A 1UA2A 1G3NA 3HP2A 4OGRA 2QLQA 4YURA 4XV3A 2I40A 3WILA 3QYWA 3RAWA 3HLLA 2F57A 3FMJA 3L8PA 1OUKA 5HCXA 4FKSA 5KZ0A 3GCUA 3EZVA 3QXOA 4FKUA 2CN5A 3OWLA 4JDIA 3GBZA 5CEMA 1PMNA 4OTIA 3V5QA 3C5UA 3SOCA 2OZAA 4XCUA 3EZRA 4BKJA 2QHMA 4RC2A 1JAMA 3OCGA 4N6YA 3UNJA 3WI6A 2UVZA 5ETIA 2OJJA 3NGAA 2OK1A 4I0TA 2CDZA 3FZ1A 1NXKA 2JIIA 4JVGA 2XUUA 4IVBA 3OZ6A 4IZAA 4QD6A 5EKOA 3UPXA 2HXLA 1ZOGA 3PVUA 3TACA 4QTCA 3TV4A 1Q8UA 3UO6A 4JNWA 4ZTRA 1P5EA 3NCZA 2RKUA 2UZBA 4CXAA 2PVFA 1WBVA 1Z9XA 3COKA 3MV5A 3E88A 3R0TA 5F1ZA 1OM1A 3I6WA 5L2QA 3FPQA 3K5UA 3I60A 3L1SA 1L3RE 3VUTA 3P5KA 4C4IA 3SDJA 5IEVA 2WO6A 2ONLA 4ZSEA 2W96B 4LV5A 1Z57A 2VTNA 4K0YA 3E7VA 1H07A 2C47A 4DYMA 2QHNA 4A9UA 4Z16A 4EKKA 5CZIA 4RWJA 4S30A 1E1XA 5HVJA 4AU8A 2QOQA 3S0OA 5LVNA 4UMUA 4BICA 4C02A 5CALA 3CD8A 3QUDA 4BIDA 3R30A 5CU6A 4TL0A 3EN5A 4YBJA 1H4LA 3FZOA 3OT3A 3TN8A 4DITA 3BZ3A 3OG7A 3QCYA 3EQGA 3R00A 4J95A 1PXPA 5CLPA 2R3QA 2YFXA 2C1BA 3ORKA 3MA6A 4AXAA 5JFVA 3OWJA 3TJCA 2XNEA 5H9BA 3O2MA 3MH0A 5HIEA 2XH5A 3KMWA 3Q96A 3CR0A 3GGFA 2C30A 4FIGA 1UWJA 1JSUA 3QU0A 5E8SA 5TOZA 4C59A 4I5CA 2BPMA 3MPTA 3C4FA 3PA3A 2QVSE 4KWPA 4QMPA 4V0GB 3UE4A 5KX8A 1FVTA 3HV4A 3LCOA 1ZAOA 4II5A 4C38A 4N4SA 4DEDA 2JEDA 3RAKA 3KC3A 4TYHB 3F3UA 4ITHA 2LAVA 5IPJA 3H4JA 4NH1A 3CCNA 3C4XA 3EKNA 3KF7A 2W1GA 4Q5EA 4DG2E 1I44A 4BTJA 3FMMA 2PWLA 1YDSE 1YWRA 2C5XA 3ZLWA 1PMEA 3HMPA 3ITZA 5BVDA 3A7JA 3HEGA 2GS7A 4XG6A 1APME 5F95A 2E9NA 2I0EA 4G6LA 5IG1A 2W1DA 5HU3A 1H1QA 3IONA 4TY1A 3S4QA 1PY5A 3RAIA 4ASZA 1T45A 5GJDA 2WELA 5LVPA 5B7VA 2XIXA 1U5RA 4ERWA 3EFWA 4QMVA 2UW3A 4PPAA 4IM0A 3I79A 3PG3A 4E26A 2GFSA 4D1ZA 3OTUA 5AUWA 4FX3A 4NCTA 4F9WA 3D5VA 3FZRA 3P79A 3QXPA 4RX9A 3ENHA 5BVNA 3ZBFA 2VGPA 3HRBA 2YZAA 4MD7E 1H1WA 3UZTA 2I6LA 3OXZA 4OAUC 2OJGA 2A19B 4GEOA 4EH8A 3AC1A 1YHWA 3W18A 4R5SA 2WMBA 4NT4A 3NUXA 4X0MA 5CASA 2XCKA 5AP2A 4QPMA 2OWBA 3A4PA 1PHKA 4H1JA 4CV8A 5C8NA 3ALOA 5M4UA 3IO7A 2EXMA 3R1SA 4O6EA 4GMYA 5JSMA 2XIKA 1H01A 2RSVA 3ZOSA 2X4FA 4LOPA 2BZHB 2OIDA 2WQOA 2W1EA 4P2KA 2IW6A 4L7FA 4RX7A 4U41A 5HNIX 3B2WA 1Z5MA 4O22A 2VAGA 3DBCA 2ETRA 2QQ7A 2QR7A 5J7HA 3E62A 3TI1A 4A9RA 2VTOA 4OAVB 2PY3A 2HZ4A 4IB1A 4ZZNA 1ZYLA 2J0KA 3V8TA 3W8LA 4EH5A 2XA4A 4R7IA 5CSPA 4PWNA 3QQFA 4JRNA 4ZSLA 4I5MA 4ASXA 1LPUA 5EYMA 4YJSA 2WMSA 3NEWA 4RZVA 4L3LA 4H36A 4ANLA 4D2RA 4AZWA 4CLJA 3TKUA 2PVYA 4ZS0A 5C01A 3H9OA 1O9UA 2X4ZA 3BLRA 3D5XA 4TWNA 5FBNC 4RLLA 4A07A 4GL9A 4QOXA 5LOHA 3C51A 4YO6A 4D0WA 2W9FB 3G51A 4U43A 3CQEA 4BTKA 2UZVA 3HRCA 1H27A 5AP4A 2BAQA 5AA9A 3NNVA 3P4KA 2CLXA 5AV0A 5EYDA 2WIHA 3ZRMA 3C50A 2WTDA 1H28A 5M4FA 5F94A 5BX0A 4EH3A 2ETMA 5HX8A 4ZJJA 4YSJA 2J0JA 5JGBA 4XRJA 2IVTA 1YI6A 3FQHA 1E9HA 3QKLA 3WIGA 2ZV8A 2B53A 3F9NA 4QYGA 3WZUA 4C4FA 4E8AA 4F9CA 2ITZA 4BDBA 4X6QC 5HO8A 3BV3A 2F7ZE 2OO8X 3UBDA 2VWYA 2PE1A 3VUIA 4YPSA 4MYGA 4I94A 4C3RA 1Q8YA 2ETKA 4ALUA 2AUHA 4A7CA 3R83A 4IWDA 4FEQA 4IZ7A 2R3HA 3VBQA 4M7IA 4XNEA 3QRUA 3FBVA 4PDSA 5DA3A 1R1WA 5HBEA 4B99A 4AW0A 5EDQA 2P0CA 4KSPA 3JPVA 3PRFA 2Y4PA 2B9HA 2PZIA 3E8DA 3NUYA 4L00A 2FA2A 3PJ1A 4RJ6A 3BGZA 3MJ2A 4CCUA 2PVHA 1KOAA 1OPJA 3PXZA 4E5BA 3DOGA 4GJ2A 4YZMA 4W8EA 5HNBA 2P2IA 3DJ5A 4GJ3A 3TNQB 1URWA 3PSBA 4JRVA 5AV3A 1XKKA 3FMLA 3R7GA 3FI3A 2A4LA 4LFIA 4LG4A 2EB2A 3B8QA 4R8QA 2XNGA 3BU5A 1Q99A 5B2MA 2GHLA 5D10A 2ZDUA 2OXXA 4ACMA 4USDA 3FC2A 4Q5HA 5CZHA 3DK7A 5A4EA 2YAAA 3MDYA 4MD9E 1OL6A 3L9LA 3QGYA 1GIJA 4UXLA 2XCHA 3TL8A 2W17A 2AC3A 4EOIA 3ORZA 3MH3A 4QYFA 5TO8A 2W4OA 4EHZA 5C8KA 4NWMA 3DK6A 2I0HA 1KE5A 3LVPA 3KRJA 2UW5A 2C5YA 1SMHA 3U9CA 1FMOE 2JLDA 3CE3A 4XOYA 5K4IA 4F7SA 3PVBA 3QL8A 3U4UA 1FGIA 2IVUA 5LXMA 4FV3A 4HCTA 4C33A 5J1VA 5FXQA 2HZ0A 3PFQA 1WVYA 5E91A 4AZFA 4Q2AA 3HGKA 4FKGA 5HLPA 4RIXB 2XF0A 3ZO2A 5H3QA 5C1QB 1O6KA 1BYGA 3PUPA 3QZFA 2ZDTA 4M67A 4O0XA 4GU9A 5BUEA 2JDRA 3E3PA 3PP0A 3NSZA 2OF4A 3TZMA 1GOLA 4F64A 3MI9A 5AWMA 3BLQA 3FQSA 3EMGA 4FL2A 4IB3A 4FTRA 4BC6A 2R64A 2UZEA 4F09A 2WEVA 3DBDA 1X8BA 2Y6OA 3NW6A 4M0YA 4FT3A 4PNIA 5CU4A 2PE2A 1G5SA 2YJSA 4F6SA 4EH9A 2XBJA 4FT9A 2W1ZA 2R3OA 3GU8A 2Y0AA 4BHNA 2VTPA 4JQ7A 4D2WA 4ID7A 3NYNA 5M56A 3OWPA 2YAKA 4BCKA 1R78A 3WE4A 4IWOA 4CZUA 3Q53A 1WFCA 2OSCA 4BDEA 4N70A 4EK8A 4H39A 4TYJA 2GNIA 4GV1A 3ORPA 4C58A 3TNWA 1ZMUA 2QODA 2YDKA 5HIDA 4O38A 1JOWB 4EK4A 1IG1A 4O21A 1F3MC 1Q4LA 4D1SA 3AT4A 5IF1A 5LVOA 2YA9A 4MH7A 1NA7A 3Q4TA 4W4YA 4C4EA 2PVMA 3OW4A 3BE2A 5IEYA 1JVPP 4TWCA 4EKLA 5AV4A 3QQLA 4RVMA 3RVGA 4RG0A 1ZZLA 5DEWA 4OT5A 3VQUA 3VO3A 1GAGA 3EQPA 4FV8A 3ZYAA 1QL6A 2QOFA 2XRWA 3PZHA 1YXSA 4ZTHA 4FK6A 3UIBA 4K9YA 4EC8A 2X0GA 4I6FA 1BI8A 5EHLA 4A9YA 5HLNA 5L2SA 3MGYA 3G5DA 4AOJA 2GTNA 3F5GA 3LFQA 2X7FA 4Q9SA 3ZH8A 3HA8A 5LMAA 3NPCA 3WBLA 2VWXA 1PXJA 4F70A 2XKDA 2B9FA 3FLNC 4NFNA 3QGWA 4IC7A 3GOPA 3BBWA 2H34A 4APPA 3SV0A 2F2CB 4ASEA 4DTKA 3U6JA 4KS8A 3QUEA 4KIKB 3S00A 4EK6A 3TNIA 1OL1A 3LJ1A 4YJNA 4R3CA 1IR3A 1ZARA 2WQMA 4QP9A 4NM5A 2JC6A 2J6MA 3TWJA 3W32A 4TTHB 1GZKA 2RFDA 4HNIA 3T3VA 4U97A 4I6HA 1PXLA 1SVEA 3IGOA 3EQRA 5FEDA 3R21A 4AGWA 4FSZA 4DGMA 1KE8A 3C0IA 3ORTA 2VTRA 4RIYA 4A4XA 5KBQA 3LFEA 4D55A 2W4KA 4ZSAA 5CF5A 4WUAA 4AAAA 3HA6A 4YR8A 5CXZA 2BDFA 4PV0A 4FI1A 3CTJA 5H2UA 3ANRA 3TJDA 2XVDA 2BCJA 2HZIA 3M2WA 4APCA 4G6NA 1U5QA 3F5UA 5JK3A 3EFJA 3OMVA 5LMKC 4DN5A 5J7BA 5CT0A 1GIIA 3BHTA 4HZSA 3H0YA 4M15A 4NKAA 5ANGA 5EYKA 1Q97A 2Z7SA 2VWVA 2JKKA 2ZVAA 5HEZA 4AA4A 4F1OA 3DAKA 2RFNA 3Q4UA 4S2ZA 3QD2B 3A7IA 4TKSA 2HY81 2B52A 4OW8A 2P33A 2JAVA 5LQFA 1V0OA 3AGLA 4P5QA 2VTAA 4FNWA 3NW5A 4C2WA 2QO2A 5DG5A 2BTRA 3ZDIA 3F7WA 4J96A 3G9NA 4LM5A 5L4QA 1RE8A 3CEKA 3NYVA 4KRCA 2ITQA 2VTHA 3QQHA 1REJA 5DT0A 4ANMA 4U7ZA 1MRVA 4UALA 5E8YA 4FF8A 5CQWA 5IDNA 5CT7A 1YRPA 3BYVA 4BDFA 4XG7A 3C13A 5FEQA 3VHKA 5I0BA 3PY0A 3ACKA 4U9AA 2VU3A 2YWPA 3MA3A 4KA3A 1LEWA 1QPDA 2X6EA 5HNGA 5AAGA 4J52A 4MKCA 4PP9A 4JDKA 4U0IA 3BWJA 3ZZEA 3O51A 4EOJA 5FWKK 4Y8DA 4E6QA 1PW2A 1LR4A 4IIRA 1DAYA 4EI4A 3UQFA 4FSWA 3AT2A 3MBLA 4G31A 2O64A 4CFUA 2VWBA 3F5XA 4P4CA 2Z7RA 4K6ZA 1OITA 2R3PA 2GNFA 4V01A 1MRUA 5FTQA 1QCFA 2W05A 1P4FA 3R1QA 4O91A 2PMIA 4HJOA 4JBPA 4YJTA 3ORIA 2BDWA 2BIKB 3Q5ZA 3BEGA 2H8HA 4HPUE 4BIEA 3WF5A 3C1XA 2GMXA 3I7BA 4E6DA 2ITPA 3U51A 5EM8A 3UODA 3OT8A 3ZSHA 5E1SA 3CC6A 4M3QA 4MK0A 5TR6A 4EZ7A 4QMTA 4JQEA 2VNYA 2YIQA 4F99A 1YXXA 4UWBA 3BLHA 1IA8A 3L8VA 3UNKA 3RJCA 3QRTA 4AW2A 5ANOA 3ZTXA 3OW3A 1ZZ2A 1DI9A 3AT3A 4XG4A 5K5NA 3DZOA 4EYJA 2DWBA 4B8MA 4IAAA 3DKGA 2C3JA 4RX5A 4ANBA 1OVEA 4NJDA 1OMWA 1WCCA 5JH6A 1YXUA 2VO6A 3GC8A 4ACDA 5M4CA 2BAJA 4LRJA 2YDJA 4B8LA 3JVSA 3NR9A 3PIXA 3I6UA 4FV9A 3SC1A 3V6RA 3R1NA 1JLUE 4FV5A 2X8DA 3PSCA 4Z7HA 4L52A 3FKOA 3CBLA 3WF9A 4NIFA 3FV8A 4M8TA 2OG8A 2C1AA 3VNTA 3PG1A 1WZYA 3NWWA 3GCSA 3HV3A 4EORA 5FXRA 3NUSA 4QTAA 4S31A 4XLVA 5EW3A 3T9IA 3KGAA 4QPAA 3VF8A 4CD0A 3V01A 2IZRA 4G3FA 4RX8A 3TIYA 4DFLA 2W99B 3C0HA 3UOLA 5HO6A 2X7GA 2WIPA 2XJ1A 3MJ1A 3R6XA 1BL6A 4HGEA 3FAAA 4B6LA 2XK7A 2WMXA 5BVEA 4YZ9A 2R3LA 2RG5A 3K54A 4L3JA 4A4LA 3R71A 4BBFA 3RALA 4TNDA 5HQ0A 4IAIA 4E6AA 4YZDA 3SQQA 4D58A 3U6IA 3A8XA 2VWWA 5AR7A 5ACKA 3FE3A 3IKAA 1FOTA 4C35A 5J5SA 4CKIA 5IMXA 4PF4A 4DEEA 1VYZA 3HUBA 2QOOA 3LE6A 3QCXA 5AR8A 3TTJA 3Q9ZA 3W2QA 3FJQE 5KMIA 3R9DA 2H96A 3OCBA 2Y4IC 4ZSGA 5H8EA 4L7SA 1OKZA 3UYTA 3F2NA 4M0ZA 3N51A 4MNEB 4IFCA 5DRBA 4XH6A 3FYJX 4QNAA 3WZEA 4FNXA 4JDJA 2FSTX 3LAUA 4BGQA 5TF9A 3ACJA 3NAYA 3ODYX 1BMKA 4WBBB 5HIBA 3V04A 3WF7A 2WTKC 4E6CA 4AE9A 4ACCA 2ITOA 4GVJA 4WG4A 3CGOA 3I81A 4IM2A 3CTQA 3ULZA 4FC0A 4GS6A 3PE2A 4X3FB 3R8ZA 3BI6A 4IAYA 5AP1A 2VX0A 1A9UA 4I21A 5IUIA 4EWQA 3DB8A 4PL5A 4Z9LA 3BQCA 5DH3A 1GNGA 2QG5A 3PIYA 2P2HA 4WNPA 5C03A 4YHJA 4BZNA 3D94A 3ZFMA 4WIHA 2I0VA 2IJMA 2QO9A 3QFVA 5IKWA 4RJ3A 3BCEA 5AP0A 3NUUA 4IW0A 3UP7A 4GT4A 4I20A 1ZYDA 2ITTA 4J99A 4JR7A 3LW0A 4IM3A 4PTEA 3F61A 2WEIA 5J9ZA 5IDPA 4YJUA 3VBXA 4TXCA 5BVOA 4JIKA 5JGAA 4QQJA 4FSRA 2B9IA 1CTPE 1W8CA 2X2MA 4K8AA 1PXIA 2YITA 3I0QA 3E93A 2DUVA 1H0VA 4FTCA 3IW7A 2Z7LA 2ZJWA 4O0SA 3IDPA 2GFCA 3LCSA 4K11A 2RL5A 3WOWA 2BZJA 3FLQA 3OBGA 3LQ8A 4XP3A 4LRKA 1H26A 3WZDA 5IA1A 2JD5A 3WZKA 2R9SA 4M69B 4CT1A 5IA0A 3QLGA 3D83A 3DDQA 5I9WA 2UZWE 4D5KA 5CI6A 3KMUA 4L68A 4FT5A 5HU9A 2JKQA 4UMRA 4QMQA 2R5TA 1WBPA 3F66A 2O3PA 4EZ3A 4Z3VA 3KXHA 3SW4A 3LFCA 3M11A 5IUHA 3P86A 1YQJA 1XH4A 2PZRA 1H00A 5J95A 5K5XA 2QU6A 4MF0A 3K5VA 4PQNA 4FMQA 1PKDA 2BZKB 3S95A 5JFXA 5LMKA 2XS0A 4LOOA 4UY9A 4WG3A 1CSNA 4MWIA 3OROA 4DH1A 4YGAA 2WKMA 2V7OA 2ZOQA 1FVVA 2H6DA 1PXMA 1WVXA 1OIYA 1YI4A 2WQEA 2HXQA 2YM8A 4YC8A 4ANQA 4F9AA 4AP7A 4ZTLA 4BCPA 4PP7A 5F9EA 5FLFA 2J90A 2C6MA 5CQUA 3GB2A 3PVWA 3FQEA 3TXOA 3UQGA 4HVGA 3FL4A 2GU8A 4I22A 4NKSA 5FEEA 3Q2MA 3AC4A 2JFLA 4PDOA 5JZJA 4ANSA 2HIWA 3LMGA 4IH8A 4QQ5A 4TW9A 5J87A 1JWHA 3CP9A 4KABA 4XG8A 3KVXA 4GT3A 4FV6A 2QU5A 4NJ3A 5HG7A 1M14A 3HP5A 3LQ5A 1JSVA 4YJVA 2IWIA 4U6RA 5ANDA 5T3QA 4AOTA 4DH3A 4LGGA 4M68A 4MEDA 3SRVA 2BFXA 5J1WA 4D0XA 2WU7A 4CMTA 3A4OX 5IMEA 3MFSA 2YIXA 5ITAA 3E87A 2HYYA 4UMQA 4MXXA 5F4NA 1ZYSA 3D7TA 4QO9A 3JXWA 4YC3A 4ZY6A 3QWKA 1B38A 2YDIA 2JDVA 2X7OA 3LJ0A 1YOLA 5J8IA 3V5PA 4EHVA 1UNLA 2C5OA 4CLIA 3OUNB 1M2RA 3DBQA 2QOKA 4S33A 4YLLA 2XK8A 2R7IA 4I41A 5HVKA 3WIKA 4HGLA 3BHVA 2HAKA 4YJPA 4FV7A 3ZFYA 3UG2A 4DGNA 2QOLA 3O7LB 4FTUA 2UV2A 4RGJA 3NX8A 4FL3A 3KEXA 2FO0A 2VV9A 2XKCA 4LI5A 4H3BA 3R04A 3FUPA 5EM6A 1NVQA 2WAJA 3E7OA 4XG9A 5FBOA 3MH2A 3RPSA 2NPQA 4IVAA 3AC8A 4WT6A 3ZSGA 2VO7A 2BKZA 3I7CA 2JITA 3UG1A 1H1RA 4AS0A 3ZLSA 5LJJA 5LWMA 4U5JA 5HCYA 3LXLA 5I9YA 1V0BA 5IH4A 5LVLA 2VTTA 3BYOA 3DTWA 4NIFB 4RMZA 4QYHA 3LFDA 3QCSA 2NO3A 3GCPA 4FKOA 4FODA 4X6RA 3C9WA 3I5ZA 4IJ9A 4LL0A 2G1TA 3LZBA 2V55A 4DGOA 3QRIA 4NU1A 4QMUA 5JT2A 4FSUA 3DGKA 2WMUA 5I9UA 4EUTA 4HVIA 5KHWA 3FZSA 1YDRE 2ZMDA 2VWIA 3LCDA 4GFMA 5I9XA 2VNWA 4DH7A 4YHFA 4XX9A 3R7UA 3Q9YA 4G34A 4FV0A 4QP7A 3JY0A 5DWRA 4QNYA 5IA5A 2WGJA 3VS1A 4A9TA 4F4PA 4CKRA 2V62A 3FZTA 4I24A 5LARA 3HUCA 2JIVA 3BELA 3KXGA 4PRJA 5M51A 5E8XA 4GFOA 1LEZA 2XB7A 3ANQA 3UZPA 4F1MA 2C6EA 3NRMA 1GJOA 3VVHA 2Z2WA 4XEYA 4OBPA 4IWPA 1YHSA 1IRKA 1SNUA 5AIRA 5TT7A 4AW1A 3O23A 1Y8YA 4MQ2A 2OXYA 3EQDA 2EWAA 3QZHA 5CAOA 4CRSA 4CV9A 2VUWA 1XO2B 4NM3A 4RWKA 3BBTB 5KKRB 1OL7A 3TZ9A 4KIOA 4JX3A 2YIRA 3THBA 3WZJA 4U80A 4BVUA 3KFAA 2ZMCA 4I6QA 4JBQA 4BKYA 4E5AX 1MQBA 4ONAA 1K9AA 3HMMA 5AUTA 4RIWA 5HX6A 4YTHA 5AX3A 3UTOA 1S9JA 3OS3A 1FGKA 5GHVA 3FC1X 3PYYA 4FSYA 1Y91A 2YCSA 2W1IA 4BIBA 5LMBA 3QD3A 4PTCA 1U54A 2YACA 5JN2A 4PTGA 2C3KA 4FKLA 3UO4A 4MWHA 3PXYA 4AN2A 2QLUA 3EHAA 4YZBA 4EH4A 2GNJA 3QAME 3JYAA 4L46A 2IZUA 4L8MA 4EK3A 3UIXA 4UMTA 4KS7A 5AJQA 5IUGA 4AT5A 4U44A 4W4VA 3P0MA 4BCIA 4NSTA 3ZLXA 1W84A 3EN6A 4G3GA 3IS5A 4YMJA 4DAWA 4USFA 3NDMA 4BDKA 2PE0A 4AN3A 1YKRA 5A9UA 4K2RA 5DRDA 5DN3A 5E8VA 3AC3A 4ZZMA 3DLZA 3TUDA 2VO3A 3NS9A 4HYSA 2FSOX 5GJFA 4EOQA 5JFSA 2IW9A 1J3HA 3FLYA 3F88A 3ORMA 4KKEA 2BMCA 4FZ6A
chains in the Genus database with same CATH superfamily
1R3CA 4O0VA 4UV0A 3VUMA 3Q60A 3RWQA 5DI1A 5DR6A 4DEGA 5KE0A 2ZV9A 3H0ZA 3EIDA 3ERKA 1Q5KA 3OWKA 1JQHA 3BKBA 1TZDA 3SXRA 4DFZE 3LHJA 3SOAA 3W1FA 1B6CB 3DK3A 2X9EA 3FLZA 3DY7A 4FSQA 4KB8A 4UZHA 2WQNA 3VS0A 2A1AB 2ITNA 2GS2A 4WHZA 4XP0A 2CGXA 4O4EA 3GC0A 3FI2A 3W2SA 4EOKA 4Q9ZA 2W06A 2G2IA 3HMIA 3LFNA 4M66A 3OEZA 4O2ZA 4EUUA 3FY2A 1TQPA 3FWQA 5JQ5A 5EG3A 2O2UA 4HVDA 4AT4A 3C7QA 3R02A 3ZUTA 3KRLA 3C4ZA 2BR1A 2WFYA 2G01A 2WTWA 3WE8A 4CFVA 1O6LA 2OZAB 4XBUA 5CTPA 4E4XA 2OW3A 5KMLA 3VS3A 4EOPA 3COHA 2OH4A 3UVRA 3MB6A 5JQ8A 3NNWA 1XWSA 3ETAA 4I23A 3WF8A 1YVJA 4HZRA 4C57A 2LGCA 4G3DA 4WNKA 3TZ7A 1GZ8A 4I5PA 2R3NA 3AG9A 4J53A 1GZNA 3NW7A 4H3QA 2GQGA 4XG2A 4L9IA 3KK9A 5EI8A 4BRXA 3ZM4A 1M2QA 4P90A 4X2GA 4JDHA 3R8LA 4S34A 3L9PA 4D2SA 5LVMA 4GU6A 3RPRA 3IDCA 2HW7A 3MFUA 4TT7A 3CJFA 3PVGA 2OICA 3A60A 4BN1A 4NW5A 3VUGA 3R8UA 2J51A 4F7NA 4MQ1A 2G15A 4ZEGA 3ET7A 1URCA 4EL9A 3QTQA 3DA6A 4FV2A 3WYXA 4HVSA 4ANNA 3DDPA 3TCPA 3TG1A 4RFZA 3G0FA 5BYYA 4XRLA 3CS9A 3VBWA 3QC4A 4QTBA 3C0GA 4XV2A 4IZYA 4YJOA 1FMKA 2ITYA 5ANKA 4FT7A 4J97A 4J8MA 1PXNA 3PWYA 5TE0A 2ZB1A 3A7HA 4TYEA 3V8WA 4B9DA 3SKCA 1MRYA 2YEXA 2EXEA 3IW8A 2UW4A 2V7AA 4AF3A 3RHXA 1FQ1B 1W83A 1GZOA 1ZXEA 3CJGA 1FPUA 3QZGA 1Y57A 4FZAB 5CWZA 2PZPA 1CM8A 3Q3BA 5KMKA 3BE9A 3JUHA 3OC1A 4IANA 3WYYA 4AA0A 2WOUA 3QTIA 4OTQA 3MY1A 4I93A 4ZTNA 4CYJA 5AM6A 1JSTA 3HV5A 4I0SA 4PL3A 2VWZA 1UNHA 2OKRA 4RRVA 3QHRA 2UZUE 5FP6A 2PVLA 4OR5A 2WMVA 4OTRA 3PXKA 4RVKA 4Y72A 4AZEA 4OBQA 4U79A 3DFAA 5D41A 1GIHA 2X8IA 2RFSA 4V04A 4AUAA 3PP1A 3VQHA 5AP5A 2J0IA 4W4XA 2W5AA 3C4EA 4CZTA 4PUZA 4G5PA 4G5JA 3DS6A 4O6LA 4DG3E 3LLTA 3KRRA 3CY2A 3COMA 5HTIA 4TN6A 4IX4A 1UU9A 1OGUA 3PWDA 3RGFA 4C4GA 2PVJA 4LRMA 4Z55A 2KTYA 5C27A 1GY3A 3NYXA 3KMMA 4FUXA 4U45A 4D2TA 4KIPA 1MP8A 3G2FA 3QYZA 2OGVA 4WSYA 4Y5HA 4C0TA 2XYNA 2OIBA 2AYPA 4FOBA 4CQGA 3F2AA 3HMNA 4NUSA 1KOBA 2UZDA 5HE1A 4NM7A 5CVFA 4PMPA 3FKLA 3KA0A 4G17A 2JDTA 5D7AA 3W10A 3PXQA 5M57A 3TUBA 5GZ9A 1IEPA 2R3GA 2UW0A 5J79A 3CXWA 3LFAA 5CANA 4JBVA 3P08A 5E8ZA 3WARA 2W5HA 2R3JA 4MAOA 5ETAA 2QCSA 2XK3A 5FQDC 2B55A 3ULIA 3I5NA 4F1TA 5C9CA 2YJRA 4CTBA 4KINA 4L45A 3AC2A 3ZSIA 2XNPA 4UXQA 3MIAA 3KULA 3EQCA 4UYAA 4BWXA 3IK3A 2QONA 2JDSA 3G9LX 3PXFA 2BRNA 2IZTA 2XYUA 5EM7A 5CYIA 1NY3A 4FNZA 4NFMA 4JXFA 3GNIB 2I0YA 2J4ZA 4NW6A 2IVVA 2NP8A 2QOHA 3QQKA 2EB3A 4BDCA 5AUYA 2PMLX 1IASA 5DR9A 3S2PA 4UX9A 5GZAA 3BHUA 3OY3A 3MB7A 4FIIA 3COIA 3GC9A 2FSMX 2OU7A 4MXCA 1UU8A 4IHPA 3MVJA 3MY0A 2VX1A 4O1PA 4ACHA 4YZNA 2UW9A 5A46A 2WMAA 3DLSA 4GYGA 4XV1A 4F7JA 2CGVA 4JT3A 3DKCA 4G6OA 5K0KA 2BUJA 1KE9A 5FM3A 2PZYA 4GVAA 2GS6A 4RT7A 3SXSA 4ZTMA 3UMWA 2G2HA 3NAXA 2C0TA 3W55A 1WVWA 3MYGA 3MN3A 2XIZA 3P7CA 4NEUA 4FVRA 1YXVA 2YLEA 4X3JA 3VUKA 2CMWA 3CPCA 2CPKE 5CSVA 2HENA 5DLSA 5HE0A 4UN0C 3A61A 2VGOA 3NIZA 1ZLTA 5EHOA 4L67A 4BDJA 2JBOA 4YTFA 5M53A 1UU3A 4C7TA 4F0GA 5A6NA 2O5KA 3MH1A 2GNGA 3PY3A 4KNBA 5AEPA 4DEHA 4IX6A 1OZ1A 4RSSA 4FTIA 3RP9A 3LM5A 5K0XA 4OTGA 4PNKA 2WTIA 2WU6A 5AR3A 2AC5A 1Q8TA 3ROCA 4AACA 2QOCA 2ZV2A 3P9JA 3R01A 4MNFA 2C6DA 2HWPA 4DFNA 3ZEPA 2HOGA 4FV1A 3R9HA 4F0FA 2IZSA 4FK3A 3QTZA 1T46A 3D4QA 1F5QA 4PMSA 3VAPA 3CTHA 2YERA 2X6DA 1XJDA 4F9BA 3GI3A 1ATPE 3PPKA 3R7VA 2E9PA 1YW2A 3HMOA 3F69A 3ZXZA 3CPBA 4ACGA 4L42A 4GUBA 2XEYA 4ANOA 4QTEA 3PE1A 1W98A 3BWFA 3S1HA 4AOIA 5DNRA 2X8EA 4BZOA 2R3KA 4FZ7A 2BRMA 4FT0A 4ZTSA 3QD0A 2JDOA 3EL7A 1PYXA 3A7GA 3NUNA 4ZOGA 4X7QA 2QNJA 3DBEA 3BV2A 3CIKA 5AV1A 2XIYA 3GT8A 3HV6A 3QWJA 3R63A 4OBOA 4QMZA 2J9MA 4XV9A 2Z7QA 4UB7A 2PSQA 4CMOA 4F08A 2BALA 4LMNA 3ZONA 4IAFA 1NVRA 2V5QA 4FYNA 4AT3A 2Y7JA 1W7HA 5H8BA 3UC3A 2DS1A 3DU8A 4LUDA 4BBMA 5CF8A 2XBAA 3VBTA 5L2IA 5CF4A 4BL1A 3LCKA 4QTDA 3UOKA 1B39A 4X2JA 3PJ8A 2R0UA 4QT1A 5AR2A 4AGCA 5E7RA 2YCFA 3DQXA 5A3XA 3D9VA 4GSBA 1ZOEA 3OXIA 5HOAA 4U3YA 4EHGA 1Q8WA 4YSMA 5HTCA 2B9JA 3FPMA 4PX6A 1M2PA 2WQBA 4EH6A 3DCVA 5IH6A 4O2PA 3CQWA 4JJRA 5AUZA 4V05A 3PPJA 2PVRA 3F3ZA 3PRIA 4QMMA 4GUEA 1OI9A 1YI3A 3TKIA 2C0IA 3UIUA 4AFJA 5ANEA 5AA8A 1OL5A 1Q61A 4BTFA 4FKTA 2VD5A 3IW6A 3Q52A 3HKOA 2XMYA 4NTTA 5FG8A 3QX4A 4GK4A 1WMKA 2X2LA 4A06A 3SD0A 5A4TA 4J98A 4JL9A 4D5HA 4UWCA 3RCDA 5JEBA 3KRXA 4I5HA 3Q6WA 1SNXA 3QX2A 4JIAA 5E92A 4ZLOA 4YTIA 4WD5A 2B54A 5D1JA 3F3VA 3VRYA 5HGIA 5JGDA 1Q41A 2FYSA 4O4CA 5EW8A 4EH2A 2HZNA 2XJ0A 3UYSA 5L2TA 3TEIA 5D11A 4BZDA 4EK5A 2F49A 1K3AA 1W2CA 2FGIA 4AZVA 2RGPA 1ZYJA 4C34A 4GFGA 4KBCA 3U87A 4GG7A 2YM3A 3AC5A 3VWAA 2YM5A 3EFKA 3UVPA 3PIZA 3POZA 1W0XC 1Y6AA 4HNFA 3FY0A 4H1MA 5CS6A 4A9SA 4WRSA 4ZTQA 5EKNA 1J1CA 2WD1A 3ZBXA 4EONA 3QF9A 3DNEA 2ESMA 2O8YA 4LQMA 5CU3A 4GK2A 3VBVA 3GU7A 4BI0A 5HICA 3Q9WA 4AE6A 5JMSA 4FTQA 3RM7A 1VZOA 1XH8A 2WZJA 1TKIA 3NNXA 4IX3A 4BYJA 4LMUA 5ACBC 2J0MB 3DV3A 4L44A 4BDIA 4FZDB 4YTCA 2B4SB 4FVPA 3KK8A 3OY1A 4IADA 4V0GA 4AZTA 4E93A 3OD6X 4ASDA 2BRGA 2O0UA 4RPVA 4UBAA 2XZSA 2PVNA 5HORA 2XK4A 2C68A 3QTUA 4GRBA 3QCQA 3ZMMA 5EK7A 4EWHA 2H9VA 4F0IA 5HHWA 3D14A 2OBJA 3QHWA 1NVSA 2XM9A 3FHRA 3NCGA 4RFYA 3QRKA 3D2KA 3OP5A 3GU5A 2RFEA 2Q0NA 4FTKA 4NCTC 4O1OA 4QYEA 4FKQA 5CU0A 3SA0A 3DTCA 5ETFA 3OF0A 1OIQA 3BHHA 3TT0A 2XP2A 4RLKA 5AR4A 4YP8A 2W1HA 3F5PA 3RPYA 1DI8A 3MIYA 5DFPA 1HCKA 5AP3A 1Q8ZA 1PKGA 4S32A 2R2PA 1U59A 1KV2A 4FTNA 3TNHA 3FL5A 4I3ZA 4GIHA 2FB8A 2W1CA 3P78A 4YZCA 1OKVA 2BZIB 2UVXA 3E5AA 2XM8A 4G3EA 4DCEA 4O0TA 1EH4A 3LFFA 5IEXA 4UMPA 1V1KA 4Y85A 4RIYB 3RPVA 3E64A 3G0EA 3QD4A 2GPHA 3DBFA 2PUUA 4AW5A 4UZDA 4ZAUA 4C4HA 2X0OA 4ZLYA 3E3BX 2X0PA 4WRGA 5HG9A 3OBJA 4ZJIA 2OZOA 3VRZA 5E90A 3Q6UA 2OJ9A 2B7AA 2ZV7A 3RWPA 4DBNA 1R0PA 3H30A 3G6GA 2C6TA 4R1YA 1WBNA 2QR8A 3FI4A 3DJ6A 4U3ZA 2RIOA 4O0WA 4QMWA 4DC2A 5B2KA 4E20A 4FTJA 1UKHA 4QRCA 2BILB 2BFYA 1OPKA 2GSFA 3KN5A 3Q5IA 4LYNA 3W8QA 5L8JA 4MBLA 2WB8A 5EDPA 4DG0E 2ZM1A 3EQIA 4QMLA 4EEVA 3UQCA 3GFEA 4CFWA 5A4QA 2PTKA 5A6OA 2WNTA 3RTPA 3O17A 3TUCA 2J50A 3MVLA 5M44A 5KMJA 4QMSA 5L6PA 4QP3A 1Q24A 2XNBA 3SHEA 4I92A 3GENA 4WOVA 5G1XA 3W2OA 2BHHA 5F20A 3ZC5A 2V22A 3I1AA 3VW6A 4L01A 3FMEA 5EI6A 4BCJA 4U42A 3G90X 2EUFB 4I4FA 4C4JA 5C26A 1XHAA 4ENXA 4IAKA 3C4CA 3OUKA 4MBJA 3ZDUA 4EZ5A 3R22A 4IE9A 4DLIA 5BUIA 5GZ8A 4RBLA 5L6OA 4E5WA 1XBBA 1R0EA 3ZO4A 2IN6A 2C4GA 4PMMA 3A7FA 3GUBA 3L9MA 4D2VA 2X1NA 4EOLA 3MVHA 2OH0E 1PMUA 2GDOA 3QTWA 2F4JA 3QALE 3UVQA 3NZ0A 5CX9A 4Z7GA 3W2PA 3DAEA 5DMZA 4EQMA 1QPJA 2P55A 3QTXA 4TNBA 4R1VA 2XRUA 3R1YA 4TYGA 4RJ8A 4XP2A 4Y83A 5HG5A 3ORXA 3UIMA 5KMMA 4YHTA 1CKIA 2BDJA 4K77A 3IQ7A 3QKMA 3VS5A 3FDNA 4P7EA 2UW6A 1XBCA 2ITWA 3EN7A 4LL5A 4OLIA 3ZU7A 2CHLA 5D9HA 5DHJA 4K18A 2R3IA 3AMAA 3MTLA 4EBWA 3V3VA 2WPAA 2VZ6A 1OECA 4AGDA 3SVVA 3A99A 2OIQA 3M42A 4J71A 5HKMA 3RAHA 1LUFA 4Y5QA 1BLXA 4KRDA 2X2KA 3W33A 3UC4A 2RG6A 4IAZA 2A2AA 1JPAA 1F0QA 3QBNA 4M13A 3R9NA 4FSNA 4FZFB 4HYHA 4JS8A 3ZHPC 1W82A 4F9YA 5H8GA 1VYWA 2OXDA 5JRSA 3GCVA 4YNOA 5DT3A 3IPHA 5I9VA 3O50A 4BDDA 1REKA 5CVGA 2XJ2A 3FMNA 4U40A 4EQUA 4R7HA 3EWHA 4G9RA 3O7LD 3AMYA 2VTIA 3BEAA 4QQTA 4WG5A 3DXNA 2BTSA 4FA2A 5CVHA 2ACXA 3Q9XA 3U9NA 2KULA 2QKWB 4GH2A 4BKZA 2YCRA 5AX9A 2CN8A 4QYYA 5IZFA 4GYIA 4F63A 4D4RA 4NK9A 3MY5A 3CQUA 3TV6A 1VR2A 2WTVA 4KIQA 4HYIA 4IXPA 4U8ZA 3ZO1A 1ZMVA 1ZRZA 2IF8A 4LGDA 5ETCA 5EH0A 4KSQA 4RQKA 1QMZA 3BX5A 2UUEA 4R3RA 3UNZA 3E63A 4GIIA 4FKIA 1UWHA 4QMXA 4G9CA 4D4VA 4YU2A 4GW8A 4RIXA 3HDNA 4YJRA 1YOMA 5IA4A 3OCTA 1BX6A 4FKWA 5M55A 5L3AA 2XIRA 4MCVA 3MS9A 4GCJA 5AUUA 1YXTA 4BI1A 4WBOA 1U46A 1BL7A 2WMTA 3GQLA 2WTCA 4RJ7A 3QQJA 3BGQA 2UW8A 4RWLA 3PPZA 4EC9A 2QC6A 4BDAA 1H0WA 4LUEA 1VEBA 2JKOA 3QTSA 3SAYA 4BDGA 4MXZA 4YO4A 4J1RA 4IDTA 1TQMA 4C3PA 1PYEA 5L6WL 5C8MA 3OTVA 3HX4A 3O96A 3EB0A 5CEOA 4JQ8A 5DEYA 1ZYCA 3LFSA 2P3GX 3FXWA 4RC4A 2BHEA 2OFVA 5E8WA 4TWPA 5FDPA 1K2PA 3OEFX 1OKYA 3FLSA 3FXZA 4U81A 5LCJA 5AIKA 1XH6A 3HL7A 4GT5A 3HDMA 4HGTA 4D9TA 4HPTE 1P14A 1Q3DA 1STCE 1S9IA 1XQZA 4BBEA 1PJKA 4CQEA 4MD8E 4DGLC 3UO5A 4UWYA 2P4IA 1SYKA 1UVRA 4TPTA 2WMQA 2A98A 5TKDA 2JFMA 4FG8A 3DNDA 5ANIA 3F3WA 4WA9A 3ROYA 3CKWA 5IU2A 4IZ5A 4ALWA 5CNNA 3EL8A 2C0OA 3V5TA 2ZM3A 3G33A 2UZOA 3QQGA 4C2VA 3I0OA 4M84A 4X3FC 4FUYA 4F6UA 1RQQA 4DEAA 3KY2A 4KD1A 3IDBA 3ZCLA 2G2FA 3ZZWA 3K3IA 3PJ2A 3OHTA 2F9GA 1XR1A 2C5NA 3RZBA 4CTCA 3BYUA 4LV8A 4ZK5A 3RCJA 4QMNA 5HG8A 1ERKA 4O27B 4YBKA 5KMNA 5KUPA 3KQ7A 4QP6A 4PMTA 3KXMA 3PLSA 2VX3A 3DFCB 5D7VA 3FZPA 1SVHA 1OIRA 4KIKA 5BYZA 5AM7A 5DPVA 5I3RA 1ZOHA 4RFMA 1JKTA 5CSXA 3EOCA 3I4BA 3E8CA 5BVWA 3E8NA 3VHEA 3U4WA 3MFRA 4R3PA 4DEIA 4DEBA 1M7QA 4YPDA 4FTLA 3CLYA 4FIFA 3H3CA 3R73A 4F6WA 5L8LA 2EXCX 4WNMA 1OIUA 3RKBA 3DJ7A 3LPBA 2CKEA 3GQIA 1YDTE 3N9XA 2C69A 3V5WA 2BRBA 3EH9A 3GU6A 4FYOA 3LXPA 4F7LA 2BRHA 5AV2A 3ALNA 4RJ4A 3PY1A 5CAQA 1P2AA 3RINA 4IWQA 1JKLA 5EM5A 5ICPA 3HV7A 2ERZE 4JAJA 3IG7A 1HCLA 3LJ2A 2ERKA 5I9ZA 1SM2A 3ZFXA 4CFFA 4JG8A 2HCKA 4C37A 2CCIA 3R2BA 3OOMA 3LIJA 3SRVB 4OTFA 1UKIA 4AZSA 4OTPA 3VW8A 3EQFA 2YM6A 4X2KA 3FMDA 4EJNA 3VF9A 3D15A 3ZUVA 3A8WA 5JRQA 2E9UA 3D7TB 2UZNA 1WBWA 4TRLA 3FKNA 2XKEA 4M97A 1Y6BA 5EOBA 3RM6A 3VJOA 3BRBA 2FVDA 4NTSA 4Y46A 5L2WA 4HOKA 4KKGA 4CFMA 1RW8A 2ITUA 4XMOA 4UYNA 1E1VA 1AGWA 2YN8A 3V8SA 4BYIA 2CJMA 4KBAA 3R8MA 3FHIA 2HY0A 4BCOA 2C3IB 3UJGA 4NM0A 5AR5A 1Y8GA 5KHXA 2HW6A 3F6XA 3U6HA 4D4SA 5FGKA 4QMOA 5HLWA 3TNPC 4YLKA 3IW4A 5HVYA 5HI2A 3RHKA 2FUMA 3R7OA 4RVLA 5EHYA 3VJNA 4BGGA 1PXKA 3K3JA 3O8PA 4FGBA 1XH5A 4YLJA 2F7EE 4ARKA 3GFWA 3IOKA 4HCVA 1AQ1A 4FTAA 3T9TA 4EBVA 4E73A 5EFQA 3M1SA 3EFLA 4FG9A 3HVCA 3H9FA 3MWUA 3BU3A 5GNKA 3FXXA 3EYHA 3ORLA 3Q4CA 3MPMA 5I5ZA 1OUYA 5E1EA 1J1BA 2IO6A 5FXSA 4IBMA 4RVTA 5HESA 4CNHA 3NUPA 4KKHA 4DFXE 3A62A 4E4LA 1PF8A 5FRIA 3IECA 3W2CA 3BGPA 4F65A 3AD6A 3BU6A 3AXWA 4N6ZA 1TQIA 2YIYA 5BMSA 4FIEA 2BVAA 3R9OA 3F3TA 2WTJA 2GHMA 5HE3A 3P23A 3EQHA 5DR2A 3VIDA 1JKSA 3C4WA 3RBWA 1XBAA 1FINA 4B7TA 1OB3A 4FTTA 5DGZA 3QZIA 4QP8A 3KCKA 3KXZA 4AQCA 4RIOA 4JAIA 2G9XA 4PPCA 4IEBA 2NRYA 5BMMA 2X39A 2PVKA 4MXOA 3UOHA 5AP7A 3AD4A 1H25A 4IFGA 3DKOA 1WBOA 1PXOA 3KU2A 1V0PA 4BB4A 1XH7A 1BUHA 5A4LA 4IMYA 2XNOA 4K1BA 4RWIA 3UP2A 4QQCA 3PA5A 5AADA 4JG7A 4EOMA 3UDBA 5FP5A 2EU9A 3RK9A 2YCQA 5CSHA 4BCHA 4RIWB 4W9XA 3LXKA 5CEQA 3KN6A 2R7BA 5CEPA 3VBYA 2CGWA 3FSFA 2OI4X 2Y4IB 2J0LA 2VTLA 2C6OA 4X2FA 5I3OA 3RNYA 5K4JA 4FIHA 3EN9A 2GHGA 4IX5A 3GVUA 3UMXA 1U54B 4FG7A 4DGGA 5A4CA 5JKGA 4EOOA 3NYOA 1ZY4A 5K3YA 2JGZA 2O65A 4EYMA 5HBJA 3E92A 4CT2A 2PMOX 2WMWA 1M17A 2QURA 4JBOA 2YHVA 3KCFA 4FIJA 3TIZA 2WTKB 5CSWA 3OXTA 2Q0BA 3OCSA 3CY3A 4FSMA 4IVCA 3HZTA 4USEA 1KWPA 3RK7A 3OFMA 4L6QA 3R7EA 4E3CA 5BVFA 5CU2A 3QQUA 5DOSA 3V5LA 3ZO3A 4D4YA 2ZM4A 3D5WA 5EDRA 4DFYA 3NLBA 1UV5A 5KKRC 4L43A 1DAWA 3KKVA 4RQVA 3PSDA 4FTOA 1SZMA 4XOZA 4XYFA 3QC9A 4FKJA 4MTAA 2W4JA 3DZQA 4BCQA 4EQCA 3UOJA 4CSVA 3MTFA 3LFBA 4BFMA 1Q3WA 4W9WA 2C6KA 4IDVA 3ZRLA 3ZC6A 4ZJVA 3BQRA 4MNEA 3MVMA 4RA5A 5GJGA 3KVWA 3FMKA 4J8NA 4OTHA 2W7XA 1WBSA 4RJ5A 1HOWA 4G3CA 4I1ZA 2WMRA 3PZEA 4DH5A 5K9IA 5CNOA 2VN9A 2J7TA 2Y6MA 4Y95A 3MFTA 1CDKA 3FSKA 3ZLYA 4D2PA 1DM2A 2UW7A 4AN9A 1JNKA 4DHFA 3UGCA 2ZAZA 2XNNA 4X3FA 4YC6A 4C62A 3KB7A 4FKVA 3GC7A 5IA3A 4M12A 3NNUA 5I4NA 2WXVA 2YISA 4FTMA 3FLWA 4YNEA 4FVQA 5IA2A 3V51A 4N0SA 2R0IA 4O0RA 4TWOA 4I4EA 4XBRA 3VS2A 4WKQA 3TZ8A 2QOBA 4HYUA 3R7IA 1SVGA 2W9ZB 3NIEA 1QPCA 4H3PA 5CAPA 4EHEA 2Y9QA 1H1SA 3F7ZA 5B2LA 2Z60A 1OL2A 4D9UA 5FD2A 4MF1A 2BAKA 2OFUA 3QA0A 3B2TA 3RNIA 3BYMA 3RI1A 4A4OA 3ZRKA 2XNMA 5HD7A 2FSLX 1KV1A 2UVYA 4I0RA 3ODZX 5CAUA 3SX9A 2JIUA 3R7YA 4E4NA 4GG5A 4EOSA 3KXXA 3DQWA 2C6IA 5DT4A 4RA4A 3POOA 1O6YA 4J7BA 4OT6A 2VTMA 2PZ5A 4O96A 4FICA 4M14A 4MHAA 3QTRA 4B0GA 3VULA 4WO5A 3VS4A 2QI8A 1OPLA 4LGHA 4ITJA 2PMNX 4L53A 4M69A 3GCQA 4ZXTA 2R3RA 4I6BA 4R6VA 4UEUA 2YM7A 5HTBA 5HE2A 4BCFA 5HO7A 4C3FA 3UPZA 2E2BA 1KSWA 1KE7A 2VTQA 2R4BA 2OJIA 2PHKA 4PY1A 3EYGA 3QUPA 3S3IA 1KE6A 3R2YA 4BCMA 1OKWA 2B1PA 4JOAA 2GTMA 4TYIA 4AX8A 3EQBA 4IJPA 3LM0A 3R8VA 4XHKB 2E9VA 5M4IA 1YWVA 3E8EA 4WUNA 5B0XA 3OVVA 2X81A 4XJ0A 2J5EA 5DE2A 2GNHA 4ITIA 2XK6A 2O63A 3TTIA 2Z8CA 4FOCA 4CFXA 5FM2A 5BNJA 5KNJA 4MXAA 3LOKA 5J9YA 3AQVA 3VC4A 3RK5A 5AMNA 3PJCA 2J5FA 2C3LA 1UU7A 3AGMA 3L8SA 3PXRA 5DVRA 5BPYA 4BI2A 5LCKA 5ANJA 3A2CA 3B8RA 4AG8A 4XS2A 4FV4A 3BHYA 4FL1A 1R39A 4ZY4A 2ONLC 3P7AA 3MSSA 3HECA 4JLCA 4JX7A 2JAMA 3VUHA 4ALVA 3DB6A 4RC3A 3CGFA 4BWKA 5CEKA 5HD4A 4HW7A 1CKPA 3ZUUA 4CMUA 3HRFA 2GNLA 2A0CX 4ZY5A 3IOPA 4X21A 3TKHA 3L8XA 3PJ3A 2C6LA 4HGSA 1P4OA 1ZWSA 3CKXA 3SXFA 3BYSA 3T8OA 3LXNA 3VUDA 3VS6A 4TZRA 1Q62A 1H24A 3BPRA 3G6HA 1M7NA 4ZLZA 3Q04A 2A27A 4OTWA 3T3UA 2V0DA 5EOLA 2PK9A 3V5JA 1WAKA 3HNGA 1VJYA 2AQXA 3GXLA 4QP2A 4BF2A 2VO0A 4ZZOA 3FYKX 3P1AA 4BWPA 4KAOA 4CFNA 2IW8A 5AUVA 5J9LA 4G16A 4R5YA 1BI7A 5AP6A 3W2RA 3DT1A 1DS5A 3RZFA 1A06A 3GEQA 3PTGA 4FKRA 3SLSA 3REPA 3KF4A 2OJFE 4W4WA 4C8BA 1J91A 5KZIA 3GOKA 3K2LA 4D1XA 4W8DA 2SRCA 2YABA 5EI2A 1RJBA 3FMHA 2DQ7X 1BKXA 3L9NA 5EYCA 2QOIA 3IW5A 3Q32A 3W16A 4XLIA 1RDQE 3AMBA 1JBPE 3BIZA 5E8UA 3H10A 1H1PA 2I1MA 2EVAA 2UZTA 4X2NA 4FNYA 4IQ6A 3R8PA 4D28A 5IH5A 5KO1A 4DINA 4FSTA 4MXYA 1MUOA 4G2FA 5EW9A 3D5UA 3DAJA 4C61A 3MW1A 2R3MA 3KULB 4IVDA 4DH8A 2DYLA 3JY9A 4OTDA 5HBHA 2CSNA 4GK3A 4AA5A 1AD5A 5CEIA 3SW7A 4HCUA 4PDPA 1YOJA 3D7ZA 3ORNA 4JG6A 4JR3A 4ENYA 5KBRA 1MQ4A 4FKPA 2GCDA 3GU4A 1QPEA 4XG3A 4TYHA 4G1WA 5IISA 2CCHA 3D2IA 1CMKE 2WOTA 3KRWA 4MVFA 3O8TA 5AAFA 3ZEWA 1I09A 4Y73A 1FVRA 4NZWB 5HCZA 4HVHA 2YM4A 3EN4A 2YIWA 3QA8A 5KCVA 5BUJA 1PMVA 1U4DA 1ZMWA 1CKJA 2OF2A 3CD3A 4CKJA 4LOQA 3RPOA 4WNOA 4PPBA 3QKKA 1XH9A 3DKFA 5DIAA 5D12A 2W1FA 3DPKA 4H58A 3P7BA 4OUCA 4QMYA 4BTMA 2HK5A 4MX9A 4QP4A 1JKKA 5FTOA 3JS2A 3EKKA 4BCNA 4QP1A 5CXHA 3WF6A 4P5ZA 4O0YA 2Y8OA 4WSQA 3ZS5A 2ITXA 3ELJA 4JI9A 2HWOA 3ZXTA 2CLQA 2RF9A 3Q4ZA 5LWNA 2VTSA 3GP0A 4CYIA 5DBXA 4CCBA 2FH9A 5CF6A 3AD5A 4DLJA 4XUFA 4ZSJA 3H9RA 5CY3A 2XEZA 5L8KA 3QLFA 5CI7A 3U8WA 3QRJA 5BVKA 3RMFA 4IC8A 2ZYBA 4MBIA 4BHZA 1UNGA 5AAEA 4IB0A 3VS7A 5E8TA 4CRLA 1H8FA 1M52A 3R28A 4IB5A 4C36A 4YUQA 4AWIA 2HELA 2J2IB 2NRUA 2QO7A 3AOXA 2BROA 4FR4A 4E7WA 5CAVA 3EJ1A 4KBKA 4L3PA 2BIYA 2VWUA 2VTJA 4ZP5A 4AGUA 3ENMA 4EH7A 5J5TA 2ITVA 4O0UA 5HZNA 2W5BA 4YJQA 2VRXA 2C5VA 2QKRA 3II5A 1H08A 5FDXA 2YLFA 4BDHA 4ZIMA 5G6VA 3KL8A 4BCGA 3O8UA 3VN9A 4B4LA 5JZNA 1TVOA 3JVRA 2QD9A 4RZWA 4BGHA 4CZYB 3KXNA 2UZLA 4E4MA 2XK9A 2IVSA 2REIA 5A14A 1YHVA 3O71A 5KMOA 5A54A 3PA4A 5CENA 4ERKA 3LCTA 2JBPA 4AFEA 2R3FA 3OOGA 1ZY5A 4QPSA 4IACA 5T68A 4CEGA 4FBXA 3HYHA 2E9OA 5AUXA 5BQ0A 4PL4A 2CGUA 4CVAA 3O0GA 2X9FA 2PL0A 1LP4A 2F2UA 3IGGA 2F7XE 3F82A 2WHBA 4K33A 5JFWA 2XKFA 4E1ZA 2ZB0A 2W0JA 1WBTA 1YWNA 3D0EA 3MPAA 5T6KA 2JKMA 3V6SA 3TV7A 1UA2A 1G3NA 3HP2A 4OGRA 2QLQA 4YURA 4XV3A 2I40A 3WILA 3QYWA 3RAWA 3HLLA 2F57A 3FMJA 3L8PA 1OUKA 5HCXA 4FKSA 5KZ0A 3GCUA 3EZVA 3QXOA 4FKUA 2CN5A 3OWLA 4JDIA 3GBZA 4O4DA 5CEMA 1PMNA 4OTIA 3V5QA 3C5UA 3SOCA 2OZAA 4XCUA 3EZRA<