5I3OA

Crystal structure of bmp-2-inducible kinase in complex with an indazole inhibitor
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
302
structure length
302
Chain Sequence
b'RVFAVGRHQVTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAAADCPVSNINNSSIPSALPEPMTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BMP-2-inducible protein kinase
publication title Crystal Structure of BMP-2-inducible kinase in complex with an Indazole inhibitor
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5i3oA00
1KE5A 3H3CA 3AC5A 4WG4A 4QYFA 4BCIA 3VF8A 4IEBA 1PJKA 5E90A 5EW8A 3B8QA 4DBNA 3BHYA 4X0MA 2VNYA 4IDTA 4H36A 4NSTA 4JQ7A 5EOLA 4YSJA 3BIZA 3GGFA 5T3QA 4D55A 4F6UA 1VZOA 4WG5A 1JWHA 1LPUA 5A6NA 1UWHA 3H9RA 3V8TA 4BC6A 1YWVA 4AOTA 3FMKA 3OCSA 3DJ7A 5DT0A 2EVAA 3HRCA 3VVHA 4FKUA 1Y57A 2IVTA 4IAFA 3OOMA 3BBWA 4K6ZA 4L3JA 4WOVA 5EHOA 5GZ9A 3G33A 3EN9A 1H08A 3P08A 4GV1A 3VBTA 3D7TB 3EQIA 5F94A 1OPKA 3NNVA 3PY0A 4S30A 5FDPA 1LP4A 3NPCA 2VX1A 3RVGA 1WBVA 3ELJA 3PPZA 1JSTA 4WNOA 4X2JA 2HY0A 3MVJA 1DAYA 1YXXA 2XRWA 4FZDB 2NPQA 4EBVA 4MD7E 4KA3A 2VTTA 2HW7A 2B53A 2YAAA 3QA8A 1AGWA 2QO9A 3OWJA 3HDMA 3ORPA 4ACGA 5GJGA 4RZWA 3FKNA 1PKDA 3P7AA 2OSCA 4AA4A 1OM1A 1OKYA 2JAMA 2OF2A 3PY1A 4B9DA 4BWPA 3MW1A 4HVHA 5AA9A 3UQCA 3TL8A 3VUDA 3R00A 3W16A 3DK7A 4ZY6A 3CTQA 4L44A 3KXMA 4NKAA 5FG8A 4D2TA 5L3AA 3WILA 4EQCA 2HK5A 3OCGA 4ZK5A 4LV5A 3UQFA 4RC4A 5GJDA 4PP9A 2F7EE 3R2BA 4AE6A 1GIIA 4OAUC 1U59A 5JQ5A 2BRBA 2H6DA 2R0IA 3FLYA 4IDVA 4RX9A 1H01A 4AA0A 4AZVA 4YSMA 1BI8A 2J0LA 5J8IA 4AGDA 1GAGA 3JVRA 4M67A 3R7GA 4KABA 4WNKA 4XCUA 3Q53A 5J79A 1WZYA 4J97A 1ZRZA 4MNEB 4HCTA 4D2SA 2OJIA 3QFVA 1TQMA 4MAOA 3ULIA 3U9NA 2XUUA 1VEBA 1HCKA 2VRXA 3V5PA 4DG0E 2V55A 3KULB 3QX4A 3SVVA 1TKIA 5CI7A 4FTUA 4RIOA 5BVWA 3UIBA 3ZEPA 4BDKA 3MFUA 3ET7A 3MWUA 1R0PA 4LMNA 2C5NA 3UE4A 2PTKA 2J9MA 3FBVA 3NCGA 3BZ3A 1QL6A 3GU6A 4PY1A 2UW5A 1P2AA 2W4KA 2WTCA 3FHRA 3PWYA 4LRMA 4TN6A 4GFGA 3LM5A 5HBHA 3SXRA 4RA4A 3UBDA 3BHHA 4QTCA 2JKKA 3T9IA 1FVVA 1U54A 3FL4A 3LCSA 1ATPE 3I6WA 5LWNA 2YIWA 2OZAA 5CI6A 4PRJA 4XV2A 2H9VA 2C69A 4EH5A 2E9NA 4HYSA 4O27B 5EFQA 3HUBA 2UZTA 3SW7A 5AIRA 5CEQA 4FV7A 2WHBA 2GS6A 4ID7A 4DC2A 3C50A 3EL8A 4EOJA 3M11A 5I0BA 5LWMA 4FT0A 3OBJA 3QTZA 1BLXA 4QMNA 5HBEA 2VTOA 3V51A 2QOHA 2CDZA 1FOTA 4YBJA 4O1OA 3LW0A 5AV4A 4KWPA 4FG8A 5GJFA 2WKMA 1LEWA 4FSYA 3QRIA 3C9WA 2HZIA 4JNWA 1FPUA 3ZRKA 3VS3A 3O51A 2GHMA 4D1XA 3ZZWA 1ZMWA 2XIRA 4JIKA 4QMWA 4XMOA 3Q52A 2QONA 1E9HA 3ORIA 1PHKA 4FTTA 5D11A 4HNIA 5EOBA 2BIKB 2XYUA 3Q3BA 4BIDA 1GZNA 4CRLA 2LAVA 2BDJA 2BFXA 5E8SA 2BAJA 1VYWA 2XB7A 5CAUA 5DR9A 4BDIA 5CVFA 3DBQA 2OIDA 5EW9A 3VRZA 1F3MC 3HECA 4GK2A 2J51A 4KAOA 4QRCA 4WUNA 2UZOA 5CX9A 4DEAA 2RIOA 5CEOA 2X9FA 4U0IA 4FSQA 4BTKA 3HV4A 3C0IA 3Q2MA 3ENMA 4Q2AA 2UW8A 2JEDA 4UXQA 4BF2A 1ZY5A 5HD7A 4GUBA 2QHMA 3W2PA 1UU8A 2PZPA 2QR8A 5CEMA 4QP3A 1Q4LA 4I23A 5L2QA 4LV8A 4AS0A 4G2FA 4QQTA 4FNWA 4M14A 4DFLA 4E6CA 2XJ2A 3CJFA 5CENA 4X3JA 4K11A 3D15A 4NCTA 2C47A 1YQJA 2P2IA 5FXSA 3LFCA 3BKBA 4LGDA 4WT6A 3MGYA 3Q4CA 3QF9A 3GCUA 4XG8A 5AP6A 5AR2A 2B55A 2YCRA 4MXXA 5EI8A 5AUWA 3QQJA 2UZUE 2XBAA 5IKWA 2VAGA 4CT1A 5IA0A 4IANA 4QMLA 1WMKA 3GU7A 4JX7A 1YI6A 2GNFA 3DNDA 1P14A 3HP5A 5BYZA 5TOZA 4MXAA 4YZNA 5AV2A 4JIAA 3K3JA 4GCJA 1YKRA 3LFFA 4HPTE 4FTRA 4FV6A 5HG8A 4RQVA 5JT2A 3QD3A 2UVZA 4AGCA 3KCKA 3TNHA 2YA9A 1GOLA 3U9CA 5CEPA 4DFZE 5IH4A 2XKFA 3RINA 2P33A 3II5A 4PPBA 3R7YA 4Y8DA 3A2CA 3MJ1A 5HE1A 4BTFA 5AUUA 3E93A 4N70A 1CM8A 2C3KA 3KGAA 5DR2A 4DEBA 3F5PA 3EN4A 5HHWA 3RAIA 2IZUA 4W9XA 3P9JA 4K77A 5TKDA 2I0HA 3MA6A 2W5BA 1YOMA 3OCBA 3EN6A 2R3GA 4M8TA 2QG5A 2PSQA 4TYGA 4J8MA 4KIKA 3EQGA 4RQKA 4EC9A 3W2SA 4XV3A 2CGWA 5FP6A 3ZO2A 4X2FA 4CSVA 3TJCA 1F5QA 1TVOA 2XRUA 4KRCA 5CVHA 3AMAA 3EFJA 4AW5A 3R22A 4U3ZA 4G16A 3ZRLA 3DTCA 3TN8A 2YLFA 2B9FA 4IW0A 3UP2A 4NKSA 3GCQA 4YLKA 2CJMA 2X8EA 4EOPA 4YHFA 3G9LX 2Y4IC 3C7QA 4FNXA 2W1FA 4F99A 2QURA 5CAVA 3R30A 3HA8A 2QKRA 4IWOA 3TG1A 2ETKA 4I0SA 4MVFA 2B9HA 3UNJA 5IZFA 2GS2A 4H3BA 3VN9A 2QVSE 4N4SA 2PE1A 2GNGA 2IO6A 2Y6OA 5EDQA 4C4JA 4IQ6A 3EQFA 1GIJA 4R3RA 5HD4A 1LUFA 3G5DA 3IDPA 4FKVA 4AQCA 3Q04A 3VS1A 5FTQA 5C01A 3W33A 5CU0A 4NTTA 5G1XA 3OEZA 2OXYA 3QD2B 4R3CA 4BBMA 3ODZX 3ZC6A 5K5NA 4G1WA 2ZV8A 1R1WA 3TKHA 5IA4A 2PUUA 5M4IA 4AGWA 5E91A 4C33A 2RFNA 3TV4A 4B6LA 4HGLA 4QMTA 3PSCA 2YJRA 3EH9A 2GMXA 2B52A 3QTUA 4XHKB 3DAKA 4NM5A 3VS4A 4CMUA 3V5TA 3JVSA 1W8CA 4G3EA 5B0XA 4E5AX 3EIDA 3ZFXA 2EXCX 1RW8A 3KN6A 4S33A 3W2RA 3DJ5A 4TYJA 4FEQA 1JAMA 4L3PA 2FVDA 2YM5A 3C5UA 4NM7A 1XH9A 4CNHA 3EHAA 3KXZA 4GU9A 2HIWA 4DH3A 2X8DA 4ZSLA 5A9UA 2F7ZE 3VW6A 3H0YA 3TIZA 3GU4A 3OXZA 3VHEA 5L8KA 2E9OA 3EQBA 3NNXA 1H8FA 5KNJA 3ZLYA 3WF9A 2HZ4A 4YPSA 5KZ0A 4ASZA 3NUUA 5J5TA 5HG7A 5J9YA 4I4EA 4IACA 4TWOA 2J7TA 3AD5A 4XBUA 4E4MA 3S0OA 5D1JA 4E26A 5E7RA 1KV2A 1Q97A 4RX5A 3F5UA 4EKLA 2UZLA 3GNIB 5I5ZA 4I1ZA 3CEKA 4HYHA 5E8XA 3KRRA 5JFWA 3R7OA 2AYPA 3QZFA 3BWFA 4DEHA 4Z7GA 4ZOGA 4A06A 3NIEA 2REIA 2BRGA 3EKKA 4MHAA 4R5YA 3A7IA 4WRSA 5DIAA 4IIRA 1B6CB 3S1HA 2OW3A 3JYAA 4BDAA 3QQFA 4XV9A 2HENA 2IVSA 4DAWA 2XIXA 3E7OA 2BRHA 4XLVA 4DCEA 4YURA 2WTIA 2QHNA 4M66A 3FY2A 4YZCA 1XH8A 1OL6A 4O0VA 4CZTA 3BYVA 4I5PA 4Y46A 2PE0A 4RX8A 4ZJJA 4GSBA 4FV9A 1IRKA 4FZ7A 4LUDA 3ORMA 4MF0A 2R4BA 4ACHA 4FKOA 4GH2A 1JLUE 5DT4A 1W7HA 5CU2A 1GZKA 4YC6A 3R1YA 2QOIA 1GIHA 5TT7A 2W1EA 5CT0A 4D58A 1W98A 1H1QA 2QODA 3DS6A 4RWJA 2Y7JA 4IB1A 3RGFA 4XS2A 1OL1A 2C6EA 4FTKA 5HCZA 3OT8A 3PSBA 3QUPA 5FD2A 1ZOHA 1E1VA 4ZJVA 2JDVA 2QO2A 4F0GA 4F9WA 2GDOA 5IU2A 4JAIA 4CEGA 3O50A 1O6YA 4CQGA 2IN6A 3GQLA 2XK3A 3H4JA 2ETMA 3FDNA 5JGDA 4BTMA 3SHEA 5J95A 4F9CA 3I7BA 1BX6A 2ITYA 2JIUA 5ANIA 5E8VA 5C9CA 4AN3A 4W4VA 4OAVB 3EZRA 4GT3A 3FE3A 4JG8A 1YHSA 4N6YA 3RMFA 4BBEA 4FVQA 3F2NA 1CSNA 4PTCA 4JDJA 3ZCLA 1BL6A 4DFXE 5ETAA 1FVRA 3UIXA 1SMHA 2EB3A 3LFBA 3NUSA 4ZTHA 5HNGA 2VWVA 3QXPA 1JQHA 4RIYB 4U43A 1X8BA 3RPVA 3PPJA 4EK6A 1XQZA 3UYSA 5JKGA 4IZAA 4IJ9A 4R1YA 3FXZA 4BBFA 4QT1A 2YACA 4FKRA 3COIA 1QCFA 4RBLA 4LRKA 4M97A 4YHTA 4C34A 3TZ8A 5M55A 1AQ1A 1G3NA 5EM5A 4BGHA 3PVUA 4BHNA 3ZBFA 4EH3A 2QOBA 3IOKA 2WZJA 5ETCA 5HIBA 4EHEA 1ZOGA 3UOHA 4F7NA 3ZTXA 3ZO4A 4CFVA 4K33A 4FVPA 2YCFA 2ZVAA 2BZIB 4RWIA 5CS6A 4BIBA 4EK8A 3GC8A 4WBBB 2J5EA 3PXRA 1JSVA 4F1TA 2W5HA 4FTAA 2KULA 3VIDA 2OZAB 4EOMA 5A4CA 4HZRA 4HCVA 5E8UA 3D0EA 2ERZE 4ERKA 2J0MB 3PVBA 5H3QA 3RM6A 3O8PA 2VTJA 4F9BA 3O96A 5AP3A 4X6RA 4O96A 4CV8A 2E2BA 5KMMA 5AR8A 4OBOA 3C4EA 3D7ZA 3H10A 2X9EA 4TTHB 3U8WA 2Y9QA 3LVPA 5CU6A 4F7SA 3PG1A 2XNEA 4OTDA 4RWKA 4GT5A 1IR3A 5AUVA 4MBIA 1FGKA 2RG6A 4IZ5A 2OI4X 3D2KA 5I9YA 2JBOA 5M53A 4G5JA 1J3HA 2B7AA 2BZKB 1SVEA 2W96B 3HKOA 4V0GB 4DHFA 2UZWE 3MFTA 3U87A 4L43A 2WQMA 4O0XA 5I3RA 2PK9A 1Z9XA 3BHUA 5IISA 2WD1A 2ZJWA 4KBKA 4QP6A 3TEIA 4BL1A 3BYMA 4E4LA 4NW5A 5JZJA 1OZ1A 1PF8A 2BKZA 3RCDA 3ZM4A 5DH3A 2PMOX 4ZTSA 2R3KA 5HNBA 2WMBA 3PE1A 3VS6A 1XBBA 3O2MA 3ODYX 2W06A 5HE3A 1ZYCA 4GU6A 1UA2A 1NY3A 5AV3A 5DI1A 2XCHA 4FTOA 5EHLA 1Q61A 3VUTA 5FM2A 1S9JA 1FQ1B 3CE3A 2ITXA 3MPAA 3VS0A 5JGBA 4BICA 1MRYA 4RGJA 1GJOA 3F3UA 4CTBA 3ZRMA 2GS7A 4EH9A 1Q8WA 3LAUA 3OXTA 4FMQA 4C4FA 4AU8A 2XVDA 3FZOA 5M56A 1JSUA 3DBEA 4XLIA 4BKJA 2C0IA 4E6AA 3TZMA 4CZUA 3QBNA 2JITA 4WHZA 3RPRA 1LR4A 1PXOA 2Z7LA 4G6LA 3FZRA 4ACMA 4NM3A 3RNIA 2JKMA 4BCQA 3CY2A 4C36A 5DMZA 5HORA 5BVFA 4A9SA 5IUIA 5T68A 1Q62A 4BCJA 3NNWA 3NW6A 5BMSA 4RVLA 2WOTA 1OL7A 3V5QA 5HQ0A 4XOZA 3EYGA 3LXNA 4FIGA 4ZTNA 2HXLA 3DBFA 4L00A 3ZLXA 2R3OA 3TTIA 2H96A 4FNYA 4AZWA 3EWHA 1M7QA 2G2HA 4JRNA 2BPMA 3ZXTA 3CTHA 1PXNA 3IECA 5HOAA 3AD6A 2YFXA 3V5LA 3MV5A 2WEVA 3COKA 1U46A 4ZXTA 4WD5A 4BZOA 5J7BA 3KXNA 4UMQA 2I0YA 4NT4A 4YJTA 3UG2A 4DGMA 2BRNA 4FODA 3F5XA 1ZZLA 4B99A 3Q96A 4GYGA 3VUIA 1V1KA 4ENXA 5K4IA 4LGGA 4OR5A 5BMMA 4TRLA 4KIKB 4BYJA 4O6LA 1YVJA 2R3FA 3CPCA 4YJSA 3MS9A 4C4GA 1H1SA 2G2FA 4FVRA 4IWQA 2ITQA 4XYFA 3S3IA 4OTPA 4ANBA 3HZTA 3RCJA 2YM7A 3DQXA 3QRUA 4J7BA 3OUKA 5AMNA 3VC4A 1XO2B 3MFSA 4W9WA 3NUPA 3F7WA 4L67A 4BDBA 2X4ZA 3KU2A 4H3QA 4YJNA 4B8LA 2H8HA 1Y91A 3LZBA 3ZLWA 3A7HA 4YU2A 2AUHA 3DT1A 4E93A 4IB3A 4YNEA 1WBTA 1NVQA 1W84A 4OBPA 5CSWA 4I5CA 3ZLSA 3AMYA 1UV5A 4W4WA 1SM2A 4RZVA 2BUJA 3P78A 4RVKA 5DEWA 3UNZA 4A9YA 2AC5A 3LJ0A 1JKKA 4FTLA 4KS8A 2W05A 3HX4A 3KF7A 5FXRA 5J1WA 3D5XA 2HXQA 3PJ3A 4AFEA 5ACBC 2CN5A 4X3FA 5CF5A 4QMSA 3H30A 2IVUA 3KFAA 4C58A 2OK1A 4ACDA 2QO7A 3NYXA 4FYNA 1ZMUA 1GNGA 3FKLA 3COMA 1NXKA 1PXMA 2JIIA 3LE6A 4W8DA 2Z7QA 4DLJA 4BZDA 3DCVA 1WAKA 3AGLA 5JGAA 5LQFA 4C3FA 4FTIA 1FVTA 4E8AA 5BUEA 4MNFA 2VO3A 4IZYA 5CQUA 2VO7A 1ZYDA 4HZSA 4X2GA 3KF4A 1E1XA 1CMKE 2YIRA 2C5XA 2XCKA 3LCKA 4TY1A 3DB6A 3R8LA 3QL8A 1OPLA 4BDDA 2YZAA 3LCTA 4B7TA 1I09A 4FT5A 1RDQE 4NFNA 4QOXA 4WNPA 1OUKA 4MQ1A 4RG0A 2C0TA 3WF7A 2HOGA 3GC0A 4UN0C 4C62A 2OKRA 2F2CB 1OIQA 4XEYA 4XP0A 5IEXA 3QCYA 1Y6AA 3FLZA 3WF6A 4S31A 1YXVA 3HYHA 2CN8A 2W1HA 2B9IA 2OWBA 4LOQA 4YZMA 3R04A 4IAKA 4QPAA 4G5PA 2IZTA 4FGBA 4DINA 1Z57A 3IW5A 3O7LB 3E88A 4IFGA 4JBOA 2VO6A 4XBRA 3GU5A 2BHEA 4EOLA 5H8BA 3AT4A 1CKJA 4LYNA 4B8MA 3DOGA 4RLLA 5LCKA 3Q6WA 2BILB 4K1BA 2VTPA 3ORTA 4FSNA 3DQWA 1UU9A 4O2ZA 2YCSA 4MYGA 5HI2A 3BHVA 2IW6A 4ZTLA 2YN8A 3PWDA 1PY5A 3KMMA 1A9UA 3V6SA 4BKZA 3SA0A 5FEQA 4UWCA 3UOJA 4FKJA 3BBTB 4JXFA 3UJGA 4JT3A 4NFMA 3PXQA 4YLLA 4AZTA 2ONLA 1GZ8A 3H9OA 3MIAA 3PRIA 5AIKA 3I4BA 4MX9A 3QYWA 4AXAA 1O6KA 3QQLA 3FZSA 3WZEA 2WMQA 2W1IA 1SZMA 2XK7A 3GOPA 5DGZA 2JKQA 2VTNA 3EQDA 4F9AA 2GSFA 3FQHA 5KZIA 2C1AA 4BWKA 5JK3A 2ITTA 4EHZA 5CXZA 5FGKA 2WAJA 5HCYA 3JPVA 1GZOA 4S2ZA 3O17A 3SRVA 3GCPA 1Q8UA 1W0XC 3LXPA 3ULZA 5IH5A 4CCBA 4PDOA 4QMUA 3L8VA 3DAJA 4X2NA 4XP2A 1U5QA 3LFNA 3N51A 5C27A 2VWXA 4PX6A 4YBKA 2QOFA 2W1ZA 3BLQA 4MD8E 4BB4A 3A7GA 4G3CA 2QU6A 3PY3A 3RJCA 2VD5A 3EB0A 4QP8A 4EH6A 3R7VA 4RIXB 5A3XA 1H1PA 4NEUA 4ITJA 3ROCA 4ANQA 2BDFA 3H9FA 2XF0A 2XBJA 3EFKA 3KK8A 4U40A 5E8WA 2HZ0A 1BUHA 2XEYA 3QXOA 5D12A 4V04A 2EU9A 4HGEA 4IX4A 4IM0A 4BDJA 3R9HA 3HMOA 3NGAA 4RX7A 3R8ZA 2YM3A 4XG6A 4FKWA 1KSWA 2W7XA 4CFFA 3GFWA 3L9LA 1G5SA 2H34A 4LQMA 5IA5A 4ZTMA 4NW6A 3BLHA 1RE8A 3OVVA 4HYIA 4QTDA 4JBVA 3PIZA 4GJ3A 2WELA 2CSNA 4K9YA 2XS0A 2R9SA 2UVYA 4BKYA 1UNGA 3GI3A 4GW8A 5EDPA 4ITIA 3QQHA 3AC2A 5CF4A 5LVLA 4E5BA 4APCA 3P0MA 3VJOA 5I9XA 3ANRA 3L8SA 2CKEA 3G6HA 3NYOA 4ASXA 5HU9A 2HCKA 1XBAA 2PMLX 4QTEA 5A4TA 4U81A 4I92A 3WZUA 1OMWA 1Q24A 3ZFMA 2I0EA 1M2RA 3EOCA 3OW3A 4F0IA 3VUMA 2CHLA 4O38A 2C6LA 4CFWA 3R9NA 3UYTA 2C1BA 4CT2A 2HELA 2R3HA 2YISA 4YJPA 4EH4A 1YHVA 3GP0A 2X7GA 1XH7A 1YDSE 3QQKA 4F65A 4JBQA 3KKVA 4D28A 3CC6A 1J1CA 4OBQA 3VS2A 4RWLA 3HLLA 4MF1A 3W8QA 4WO5A 3OY1A 4L3LA 3RTPA 2WMSA 3ZSIA 4AZEA 3NR9A 5CEIA 2YM8A 1Z5MA 4IVDA 3R1NA 3QRKA 1FGIA 1H25A 3D14A 3QALE 4FV1A 1T46A 3UG1A 2XYNA 1ZMVA 3WIKA 1IASA 3SD0A 3MSSA 4TYHB 4IAIA 2XK4A 3FV8A 1TQIA 2EXEA 1A06A 2ITWA 3UMWA 4KKHA 3D5VA 1OIUA 5EKNA 4W4YA 4TWPA 5JZNA 2IWIA 2GNIA 2PZ5A 3ENHA 1OPJA 5ETFA 4C4EA 5AP2A 5ETIA 4DYMA 1DI9A 3QC9A 4ZY5A 4USDA 2A2AA 4YP8A 4FIFA 2FYSA 3MYGA 4M69A 4C4IA 4JR3A 4NUSA 3C0GA 4U3YA 3UVQA 5J9ZA 4EQMA 4TYIA 5E1SA 5I9UA 3BYSA 3P79A 4BIEA 5L2SA 2ZMDA 4H58A 4LGHA 2W4JA 4I93A 3F66A 3O8UA 2FSLX 3A62A 3HVCA 4V05A 1ZZ2A 5LMBA 4FBXA 4PUZA 2XEZA 3I7CA 5IPJA 4UWYA 5FEEA 4AWIA 1Q5KA 2ZB1A 4UMRA 4O6EA 3LOKA 1HCLA 4L8MA 3C4WA 3TKUA 5AJQA 5CAPA 4IC8A 2OJ9A 3OY3A 4BDGA 1OECA 3R73A 2ITUA 5FBNC 4P7EA 4ERWA 3V8WA 4LI5A 3E8EA 1YWRA 3KRLA 2WTJA 3PPKA 3VBWA 4C38A 3EFWA 1SNUA 2C5OA 3AC4A 1K3AA 3VHKA 4E1ZA 4H1JA 5CZIA 3TUCA 2W1CA 3VULA 2WMUA 4O91A 4O21A 3W10A 5KKRB 4PNIA 4FOCA 1DM2A 4YTFA 4YTIA 2OZOA 2XNBA 3DK6A 2VTRA 4QNAA 5BVEA 4DEEA 2QR7A 5ITAA 3KVWA 4L68A 5M51A 4I5HA 2YHVA 3LLTA 5EYMA 3QCSA 4CKJA 5LXMA 2J2IB 1UKHA 1YXTA 5IA1A 1YW2A 2WXVA 4WBOA 2YIXA 4J95A 1R3CA 4PV0A 4AGUA 3DFCB 5M44A 4O2PA 3KQ7A 3F5GA 3P23A 3LFAA 4XNEA 2JAVA 4BRXA 5JFSA 4TYEA 5HGIA 3E64A 3SQQA 1B38A 5EDRA 4EKKA 3R1QA 4JBPA 4TZRA 5DLSA 5G6VA 5ANDA 4BCGA 4U42A 3VUGA 4C02A 3R7EA 1U5RA 1P4FA 2I6LA 4YJRA 3W32A 5LVPA 2OIQA 3S00A 2W0JA 4WKQA 5A6OA 1R39A 3UC4A 1K9AA 3QD4A 2R64A 3E8NA 2WOUA 1SVGA 2E9UA 2VTIA 3QA0A 3SOAA 5CF8A 4QP7A 3RPSA 4OTHA 4C59A 1H28A 3FPMA 4YZBA 3NUYA 4RPVA 1BL7A 3AG9A 2EB2A 2HYYA 4QMOA 2ITZA 3VRYA 5JSMA 4BDEA 2DS1A 5CALA 3D83A 4GYIA 4EOKA 1QPCA 4AZFA 1JBPE 5A4EA 1NVRA 3CXWA 2UZDA 5HVJA 4BFMA 3S95A 1ZY4A 1FMOE 3PYYA 3U6HA 3MIYA 4EBWA 2C4GA 1OIYA 1ZOEA 4JVGA 3ACJA 3TV6A 4J53A 4G9CA 2Z2WA 5LMKC 2FUMA 3QTXA 4FTQA 4LMUA 4XG9A 3WARA 4Z7HA 5CSHA 1H07A 4EWHA 2RGPA 1Q41A 4NWMA 2VN9A 4KNBA 3BE2A 3AC8A 4I0RA 4EOSA 4YJVA 3HNGA 4U97A 3UMXA 5EH0A 4E6DA 5L6PA 5LVNA 4IBMA 5BVKA 1U4DA 5AA8A 3IKAA 3N9XA 4PPCA 4QP1A 4NM0A 1T45A 5CT7A 3LIJA 4GS6A 3ZOSA 3ZYAA 1FMKA 3E87A 5HESA 5KMJA 3DJ6A 4G3FA 4FTMA 2VWWA 1XH4A 2IW8A 3ZFYA 4JDIA 5B2LA 1IA8A 1PXPA 2RFEA 3RPYA 4FZ6A 3RWQA 3ZXZA 5CSVA 2XJ1A 3REPA 2OJFE 4EH8A 3QU0A 4R1VA 4FIHA 2OFUA 4HVIA 5DG5A 1URWA 5J87A 3QWKA 4QMXA 2GTMA 3A4OX 1CKPA 4NIFB 3T3UA 3FXXA 4X7QA 3TACA 4EK4A 4F63A 4D0XA 3RI1A 1KE9A 4W8EA 3NRMA 4ZSAA 4XG2A 3KMWA 3MDYA 2JKOA 5IG1A 4Z3VA 3I60A 3CGFA 4FSRA 2NRUA 3W2CA 3FMJA 3NCZA 4MXCA 5K3YA 3SW4A 5K0XA 2QU5A 3PZHA 4YHJA 5HTIA 3DK3A 4H39A 3BX5A 3I5NA 5FP5A 4AAAA 4D9TA 2VTHA 3R01A 4M68A 4AFJA 3EQPA 5AM7A 2VUWA 3TUBA 4P90A 3SX9A 3VS5A 3FWQA 2WTVA 3VBYA 2RSVA 3UDBA 3BHTA 3QCXA 5FWKK 3D9VA 4RIWA 5C8KA 3WF8A 2Z60A 3AT2A 2ITNA 2UW6A 3CTJA 4AW1A 4MBJA 4RJ5A 3CLYA 2W9FB 3QHRA 4FR4A 4ZIMA 2WIHA 2RFSA 3AC3A 4YNOA 4ZTRA 5AEPA 2OJGA 4UMUA 5DFPA 1REJA 2HY81 1VR2A 3R8PA 3VQHA 4PP7A 4EORA 4FX3A 4PTGA 4IM3A 3LPBA 3MTFA 4UZDA 1BKXA 5IMXA 2OH4A 2GHLA 3BQCA 4IVAA 3R8UA 4MXYA 5K0KA 4UMPA 3HGKA 4PMTA 2BROA 4PL4A 3WYXA 2X7OA 1CTPE 2IJMA 4QMQA 4O0UA 4E20A 4EK5A 4C4HA 1H4LA 3BU5A 3O23A 5CVGA 2P4IA 1OI9A 4I6FA 3BGPA 4RLKA 1DS5A 3RM7A 2JDOA 4N0SA 3KL8A 3EN7A 5HG5A 2ZAZA 3LQ5A 5CEKA 3LFEA 1M14A 4IX3A 5HTBA 2X4FA 4PL5A 4FZAB 3ZHPC 4AN2A 1S9IA 1OVEA 4AW0A 3KXHA 3QZIA 2GCDA 1CDKA 3O71A 5D9HA 5ACKA 3OMVA 5K9IA 2BZHB 5TF9A 3D7TA 4J96A 4E3CA 4MKCA 3LJ1A 3ALOA 4NU1A 3OEFX 4JDHA 3KY2A 3UO6A 2O64A 3BLRA 2C6OA 4DH7A 5BVOA 5C8MA 4YO4A 1W83A 3C4XA 2GPHA 3QUEA 5DE2A 5DHJA 5AM6A 4E6QA 1Q8TA 4KIOA 3SKCA 4FV8A 3QD0A 3HRFA 4YO6A 4EYJA 3QYZA 4Y73A 3KEXA 3ZS5A 2WU6A 3NLBA 3VF9A 4OTWA 3OFMA 2O3PA 3ZEWA 3LFQA 4RJ7A 5JQ8A 5JMSA 3Q5ZA 2X39A 4X21A 2JC6A 3NWWA 5D41A 3THBA 3DPKA 2QOKA 2UZNA 3PRFA 4UYNA 3BYUA 3KMUA 4D5KA 5B7VA 1PKGA 3BGQA 3R8MA 2CGUA 2FGIA 4FUYA 3QZGA 5AWMA 3A60A 4C35A 5BUJA 1U54B 1YDRE 4JG6A 1KWPA 2WU7A 3PP1A 2JGZA 3BEGA 4CFUA 3LMGA 2CGVA 3GOKA 5A46A 1YHWA 3GUBA 3A99A 2I0VA 2X81A 2FSTX 4QQ5A 4E7WA 2VO0A 3B8RA 4QPMA 4D2RA 3AQVA 4D4SA 1Q3DA 3FSFA 4AP7A 1ZLTA 2GNJA 4FTJA 4RRVA 3DKFA 3DDQA 4KBAA 3Q9WA 3EFLA 4ZZNA 5ANEA 5AAEA 4ALWA 4XV1A 1PXIA 3FC2A 2UZBA 3FZPA 4D4VA 3G0FA 4RA5A 4L7SA 3UZPA 2EUFB 2PVNA 1YXUA 2X2LA 4MQ2A 1OITA 3SC1A 2BVAA 3DLZA 4GFOA 2PVYA 1V0PA 5KMLA 2BFYA 2C6IA 4M13A 1NVSA 4C3PA 1PMUA 2ITVA 5AR7A 2OBJA 3Q4ZA 3A7FA 2A19B 2NRYA 3Q6UA 3CKWA 4F6WA 3TKIA 1LEZA 3LFSA 3SDJA 4ANLA 2PVFA 4M69B 4GUEA 4FSUA 3FQEA 3DLSA 2SRCA 2B4SB 2HAKA 2PVMA 4IFCA 2JBPA 3U51A 2ZV9A 1UU7A 2OGVA 2QOCA 3PUPA 4FV3A 4EL9A 1Q99A 3LXKA 3MB6A 4IH8A 4BCPA 4QPSA 5A4LA 3BU6A 5FRIA 3QWJA 4BI1A 3F6XA 4ASDA 2YAKA 5HBJA 3FMDA 2XA4A 4EZ5A 4FSZA 3WI6A 4BI0A 5CAOA 2UW7A 3OP5A 3PXZA 5BQ0A 4KSPA 2OJJA 2QOQA 5I9VA 4NCTC 2X1NA 4QMZA 4UV0A 4FSMA 3BGZA 3LM0A 2XNGA 1BYGA 3M42A 4D1SA 2VX0A 4R7IA 1SVHA 2OG8A 1XBCA 2Z8CA 3P7BA 4QMMA 4EH2A 4FICA 4LUEA 3DB8A 5J9LA 1PMNA 4G9RA 3VNTA 4L6QA 1DAWA 3P7CA 4QTAA 5E8YA 1ERKA 3G6GA 2VWIA 2UZEA 4D9UA 5KMKA 1KOAA 4FUXA 1JKSA 2VTQA 4J52A 4KIPA 4OTIA 4ACCA 4O0YA 1RQQA 4HVSA 3DV3A 4R6VA 3ZDIA 4CFMA 2AC3A 2R2PA 2RFDA 5DWRA 3HA6A 3ORXA 4AG8A 5HVKA 2QQ7A 2R7IA 4HVGA 1SNXA 2WB8A 4HPUE 5KMIA 3PXFA 2VGOA 2XIZA 4GK3A 3ACKA 5AUYA 1KV1A 3R9DA 2VTMA 5T6KA 2B1PA 1MQ4A 4IJPA 3M2WA 1V0BA 2ZMCA 4WRGA 4FKLA 4F9YA 3R21A 1XJDA 2WTKB 3CKXA 3FUPA 3KVXA 3EYHA 4HYUA 4I0TA 3WIGA 3IDBA 3R28A 4L7FA 4U9AA 2BR1A 3MVMA 4I21A 3FKOA 2Y4PA 3VBXA 3HV3A 4OGRA 2G2IA 3ORLA 4PDPA 4S32A 4CD0A 5IF1A 4MWIA 3PJCA 4D0WA 2PL0A 4O0TA 4P5QA 3WYYA 5L6WL 4ZZOA 5C26A 2XNNA 3OZ6A 5EKOA 3T9TA 4ALVA 2J0JA 3A8XA 4EHVA 1OUYA 4Y85A 4F1MA 2PVKA 1O6LA 2ZB0A 3RPOA 4AOIA 5FDXA 3NYNA 3FMHA 3P4KA 3ZSHA 2OH0E 3Q60A 4ITHA 4J8NA 3HEGA 4H3PA 5M57A 4L53A 5AUTA 3PP0A 3QTWA 3RK9A 3UZTA 2WMVA 4GL9A 2O0UA 4IWDA 3OT3A 1M52A 2C3JA 2C6MA 3EJ1A 5FM3A 4JL9A 3W2QA 3DU8A 3OXIA 3K5VA 1R0EA 4GG5A 4C3RA 3FYKX 1MP8A 1XR1A 4I22A 4H1MA 3NUXA 3HL7A 2C3LA 4YTHA 5JFXA 1JPAA 4RT7A 4F7JA 1QPDA 2VWUA 4EONA 4JQ8A 3UP7A 3DFAA 3EQRA 3NDMA 4A9UA 3P1AA 5CTPA 3MH2A 3PZEA 2VZ6A 3QAME 2X2MA 3F7ZA 2CGXA 2XH5A 1ZARA 3D4QA 3QTSA 4BCKA 3HRBA 2DYLA 3CGOA 5I3OA 4RJ4A 1Q3WA 4U44A 2DWBA 1WBOA 5HO7A 2CCIA 5KBRA 2HZNA 4IC7A 1Q8YA 3L8PA 2RL5A 2IW9A 2WIPA 4PF4A 3ZSGA 4CMOA 5D10A 3E92A 4OTQA 2UW9A 4NZWB 4OTFA 5EM6A 3WE8A 4AACA 2YITA 4XH6A 2JDSA 3IW8A 5EYCA 3L9NA 1W82A 3OW4A 3MFRA 4GFMA 4ZLZA 4UBAA 3TTJA 3S2PA 4FSTA 4QP9A 3GCVA 5EW3A 3TWJA 3RAKA 2PVJA 3FMMA 4UYAA 2C30A 3OC1A 3PXYA 3FPQA 3W2OA 4E4XA 2BTRA 2QLQA 1UKIA 3LQ8A 3VW8A 3V8SA 3ZO1A 1NA7A 3HMNA 2W5AA 4XUFA 5E1EA 4EUTA 5AUXA 5H2UA 5LMKA 3DZOA 2GFCA 2BAKA 1J91A 5HG9A 4I6QA 3R8VA 4A7CA 2Q0NA 3GC9A 2W99B 4MXOA 1M7NA 3W8LA 5HIEA 2W17A 3V01A 4ALUA 5CNOA 3QKKA 4I6HA 3PA4A 4XJ0A 4U45A 5J7HA 2YJSA 5AAGA 5EM7A 3TNIA 5ANOA 1OKWA 4FKGA 5HX6A 4D2WA 3UIMA 2X7FA 2ZYBA 4MEDA 2X8IA 3QHWA 3KK9A 4U41A 3E8CA 3JY9A 4FKPA 5F20A 3RK5A 5I9ZA 5A54A 2VTAA 5CU3A 3FAAA 3G51A 2JFLA 2CMWA 4WUAA 5CASA 2WEIA 3BE9A 4JOAA 3MY1A 4YC3A 3IPHA 3POOA 4MBLA 2X2KA 3OTUA 4FKSA 3F3TA 3PVGA 5KO1A 4WIHA 3RALA 5L6OA 5A4QA 3K3IA 4M12A 2YEXA 4ZZMA 4IB0A 4IXPA 3R7UA 2F2UA 5F4NA 3DAEA 3GBZA 4R7HA 4I5MA 1IEPA 2PE2A 3LCDA 1GY3A 2C0OA 3Q4TA 3DKCA 4LL5A 3RHKA 5IUHA 4XX9A 4LOOA 4K2RA 4O1PA 3HV5A 3U4WA 3I6UA 1L3RE 3FYJX 3DZQA 4GT4A 3GQIA 4TKSA 4CLIA 5IEVA 5M4FA 2PZYA 2VWZA 4TT7A 4IAAA 4ASEA 5EI2A 2WQOA 3FI2A 2DUVA 4A4LA 1CKIA 1WBNA 3G9NA 1R78A 3E5AA 3QQUA 5KCVA 4QP2A 2JIVA 4CTCA 4D4YA 4A9RA 5AUZA 1JOWB 3F69A 1PW2A 3QGYA 4RVTA 5HIDA 5HO6A 3E7VA 4FKQA 5LOHA 2UZVA 5CU4A 4WA9A 3QKMA 4I20A 4DEGA 2J0KA 4GMYA 2PMNX 3TZ9A 4AOJA 1FINA 2OFVA 1BI7A 2ZOQA 3B2TA 3KB7A 4XG4A 4E73A 3AGMA 4O0SA 4CYIA 2G9XA 3FQSA 1KOBA 1M2QA 4IWPA 3U6JA 3A61A 5CANA 5L8LA 4QYYA 1P4OA 5FTOA 4RC3A 4CZYB 3DDPA 4FV5A 4FL3A 3KXGA 4I94A 4GRBA 3D2IA 2R0UA 3GEQA 4GK4A 2JLDA 2WPAA 3FSKA 4BCHA 4USFA 3AMBA 3SLSA 4PTEA 3PVWA 5HX8A 5KMNA 4OTRA 5EHYA 3G2FA 5LCJA 4ZSEA 5K5XA 2CLXA 3UO5A 3LCOA 4HGTA 4LM5A 4EOIA 3I5ZA 5DRDA 4RIYA 4BYIA 4DFNA 4CXAA 2ZV2A 5E8ZA 4FYOA 4TWCA 4BCNA 3NYVA 4W4XA 4I24A 4XRLA 5DN3A 2P3GX 3IQ7A 5KHWA 3WE4A 3DKOA 3FL5A 4R3PA 4D1ZA 4UMTA 4EEVA 2O2UA 3GENA 4JDKA 1URCA 4CCUA 4CQEA 4EYMA 3CPBA 4FZFB 2O5KA 4J71A 4C2VA 4YTCA 5HU3A 3FC1X 4XP3A 2XNMA 3FLSA 5HNIX 2ZV7A 5CSPA 2WFYA 4IX5A 1OB3A 2BIYA 2Y0AA 2P55A 3FLNC 4HGSA 3R63A 4Y83A 5GHVA 2XP2A 4XOYA 4OW8A 4TWNA 4Z16A 2O63A 2Q0BA 4L9IA 4KD1A 5F9EA 2Z7RA 4JJRA 2UV2A 4YR8A 3CP9A 3FMLA 2YLEA 4RJ8A 3OF0A 5DR6A 4AT5A 3V6RA 4YLJA 2F4JA 2HWPA 4FTNA 3VAPA 2QKWB 3G0EA 2X6EA 4NJ3A 5L8JA 2UUEA 3OROA 3KXXA 3OG7A 1PXKA 1JVPP 4TNBA 1YI3A 3MN3A 4DGGA 4D5HA 4QYEA 5JRSA 2WQNA 3UIUA 4G6NA 1REKA 4FT9A 3O8TA 2XKEA 3IGGA 3QLGA 4KIQA 2NP8A 5LARA 5B2KA 3MA3A 3T3VA 1UWJA 4RJ6A 2FH9A 3ZC5A 4P2KA 3CCNA 4OLIA 5L4QA 4KS7A 4BGQA 4G3DA 3UPXA 3COHA 4M84A 3RZFA 4ZP5A 4FKTA 4FT7A 4YJUA 4EHGA 4D2PA 5C8NA 4S34A 3SOCA 3E62A 4PQNA 4V0GA 4PMPA 3OWLA 5JRQA 1H27A 3QZHA 1QPEA 2R3LA 4IHPA 3D5WA 3IS5A 3PSDA 3UC3A 2O8YA 3AC1A 1Y8YA 2DQ7X 1JNKA 2PY3A 2WMTA 4UY9A 3UQGA 4LG4A 3QC4A 5TO8A 5M4UA 3MH3A 4FIEA 4IB5A 4KKGA 3WZDA 3F9NA 3TIYA 4TL0A 2IVVA 3D5UA 2J4ZA 4PL3A 4YMJA 3RZBA 4LOPA 3VS7A 4BDCA 1APME 4WNMA 3GT8A 5AP4A 5KKRC 4DG3E 3I0QA 3ERKA 3LHJA 2CLQA 2I1MA 3OTVA 4QO9A 4D4RA 1J1BA 2R3PA 3IOPA 4M3QA 5FQDC 3Q4UA 3GC7A 4IX6A 4B4LA 2HW6A 3CS9A 3MPMA 4JRVA 2R3IA 4OUCA 4XG3A 1XH6A 4BGGA 2F49A 3CIKA 3QKLA 4RJ3A 2J50A 3MVLA 2WMXA 2VTLA 5KBQA 2A0CX 3DBCA 3VUHA 3BELA 3DXNA 3TJDA 3NSZA 3C4CA 3ETAA 2XM9A 4R5SA 3R9OA 4RC2A 3ANQA 4TNDA 4D2VA 5BPYA 2JDRA 3TCPA 5IH6A 2ZM1A 3NS9A 4Q5HA 3ZZEA 5LVOA 4F4PA 3BU3A 5AV1A 3KRWA 1WVXA 1Y6BA 4PPAA 2F57A 4UZHA 2QNJA 2C5VA 3IDCA 4FK6A 3TT0A 5J5SA 2BTSA 1WCCA 1I44A 3O0GA 5KMOA 2BAQA 4FV4A 3NAXA 4DG2E 5ANGA 4PNKA 4ZAUA 4DGNA 4DH5A 3OWKA 5BX0A 4CKIA 4X3FC 5E8TA 4EJNA 3FJQE 4X3FB 4L01A 4Y5HA 2QOOA 4MXZA 4BI2A 2GHGA 5HE0A 3L9MA 3TNWA 2C6DA 1PMEA 1MQBA 1H26A 1UVRA 2G01A 3D94A 5DBXA 4KB8A 5JH6A 4ZLYA 3U6IA 3QCQA 3OUNB 2UW4A 4A4OA 4MK0A 5HLPA 1OKVA 3AD4A 3C0HA 2V62A 5HE2A 1M2PA 2XZSA 1V0OA 5IEYA 4KBCA 3ZUVA 4HOKA 1UU3A 3E3PA 4RVMA 3QTIA 2PMIA 3GB2A 3QQGA 4ZSJA 3Q9XA 3F3WA 4R8QA 5BNJA 4U79A 2E9PA 3NAYA 4U7ZA 1VYZA 3CR0A 3B2WA 2Y4IB 4EQUA 2BMCA 2ESMA 2YDJA 4ONAA 4GEOA 4RFYA 1YRPA 3DBDA 5DT3A 3K5UA 4Z55A 2FSMX 3FLQA 3ZUUA 3ALNA 3E8DA 4KKEA 5CF6A 3E63A 3R7IA 1ZYJA 1PYEA 5FXQA 3L9PA 4I4FA 4E5WA 4J1RA 4EWQA 4C61A 4FOBA 4G6OA 3W55A 4UALA 3RHXA 5GZ8A 4UEUA 3BV2A 2PWLA 3BCEA 1WBWA 3NIZA 1O9UA 1M17A 3KCFA 3MPTA 2BRMA 4BWXA 4WG3A 3IONA 4FTCA 4F1OA 2VV9A 1OL5A 2J5FA 2WQBA 3V5JA 2E9VA 2J0IA 4GVJA 3JXWA 2C6TA 1KE6A 4M15A 3WOWA 1H0VA 4UXLA 5AX9A 4AUAA 4B0GA 3PIYA 3UNKA 4C7TA 5A14A 1EH4A 5HO8A 2ITOA 5BUIA 5LVMA 2QC6A 2GQGA 1F0QA 4BN1A 4XG7A 3MTLA 2Z7SA 4P5ZA 5H8GA 2XIYA 4K18A 3AT3A 2PZRA 4C2WA 2ONLC 3DTWA 2P2HA 2BHHA 2GNLA 4QQJA 3OWPA 3NZ0A 3F88A 5DEYA 3CQEA 4Q9ZA 1YWNA 2OICA 4QMYA 3HMIA 3IW4A 3ORNA 4BVUA 5AR4A 3QTQA 1OIRA 1STCE 1YXSA 2W9ZB 4ZTQA 4F70A 5JN2A 2W1GA 4A07A 1PMVA 5I4NA 3R0TA 5ANKA 3PXKA 3UVPA 2YDIA 3QX2A 3U4UA 2A1AB 3I1AA 4KINA 2X0GA 5FEDA 4ARKA 2GTNA 4L45A 2VTSA 3SRVB 4Q5EA 5KE0A 4P4CA 3HUCA 3CY3A 1ZXEA 3JUHA 3MVHA 4O0RA 5CQWA 3RWPA 4UB7A 3NUNA 1WBPA 4JX3A 3BI6A 2YABA 2YM4A 3EMGA 4RSSA 5DRBA 1XH5A 3GCSA 5CNNA 4EI4A 1YDTE 4Q9SA 4QYGA 4JG7A 3CQUA 2P0CA 4HJOA 4IZ7A 3TNQB 3R83A 3G90X 4JR7A 5BYYA 4O22A 2ACXA 4EOOA 2QI8A 5AP5A 4BTJA 3T8OA 4Y95A 2CPKE 4MWHA 4FI1A 2Y8OA 3ZO3A 5TE0A 4AZSA 4C0TA 4EK3A 4II5A 2WO6A 4MH7A 4ZSGA 3C51A 4TXCA 4FNZA 4A9TA 2V5QA 3PJ2A 1IG1A 3BV3A 3PJ8A 5D7VA 5IA2A 3WF5A 1UNHA 2WMWA 5CY3A 1H1WA 3CJGA 3OHTA 4NK9A 4KSQA 2BALA 4G31A 1YI4A 1QPJA 3PIXA 3UGCA 4YJQA 2XMYA 4I6BA 2A27A 4FT3A 3GVUA 4NJDA 4U8ZA 5D7AA 5AV0A 4CKRA 3KC3A 4OT5A 3ZBXA 2B54A 4FK3A 5L2WA 2UVXA 3NEWA 3VBQA 4AE9A 2XIKA 2XKCA 4G34A 1H00A 5H9BA 4HNFA 5KUPA 4NH1A 2G1TA 3DY7A 3JY0A 3I79A 2C3IB 4PMSA 4RIXA 2Y6MA 2YM6A 2VU3A 5HVYA 4ANMA 2BZJA 4CVAA 2ZDUA 4EZ3A 3IW7A 3OBGA 2YERA 3HMPA 3V3VA 2R3NA 3UO4A 4DN5A 3EKNA 4HCUA 5M4CA 2OU7A 4O0WA 2VNWA 4X6QC 2IZRA 4IVCA 4RFZA 2EWAA 3C13A 2JFMA 5TR6A 3F3VA 3ZU7A 2ZM4A 4MTAA 1JKLA 2W4OA 3GFEA 3R1SA 1K2PA 2UW0A 3FZ1A 3V04A 1DI8A 2FSOX 4F64A 3PA3A 3IGOA 3ZONA 3I81A 4CV9A 4YC8A 5AR3A 4ZEGA 3UODA 1OGUA 3S4QA 4Z9LA 2VWBA 3RP9A 4MNEA 3NX8A 4JAJA 4FV2A 4C37A 4FKIA 3L1SA 1ZYLA 2FA2A 4RFMA 4NTSA 2WGJA 2PVLA 5CLPA 5C03A 2R3QA 5HLNA 3HV7A 3KULA 4QP4A 4BDHA 3PLSA 1HOWA 2OXXA 3FI4A 3ORZA 4DITA 5DPVA 5KHXA 4F09A 3IW6A 5K4JA 4BCMA 5AR5A 2VGPA 4C57A 4K8AA 4CFNA 1PXLA 4G3GA 2UW3A 3MH1A 3BWJA 3W18A 4YZDA 3FI3A 3K2LA 5F1ZA 3VJNA 4BZNA 3A7JA 4Y72A 2FO0A 2QLUA 4CLJA 4LRJA 4UX9A 3CBLA 3MY5A 4APPA 2R3MA 4IE9A 4PMMA 4A4XA 1WBSA 3HV6A 2XNPA 3V5WA 4L46A 5AP7A 5HEZA 2EXMA 4CFXA 2YDKA 4GIHA 3BRBA 2VX3A 3PG3A 4DEDA 4G17A 3RK7A 2XNOA 3LJ2A 4ZY4A 2OXDA 5CAQA 2R3RA 3QTRA 5FBOA 5AADA 2X6DA 2G15A 3ZDUA 2GNHA 5F95A 5DNRA 4FA2A 2R7BA 2PVHA 3QRJA 4PWNA 2F9GA 2VWYA 4EOQA 4FG7A 4IMYA 4FG9A 5C1QB 2WQEA 3F2AA 4J99A 2F7XE 5IDNA 5EI6A 5ICPA 3TUDA 1BMKA 4TYHA 4IAYA 3C4ZA 3KN5A 1MRUA 3Q5IA 1RJBA 2ETRA 4FF8A 2ZDTA 4GG7A 4JS8A 2XK6A 3KRXA 3NNUA 4L52A 5CYIA 3DKGA 4M0ZA 2YIQA 2XKDA 2BCJA 4JQEA 2PVRA 5JEBA 2J6MA 4JLCA 4FL2A 3TXOA 3UVRA 2LGCA 5IDPA 3CQWA 4CMTA 5IUGA 4ZS0A 5H8EA 4CRSA 2OF4A 5EYKA 5AX3A 4LL0A 4N6ZA 4KRDA 4F6SA 1ZYSA 3TV7A 1UNLA 1YOLA 3UPZA 3F82A 3IK3A 3FHIA 4TPTA 3SXSA 4AT4A 1H24A 1VJYA 4EUUA 2C5YA 4FIIA 4M0YA 3SAYA 5ANJA 4IADA 2WTKC 3F61A 3KA0A 3FZTA 3P5KA 3POZA 4YUQA 5HKMA 2WTWA 1WVYA 4YPDA 4AN9A 4YJOA 4EZ7A 4ANOA 1PXJA 3KRJA 4AW2A 5EG3A 3BYOA 2R5TA 4DFYA 5HTCA 5IMEA 3MB7A 5BVDA 3FMNA 3HP2A 1WFCA 4AX8A 3VUKA 2YCQA 4HVDA 1XHAA 3TI1A 4U5JA 3MI9A 3GXLA 3FMEA 5KX8A 2R3JA 4U6RA 4AF3A 4QMVA 2QCSA 3ROYA 4ANNA 2XK8A 2PZIA 3TZ7A 3WZJA 4FSWA 2JDTA 3ITZA 4OT6A 4HW7A 3FY0A 2GU8A 4X2KA 2IZSA 3A4PA 4L42A 4QQCA 5GNKA 1XKKA 4QMPA 3DGKA 4ZJIA 3Q32A 5BVNA 4C8BA 3EQCA 4BHZA 1P5EA 4E4NA 3EZVA 4QTBA 2O65A 3E3BX 2NO3A 3PTGA 4BCOA 4DH1A 2W1DA 4IM2A 3L8XA 3W1FA 3PJ1A 5CSXA 4FC0A 3WZKA 5HLWA 3CD8A 4FL1A 4PDSA 2WMRA 3UOLA 1OL2A 4WSQA 4BDFA 4QYHA 4JI9A 3RBWA 3AOXA 4J98A 4Y5QA 5DVRA 3C4FA 1WVWA 5AAFA 4MCVA 2GFSA 3I0OA 4GVAA 2YIYA 3PFQA 1PYXA 3IG7A 3DNEA 3C1XA 3NW7A 4GJ2A 3UOKA 4ANSA 4DEIA 4V01A 5CZHA 4DLIA 4ENYA 5HZNA 3VQUA 3HMMA 1YOJA 2OIBA 3R2YA 4FIJA 2ZM3A 3FLWA 5EK7A 5DOSA 2WTDA 3SXFA 5AP0A 4GIIA 2C68A 5EM8A 5LMAA 3ZMMA 3R71A 2BDWA 2C6KA 3OOGA 1QMZA 3R6XA 3RAWA 3UTOA 4F0FA 4YGAA 2ITPA 2V7OA 3QRTA 2JD5A 2RKUA 1KE8A 3RKBA 3TNPC 3WBLA 3LFDA 1SYKA 3VBVA 3K54A 1KE7A 3EQHA 3EL7A 3HDNA 5HCXA 4IAZA 3BPRA 3FXWA 4WSYA 4I41A 4AT3A 4F08A 3M1SA 2ERKA 2WNTA 4YZ9A 3VWAA 4DGLC 4K0YA 1Q8ZA 3RAHA 1XWSA 5EYDA 2A4LA 2KTYA 2YWPA 3EN5A 5DA3A 4DTKA 4USEA 2RG5A 4TW9A 3O7LD 2RF9A 4M7IA 3R02A 2QOLA 5J1VA 3P86A 5IA3A 2QD9A 3QGWA 3DA6A 1TQPA 3PE2A 4RMZA 4FV0A 4DGOA 5FLFA 2FB8A 2OO8X 3ORKA 5GZAA 3ZH8A 2J90A 4XRJA 2B9JA 4AA5A 2PHKA 4CYJA 2V0DA 5CXHA 4EH7A 3JS2A 3OD6X 2XK9A 1MRVA 3CD3A 1B39A 1H1RA 4IVBA 3GU8A 4ZLOA 5L2TA 3MBLA 5HICA 4QD6A 5AP1A 1H0WA 1OKZA 3F3ZA 3MH0A 3LXLA 4UWBA 4MD9E 4F7LA 5CWZA 4RIWB 1ZAOA 3H0ZA 3MJ2A 5B2MA 3IO7A 2V7AA 3MY0A 2WMAA 3BQRA 1MUOA 1AD5A 4OTGA 4QNYA 3NW5A 3OS3A 3Q9ZA 1JKTA 3OCTA 3QLFA 2HWOA 3QUDA 4U80A 4DH8A 1ZWSA 5I9WA 3Q9YA 3AXWA 3SV0A 2I40A 3PA5A 4LFIA 2V22A 2XJ0A 3A8WA 3ZUTA 4I3ZA 1Y8GA 5E92A 4BCFA 5JFVA 3RNYA 5LJJA 5L2IA 3VO3A 4NIFA 2XM8A 3BEAA 4EC8A 2CCHA
chains in the Genus database with same CATH superfamily
1KE5A 3H3CA 3AC5A 4WG4A 4QYFA 4BCIA 3VF8A 4IEBA 1PJKA 5E90A 5EW8A 3B8QA 4DBNA 3BHYA 4X0MA 2VNYA 4IDTA 4H36A 4NSTA 4JQ7A 5EOLA 4YSJA 3BIZA 3GGFA 5T3QA 4D55A 4F6UA 1VZOA 4WG5A 1JWHA 1LPUA 5A6NA 1UWHA 3H9RA 3V8TA 4BC6A 1YWVA 4AOTA 3FMKA 3OCSA 3DJ7A 5DT0A 2EVAA 3HRCA 3VVHA 4FKUA 1Y57A 2IVTA 4IAFA 3OOMA 3BBWA 4K6ZA 4L3JA 4WOVA 5EHOA 5GZ9A 3G33A 3EN9A 1H08A 3P08A 4GV1A 3VBTA 3D7TB 3EQIA 5F94A 1OPKA 3NNVA 3PY0A 4S30A 5FDPA 1LP4A 3NPCA 2VX1A 3RVGA 1WBVA 3ELJA 3PPZA 1JSTA 4WNOA 4X2JA 2HY0A 3MVJA 1DAYA 1YXXA 2XRWA 4FZDB 2NPQA 4EBVA 4MD7E 4KA3A 2VTTA 2HW7A 2B53A 2YAAA 3QA8A 1AGWA 2QO9A 3OWJA 3HDMA 3ORPA 4ACGA 5GJGA 4RZWA 3FKNA 1PKDA 3P7AA 2OSCA 4AA4A 1OM1A 1OKYA 2JAMA 2OF2A 3PY1A 4B9DA 4BWPA 3MW1A 4HVHA 5AA9A 3UQCA 3TL8A 3VUDA 3R00A 3W16A 3DK7A 4ZY6A 3CTQA 4L44A 3KXMA 4NKAA 5FG8A 4D2TA 5L3AA 3WILA 4EQCA 2HK5A 3OCGA 4ZK5A 4LV5A 3UQFA 4RC4A 5GJDA 4PP9A 2F7EE 3R2BA 4AE6A 1GIIA 4OAUC 1U59A 5JQ5A 2BRBA 2H6DA 2R0IA 3FLYA 4IDVA 4RX9A 1H01A 4AA0A 4AZVA 4YSMA 1BI8A 2J0LA 5J8IA 4AGDA 1GAGA 3JVRA 4M67A 3R7GA 4KABA 4WNKA 4XCUA 3Q53A 5J79A 1WZYA 4J97A 1ZRZA 4MNEB 4HCTA 4D2SA 2OJIA 3QFVA 1TQMA 4MAOA 3ULIA 3U9NA 2XUUA 1VEBA 1HCKA 2VRXA 3V5PA 4DG0E 2V55A 3KULB 3QX4A 3SVVA 1TKIA 5CI7A 4FTUA 4RIOA 5BVWA 3UIBA 3ZEPA 4BDKA 3MFUA 3ET7A 3MWUA 1R0PA 4LMNA 2C5NA 3UE4A 2PTKA 2J9MA 3FBVA 3NCGA 3BZ3A 1QL6A 3GU6A 4PY1A 2UW5A 1P2AA 2W4KA 2WTCA 3FHRA 3PWYA 4LRMA 4TN6A 4GFGA 3LM5A 5HBHA 3SXRA 4RA4A 3UBDA 3BHHA 4QTCA 2JKKA 3T9IA 1FVVA 1U54A 3FL4A 3LCSA 1ATPE 3I6WA 5LWNA 2YIWA 2OZAA 5CI6A 4PRJA 4XV2A 2H9VA 2C69A 4EH5A 2E9NA 4HYSA 4O27B 5EFQA 3HUBA 2UZTA 3SW7A 5AIRA 5CEQA 4FV7A 2WHBA 2GS6A 4ID7A 4DC2A 3C50A 3EL8A 4EOJA 3M11A 5I0BA 5LWMA 4FT0A 3OBJA 3QTZA 1BLXA 4QMNA 5HBEA 2VTOA 3V51A 2QOHA 2CDZA 1FOTA 4YBJA 4O1OA 3LW0A 5AV4A 4KWPA 4FG8A 5GJFA 2WKMA 1LEWA 4FSYA 3QRIA 3C9WA 2HZIA 4JNWA 1FPUA 3ZRKA 3VS3A 3O51A 2GHMA 4D1XA 3ZZWA 1ZMWA 2XIRA 4JIKA 4QMWA 4XMOA 3Q52A 2QONA 1E9HA 3ORIA 1PHKA 4FTTA 5D11A 4HNIA 5EOBA 2BIKB 2XYUA 3Q3BA 4BIDA 1GZNA 4CRLA 2LAVA 2BDJA 2BFXA 5E8SA 2BAJA 1VYWA 2XB7A 5CAUA 5DR9A 4BDIA 5CVFA 3DBQA 2OIDA 5EW9A 3VRZA 1F3MC 3HECA 4GK2A 2J51A 4KAOA 4QRCA 4WUNA 2UZOA 5CX9A 4DEAA 2RIOA 5CEOA 2X9FA 4U0IA 4FSQA 4BTKA 3HV4A 3C0IA 3Q2MA 3ENMA 4Q2AA 2UW8A 2JEDA 4UXQA 4BF2A 1ZY5A 5HD7A 4GUBA 2QHMA 3W2PA 1UU8A 2PZPA 2QR8A 5CEMA 4QP3A 1Q4LA 4I23A 5L2QA 4LV8A 4AS0A 4G2FA 4QQTA 4FNWA 4M14A 4DFLA 4E6CA 2XJ2A 3CJFA 5CENA 4X3JA 4K11A 3D15A 4NCTA 2C47A 1YQJA 2P2IA 5FXSA 3LFCA 3BKBA 4LGDA 4WT6A 3MGYA 3Q4CA 3QF9A 3GCUA 4XG8A 5AP6A 5AR2A 2B55A 2YCRA 4MXXA 5EI8A 5AUWA 3QQJA 2UZUE 2XBAA 5IKWA 2VAGA 4CT1A 5IA0A 4IANA 4QMLA 1WMKA 3GU7A 4JX7A 1YI6A 2GNFA 3DNDA 1P14A 3HP5A 5BYZA 5TOZA 4MXAA 4YZNA 5AV2A 4JIAA 3K3JA 4GCJA 1YKRA 3LFFA 4HPTE 4FTRA 4FV6A 5HG8A 4RQVA 5JT2A 3QD3A 2UVZA 4AGCA 3KCKA 3TNHA 2YA9A 1GOLA 3U9CA 5CEPA 4DFZE 5IH4A 2XKFA 3RINA 2P33A 3II5A 4PPBA 3R7YA 4Y8DA 3A2CA 3MJ1A 5HE1A 4BTFA 5AUUA 3E93A 4N70A 1CM8A 2C3KA 3KGAA 5DR2A 4DEBA 3F5PA 3EN4A 5HHWA 3RAIA 2IZUA 4W9XA 3P9JA 4K77A 5TKDA 2I0HA 3MA6A 2W5BA 1YOMA 3OCBA 3EN6A 2R3GA 4M8TA 2QG5A 2PSQA 4TYGA 4J8MA 4KIKA 3EQGA 4RQKA 4EC9A 3W2SA 4XV3A 2CGWA 5FP6A 3ZO2A 4X2FA 4CSVA 3TJCA 1F5QA 1TVOA 2XRUA 4KRCA 5CVHA 3AMAA 3EFJA 4AW5A 3R22A 4U3ZA 4G16A 2A98A 2X0PA 3ZRLA 3DTCA 3TN8A 2YLFA 2B9FA 4IW0A 3UP2A 4NKSA 3GCQA 4YLKA 2CJMA 2X8EA 4EOPA 4YHFA 3G9LX 2Y4IC 3C7QA 4FNXA 2W1FA 4F99A 2QURA 5CAVA 3R30A 3HA8A 2QKRA 4IWOA 3TG1A 2ETKA 4I0SA 4MVFA 2B9HA 3UNJA 5IZFA 2GS2A 4H3BA 3VN9A 2QVSE 4N4SA 2PE1A 2GNGA 2IO6A 2Y6OA 5EDQA 4C4JA 4IQ6A 3EQFA 1GIJA 4R3RA 5HD4A 1LUFA 3G5DA 3IDPA 4FKVA 4AQCA 3Q04A 3VS1A 5FTQA 5C01A 3W33A 5CU0A 4NTTA 5G1XA 3OEZA 2OXYA 3QD2B 4R3CA 4BBMA 3ODZX 3ZC6A 5K5NA 4G1WA 2ZV8A 1R1WA 3TKHA 5IA4A 2PUUA 5M4IA 4AGWA 5E91A 4C33A 2RFNA 3TV4A 4B6LA 4HGLA 4QMTA 3PSCA 2YJRA 3EH9A 2GMXA 2B52A 3QTUA 4XHKB 3DAKA 4NM5A 3VS4A 4CMUA 3V5TA 3JVSA 1W8CA 4G3EA 5B0XA 4E5AX 3EIDA 3ZFXA 2EXCX 1RW8A 3KN6A 4S33A 3W2RA 3DJ5A 4TYJA 4FEQA 1JAMA 4L3PA 2FVDA 2YM5A 3C5UA 4NM7A 1XH9A 4CNHA 3EHAA 3KXZA 4GU9A 2HIWA 4DH3A 2X8DA 4ZSLA 5A9UA 2F7ZE 3VW6A 3H0YA 3TIZA 3GU4A 3OXZA 3VHEA 5L8KA 2E9OA 3EQBA 3NNXA 1H8FA 5KNJA 3ZLYA 3WF9A 2HZ4A 4YPSA 5KZ0A 4ASZA 3NUUA 5J5TA 5HG7A 5J9YA 4I4EA 4IACA 4TWOA 2J7TA 3AD5A 4XBUA 4E4MA 3S0OA 5D1JA 4E26A 5E7RA 1KV2A 1Q97A 4RX5A 3F5UA 4EKLA 2UZLA 3GNIB 5I5ZA 4I1ZA 3CEKA 4HYHA 5E8XA 3KRRA 5JFWA 3R7OA 2AYPA 3QZFA 3BWFA 4DEHA 4Z7GA 4ZOGA 4A06A 3NIEA 2REIA 2BRGA 3EKKA 4MHAA 4R5YA 3A7IA 4WRSA 5DIAA 4IIRA 1B6CB 3S1HA 2OW3A 3JYAA 4BDAA 3QQFA 4XV9A 2HENA 2IVSA 4DAWA 2XIXA 3E7OA 2BRHA 4XLVA 4DCEA 4YURA 2WTIA 2QHNA 4M66A 3FY2A 4YZCA 1XH8A 1OL6A 4O0VA 4CZTA 3BYVA 4I5PA 4Y46A 2PE0A 4RX8A 4ZJJA 4GSBA 4FV9A 1IRKA 4FZ7A 4LUDA 3ORMA 4MF0A 2R4BA 4ACHA 4FKOA 4GH2A 1JLUE 5DT4A 1W7HA 5CU2A 1GZKA 4YC6A 3R1YA 2QOIA 1GIHA 5TT7A 2W1EA 5CT0A 4D58A 1W98A 1H1QA 2QODA 3DS6A 4RWJA 2Y7JA 4IB1A 3RGFA 4XS2A 1OL1A 2C6EA 4FTKA 5HCZA 3OT8A 3PSBA 3QUPA 5FD2A 1ZOHA 1E1VA 4ZJVA 2JDVA 2QO2A 4F0GA 4F9WA 2GDOA 5IU2A 4JAIA 4CEGA 3O50A 1O6YA 4CQGA 2IN6A 3GQLA 2XK3A 3H4JA 2ETMA 3FDNA 5JGDA 4BTMA 3SHEA 4FRFA 5J95A 4F9CA 3I7BA 1BX6A 2ITYA 2JIUA 5ANIA 5E8VA 5C9CA 4AN3A 4W4VA 4OAVB 3EZRA 4GT3A 3FE3A 4JG8A 1YHSA 4N6YA 3RMFA 4BBEA 4FVQA 3F2NA 1CSNA 4PTCA 4JDJA 3ZCLA 1BL6A 4DFXE 5ETAA 1FVRA 3UIXA 1SMHA 2EB3A 3LFBA 3NUSA 4ZTHA 5HNGA 2VWVA 3QXPA 1JQHA 4RIYB 4U43A 1X8BA 3RPVA 3PPJA 4EK6A 1XQZA 3UYSA 5JKGA 4IZAA 4IJ9A 4R1YA 3FXZA 4BBFA 4QT1A 2YACA 4FKRA 3COIA 1QCFA 4RBLA 4LRKA 4M97A 4YHTA 4C34A 3TZ8A 5M55A 1AQ1A 1G3NA 5EM5A 4BGHA 3PVUA 4BHNA 3ZBFA 4EH3A 2QOBA 3IOKA 2WZJA 5ETCA 5HIBA 4EHEA 1ZOGA 3UOHA 4F7NA 3ZTXA 3ZO4A 4CFVA 4K33A 4FVPA 2YCFA 2ZVAA 2BZIB 4RWIA 5CS6A 4BIBA 4EK8A 3GC8A 4WBBB 2J5EA 3PXRA 1JSVA 4F1TA 2W5HA 4FTAA 2KULA 3VIDA 2OZAB 4EOMA 5A4CA 4HZRA 4HCVA 5E8UA 3D0EA 2ERZE 4ERKA 2J0MB 3PVBA 5H3QA 3RM6A 3O8PA 2VTJA 4F9BA 3O96A 5AP3A 4X6RA 4O96A 4CV8A 2E2BA 5KMMA 5AR8A 4OBOA 3C4EA 3D7ZA 3H10A 2X9EA 4TTHB 3U8WA 1W2DA 2Y9QA 3LVPA 5CU6A 4F7SA 3PG1A 2XNEA 4OTDA 4RWKA 4GT5A 1IR3A 5AUVA 4MBIA 1FGKA 2RG6A 4IZ5A 2OI4X 3D2KA 5I9YA 2JBOA 5M53A 4G5JA 1J3HA 2B7AA 2BZKB 1SVEA 2W96B 3HKOA 4V0GB 4DHFA 2UZWE 3MFTA 3U87A 4L43A 2WQMA 4O0XA 5I3RA 2PK9A 1Z9XA 3BHUA 5IISA 2WD1A 2ZJWA 4KBKA 4QP6A 3TEIA 4BL1A 3BYMA 4E4LA 4NW5A 5JZJA 1OZ1A 1PF8A 2BKZA 3RCDA 3ZM4A 5DH3A 2PMOX 4ZTSA 2R3KA 5HNBA 2WMBA 3PE1A 3VS6A 1XBBA 3O2MA 3ODYX 2W06A 5HE3A 1ZYCA 4GU6A 1UA2A 1NY3A 5AV3A 5DI1A 2XCHA 4FTOA 5EHLA 1Q61A 3VUTA 5FM2A 1S9JA 1FQ1B 3CE3A 2ITXA 3MPAA 3VS0A 5JGBA 4BICA 1MRYA 4RGJA 1GJOA 3F3UA 4CTBA 3ZRMA 2GS7A 4EH9A 1Q8WA 3LAUA 3OXTA 4FMQA 4C4FA 4AU8A 2XVDA 3FZOA 5M56A 1JSUA 3DBEA 4XLIA 4BKJA 2C0IA 4E6AA 3TZMA 4CZUA 3QBNA 2JITA 4WHZA 3RPRA 1LR4A 1PXOA 2Z7LA 4G6LA 3FZRA 4ACMA 4NM3A 3RNIA 2JKMA 4BCQA 3CY2A 4C36A 5DMZA 5HORA 5BVFA 4A9SA 5IUIA 5T68A 1Q62A 4BCJA 3NNWA 3NW6A 5BMSA 4RVLA 2WOTA 1OL7A 3V5QA 5HQ0A 4XOZA 3EYGA 3LXNA 4FIGA 4ZTNA 2HXLA 3DBFA 4L00A 3ZLXA 2R3OA 3TTIA 2H96A 4FNYA 4AZWA 3EWHA 1M7QA 2G2HA 4JRNA 2BPMA 3ZXTA 3CTHA 1PXNA 3IECA 5HOAA 3AD6A 2YFXA 3V5LA 3MV5A 2WEVA 3COKA 1U46A 4ZXTA 4WD5A 4BZOA 5J7BA 2IEWA 3KXNA 4UMQA 2I0YA 4NT4A 4YJTA 3UG2A 4DGMA 2BRNA 4FODA 3F5XA 1ZZLA 4B99A 3Q96A 4GYGA 3VUIA 1V1KA 4ENXA 5K4IA 4LGGA 4OR5A 5BMMA 4TRLA 4KIKB 4BYJA 4O6LA 1YVJA 2R3FA 3CPCA 4YJSA 3MS9A 4C4GA 1H1SA 2G2FA 4FVRA 4IWQA 2ITQA 4XYFA 3S3IA 4OTPA 4ANBA 3HZTA 3RCJA 2YM7A 3DQXA 3QRUA 4J7BA 3OUKA 5AMNA 3VC4A 1XO2B 3MFSA 4W9WA 3NUPA 3F7WA 4L67A 4BDBA 2X4ZA 3KU2A 4H3QA 4YJNA 4B8LA 2H8HA 1Y91A 3LZBA 3ZLWA 3A7HA 4YU2A 2AUHA 3DT1A 4E93A 4IB3A 4YNEA 1WBTA 1NVQA 1W84A 4OBPA 5CSWA 4I5CA 3ZLSA 3AMYA 1UV5A 2IF8A 4W4WA 1SM2A 4RZVA 2BUJA 3P78A 4RVKA 5DEWA 3UNZA 4A9YA 2AC5A 3LJ0A 1JKKA 4FTLA 4KS8A 2W05A 3HX4A 3KF7A 5FXRA 5J1WA 3D5XA 2HXQA 3PJ3A 4AFEA 5ACBC 2CN5A 4X3FA 5CF5A 4QMSA 3H30A 2IVUA 3KFAA 4C58A 2OK1A 4ACDA 2QO7A 3NYXA 4FYNA 1ZMUA 1GNGA 3FKLA 3COMA 1NXKA 1PXMA 2JIIA 3LE6A 4W8DA 2Z7QA 4DLJA 4BZDA 3DCVA 1WAKA 3AGLA 5JGAA 5LQFA 4C3FA 4FTIA 1FVTA 4E8AA 5BUEA 4MNFA 2VO3A 4IZYA 5CQUA 2VO7A 1ZYDA 4HZSA 4X2GA 3KF4A 1E1XA 1CMKE 2YIRA 2C5XA 2XCKA 3LCKA 4TY1A 3DB6A 3R8LA 3QL8A 1OPLA 4BDDA 2YZAA 3LCTA 4B7TA 1I09A 4FT5A 1RDQE 4NFNA 4QOXA 4WNPA 1OUKA 4MQ1A 4RG0A 2C0TA 3WF7A 2HOGA 3GC0A 4UN0C 4C62A 2OKRA 2F2CB 1OIQA 4XEYA 4XP0A 5IEXA 3QCYA 1Y6AA 3FLZA 3WF6A 4S31A 1YXVA 3HYHA 2CN8A 2W1HA 2B9IA 2OWBA 4LOQA 4YZMA 3R04A 4IAKA 4QPAA 4G5PA 2IZTA 4FGBA 4DINA 1Z57A 3IW5A 3O7LB 3E88A 2X0OA 4IFGA 4JBOA 2VO6A 4XBRA 3GU5A 2BHEA 4EOLA 5H8BA 3AT4A 1CKJA 4LYNA 4B8MA 3DOGA 4RLLA 5LCKA 3Q6WA 2BILB 4K1BA 2VTPA 3ORTA 4FSNA 3DQWA 1UU9A 4O2ZA 2YCSA 4MYGA 5HI2A 3BHVA 2IW6A 4ZTLA 2YN8A 3PWDA 1PY5A 3KMMA 1A9UA 3V6SA 4BKZA 3SA0A 5FEQA 4UWCA 3UOJA 4FKJA 3BBTB 4JXFA 3UJGA 4JT3A 4NFMA 3PXQA 4YLLA 4AZTA 2ONLA 1GZ8A 3H9OA 3MIAA 3PRIA 5AIKA 3I4BA 4MX9A 3QYWA 4AXAA 1O6KA 3QQLA 3FZSA 3WZEA 2WMQA 2W1IA 1SZMA 2XK7A 3GOPA 5DGZA 2JKQA 2VTNA 3EQDA 4F9AA 2GSFA 3FQHA 5KZIA 2C1AA 4BWKA 5JK3A 2ITTA 4EHZA 5CXZA 5FGKA 2WAJA 5HCYA 3JPVA 1GZOA 4S2ZA 3O17A 3SRVA 3GCPA 1Q8UA 1W0XC 3LXPA 3ULZA 5IH5A 4CCBA 4PDOA 4QMUA 3L8VA 3DAJA 4X2NA 4XP2A 1U5QA 3LFNA 3N51A 5C27A 2VWXA 4PX6A 4YBKA 2QOFA 2W1ZA 3BLQA 4MD8E 4BB4A 3A7GA 4G3CA 2QU6A 3PY3A 3RJCA 2VD5A 3EB0A 4QP8A 4EH6A 3R7VA 4RIXB 5A3XA 1H1PA 4NEUA 4ITJA 3ROCA 4ANQA 2BDFA 3H9FA 2XF0A 2XBJA 3EFKA 3KK8A 4U40A 5E8WA 2HZ0A 1BUHA 2XEYA 3QXOA 5D12A 4V04A 2EU9A 4HGEA 4IX4A 4IM0A 4BDJA 3R9HA 3HMOA 3NGAA 4RX7A 3R8ZA 2YM3A 4XG6A 4FKWA 1KSWA 2W7XA 4CFFA 3GFWA 3L9LA 1G5SA 2H34A 4LQMA 5IA5A 4ZTMA 4O4CA 4NW6A 3BLHA 1RE8A 3OVVA 4HYIA 4QTDA 4JBVA 3PIZA 4GJ3A 2WELA 2CSNA 4K9YA 2XS0A 2R9SA 2UVYA 4BKYA 1UNGA 3GI3A 4GW8A 5EDPA 4ITIA 3QQHA 3AC2A 5CF4A 5LVLA 4E5BA 4APCA 3P0MA 3VJOA 5I9XA 3ANRA 3L8SA 2CKEA 3G6HA 3NYOA 4ASXA 5HU9A 2HCKA 1XBAA 2PMLX 4QTEA 5A4TA 4U81A 4I92A 3WZUA 1OMWA 1Q24A 3ZFMA 2I0EA 1M2RA 3EOCA 3OW3A 4F0IA 3VUMA 2CHLA 4O38A 2C6LA 4CFWA 3R9NA 3UYTA 2C1BA 4CT2A 2HELA 2R3HA 2YISA 4YJPA 4EH4A 1YHVA 3GP0A 2X7GA 1XH7A 1YDSE 3QQKA 4F65A 4JBQA 3KKVA 4D28A 3CC6A 1J1CA 4OBQA 3VS2A 4RWLA 3HLLA 4MF1A 3W8QA 4WO5A 3OY1A 4L3LA 3RTPA 2WMSA 3ZSIA 4AZEA 3NR9A 5CEIA 2YM8A 1Z5MA 4IVDA 3R1NA 3QRKA 1FGIA 1H25A 3D14A 3QALE 4FV1A 1T46A 3UG1A 2XYNA 1ZMVA 3WIKA 1IASA 3SD0A 3MSSA 4TYHB 4IAIA 2XK4A 3FV8A 1TQIA 2EXEA 1A06A 2ITWA 3UMWA 4KKHA 3D5VA 1OIUA 5EKNA 4W4YA 4TWPA 5JZNA 2IWIA 2GNIA 2PZ5A 3ENHA 1OPJA 5ETFA 4C4EA 5AP2A 5ETIA 4DYMA 1DI9A 3QC9A 4ZY5A 4USDA 2A2AA 4YP8A 4FIFA 2FYSA 3MYGA 4M69A 4C4IA 4JR3A 4NUSA 3C0GA 4U3YA 3UVQA 5J9ZA 4EQMA 4TYIA 5E1SA 5I9UA 3BYSA 3P79A 4BIEA 5L2SA 2ZMDA 4H58A 4LGHA 2W4JA 4I93A 3F66A 3O8UA 2FSLX 3A62A 3HVCA 4V05A 1ZZ2A 5LMBA 4FBXA 4PUZA 2XEZA 3I7CA 5IPJA 4UWYA 5FEEA 4AWIA 1Q5KA 2ZB1A 4UMRA 4O6EA 3LOKA 1HCLA 4L8MA 3C4WA 3TKUA 5AJQA 5CAPA 4IC8A 2OJ9A 3OY3A 4BDGA 1OECA 3R73A 2ITUA 5FBNC 4P7EA 4ERWA 3V8WA 4LI5A 3E8EA 1YWRA 3KRLA 2WTJA 3PPKA 3VBWA 4C38A 3EFWA 1SNUA 2C5OA 3AC4A 1K3AA 3VHKA 4E1ZA 4H1JA 5CZIA 3TUCA 2W1CA 3VULA 2WMUA 4O91A 4O21A 3W10A 5KKRB 4PNIA 4FOCA 1DM2A 4YTFA 4YTIA 2OZOA 2XNBA 3DK6A 2VTRA 4QNAA 5BVEA 4DEEA 2QR7A 5ITAA 3KVWA 4L68A 5M51A 4I5HA 2YHVA 3LLTA 5EYMA 3QCSA 4CKJA 5LXMA 2J2IB 1UKHA 1YXTA 5IA1A 1YW2A 2WXVA 4WBOA 2YIXA 4J95A 1R3CA 4PV0A 4AGUA 3DFCB 5M44A 4O2PA 3KQ7A 3F5GA 3P23A 3LFAA 4XNEA 2JAVA 4BRXA 5JFSA 4TYEA 5HGIA 3E64A 3SQQA 1B38A 5EDRA 4EKKA 3R1QA 4JBPA 4TZRA 5DLSA 5G6VA 5ANDA 4BCGA 4U42A 3VUGA 4C02A 3R7EA 1U5RA 1P4FA 2I6LA 4YJRA 3W32A 5LVPA 2OIQA 3S00A 2W0JA 4WKQA 5A6OA 1R39A 3UC4A 1K9AA 3QD4A 2R64A 3E8NA 2WOUA 1SVGA 2E9UA 2VTIA 3QA0A 3SOAA 5CF8A 4QP7A 3RPSA 4OTHA 4C59A 1H28A 3FPMA 4YZBA 3NUYA 4RPVA 1BL7A 3AG9A 2EB2A 2HYYA 4QMOA 2ITZA 3VRYA 5JSMA 4BDEA 2DS1A 5CALA 3D83A 4GYIA 4EOKA 1QPCA 4AZFA 1JBPE 5A4EA 1NVRA 3CXWA 2UZDA 5HVJA 4BFMA 3S95A 1ZY4A 1FMOE 3PYYA 3U6HA 3MIYA 4EBWA 2C4GA 1OIYA 1ZOEA 4JVGA 3ACJA 3TV6A 4J53A 4G9CA 2Z2WA 5LMKC 2FUMA 3QTXA 4FTQA 4LMUA 4XG9A 3WARA 4Z7HA 5CSHA 1H07A 4EWHA 2RGPA 1Q41A 4NWMA 2VN9A 4KNBA 3BE2A 3AC8A 4I0RA 4EOSA 4YJVA 3HNGA 4U97A 3UMXA 5EH0A 4E6DA 5L6PA 5LVNA 4IBMA 5BVKA 1U4DA 5AA8A 3IKAA 3N9XA 4PPCA 4QP1A 4NM0A 1T45A 5CT7A 3LIJA 4GS6A 3ZOSA 3ZYAA 1FMKA 3E87A 5HESA 5KMJA 3DJ6A 4G3FA 4FTMA 2VWWA 1XH4A 2IW8A 3ZFYA 4JDIA 5B2LA 1IA8A 1PXPA 2RFEA 3RPYA 4FZ6A 3RWQA 3ZXZA 5CSVA 2XJ1A 3REPA 2OJFE 4EH8A 3QU0A 4R1VA 4FIHA 2OFUA 4HVIA 5DG5A 1URWA 5J87A 3QWKA 4QMXA 2GTMA 3A4OX 1CKPA 4NIFB 3T3UA 3FXXA 4X7QA 3TACA 4EK4A 4F63A 4D0XA 3RI1A 1KE9A 4W8EA 3NRMA 4ZSAA 4XG2A 3KMWA 3MDYA 2JKOA 5IG1A 4Z3VA 3I60A 3CGFA 4FSRA 2NRUA 3W2CA 3FMJA 3NCZA 4MXCA 5K3YA 3SW4A 5K0XA 2QU5A 3PZHA 4YHJA 5HTIA 3DK3A 4H39A 3BX5A 3I5NA 5FP5A 4AAAA 4D9TA 2VTHA 3R01A 4M68A 4AFJA 3EQPA 5AM7A 2VUWA 3TUBA 4P90A 3SX9A 3VS5A 3FWQA 2WTVA 3VBYA 2RSVA 3UDBA 3BHTA 3QCXA 1TZDA 3D9VA 4RIWA 5FWKK 3WF8A 2Z60A 3AT2A 5C8KA 2ITNA 2UW6A 3CTJA 4O4DA 4AW1A 4MBJA 4RJ5A 3CLYA 2W9FB 3QHRA 4FR4A 4ZIMA 2WIHA 2RFSA 3AC3A 4YNOA 4ZTRA 5AEPA 2OJGA 4UMUA 5DFPA 1REJA 2HY81 1VR2A 3R8PA 3VQHA 4PP7A 4EORA 4FX3A 4PTGA 4IM3A 3LPBA 3MTFA 4UZDA 1BKXA 5IMXA 2OH4A 2GHLA 3BQCA 4IVAA 3R8UA 4MXYA 5K0KA 4UMPA 3HGKA 4PMTA 2BROA 4PL4A 3WYXA 2X7OA 1CTPE 2IJMA 4QMQA 4O0UA 4E20A 4EK5A 4C4HA 1H4LA 3BU5A 3O23A 5CVGA 2P4IA 1OI9A 4I6FA 3BGPA 4RLKA 1DS5A 3RM7A 2JDOA 4N0SA 3KL8A 3EN7A 5HG5A 2ZAZA 3LQ5A 5CEKA 3LFEA 1M14A 4IX3A 5HTBA 2X4FA 4PL5A 4FZAB 3ZHPC 4AN2A 1S9IA 1OVEA 4AW0A 3KXHA 3QZIA 2GCDA 1CDKA 3O71A 5D9HA 5ACKA 3OMVA 5K9IA 2BZHB 5TF9A 3D7TA 4J96A 4E3CA 4MKCA 3LJ1A 3ALOA 4NU1A 3OEFX 4JDHA 3KY2A 3UO6A 2O64A 3BLRA 1W2FA 2C6OA 4DH7A 5BVOA 5C8MA 4YO4A 1W83A 3C4XA 2GPHA 3QUEA 5DE2A 5DHJA 5AM6A 4E6QA 1Q8TA 4KIOA 3SKCA 4FV8A 3QD0A 3HRFA 4YO6A 4EYJA 3QYZA 4Y73A 3KEXA 3ZS5A 2WU6A 3NLBA 3VF9A 4OTWA 3OFMA 2O3PA 3ZEWA 3LFQA 4RJ7A 5JQ8A 5JMSA 3Q5ZA 2X39A 4X21A 2JC6A 3NWWA 5D41A 3THBA 3DPKA 2QOKA 2UZNA 3PRFA 4UYNA 3BYUA 3KMUA 4D5KA 5B7VA 1PKGA 3BGQA 3R8MA 2CGUA 2FGIA 4FUYA 3QZGA 5AWMA 3A60A 4C35A 5BUJA 1U54B 1YDRE 4JG6A 1KWPA 2WU7A 3PP1A 2JGZA 3BEGA 4CFUA 3LMGA 2CGVA 3GOKA 5A46A 1YHWA 3GUBA 3A99A 2I0VA 2X81A 2FSTX 4QQ5A 4E7WA 2VO0A 3B8RA 4QPMA 4D2RA 3AQVA 4D4SA 1Q3DA 3FSFA 4AP7A 1ZLTA 2GNJA 4FTJA 4RRVA 3DKFA 3DDQA 4KBAA 3Q9WA 3EFLA 4ZZNA 5ANEA 5AAEA 4ALWA 4XV1A 1PXIA 3FC2A 2UZBA 3FZPA 4D4VA 3G0FA 4RA5A 4L7SA 3UZPA 2EUFB 2PVNA 1YXUA 2X2LA 4MQ2A 1OITA 3SC1A 2BVAA 3DLZA 4GFOA 2PVYA 1V0PA 5KMLA 2BFYA 2C6IA 4M13A 1NVSA 4C3PA 1PMUA 2ITVA 5AR7A 2OBJA 3Q4ZA 3A7FA 2A19B 2NRYA 3Q6UA 3CKWA 4F6WA 3TKIA 1LEZA 3LFSA 3SDJA 4ANLA 2PVFA 4M69B 4GUEA 4FSUA 3FQEA 3DLSA 2SRCA 2B4SB 2HAKA 2PVMA 4IFCA 2JBPA 3U51A 2ZV9A 1UU7A 2OGVA 2QOCA 3PUPA 4FV3A 4EL9A 1Q99A 3LXKA 3MB6A 4IH8A 4BCPA 4QPSA 5A4LA 3BU6A 5FRIA 3QWJA 4BI1A 3F6XA 4ASDA 2YAKA 5HBJA 3FMDA 2XA4A 4EZ5A 4FSZA 3WI6A 4BI0A 5CAOA