3V04A

Discovery of novel allosteric mek inhibitors possessing classical and non-classical bidentate ser212 interactions.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
322
structure length
289
Chain Sequence
b'MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Discovery of Novel Allosteric Mitogen-Activated Protein Kinase Kinase (MEK) 1,2 Inhibitors Possessing Bidentate Ser212 Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 81
structure length 289
sequence length 322
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3v04A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3v04A01
2I6LA 2PMIA 3WZUA 1WCCA 4EYJA 3U6JA 4FK6A 4LMNA 3RPRA 2W4KA 3QFVA 3Q2MA 2ZOQA 4FV5A 4C2VA 4C02A 3ZZEA 4O0VA 3JXWA 3VUIA 3F9NA 4O81A 4FIJA 2W1HA 4O7RA 3CP9A 4W8EA 5HGIA 3QHRA 4ZP5A 2OKRA 2PPQA 2PVFA 5LJJA 4FTRA 2QNJA 4HVDA 2G2IA 2EVAA 1PW2A 2XK8A 5AAGA 1Q97A 3MIAA 5G1XA 3RINA 5EHOA 2KTYA 5DN3A 2ESMA 3PY0A 3HNGA 1Y91A 2ITYA 4RGJA 5EW9A 1OPKA 3HP5A 2BAJA 5HVKA 3ZHPC 1B38A 4WNMA 4C38A 2UZVA 2PE1A 4DHFA 4GJ3A 5F20A 2WIPA 1UWHA 4L6QA 2LAVA 4E4LA 1X8BA 2PVLA 2PVMA 3H0YA 4OTQA 4DEBA 3Q96A 3GQLA 4I4EA 3QA0A 3VC4A 4KBKA 3QTSA 2WHBA 4EZ3A 3VS1A 4G31A 5AV3A 5IA2A 2ERZE 4OR5A 1PKGA 4BCGA 1PXPA 5IA1A 3IS5A 4EOJA 4WOVA 1K9AA 4RWKA 4O96A 4WNPA 3DDPA 4FTMA 3QCYA 4CFXA 5EDPA 5JRQA 4OAUC 3RMFA 4CKJA 4RZWA 1KSWA 2PY3A 4G6OA 1UKIA 3I6UA 3SLSA 4AW5A 2Y8OA 4PNIA 2WIHA 4OGRA 2ITNA 3UDBA 4FKIA 3IK3A 3DFCB 2P4IA 2VTQA 2DQ7X 4G3FA 3WF6A 4TWOA 4XG3A 5E8WA 2ZB0A 3S95A 5IDPA 2I0VA 4AW1A 4YURA 4CFFA 1YHWA 4B0GA 1OIRA 3C5UA 2WMSA 4JBQA 4ORKA 4ZY6A 4U6RA 4FNWA 4JBVA 4EQCA 4DCEA 3A8WA 2WMBA 4KRDA 4MXZA 2IVUA 5IQGA 5E1SA 4CZTA 4IVAA 3BGQA 4MCVA 3W33A 1KE6A 1W8CA 2HOGA 4IACA 3B8QA 3PZEA 4EONA 2Q0NA 5C01A 4FEVA 3E92A 2VO6A 4CTCA 5KKRC 3R63A 5AIKA 1PMUA 5HE2A 1IA8A 3KK9A 2JAMA 5CAOA 4O7SA 2Y6OA 5EW3A 3EN7A 2DUVA 2GNJA 1WVWA 2Z7QA 2VTHA 3NNVA 4UYNA 4F1TA 1WVXA 4TKSA 3P4KA 3PG3A 4AXAA 5JFSA 4CFMA 5DPVA 4P7EA 3LZBA 3KRJA 4U40A 3QBNA 3RAIA 3R04A 2WMVA 3BHHA 3UYTA 2J9MA 5BUEA 4PDOA 5KUPA 5M06A 5TO8A 4FIIA 2DYLA 4NWMA 2GQGA 4C4HA 2UW7A 1BI8A 3BX5A 2RFNA 5HCYA 3D4QA 3DNDA 5CSPA 3LW0A 4JDJA 2R3IA 4DINA 4U42A 1BI7A 4F09A 5A4EA 5CU0A 3GT8A 5E1EA 4DGGA 1LUFA 3LXPA 2XK7A 4E5WA 3LCTA 3N4VA 5HBJA 4F7LA 3WF8A 2XH5A 5JRSA 4AZFA 4HNFA 3OOMA 4BR3A 2XEZA 3HV4A 4BCKA 3EN4A 5EG3A 1ZYSA 4YJNA 3IG7A 4F0GA 3PY3A 4UMUA 5IQCA 4G3GA 3WIGA 1PKDA 3FQSA 4I23A 4DC2A 2YM7A 5BVOA 4FUYA 5IG1A 3FYJX 4JT3A 4MQ1A 3ODYX 2WTCA 2W1CA 2EUFB 2CKOA 4U5JA 3MVLA 2EXMA 4AS0A 3QRJA 1IASA 4TZRA 4WUNA 4U80A 3ZMMA 3RK9A 4B4LA 4ZSAA 3AC2A 4KBAA 4XMOA 2R5TA 4WNOA 4RX8A 4J7BA 4FIGA 4TXCA 3KCFA 1KV2A 4RIXA 5HG9A 5BVFA 1H0WA 1JQHA 3QTIA 4JS8A 4MWIA 4EOIA 3CD3A 3F66A 2XVDA 3DKGA 5M4FA 3WZKA 3P9JA 4UYAA 4ANSA 5FUTA 3NAYA 2O5KA 4GFMA 5K9IA 2YCFA 4A9SA 4P4CA 3IW5A 4GT3A 4YMJA 3KEXA 3I7CA 1FGIA 4HCVA 3OMVA 5JFXA 3BHTA 4I92A 2WMTA 2W05A 2BTSA 4FSTA 3SXRA 4QT1A 5JGAA 2C5OA 4LV5A 1Q8TA 3FXZA 4BDJA 1ZZ2A 4FNZA 3EQFA 3H3CA 4PP9A 4RWJA 4AOIA 5CANA 4R7BA 2JLDA 4USDA 2ZMCA 4EH2A 4EK6A 1HCKA 5LWNA 3GFWA 4CMUA 3H10A 4RFZA 1XH9A 5AM7A 5AP0A 4GVJA 3FLZA 2XNPA 3DJ7A 2X2KA 3QCQA 3NW5A 2WU7A 4L7SA 4QP4A 3WILA 5HIEA 4X21A 5HI2A 5B2LA 2J51A 4BIDA 4F7SA 1ZLTA 4OTPA 3FI2A 4EUUA 1OBGA 4X2KA 2R3FA 4I5HA 3P86A 2GMXA 1IRKA 3PXZA 3EN5A 3SXSA 1OIQA 4LG4A 4DTKA 1RW8A 3FWQA 4CKIA 5CALA 5JH6A 3CC6A 5E7RA 1CTPE 5DT0A 1U5RA 4MD8E 3RPYA 3VUGA 4G17A 2B9IA 2X2LA 3GOPA 4Q5EA 4FT7A 4XG6A 2OFUA 3WI6A 3WYXA 2OSCA 2V55A 3UC4A 4LOQA 2Y4IC 4JL9A 1Z57A 3KN5A 3ORNA 5K5XA 3MSSA 3MH1A 2QOIA 3BIZA 4HYIA 4K8AA 3ZSIA 2WOUA 5AX9A 4BI2A 1YQJA 3QD0A 2XNEA 5BPYA 2UVYA 4QMZA 2QOHA 5HESA 3G5DA 4J52A 4XLVA 3EZRA 4DBXA 3ZEWA 4CCUA 3LHJA 5ANGA 2BUJA 4BDDA 5B2MA 4XG2A 1SZMA 2CN8A 3D9VA 5CF6A 5K5NA 2OXYA 4PY1A 3LM5A 5AEPA 2GDOA 5M44A 3TDVA 2O8YA 4R78A 2BRHA 4UMTA 2CNQA 1U46A 3N4UA 1UNLA 2UW8A 3B2WA 2OF4A 2XS0A 1ATPE 5ETFA 4C3RA 4CSVA 2P3GX 5L6WL 3CQEA 2YM8A 4P2KA 2XNGA 4M7IA 2OJ9A 4AFJA 2VTRA 3NEWA 4OUCA 1SYKA 5EKNA 1OUYA 2JBOA 3AD6A 4I6HA 4S32A 3ZRMA 3S3IA 4XOZA 5AP4A 2VX3A 2W9FB 2WZJA 4KIKA 3CSVA 3AC1A 4XP2A 1FMOE 1JLUE 2C69A 2BR1A 3EKKA 3QX2A 4NW6A 3FQHA 3VUKA 1PYXA 3T9IA 5I9XA 4AUAA 2CCHA 4FVQA 4R7HA 4BFMA 4C37A 3PPJA 4FVRA 1P5EA 4UY9A 3ZUUA 5KNJA 3PVWA 2YM5A 3U4WA 4F9AA 2YCQA 4CXAA 4EOOA 3QD3A 2R3LA 5ACBC 3ZDIA 4U7ZA 3T3UA 5KBRA 5KMMA 4QMPA 2XEYA 3ZXZA 4CNHA 3SV0A 2NNWB 3FAAA 3GP0A 5LQFA 3OD6X 2XJ1A 3M1SA 4RVLA 2BIKB 1ZMVA 4PWNA 3LLAA 4QP1A 3FZRA 3DTCA 4PMSA 3VS6A 4A9UA 3KF7A 1JOWB 2BIYA 2PVRA 5HX8A 2VN9A 3C7QA 1GNGA 3EN9A 3CD8A 2C3KA 3FZSA 4BDBA 4BHZA 2CLXA 3R9DA 2O63A 4E5BA 1URWA 4F64A 3F2AA 3F7WA 2UZOA 3UIBA 3ZXTA 4QMQA 5IQFA 4HPTE 4FUXA 5CASA 3DY7A 3ZEPA 2EXEA 2X2MA 2XZSA 5AP3A 3PG1A 3B8RA 2VWBA 2O2UA 5DRBA 4EHGA 1QMZA 4UBAA 3S1HA 4YZDA 1IA9A 5L2WA 5J1WA 5KE0A 3FLQA 3TV4A 4DF3A 4IFCA 5DNRA 4Y5QA 1H27A 5JGDA 2PHKA 5L6PA 2PYWA 4BL1A 4BWXA 3GC7A 4PMTA 3PRIA 4II5A 4IWDA 1BYGA 3BHYA 3E8DA 2GS7A 2EXCX 2UZDA 5CNNA 5FEQA 3U51A 1WBTA 4MXXA 5HO6A 4H05A 4NU1A 1VR2A 3QQFA 1K2PA 3PSDA 4YTHA 2ZM3A 4FTIA 3KF4A 1STCE 4ZZOA 5BQ0A 3WF9A 4J95A 2GHLA 4IM0A 3R1QA 5J9LA 4ZXTA 2XM8A 5EM6A 4EZ5A 3ZH8A 3ENHA 3LFEA 5DR6A 1NXKA 2F7ZE 3OCSA 1XHAA 4HPUE 1BLXA 5LMKA 3A99A 2FH9A 3I79A 5HBEA 3BLRA 4GU6A 4IWPA 4CRSA 2OICA 5DMZA 4KIKB 4KS8A 3MH3A 3R1SA 4O0WA 4AP7A 1YI3A 3C4EA 3SAYA 3R21A 4S31A 4CV8A 1QPDA 4FMQA 2OIBA 4FV6A 3GENA 1Y6BA 5TT7A 5K4IA 1H24A 2J7TA 4MXYA 3UVRA 4AZSA 5IA0A 2YM4A 3CBLA 3F3TA 2WMUA 5ANJA 2YACA 3JYAA 3MY1A 1UWJA 2Z7RA 2VWIA 5AA8A 4YC3A 5GZAA 2ITWA 2BHHA 2QU6A 1GIJA 4TYEA 4X3FC 3SRVB 3T3VA 4RIWA 3UBDA 4ALVA 5K4JA 3AD5A 3TUDA 3V5QA 1YWNA 3Q4ZA 4QQCA 3Q4TA 3KXMA 3QLGA 5AMNA 3FC1X 2XMYA 1YRPA 2X4FA 4BTKA 3W10A 2BDFA 3A61A 4E8AA 5L2SA 2WTDA 4X6RA 3MH2A 4A9RA 3Q4UA 5JZJA 2QLQA 3MGYA 3EQPA 4YJQA 2XBAA 4RJ6A 5BYZA 1PXMA 5HE1A 3NWWA 4NIFA 1YXVA 4TTHB 3SC1A 3DFAA 2C47A 4MNFA 3AXWA 1GOLA 4BCJA 4GK3A 1YWRA 4LGDA 5JFWA 4D28A 3HMMA 1WZYA 3ZO3A 3HDNA 5HQ0A 4WG4A 2W06A 3TTIA 4K33A 1YI4A 2UW5A 3CY2A 3OWPA 2QCSA 3RPVA 4F6UA 4TYHA 4BTFA 4U81A 3FLWA 3FMHA 3EFJA 1M17A 4JRNA 4QP9A 4FYOA 2BFYA 2NP8A 3NUPA 3ZCLA 4O7VA 2EB3A 3FI8A 4HCTA 4Y83A 5AR3A 4ENXA 3LM0A 1OL5A 2ITUA 2YA9A 3LFNA 3SKCA 1XBAA 4FSNA 4YR8A 4DT8A 3MY0A 4YBKA 5DR9A 4ZLZA 5LWMA 2C5NA 4FI1A 5JT2A 5HD7A 1H8FA 4W4VA 1K3AA 3MTLA 4U9AA 1JKKA 3VRZA 5DGZA 4D2RA 3LXLA 2PVKA 2PVHA 5HX6A 4YP8A 1OECA 1ZARA 4NZWB 4XUFA 2GFCA 4UWBA 5FP5A 3TM0A 1REKA 4AN3A 3VS0A 4LRMA 3Q9ZA 3FLSA 4U97A 3VW8A 4AT4A 5AAEA 3OC1A 3BYSA 2PL0A 2QOQA 3BBWA 1ZAOA 4XG4A 4O84A 1OKVA 4I6BA 4QNAA 5A54A 4DEIA 1O6LA 4D5KA 5A4QA 3PZHA 3QL8A 2YLEA 4D4VA 1GZKA 2PZPA 3JPVA 5HTBA 5CTPA 5IH4A 2JIIA 3VS2A 2FSLX 4AA4A 4X7QA 4G9RA 3QGYA 3TNQB 3FUPA 2UVZA 4IANA 4WT6A 3UIMA 2QG7A 4CG9A 1OUKA 5FM2A 4EH4A 4BKZA 4AF3A 5HNBA 3MPTA 4ALWA 4D5HA 2VRXA 3FMNA 4XLIA 4DG2E 2CGUA 5FTGA 1KUTA 4ANOA 1F3MC 5CSHA 3O8TA 3IGGA 4RIWB 2VNYA 3DA6A 3VF8A 5HE3A 4XV1A 2XKCA 1QPEA 1ZOGA 2XNBA 2I40A 2ZMDA 2RFEA 1HOWA 3QGWA 4QP3A 2V5QA 4M0ZA 2QU5A 3BPRA 2XB7A 4Q5HA 4WKQA 2HWOA 2XF0A 5HCZA 5KX8A 5CSWA 3HMNA 2VX1A 4YJRA 2VO0A 3JY0A 3UQCA 1SVHA 4H1MA 2QVSE 4GMYA 4MAOA 5KCVA 4NIFB 1L3RE 5HIBA 4DG3E 2PVJA 5IEXA 2V7OA 4Y85A 3MFSA 3T8OA 3UO4A 3FPQA 4PMPA 3PE2A 4MBIA 3R2YA 3A4OX 1IG1A 4G5JA 5E91A 3AG9A 3R71A 3OBJA 4FYNA 4EQUA 4FK3A 5KMLA 3C5IA 4FOCA 5AP6A 3S2PA 2JFMA 5FLFA 3LE6A 4FODA 2WQMA 4FKOA 4NM0A 4TYHB 3WZEA 4FZAB 4WG3A 3QRUA 3EB0A 3HMPA 2WPAA 3R6XA 4ZMFA 4DGLC 1JSVA 3QUPA 4FIEA 4H3BA 3WE8A 4BZNA 5CF4A 5FGKA 4WHZA 3L8XA 2ZYBA 4JOAA 5CVHA 1WMKA 1UU8A 3C13A 4DFUA 1M2RA 4GUEA 1YDTE 4OBOA 3AC3A 4D9TA 3KRXA 1YWVA 2UW4A 4IVBA 2OXDA 3MV5A 3JR1A 2HYYA 4DEDA 2WOTA 3MB7A 2IG7A 5EQYA 4DFNA 3OROA 2Y9QA 2Z8CA 3HZTA 4F7NA 4FSUA 5JZNA 1UV5A 3D2KA 3ZLSA 4M69B 4EOMA 2JAVA 4KSQA 3S0OA 4JNWA 3P79A 3UP2A 3F82A 4KS7A 3EQRA 3QKKA 4NM7A 2R3JA 3NSZA 4FT3A 3EQBA 3ORPA 4FV1A 4NJ3A 2OGVA 3EFWA 2OIDA 3OY1A 3DV3A 4DCAA 3DKFA 2ETMA 3KVXA 5AV2A 3ZM9A 5J1VA 3UVQA 4AGWA 3D7TB 4WSQA 5E4HA 3EOCA 5JSMA 3TNIA 4PDYA 4F9CA 3OEFX 3R00A 2A2AA 4H3QA 4M97A 4L45A 4YZ9A 4WNKA 1I44A 1SMHA 1FGKA 3I1AA 3W2CA 1JWHA 3BU5A 1DI8A 2XNMA 2UVXA 4FT9A 4FV3A 4MBLA 2DWBA 3NVMB 3PXYA 2R4BA 3P23A 3TKUA 5DRDA 3G0EA 1WBVA 4ZAUA 3OVVA 4U79A 2R7IA 3ZTXA 3O51A 4ZZNA 4TRLA 3HECA 2A27A 2XM9A 3PXFA 5T3QA 4KIPA 2XYNA 5DT3A 3FDNA 4YC8A 3OY3A 4M14A 4BDEA 4BCIA 4O82A 3EQGA 5LVPA 3V5PA 3EQIA 5ACKA 3HYHA 5CAQA 1OL2A 4DEHA 2FA2A 4M84A 1MQ4A 3EYHA 4QMYA 3Q9WA 3CY3A 2UZLA 4FTCA 4CRLA 4AE6A 5M4CA 3BEAA 5AJQA 3ZSHA 3COHA 5EOLA 3ZLYA 2R0IA 3DNEA 3IKAA 1PXKA 3WF5A 4BDFA 3C51A 2X6DA 3F7ZA 3UO6A 3GC0A 3F5XA 3FV8A 3VHKA 3TZ9A 3LQ8A 3HA8A 4EEVA 4HVIA 1P2AA 1IAHA 2I0EA 3O71A 4J53A 2QO9A 4BVUA 1E1XA 3CS9A 3VBTA 4O6EA 2FO0A 4LL5A 3ZC5A 2ETRA 4BB4A 3V6SA 5DVRA 3TV6A 4LI5A 5HD4A 3UODA 3R01A 2C0IA 4PTGA 3UMWA 3NVKI 4XS2A 4DA5A 3KQ7A 1G3NA 3G0FA 4TY1A 3E87A 5HCXA 4D9UA 5LVOA 2BTRA 2BKZA 2YIYA 2YITA 2Z2WA 2XRWA 3MVJA 4NK9A 4O21A 4BGHA 5IF1A 3DXPA 4MVFA 4RVMA 2RGPA 4KINA 2QD9A 3PA3A 1VJYA 2OFVA 3FKNA 1SVEA 3AMBA 5JKGA 1V1KA 3BGPA 4E4NA 3IGOA 3OWJA 1P4FA 4HZRA 2WQEA 2W96B 3W2PA 4AZVA 4L01A 4OTIA 4QPSA 3ANRA 3VAPA 5M07A 4FVPA 2XIKA 3KL8A 5AUYA 2HENA 5ANKA 5AR7A 4OT6A 2WTKB 4BYJA 4PP7A 4D4RA 5BYLA 1YXXA 3PIYA 4NFNA 3EKNA 4L43A 1R39A 4KIQA 4BDKA 5E90A 1W82A 1YI6A 4FV9A 4IZ5A 3D15A 2J2IB 4ZY5A 4C36A 4USFA 2WB8A 3DT1A 4QTDA 2YM3A 3AC8A 4MD9E 3KXZA 4C62A 5HG7A 4F4PA 3NNWA 4YHJA 5BVEA 3HAVA 4DTAA 1OBDA 3Q5IA 3C0GA 3OCTA 3SOAA 2R3QA 2V0DA 3ANQA 4AE9A 4YHTA 1TKIA 3KCKA 5I5ZA 5ICPA 3PIXA 4FICA 4RC4A 2IN6A 5E92A 3OT3A 5FBOA 5IMXA 2OF2A 1ZRZA 2P0CA 3CKXA 1U59A 5GIPE 4EOQA 3NMUF 4B6LA 5D41A 2XCHA 3MFTA 4IEBA 5I9WA 4IXPA 5CEOA 1YDRE 5KHXA 1OM1A 4NFMA 4HCUA 2X4ZA 4I6QA 4FR4A 4EH5A 3TZMA 4IWQA 5CEQA 4QOXA 2RG6A 4GVAA 3BV3A 3RHKA 3PE1A 3HDMA 4GG5A 4HJOA 3RKBA 3R9NA 2YIWA 5IQDA 4RX7A 1HCLA 4CV9A 1KOAA 4DH7A 4UZHA 1V0PA 1YDSE 3F3WA 5FTOA 4CD0A 4P90A 4N70A 4YO6A 3TUBA 4TPTA 3ZFMA 4GK4A 1MRYA 5GZ9A 3V51A 5ITAA 4R5YA 3ACJA 1J91A 4IFGA 4X2NA 3G2FA 1IEPA 5AP7A 3RCDA 3AD4A 5L8KA 3FMKA 2XJ0A 3BGZA 1Q61A 3P0MA 3OP5A 3PFQA 4TYJA 4E7WA 1BX6A 2IZUA 2VWXA 4MEDA 5GNKA 4BCMA 4BWKA 1FQ1B 4KWPA 5K3YA 4NKAA 3BWFA 2X1NA 4IZ7A 4ZS4A 4IM2A 3E3BX 5BYYA 3U4UA 2C6EA 3VULA 3AOXA 3CJFA 4AZEA 2BDJA 2Y7JA 5J95A 1ZZLA 1LEZA 3KK8A 3ORIA 2P33A 2XK4A 5EDRA 3PPKA 3LJ0A 5CF8A 3AMAA 5H8EA 5EOBA 5FM3A 3TT0A 2YZLA 1JSTA 3LMHA 4RPVA 3VHEA 3CR0A 5CS6A 2A4LA 3UP7A 2B55A 3FKLA 5CU2A 2PE0A 2FVDA 3A7GA 4LGGA 2C68A 3AQVA 4R77A 2CMWA 3R7YA 2E2BA 4ARKA 4C58A 2CSNA 5EW8A 3SVVA 3U87A 4F1OA 2VTOA 2VV9A 4K6ZA 2JKKA 3UIXA 2OG8A 3KULA 4F7JA 1IAJA 1TQIA 2CGXA 1Q4LA 4ITIA 2J5FA 5KMKA 3BYUA 4L44A 3CPCA 4NTSA 5L8JA 4ZTNA 3CLYA 4FTTA 4WUAA 4DG0E 2W99B 5HVYA 5DE2A 5ANEA 5CVGA 1R1WA 2QURA 4NCTA 3FYKX 4YC6A 3A4PA 1WBSA 1IR3A 4TL0A 4R3RA 4DFXE 1U54A 1JKLA 3IDBA 2WTWA 3NR9A 4BWPA 4F1MA 5C8KA 2C6DA 1F5QA 3GU5A 5HORA 3WF7A 3MVMA 1M2PA 4P5QA 5HBHA 3TNWA 4ANNA 3W55A 4I0RA 4IAFA 3UG2A 3F2NA 3COMA 5D11A 3W2QA 3QC4A 4IAZA 5C8MA 5B2KA 3OWLA 2HY0A 1L8TA 2CKEA 1ZYDA 3RAWA 1J3HA 2F9GA 3E63A 3ALOA 3O17A 1DS5A 3RI1A 4CFUA 4EORA 3DB8A 3VJNA 2VTPA 3LQ3A 3UMXA 2BVAA 2RKUA 3F69A 4AOJA 4A4XA 5AAFA 2GQRA 4IB5A 5CXHA 5LXMA 3NCZA 2W5HA 2AYPA 3R83A 4NM5A 2BCJA 4E6QA 4JAJA 1Q5KA 1WAKA 4FTLA 1UKHA 2X7FA 1Q8YA 3QYWA 3ZFYA 4PX6A 3P78A 4JX7A 1JKSA 2QOKA 4MXOA 3VIDA 1OL6A 4CZYB 5K0KA 1J7LA 1W7HA 4G16A 1OKWA 4CT2A 4PL4A 2RFSA 3NYNA 3NUXA 4Y46A 4ZJJA 4D2PA 3U54A 1J1CA 2HZ4A 2WQOA 3Q52A 3QTXA 2R3MA 4OAVB 5EQEA 4MQ2A 4H36A 4O27B 4B7TA 5KHWA 4U3ZA 4L9IA 4M67A 5AR2A 2PWLA 1CKPA 5FXRA 2R3GA 5H8GA 3MN3A 3M11A 3ITZA 4BICA 4X3JA 2QOOA 2W7XA 3VBYA 3VS5A 3FXWA 3KULB 4I24A 4E1ZA 2UZBA 5CEPA 4FTKA 3QUDA 2QR7A 2F7EE 4YO4A 4YZNA 4YNEA 3VUDA 1YHSA 3KFAA 3MPAA 4RJ8A 3RM7A 3FC2A 3QRIA 3QRKA 3QU0A 4A9TA 1AGWA 3BQRA 2JFLA 2E9OA 3GQIA 3V04A 5I3OA 5HNIX 4BBEA 2OH0E 3FE3A 1Q8UA 4Z7HA 3DK3A 2Y6MA 1A9UA 4AZWA 4BIEA 5C9CA 2PVNA 4D0WA 1H08A 3EQCA 1DI9A 1U54B 2XNNA 3QZIA 4PF4A 2XUUA 5ANDA 2VUWA 4O0RA 5EH0A 3I4BA 3BYOA 1ZOEA 4IBMA 4IVDA 2XRUA 2VAGA 3WARA 5HZNA 5AR5A 4D1ZA 4FSMA 2BZIB 2VWYA 3MFUA 5L3AA 2Q0BA 4G3EA 4M68A 4GV1A 4OTDA 5JQ5A 4YPDA 3FEGA 3DAEA 4IZYA 4NW5A 2VU3A 5GINE 5A6NA 3BYVA 2UZEA 4CYJA 1J7UA 3IDPA 2J0KA 3C4ZA 3KY2A 2VWZA 3OTUA 5L4QA 3TZ8A 5LMBA 2P55A 3IW6A 4I5PA 3AMYA 2P2HA 4FKGA 3O8PA 4YNOA 3UOJA 2OH4A 4PV0A 3TL8A 2YAKA 2X7OA 3U9CA 4YLKA 5D12A 1PMEA 4EOLA 3BU3A 3DLZA 3FZOA 2X9EA 1VEBA 1XH6A 2JITA 3QYZA 5TOZA 4E26A 5AFVA 1NT2A 2W1ZA 5F1ZA 2GS6A 2PTKA 4IQ6A 4EK5A 3Q6WA 5JEBA 4FA2A 3TACA 5I0BA 2P2IA 4D1SA 3POOA 1PXOA 2W9ZB 2O3PA 4GT5A 3MA6A 1R0EA 2B9JA 3KKVA 3OXTA 3ZYAA 3LFQA 1XQZA 4O2ZA 4DE4A 3ALNA 2WNTA 4RZVA 2PVYA 4XG7A 1OVEA 2Z7SA 5KMIA 4RC3A 5CNOA 3O50A 1J1BA 3NX8A 4O7LA 2R3OA 4GW8A 3SRVA 3EFKA 5LVMA 2O64A 3UOHA 2FB8A 4ZSLA 4C4IA 4E20A 2ETKA 5H9BA 4CQGA 5HTIA 4IW0A 3RHXA 4C57A 1OGUA 3Q9XA 3EJ1A 4PL5A 4C4JA 5L2QA 4UZDA 1KE8A 1V0BA 4L7FA 3F5UA 1FINA 3KMWA 3D94A 4FV0A 3OZ6A 4NSTA 3H0ZA 5DR2A 3TKHA 3QKMA 4C35A 4D4SA 5LVNA 2WGJA 1NVSA 3PA5A 3FMEA 3QC9A 5J7HA 4JVGA 2X7GA 4FSWA 3ZUVA 4Z3VA 5DBXA 3D5VA 3DU8A 3VW6A 5AP1A 2WMXA 4IADA 5CZIA 3QQHA 2C30A 3GCQA 5E8YA 3K3JA 4LL0A 4QQ5A 3EWHA 1GIIA 4ANBA 3GCUA 4B8LA 4IIRA 4JBPA 1MRUA 5AA9A 4C59A 3A62A 1Q99A 3EH9A 4RJ5A 2ITTA 5IU2A 1OL7A 1YKRA 4ASZA 3ERKA 2XBJA 3WYYA 4TYGA 3CTHA 3DAKA 4PTEA 5CAVA 4M8TA 1QL6A 2C5VA 2OXXA 2A1AB 3E8CA 1GJOA 3GBZA 4FGBA 3I81A 3R8MA 2E9VA 3GI3A 4YZBA 3HRCA 3TIYA 4FNYA 5A4CA 4ZIMA 4XG9A 4ERWA 4IC7A 1GZOA 5HVJA 3KA0A 3FI3A 3D0EA 3GCSA 4D55A 5M4UA 2WEIA 1H01A 1WVYA 2JEDA 3IOKA 3MFRA 3P7BA 4LUEA 5DIAA 3HAMA 4AX8A 2JC6A 5M09A 4N6YA 2HZIA 1H1SA 2SRCA 3ELJA 3ETAA 1LP4A 5HEZA 4MD7E 4KIOA 3QKLA 3V01A 5J5TA 4UALA 4BCHA 1NY3A 2G9XA 4NTTA 1G8AA 4LMUA 4AA0A 3OW3A 5I4NA 4WIHA 3H9OA 5CI6A 3F5GA 5BX0A 2VTTA 1CKIA 3PJ3A 4BCPA 4BYIA 2W4JA 1A06A 1PRYA 2VD5A 2JDSA 4HNIA 4FG9A 1MQBA 3LCSA 1H26A 2ZV7A 3SG8A 2OI4X 4C4FA 3FBVA 3Q53A 2ZV2A 4D2TA 3RK7A 2E9NA 3HV7A 4TWCA 1O9UA 1UA2A 3TI1A 4ZOGA 1PHKA 3PWDA 3ZBXA 5LMKC 4WRSA 3OOGA 3ACKA 5A6OA 4RLLA 4IAIA 4CLJA 2PUPA 2GCDA 2CDZA 4FGRA 3SGCA 1YOLA 4JG8A 5AX3A 4EQMA 2FGIA 4MWHA 4YJUA 3W1FA 4ALUA 4JR3A 5HKMA 2BRGA 3LJ2A 3NS9A 3FHRA 3S00A 4TWNA 1B39A 3VBXA 2OZAB 3R9HA 1FMKA 3QXOA 4S2ZA 3NZ0A 4BI0A 2W1FA 4RLKA 1GAGA 4Y72A 5DOSA 3DK6A 2QKRA 5E8TA 2VTNA 4O7ZA 3GXLA 1ZMUA 4J1RA 4L46A 3TUCA 2ZVAA 5IQAA 3P7CA 4LOPA 4BDCA 5J7BA 3TXOA 4UN0C 4EZ7A 2V62A 3PSCA 1U4DA 3BI6A 3PXKA 3DQWA 3OXIA 4LYNA 3TWJA 4U0IA 4AW0A 4D2SA 4E6AA 4HW7A 3Q9YA 4PPBA 4UXLA 3MB6A 3L1SA 3TKIA 4BBMA 4I6FA 3N9XA 4ACHA 4W4XA 3VS3A 4KNBA 5AR4A 2Z02A 3G9LX 2ITOA 1ND4A 4MBJA 5AADA 3LCKA 4NKSA 1FVVA 4WSYA 3QCSA 1XH7A 2PZRA 4FTUA 4O0YA 2XIRA 4OBQA 5CZHA 5EDQA 2C5XA 2J90A 3HEGA 1XH4A 4FKWA 3R8PA 4YHFA 4BDGA 2BZKB 4EHVA 4FTAA 4PRJA 2C0OA 4IX6A 4IDTA 1A48A 5I9UA 1JPAA 2BPMA 5EYDA 4Y95A 4ONAA 4BCQA 3Q6UA 2F57A 1FOTA 3D14A 4O6LA 5C03A 1RQQA 4FV7A 3DLSA 3CTJA 4G1WA 1G5SA 3LVPA 4TT7A 1DM2A 1I09A 3NUSA 1OPLA 5L2TA 2F4JA 2RG5A 2WEVA 4FL2A 5M53A 1RJBA 2ITZA 4M69A 2AUHA 3LFSA 4UMRA 1M7NA 4B99A 2XKFA 1FPUA 4IDVA 3TV7A 4OTHA 4YTFA 5AUUA 3KMMA 5JQ8A 2GHMA 4G5PA 4IJPA 1YOMA 5HU3A 5ETIA 3GNIB 3ROYA 1V0OA 5CXZA 3HX4A 2VNWA 4WD5A 3D7TA 4RT7A 3ZONA 4ZLYA 5DG5A 1QPCA 3VUMA 3JVSA 4BGGA 4TW9A 2JIUA 3RGFA 1G8SA 2WMRA 3H9FA 5DA3A 2X81A 4EK8A 5IQEA 3C4CA 4ZTSA 3VBVA 4EL9A 2JDTA 3OW4A 4QO9A 5CWZA 3IW8A 4I21A 4QTBA 3R73A 4A4OA 1NVRA 4XV3A 2J0IA 4AOTA 2OU7A 3NUAA 4R1YA 5M4IA 4BI1A 3L8VA 2WQBA 3F61A 3OTVA 4EYMA 3TNPC 4JG7A 1OKZA 3CE3A 4ZTMA 3KB7A 4X3FB 3MESA 2IZRA 3NUNA 2B54A 3MWUA 3ULZA 1KWPA 3NNUA 2ITPA 2OJGA 2YZAA 4O22A 3VRYA 3S4QA 1QPJA 1UVRA 4AWIA 2FUMA 1TQMA 4CTBA 2ZAZA 4IVCA 4MK0A 4RVTA 4QP7A 3V8TA 5DEYA 4XJ0A 4G6NA 1ZY5A 4FKPA 4QYFA 5GIOE 5FRIA 3QALE 5IUIA 4OLIA 1OPJA 2Y4PA 4EJ7A 5CU6A 3G9NA 2IW8A 2C5YA 4EOSA 3D5XA 4UMQA 3OG7A 2IJMA 4HGEA 3ATSA 3UOKA 2FSMX 5CT7A 2QOLA 5C8NA 4IH8A 3PA4A 5TR6A 2QOFA 5EYKA 5F9EA 2H96A 5GHVA 3W2RA 3CXWA 5JK3A 3OCGA 2JKMA 4GU9A 1UNHA 4ID7A 4L68A 3Q32A 4GUBA 5M08A 5HLNA 4ACCA 4F6WA 3C4FA 1H07A 1ERKA 4ZY4A 4O2PA 4RQKA 2BZJA 3E7OA 5E8XA 4RFMA 1NW1A 2ACXA 3M2WA 3IQ7A 3I7BA 4HVGA 5C1QB 2Y0AA 1H1QA 4PMMA 2B1PA 2J0JA 2I7QA 3PP1A 4NH1A 1M2QA 5CEIA 1CKJA 3ZLWA 4Q9ZA 3PRFA 5M56A 2NO3A 2XA4A 4AFEA 2HELA 2C0TA 5KZIA 4WA9A 4RJ4A 5GJDA 3RAHA 4AZTA 3QF9A 1P14A 4ZK5A 4G9CA 2JBPA 2PULA 2WQNA 2PMNX 5IA3A 3L9LA 4QPAA 4CT1A 2UW9A 3GB2A 3V8SA 4KD1A 3QTRA 4IB0A 1VZOA 2R3PA 3VBWA 5IEYA 2PUIA 4D0XA 4XYFA 4DEAA 2HCKA 4HOKA 5CAPA 2YHVA 4IC8A 1PYEA 2OK1A 2QLUA 2JGZA 5D1JA 3UQGA 3WZJA 3P08A 4F65A 1BL7A 2BRNA 1REJA 3OWKA 2RIOA 4IX5A 5FBNC 3RK5A 4CMOA 2OJIA 3UTOA 2QHNA 4CYIA 3H4JA 4P5ZA 2BKKA 3DOGA 3NYOA 4LRKA 3QQGA 2X9FA 4FKRA 4LGHA 1QCFA 5EKOA 4ZTQA 3EQDA 3ET7A 5F95A 5J8IA 4IWOA 1GZNA 3JUHA 1SVGA 4HYUA 4AACA 5KMNA 5IQIA 2C1AA 3HMOA 5KMJA 2WTKC 3F6XA 4GH2A 1R3CA 5HOAA 2IVTA 3EYGA 3BU6A 3PP0A 4F9BA 4Z16A 3V5LA 5JMSA 4S30A 2R0UA 4NUSA 4OTWA 4YTIA 4U41A 3K2LA 4R3CA 3V5WA 4BKJA 3KXNA 4O7NA 5FEEA 5AWMA 3RP9A 3R7OA 3OUKA 3QD4A 4RC2A 4G3CA 4J99A 2WAJA 3OBGA 5HE0A 1ZYCA 5IEVA 2YCSA 1PJKA 5J87A 3RAKA 4TYIA 2GNHA 3KXHA 4GG7A 4J8MA 1JSUA 4F70A 5HU9A 4LV8A 2AC3A 1YHVA 3QQJA 3BBTB 3OUNB 4FG7A 3MBLA 2YLFA 3FQEA 3VN9A 2W17A 3ORZA 5KZ0A 5DWRA 4UMPA 3HMIA 4XCUA 4ASEA 2W1DA 4FNXA 2LGCA 3C4XA 4FTQA 1R0PA 4ITHA 4M3QA 3PVBA 4O1PA 4ZLOA 3ORMA 5CT0A 4U3YA 4U8ZA 1UNGA 3ROCA 3ZU7A 4JIKA 5BVNA 3DBQA 5TE0A 3W32A 5EHYA 4M66A 4CFVA 3QZHA 4I3ZA 4G3DA 2GNLA 5KO1A 5ANOA 4ZTLA 3UJGA 5CSVA 5A14A 3QD2B 3QCXA 1URCA 4XNEA 5TF9A 4ASXA 3LPBA 1H1WA 5A3XA 5D7VA 4YSMA 4ANQA 4FKUA 3HVCA 4CLIA 3R2BA 3UPZA 4HGLA 3QTUA 3UG1A 1SNXA 4FEQA 4JI9A 2UZNA 3ZOSA 3Q2JA 1XR1A 2O0UA 2JDVA 3I60A 3MI9A 2ONLA 4TNBA 4UB7A 5DLSA 1Q8ZA 4C2WA 3CPBA 3PWYA 2FSTX 3THBA 4L3LA 1GZ8A 2EB2A 4AT3A 3O2MA 2E9UA 3NUUA 3OS3A 2BILB 4QTEA 3O8UA 1H28A 2B4SB 4RSSA 3O23A 3FZTA 3LCOA 3MTFA 4XBUA 4F0IA 2XIYA 2V7AA 3Q04A 4XP3A 3RM6A 5C26A 5AUZA 5K0XA 4N57A 3BELA 3SHEA 4BDAA 4J97A 4GKIA 1NVQA 3GU8A 4MTAA 1PXJA 4OW8A 2JDRA 3FZPA 3ORTA 4BKYA 5LCJA 4GCJA 2C6TA 5CQUA 2VGOA 4BRXA 3TNHA 4APCA 2GNFA 3UNZA 5IUGA 2CNUA 3P7AA 3SDJA 4C7TA 3SQQA 3WZDA 5CEMA 2CJMA 3AC4A 5E8VA 1XKKA 4J8NA 3RVGA 1H1RA 2C3IB 2J0LA 3A7HA 5HHWA 4K0YA 1GIHA 3K3IA 4UV0A 4XRLA 3PUPA 1O6YA 2CLQA 3RWQA 5A9UA 3BWJA 2ZV9A 4DEGA 2CNVA 3DZQA 2XIZA 2HIWA 3K54A 5C27A 4MXCA 4V05A 4D2VA 4G6LA 2X8DA 4O91A 5J9ZA 4RG0A 4XEYA 2HY81 3GU7A 2PU8A 4OBPA 4FEWA 2R3RA 4IZAA 5EK7A 4V0GA 1SNUA 4J71A 2OW3A 1JNKA 4WBBB 3FZ1A 4R1VA 1P4OA 4CFWA 2UW0A 2G15A 3NYXA 2YDIA 4JX3A 4CEGA 4GIHA 3ZBFA 2OZOA 3DKCA 4C3FA 2WTVA 3TG1A 4RQVA 5AUWA 5IA5A 4XP0A 4KSPA 3BZ3A 3VQUA 4O0UA 2WMQA 5HG8A 2F2CB 2PSQA 2XCKA 4BY9E 1XBCA 4DFYA 4N4SA 4E6CA 2WMAA 4USEA 2JDOA 3C9WA 2IWIA 2OO8X 3FKOA 1TQPA 1ZYJA 4W4YA 4IMYA 4B9DA 5BUJA 3WE4A 3UPXA 3AGMA 1S9IA 3SX9A 3U8WA 4BDIA 4F6SA 3SW7A 3NNXA 4JDIA 4O0SA 5CI7A 5CAUA 3PSBA 4FL1A 3CQWA 4FKLA 3UVPA 2JIVA 3VUTA 1Q62A 4XBRA 2IZTA 3A7FA 3TJDA 4QQJA 4XV2A 5HTCA 1KOBA 2BALA 3H9RA 2PMOX 4OTGA 1R78A 2WFYA 3TCPA 4BHNA 4RFYA 4FKSA 2B7AA 4JDKA 4XRJA 4K77A 4QYHA 4ASDA 1F0QA 2WMWA 3LLTA 4HYSA 5EI2A 4CGAA 3LJ1A 5D9HA 3RZBA 4QMVA 4RJ3A 3L8PA 4EH7A 3SW4A 4NL0A 4L42A 1ZYLA 4O38A 2HXLA 5FG8A 4OTFA 4H58A 2CGVA 2HW7A 3PJ2A 3QA8A 2JKOA 4KA3A 4MXAA 2C6MA 2I1MA 5EM8A 4EH6A 1LPUA 1Y8GA 2QC6A 4Z55A 3POZA 4JDHA 4MF0A 2W1EA 3ZC6A 2A0CX 3NDMA 4JQEA 2OBJA 1H4LA 3V8WA 1J7IA 4LFIA 3NUYA 1ZOHA 4R7IA 5EFQA 3UYSA 2GS2A 3A7IA 2ZM1A 4ACGA 1PXLA 4GT4A 4EKLA 2WO6A 3C0HA 3I5ZA 5GZ8A 2GPHA 3BQCA 5LOHA 2B9HA 3FMDA 2B0QA 3VF9A 5JFVA 2BHEA 4CVAA 3TZ7A 3EHAA 4NCTC 5IKWA 2YWVA 4OT5A 2F49A 4H1JA 3ZUTA 5D10A 4YJVA 3DAJA 3V6RA 4DFZE 2RL5A 4LM5A 5I3RA 3LKMA 3R9OA 1KV1A 4AT5A 3T9TA 5LVLA 4V0GB 5EYCA 4KBCA 4DAWA 2FYSA 3P1AA 3MJ1A 2YFXA 4QP6A 3ZDUA 1Q24A 5F4NA 2RF9A 4A07A 4DFBA 3DGKA 5FEDA 3LFDA 3R7EA 3FY2A 1YXUA 3MIYA 3EMGA 3RNYA 4FV8A 4RA5A 4EOKA 4A4LA 1TVOA 2GTNA 4M0YA 4PUZA 3OHTA 4L53A 4E4MA 3BRBA 2WTIA 2ZDTA 4YZCA 4W9XA 4QPMA 5CYIA 2B53A 2F7XE 5H8BA 1KE7A 3R22A 4Z7GA 3D83A 2REIA 5BVKA 3HRBA 3B2TA 4GS6A 2UZUE 1OIUA 2WKMA 4L3JA 2C1BA 4LRJA 2F2UA 2GU8A 3CJGA 4B8MA 5C4LA 4EJNA 3ZO1A 3KU2A 3GU6A 4BCNA 2GTMA 3K5VA 3TDWA 4EH3A 3ZO4A 3L9MA 3A8XA 4TWPA 3E5AA 3RPOA 3L9PA 4EWQA 4QRCA 3QUEA 2X0GA 4E3CA 3GC8A 2C3JA 3FMJA 3KXXA 4IAYA 3UGCA 3FMMA 3W8LA 4ACDA 2HK5A 5DH3A 1RDQE 1E9HA 1Q3WA 4JIAA 4XX9A 3IONA 4IB1A 5L8LA 2XK6A 4YU2A 2PUNA 3OT8A 3TIZA 3ZFXA 2ERKA 3CTQA 1PF8A 2HAKA 5KKRB 3SA0A 4AGCA 4E6DA 2ZB1A 2FSOX 3O7LB 2IW9A 2W4OA 3O96A 3PTGA 4JJRA 3TJCA 4EI4A 5IQBA 3ZO2A 4F9WA 5CVFA 2ITXA 4YTCA 4MHAA 4I5MA 3E62A 5IDNA 5M57A 3OF0A 3R7IA 3GVUA 3HA6A 3QZGA 2RFDA 3DZOA 3F5PA 3IW4A 1OI9A 4J98A 5DFPA 1OIYA 5FD2A 4DTBA 3ENMA 1WBOA 4O83A 3G90X 4UWYA 4WO5A 4DLIA 3F3VA 2OIQA 4XHKB 2R9SA 4DH3A 4O0XA 4I22A 3BHVA 2J0MB 2ZDUA 2WTJA 3FSFA 3VUHA 3PXRA 3C4WA 4DH1A 4KB8A 4I20A 4X6QC 3G6HA 2G1TA 3ZRLA 4C3PA 5KMOA 3DJ5A 4BN1A 4EC9A 4IX3A 3N51A 4CMTA 4G34A 4EOPA 4QTCA 5EI6A 4HGTA 4YUQA 2R3HA 2QG5A 2VWWA 3MDYA 1JAMA 2XP2A 3R7GA 3PDTA 2YABA 4YLLA 3DCVA 3EIDA 3BYMA 4F08A 3QTZA 1BUHA 2CN5A 2O65A 4QYGA 2GFSA 3REPA 5DI1A 4C0TA 1XH8A 2X8IA 3BE9A 3F3UA 2W0JA 1FVRA 3OFMA 4V01A 3W2SA 4FTJA 3AT4A 4Z9LA 3DPKA 4QQTA 2R2PA 3DTWA 1Q8WA 5HICA 4PDSA 1RE8A 3CKWA 3R8UA 2CKQA 3DB6A 4MNEA 2XYUA 1KE5A 2QO2A 3COIA 3I5NA 1OL1A 1CM8A 5CY3A 4QMNA 3DBCA 4RX5A 3U9NA 2A19B 5I9ZA 5HO8A 3UZTA 4GKHA 3PVGA 1M52A 3HGKA 4FSYA 4FV4A 4E73A 2IVVA 2CHLA 2IO6A 1W98A 2BZHB 3LMIA 5LMAA 5BMMA 3FSKA 5L2IA 2VTIA 2YDJA 3KN6A 2X8EA 1GY3A 3W18A 3KRWA 5AP5A 2GHGA 3PLSA 2VWVA 3PIZA 4AQCA 3NYVA 1H00A 3BV2A 4MKCA 3RNIA 4YSJA 4YLJA 4E93A 3E3PA 4RIXB 1W0XC 5BVWA 3NCGA 5LARA 2VZ6A 3Q3BA 4RJ7A 4F0FA 4BBFA 1WBWA 4M13A 2CPKE 3PYYA 4KUJA 2ITVA 1BL6A 1T46A 1DAWA 3O7LD 4M12A 4C4GA 3C0IA 3ULIA 1YOJA 3JY9A 4JRVA 4NEUA 2OZAA 3NW6A 3QTWA 5JN2A 3LXNA 4A9YA 4FT5A 4FX3A 3W2OA 1UU3A 1XBBA 4EC8A 3QHWA 4L8MA 5EM7A 1E1VA 5B0XA 3LAUA 5FXSA 5DHJA 2B52A 2PZYA 5CSXA 3U6IA 5AUXA 3RBWA 4FE2A 3CEKA 3PJCA 4ZZMA 4EK4A 3UZRA 3H30A 4O86A 4BCFA 3WOWA 4IJ9A 5AV4A 3E64A 3RALA 3VWAA 2PE2A 2QO7A 2R7BA 3D5WA 4DT9A 4F63A 3F3ZA 3D2IA 2UUEA 3L8SA 2PZ5A 4L3PA 4CG8A 4W4WA 2Y4IB 5GJFA 1PMNA 2VTJA 4U45A 4FZ6A 2QHMA 5G6VA 4QP2A 2QI8A 4GEOA 1Z9XA 1LEWA 2ZM4A 2R3KA 3V3VA 5A4TA 1CDKA 4IAAA 2CKPA 5DYJA 3FLNC 3KMUA 3NIZA 4RVKA 4C61A 5AR8A 1OKYA 3ORLA 3E8NA 1LR4A 4YZMA 4ERKA 3ZSGA 4TN6A 3RPSA 4ACMA 3LXKA 1ZMWA 2W5AA 4R3PA 1XH5A 1BMKA 2NRUA 2YEXA 4BDHA 3GU4A 3HRFA 3VS4A 4PPAA 3EZVA 4BTJA 5AUVA 5FWKK 3DBFA 3DXNA 4S33A 5KBQA 3N4TA 1PMVA 4IB3A 3R8VA 3ZS5A 3UQFA 3BLHA 2VWUA 2YIQA 3JVRA 4GYGA 1Y57A 2IW6A 3E93A 4RRVA 3RJCA 5EHLA 2XKEA 4MNEB 5AP2A 4N6ZA 3EL8A 3VVHA 2Q83A 3DBEA 3PLAE 1Q41A 4XG8A 1SM2A 2AC5A 3FL4A 2X6EA 2HZNA 4RIYA 2UV2A 4EKKA 2E9PA 5IPJA 3R7UA 4APPA 4QMSA 5DT4A 1ZY4A 4BGQA 2IZSA 3FXXA 2YN8A 5HLPA 4NJDA 3UNJA 5CEKA 4QD6A 3RTPA 4BIBA 3MY5A 2QODA 2OJFE 3QTQA 4H39A 5A4LA 2J6MA 2ZJWA 2CCIA 2OJJA 3KC3A 4IE9A 4JQ7A 3I0QA 4PTCA 1M7QA 4C34A 1PXNA 1NA7A 2UW3A 5C4KA 4U44A 1OZ1A 1OB3A 4DH5A 2PMLX 1Y6AA 4CQEA 3LFCA 4DN5A 4X3FA 3D5UA 4HZSA 4YJPA 5IH5A 2QONA 4JLCA 4V04A 1YXSA 2G01A 5IQHA 3A60A 2I0YA 3Q5ZA 4FZDB 4S34A 5IISA 2OLCA 3KGAA 3E8EA 2KULA 2VTLA 4QMTA 4BC6A 5LCKA 2QOBA 4DFLA 1O6KA 4QP8A 3NPCA 1OITA 4AG8A 5HO7A 3NGAA 4IHPA 1MUOA 4O7WA 5L6OA 4FV2A 5FQDC 4TNDA 3V5TA 2QR8A 4K18A 2J4ZA 2XNOA 3HP2A 3NLBA 4AGUA 3R0TA 1H0VA 2EU9A 4FSRA 1WBNA 1UU7A 3IOPA 4Q9SA 3SOCA 4JQ8A 4RWLA 4F99A 3V5JA 4QMWA 4EBVA 4C8BA 1APME 4W8DA 4NYEA 4KKEA 5EYMA 4MYGA 4BF2A 3G51A 2XKDA 5HLWA 4ZJIA 5CF5A 3QAME 4I1ZA 3ID6C 2DS1A 2YISA 4HGSA 2BRBA 4FSZA 3EQHA 3M42A 3QQUA 1WFCA 4RMZA 5J9YA 3GUBA 5EI8A 3HUCA 4L67A 4ZTRA 3HUBA 2HXQA 4FZFB 5CX9A 2IVSA 2PZIA 3QXPA 4NM3A 5CENA 3II5A 3MJ2A 5B7VA 4D2WA 3G15A 3TN8A 1CSNA 4R8QA 4AW2A 4FKTA 5IZFA 3ATTA 3KREA 3VJOA 1M14A 4FT0A 3DK7A 4O0TA 3TTJA 1B6CB 4PDPA 1WBPA 4N0SA 5JGBA 1JVPP 4ZSJA 2ITQA 5EM5A 4QMUA 3I0OA 1Y8YA 3BHUA 2X39A 3GOKA 4GRBA 4JR7A 4Q2AA 4QMOA 5DEWA 3W16A 1H1PA 4D58A 4F9YA 3IDCA 4RIYB 4K9YA 4I0TA 3ORKA 1OMWA 4EBWA 2GQSA 2C4GA 1W84A 3BE2A 4FZ7A 4G2FA 5T6KA 1FBNA 4BZDA 4RA4A 3VBQA 5ETAA 2BDWA 4K1BA 4AN9A 2XIXA 3BKBA 3MH0A 3ZM4A 2HW6A 2BMCA 3PY1A 4RX9A 3GGFA 1Z5MA 4AA5A 4EH9A 5CU4A 3QQLA 4K11A 3R7VA 3CIKA 3VO3A 4Y8DA 2GNIA 3AGLA 2CGWA 2GNGA 3HV5A 3RWPA 4DGNA 3G33A 5FTQA 2C6IA 4X2FA 4YJOA 4FKVA 4L52A 3U6HA 5E8UA 1VYWA 5E8ZA 5HG5A 4ZEGA 4ZMEA 4I41A 4IAKA 4I0SA 4O7YA 2B9FA 2JD5A 2BRMA 4MX9A 4ITJA 2C6LA 1ZWSA 4I93A 3UZPA 4QTAA 3BLQA 3CCNA 4KAOA 4DEEA 3R9RA 2NPQA 5M51A 2BROA 5FP6A 4PQNA 4X0MA 3CQUA 3LFFA 1JBPE 3MVHA 1XJDA 2EWAA 4LUDA 2BFXA 3E7VA 4FKQA 3C1XA 4CCBA 1PXIA 4O1OA 4D4YA 4W9WA 4GFGA 3HV3A 4Y5HA 2ZV8A 1VYZA 5HIDA 5AM6A 2XJ2A 3Q4CA 2YJRA 4I94A 5ETCA 4ANLA 4FEUA 2HWPA 2R64A 2YERA 4RIOA 3IO7A 3ZLXA 4JBOA 2GSFA 3CGOA 3DQXA 4AGDA 3AT3A 3MYGA 5D7AA 4UWCA 3GCVA 4EK3A 5A46A 3ZZWA 3E88A 4R6VA 3UOLA 3G6GA 3COKA 3LCDA 4FL3A 3UIUA 3MW1A 4GFOA 2C6OA 4LQMA 4BTMA 4FIHA 3L9NA 4PL3A 3D7ZA 3QWJA 2QOCA 5CQWA 2WD1A 4AN2A 4WG5A 4GSBA 3P5KA 4ZJVA 4KABA 3JS2A 3GC9A 3UO5A 3FHIA 4L00A 2BAQA 2VTMA 2YIRA 4QMLA 5IMEA 3IECA 4FF8A 4CFNA 4MF1A 4YJTA 4J96A 4HVSA 1XWSA 4JG6A 4NT4A 5CLPA 1EH4A 2YWPA 1MRVA 2NRYA 3AC5A 4YJSA 5IUHA 4DLJA 3QQKA 3Q60A 3GEQA 2YIXA 3PPZA 4QYYA 4IM3A 5CU3A 4UEUA 4ANMA 3DJ6A 4UX9A 4PPCA 2YJSA 3R1YA 2IPXA 5J79A 3LQ5A 2WU6A 2VO7A 3O0GA 2Z7LA 5FDPA 4GJ2A 4WBOA 3HL7A 5HNGA 3FMLA 3A7JA 2PUUA 4GL9A 3FLYA 2C3LA 4U43A 1JKTA 3DBDA 4BCOA 2H9VA 3LFBA 4C4EA 4FTOA 4HYHA 2G2HA 5H2UA 5TKDA 4FC0A 4Y73A 5FXQA 5IA4A 4O7TA 3QRTA 2BAKA 3R30A 4DBNA 3NW7A 4ZSEA 5I9VA 1YXTA 3F2RA 3QLFA 4FSQA 5EQPA 3R1NA 5GJGA 4PNKA 2RSVA 4CKRA 3HV6A 4QMXA 1BKXA 2R3NA 3MA3A 4QNYA 3U55A 4I4FA 2YDKA 2Z60A 3FPMA 4FIFA 4FOBA 3ORXA 5AV1A 5H3QA 4ZSGA 4GIIA 5T68A 1YW2A 2H6DA 1T45A 2W5BA 3A2CA 3SD0A 4QMMA 1XO2B 3BEGA 2XK3A 4YGAA 4JAIA 3NRMA 4RBLA 2J50A 2WXVA 4X2GA 2QQ7A 2V22A 5BUIA 1ZXEA 4AAAA 2YCRA 1UU9A 3DS6A 3PVUA 3LMGA 3OXZA 2J5EA 3DDQA 5FDXA 3FL5A 5AUTA 5BMSA 3LIJA 3R8LA 3EFLA 3AT2A 3PJ1A 3FJQE 3C50A 4ENYA 2YAAA 4EHZA 4K2RA 2H34A 3BCEA 4EHEA 1W83A 4EWHA 2UZTA 4OTRA 3DKOA 3KRRA 4JXFA 5IH6A 2VX0A 5AV0A 2W1IA 2QKWB 2C6KA 2YM6A 4X2JA 4BZOA 3R28A 3SXFA 3R8ZA 4XOYA 5I9YA 2H8HA 4GK2A 2I0HA 2UW6A 2VTAA 4ZTHA 4DGMA 4EUTA 3FY0A 3UE4A 3QX4A 3RZFA 4EH8A 4LOOA 5F94A 4MH7A 4I5CA 4ZS0A 2UZWE 2VTSA 2G2FA 1S9JA 3ODZX 4UXQA 5E9EA 1H25A 4QYEA 4XV9A 3CGFA 3KRLA 4FKJA 3LFAA 3ZRKA 4E5AX 4H3PA 4KKHA 3EL7A 1AQ1A 3MPMA 2W1GA 3K5UA 3NAXA 1DAYA 4WRGA 3QWKA 3IPHA 4DITA 3OCBA 3VQHA 1YVJA 3MS9A 3R02A 5AIRA 2OWBA 3QZFA 5M55A 3NIEA 3W8QA 3VNTA 4DGOA 4A06A 4YBJA 3DXQA 3KXGA 4GYIA 4E4XA 3SG9A 1KE9A 3EN6A 1FVTA 4FBXA 2VGPA 3WBLA 4HVHA 4IX4A 2XK9A 4CZUA 3OEZA 2ONLC 3I6WA 4C33A 3IW7A 1Q3DA 3UC3A 4DH8A 4M15A 1U5QA 3HKOA 4A7CA 3PJ8A 1MP8A 3KVWA 1PY5A 2PK9A 5E8SA 4DYMA 4KRCA 2HZ0A 4R5SA 3FI4A 3GCPA 4AU8A 5ANIA 2WELA 4XH6A 3GFEA 4FTNA 4YPSA 1AD5A 2JKQA 3VS7A 3TEIA 3LOKA 5BNJA 2VO3A 5J5SA 4FEXA 4FG8A 3PXQA 4KKGA 3WIKA 1CMKE 3HLLA 5BVDA 4D1XA 3UNKA 4RWIA 3RCJA 3F88A
chains in the Genus database with same CATH superfamily
2I6LA 2PMIA 3WZUA 1TFFA 1WCCA 4EYJA 3U6JA 4FK6A 4LMNA 3RPRA 2W4KA 3QFVA 3Q2MA 2ZOQA 4FV5A 4C2VA 4C02A 3ZZEA 4O0VA 3JXWA 3VUIA 3F9NA 4O81A 4FIJA 2W1HA 4O7RA 3CP9A 4W8EA 5HGIA 3QHRA 4ZP5A 2OKRA 2PPQA 2PVFA 5LJJA 4FTRA 2QNJA 4HVDA 2G2IA 2EVAA 1PW2A 2XK8A 5AAGA 1Q97A 3MIAA 5G1XA 3RINA 5EHOA 2KTYA 5DN3A 2ESMA 3PY0A 3HNGA 1Y91A 2ITYA 4RGJA 5EW9A 1OPKA 3HP5A 2BAJA 5HVKA 3ZHPC 1B38A 4WNMA 4C38A 2UZVA 2PE1A 4DHFA 4GJ3A 5F20A 2WIPA 1UWHA 4L6QA 2LAVA 4E4LA 1X8BA 2PVLA 2PVMA 3H0YA 4OTQA 4DEBA 3Q96A 3GQLA 4I4EA 3QA0A 3VC4A 4KBKA 3QTSA 2WHBA 4EZ3A 3VS1A 4G31A 4FRFA 5AV3A 5IA2A 2ERZE 4OR5A 1PKGA 4BCGA 1PXPA 5IA1A 3IS5A 4EOJA 4WOVA 1K9AA 4RWKA 4O96A 4WNPA 3DDPA 4FTMA 3QCYA 4CFXA 5EDPA 5JRQA 4OAUC 3RMFA 4CKJA 4RZWA 1KSWA 2PY3A 4G6OA 1UKIA 3I6UA 3SLSA 4AW5A 2Y8OA 4PNIA 2WIHA 4OGRA 2ITNA 3UDBA 4FKIA 3IK3A 3DFCB 2P4IA 2VTQA 2DQ7X 4G3FA 3WF6A 4TWOA 4XG3A 5E8WA 2ZB0A 3S95A 5IDPA 2I0VA 4AW1A 4YURA 4CFFA 1YHWA 4B0GA 1OIRA 3C5UA 2WMSA 4JBQA 4ORKA 4ZY6A 4U6RA 4FNWA 4JBVA 4EQCA 4DCEA 3A8WA 2WMBA 4KRDA 4MXZA 2IVUA 5IQGA 5E1SA 4CZTA 4IVAA 3BGQA 4MCVA 3W33A 1KE6A 1W8CA 2HOGA 4IACA 3B8QA 3PZEA 4EONA 2Q0NA 5C01A 4FEVA 3E92A 2VO6A 4CTCA 5KKRC 3R63A 5AIKA 1PMUA 5HE2A 3AKJA 1IA8A 3KK9A 2JAMA 5CAOA 4O7SA 2Y6OA 5EW3A 3EN7A 2DUVA 2GNJA 1WVWA 2Z7QA 2VTHA 3NNVA 4UYNA 4F1TA 1WVXA 4TKSA 3P4KA 3PG3A 3PUFC 4AXAA 5JFSA 4O4BB 5DPVA 4CFMA 4P7EA 3LZBA 3KRJA 4U40A 3QBNA 3RAIA 3R04A 2WMVA 3BHHA 3UYTA 2J9MA 5BUEA 4PDOA 5KUPA 5M06A 5TO8A 4FIIA 2DYLA 3BL9A 4NWMA 2GQGA 4C4HA 2UW7A 1BI8A 3BX5A 2RFNA 5HCYA 3D4QA 3DNDA 5CSPA 3LW0A 4JDJA 2R3IA 4DINA 4U42A 1BI7A 4F09A 5A4EA 5CU0A 3GT8A 5E1EA 4DGGA 1LUFA 3LXPA 2XK7A 3TYKA 4E5WA 3LCTA 3N4VA 5HBJA 4F7LA 3WF8A 2XH5A 5JRSA 4AZFA 4HNFA 3OOMA 4BR3A 2XEZA 3HV4A 4BCKA 3EN4A 5EG3A 1ZYSA 4YJNA 3IG7A 4F0GA 3PY3A 4UMUA 5IQCA 4G3GA 3WIGA 1PKDA 3FQSA 4I23A 4DC2A 2YM7A 5BVOA 4FUYA 5IG1A 3FYJX 4JT3A 4MQ1A 3ODYX 2WTCA 2W1CA 2EUFB 2CKOA 4U5JA 3MVLA 2EXMA 4AS0A 3QRJA 1IASA 4TZRA 4WUNA 4U80A 3ZMMA 3RK9A 4B4LA 4ZSAA 3AC2A 4KBAA 4XMOA 2R5TA 4WNOA 4RX8A 4J7BA 4FIGA 4TXCA 3KCFA 1KV2A 4RIXA 5HG9A 5BVFA 1H0WA 1JQHA 3QTIA 4JS8A 4MWIA 4EOIA 3CD3A 2ZFYA 3F66A 2XVDA 3DKGA 5M4FA 3WZKA 3P9JA 4UYAA 4ANSA 5FUTA 3NAYA 2O5KA 4GFMA 5K9IA 2YCFA 4A9SA 4P4CA 3IW5A 4GT3A 4YMJA 3KEXA 3I7CA 1FGIA 4HCVA 3OMVA 5JFXA 3BHTA 4I92A 2WMTA 2W05A 2BTSA 4FSTA 3SXRA 4QT1A 5JGAA 2C5OA 4LV5A 1Q8TA 3FXZA 4BDJA 1ZZ2A 4FNZA 3EQFA 3H3CA 4PP9A 4RWJA 4AOIA 5CANA 4R7BA 2JLDA 4USDA 2ZMCA 4EH2A 4EK6A 1HCKA 5LWNA 3GFWA 4CMUA 3H10A 4RFZA 1XH9A 5AM7A 5AP0A 4GVJA 3FLZA 2XNPA 3DJ7A 2X2KA 3QCQA 3NW5A 2WU7A 4L7SA 4QP4A 3WILA 5HIEA 4X21A 5HI2A 5B2LA 2J51A 4BIDA 4F7SA 1ZLTA 4OTPA 3FI2A 4EUUA 1OBGA 4X2KA 2R3FA 4I5HA 3P86A 2GMXA 1IRKA 3PXZA 3EN5A 3SXSA 1OIQA 4LG4A 4DTKA 1RW8A 3FWQA 4CKIA 5CALA 5JH6A 3CC6A 5E7RA 1CTPE 5DT0A 1U5RA 4MD8E 3RPYA 3VUGA 4G17A 2B9IA 2X2LA 3GOPA 4Q5EA 4FT7A 4XG6A 2OFUA 3WI6A 3WYXA 2OSCA 2V55A 3UC4A 4LOQA 2Y4IC 4JL9A 1Z57A 3KN5A 3ORNA 5K5XA 3MSSA 4AQKA 3MH1A 2QOIA 3BIZA 4HYIA 4K8AA 3ZSIA 2WOUA 5AX9A 4BI2A 1YQJA 3QD0A 2XNEA 5BPYA 2UVYA 4QMZA 2QOHA 5HESA 3G5DA 4J52A 4XLVA 3EZRA 4DBXA 3ZEWA 4CCUA 3LHJA 5ANGA 2BUJA 4BDDA 5B2MA 4XG2A 1SZMA 2CN8A 3D9VA 5CF6A 5K5NA 2OXYA 4PY1A 3LM5A 5AEPA 2GDOA 5M44A 3TDVA 2O8YA 4R78A 2BRHA 4UMTA 2CNQA 1U46A 3N4UA 1UNLA 2UW8A 3B2WA 2OF4A 2XS0A 1ATPE 5ETFA 4C3RA 4CSVA 2P3GX 5L6WL 3CQEA 2YM8A 4P2KA 2XNGA 4M7IA 2OJ9A 4AFJA 2VTRA 3NEWA 4OUCA 1SYKA 5EKNA 1OUYA 2JBOA 3AD6A 4I6HA 4O4FA 4S32A 3ZRMA 4DHJA 3S3IA 4XOZA 5AP4A 2VX3A 2W9FB 2WZJA 4KIKA 3CSVA 3AC1A 4XP2A 1FMOE 1JLUE 2C69A 2BR1A 3EKKA 3QX2A 4NW6A 3FQHA 3VUKA 1PYXA 3T9IA 5I9XA 4AUAA 2CCHA 4FVQA 4R7HA 4BFMA 4C37A 3PPJA 4FVRA 1P5EA 4UY9A 3ZUUA 5KNJA 3PVWA 2YM5A 3U4WA 4F9AA 2YCQA 4CXAA 4EOOA 3QD3A 2R3LA 5ACBC 3ZDIA 4U7ZA 3T3UA 5KBRA 5KMMA 4QMPA 2XEYA 3ZXZA 4CNHA 3SV0A 2NNWB 3FAAA 3GP0A 5LQFA 3OD6X 2XJ1A 3M1SA 4RVLA 2BIKB 1ZMVA 4PWNA 3LLAA 4QP1A 3FZRA 3DTCA 4PMSA 3VS6A 4A9UA 3KF7A 1JOWB 2BIYA 2PVRA 5HX8A 2VN9A 3C7QA 1GNGA 3EN9A 3CD8A 2C3KA 3FZSA 4BDBA 4BHZA 2CLXA 3R9DA 2O63A 4E5BA 1URWA 4F64A 3F2AA 3F7WA 2UZOA 3UIBA 3ZXTA 4QMQA 5IQFA 4HPTE 4FUXA 5CASA 3DY7A 3ZEPA 2XANA 2EXEA 2X2MA 2XZSA 5AP3A 3PG1A 3B8RA 2VWBA 2O2UA 5DRBA 4EHGA 1QMZA 4UBAA 3S1HA 4YZDA 1IA9A 5L2WA 5J1WA 5KE0A 3FLQA 3TV4A 4DF3A 4IFCA 5DNRA 4Y5QA 1H27A 5JGDA 2PHKA 5L6PA 2PYWA 4BL1A 4BWXA 3GC7A 4PMTA 3PRIA 4II5A 4IWDA 1BYGA 3BHYA 3E8DA 2GS7A 2EXCX 2UZDA 5CNNA 5FEQA 3U51A 1WBTA 4MXXA 5HO6A 4H05A 4NU1A 1VR2A 3QQFA 1K2PA 3PSDA 4YTHA 2ZM3A 4FTIA 3KF4A 1STCE 4ZZOA 5BQ0A 3WF9A 4J95A 2GHLA 4IM0A 3R1QA 5J9LA 4ZXTA 2XM8A 5EM6A 4EZ5A 3ZH8A 3ENHA 3LFEA 5DR6A 1NXKA 2F7ZE 3OCSA 1XHAA 4HPUE 1BLXA 5LMKA 3A99A 2FH9A 3I79A 5HBEA 3BLRA 4GU6A 4IWPA 4CRSA 2OICA 5DMZA 4KIKB 4KS8A 3MH3A 3R1SA 4O0WA 4AP7A 1YI3A 3C4EA 3SAYA 3R21A 4S31A 4CV8A 1QPDA 4FMQA 2OIBA 4FV6A 3GENA 1Y6BA 5TT7A 5K4IA 1H24A 2J7TA 4MXYA 3UVRA 4AZSA 5IA0A 2YM4A 3CBLA 3F3TA 2WMUA 5ANJA 2YACA 3JYAA 3MY1A 1UWJA 2Z7RA 2VWIA 5AA8A 4YC3A 5GZAA 2ITWA 2BHHA 2QU6A 1GIJA 4TYEA 4X3FC 3SRVB 3T3VA 4RIWA 3UBDA 4ALVA 5K4JA 3AD5A 3TUDA 3V5QA 1YWNA 3Q4ZA 4QQCA 3Q4TA 3KXMA 3QLGA 5AMNA 3FC1X 2XMYA 1YRPA 2X4FA 4BTKA 3W10A 2BDFA 3A61A 4E8AA 5L2SA 2WTDA 4X6RA 3MH2A 4A9RA 3Q4UA 5JZJA 2QLQA 3MGYA 3EQPA 4YJQA 2XBAA 4RJ6A 4BJJA 5BYZA 1PXMA 5HE1A 3NWWA 4NIFA 1YXVA 4TTHB 3SC1A 3DFAA 2C47A 4MNFA 3AXWA 1GOLA 4BCJA 4GK3A 1YWRA 4LGDA 5JFWA 4D28A 3HMMA 1WZYA 3ZO3A 3HDNA 5HQ0A 4WG4A 2W06A 3TTIA 4K33A 1YI4A 2UW5A 2X0PA 3CY2A 3OWPA 2QCSA 3RPVA 4F6UA 4TYHA 4BTFA 4U81A 3FLWA 3FMHA 3EFJA 1M17A 4JRNA 4QP9A 4FYOA 2BFYA 2NP8A 3NUPA 3ZCLA 4O7VA 2EB3A 3FI8A 4HCTA 4Y83A 5AR3A 4ENXA 3LM0A 1OL5A 2ITUA 3W0NA 2YA9A 3LFNA 3SKCA 1XBAA 2AQXA 4FSNA 4YR8A 4DT8A 3MY0A 4YBKA 5DR9A 4ZLZA 5LWMA 2C5NA 4FI1A 5JT2A 5HD7A 1H8FA 4W4VA 1K3AA 3MTLA 4U9AA 1JKKA 3VRZA 5DGZA 4D2RA 3LXLA 2PVKA 2PVHA 5HX6A 4YP8A 1OECA 1ZARA 4NZWB 4XUFA 2GFCA 4UWBA 5FP5A 3TM0A 1REKA 4AN3A 3VS0A 4LRMA 4O4DA 3Q9ZA 3FLSA 4U97A 3VW8A 4AT4A 5AAEA 3OC1A 3BYSA 2PL0A 2QOQA 3BBWA 1ZAOA 4XG4A 4O84A 1OKVA 4I6BA 4QNAA 5A54A 4DEIA 1O6LA 4D5KA 5A4QA 3PZHA 3QL8A 2YLEA 4D4VA 1GZKA 2PZPA 3JPVA 5HTBA 5CTPA 5IH4A 2JIIA 3VS2A 2FSLX 4AA4A 4X7QA 4G9RA 3QGYA 3TNQB 3FUPA 2UVZA 4IANA 4WT6A 3UIMA 2QG7A 4CG9A 2XAOA 1OUKA 5FM2A 4EH4A 4BKZA 4AF3A 5HNBA 3MPTA 4ALWA 4D5HA 4QEBA 2VRXA 3FMNA 4XLIA 4DG2E 2CGUA 5FTGA 1KUTA 4ANOA 1F3MC 5CSHA 3O8TA 3IGGA 4RIWB 2VNYA 3DA6A 3VF8A 5HE3A 4XV1A 2XKCA 1QPEA 1ZOGA 2XNBA 2I40A 2ZMDA 2RFEA 1HOWA 3QGWA 4QP3A 2V5QA 2NYAA 4M0ZA 2QU5A 3BPRA 2XB7A 4Q5HA 4WKQA 2HWOA 2XF0A 5HCZA 5KX8A 5CSWA 3HMNA 2VX1A 4YJRA 2VO0A 3JY0A 3PFYA 3UQCA 4BJJB 1SVHA 4H1MA 2QVSE 4GMYA 4MAOA 5KCVA 4NIFB 1L3RE 5HIBA 4DG3E 2PVJA 5IEXA 2V7OA 4Y85A 3MFSA 3T8OA 3UO4A 3FPQA 4PMPA 3PE2A 4MBIA 3R2YA 3A4OX 1IG1A 4G5JA 5E91A 3AG9A 3R71A 3OBJA 4FYNA 4EQUA 4FK3A 5KMLA 3C5IA 4FOCA 5AP6A 3S2PA 2JFMA 5FLFA 3LE6A 4FODA 2WQMA 4FKOA 4NM0A 4TYHB 3WZEA 4FZAB 4WG3A 3QRUA 3EB0A 3HMPA 2WPAA 3R6XA 4ZMFA 4DGLC 1TZDA 1JSVA 3QUPA 4FIEA 4H3BA 3WE8A 4BZNA 5CF4A 5FGKA 4WHZA 3L8XA 2ZYBA 4JOAA 5CVHA 1WMKA 1UU8A 3C13A 4DFUA 1M2RA 4GUEA 1YDTE 4OBOA 3AC3A 4D9TA 3KRXA 1YWVA 2UW4A 4IVBA 2OXDA 3MV5A 3JR1A 2A98A 2HYYA 4DEDA 2WOTA 3MB7A 2IG7A 5EQYA 4DFNA 3OROA 2Y9QA 3W0QA 2Z8CA 3HZTA 4F7NA 4FSUA 5JZNA 1UV5A 3D2KA 3ZLSA 4M69B 4EOMA 4LV7A 2JAVA 4KSQA 3S0OA 4JNWA 3P79A 3UP2A 3F82A 4KS7A 3EQRA 3QKKA 4NM7A 2R3JA 3NSZA 4FT3A 3EQBA 3ORPA 4FV1A 4NJ3A 2OGVA 3EFWA 2OIDA 3OY1A 3DV3A 4DCAA 3DKFA 2ETMA 3KVXA 5AV2A 3ZM9A 5J1VA 3UVQA 4AGWA 3D7TB 4WSQA 5E4HA 3EOCA 5JSMA 3TNIA 4PDYA 4F9CA 3OEFX 3R00A 2A2AA 4H3QA 4M97A 4L45A 4YZ9A 4WNKA 1I44A 1SMHA 1FGKA 3I1AA 3W2CA 1JWHA 3BU5A 1DI8A 2XNMA 2UVXA 4FT9A 4FV3A 4MBLA 2DWBA 3NVMB 3PXYA 2R4BA 3P23A 3TKUA 5DRDA 3G0EA 1WBVA 4ZAUA 3OVVA 4U79A 2R7IA 3ZTXA 3O51A 4ZZNA 4TRLA 3HECA 2A27A 2XM9A 3PXFA 5T3QA 4KIPA 2XYNA 5DT3A 3FDNA 4YC8A 3OY3A 4M14A 4BDEA 4BCIA 4O82A 3EQGA 5LVPA 3V5PA 3EQIA 5ACKA 3HYHA 5CAQA 1OL2A 4DEHA 2FA2A 4M84A 1MQ4A 3EYHA 4QMYA 3Q9WA 3CY3A 2UZLA 4FTCA 4CRLA 4AE6A 5M4CA 3BEAA 5AJQA 3ZSHA 3COHA 5EOLA 3ZLYA 2R0IA 3DNEA 3IKAA 1PXKA 3WF5A 4BDFA 3C51A 2X6DA 3F7ZA 3UO6A 3GC0A 3F5XA 3FV8A 3VHKA 3TZ9A 3LQ8A 3HA8A 4EEVA 4HVIA 1P2AA 1IAHA 2I0EA 3O71A 4J53A 2QO9A 4BVUA 1E1XA 3CS9A 3VBTA 4O6EA 2FO0A 4LL5A 3ZC5A 2ETRA 4BB4A 3V6SA 5DVRA 3TV6A 4LI5A 5HD4A 3UODA 3R01A 2C0IA 4PTGA 3UMWA 3NVKI 4XS2A 4DA5A 3KQ7A 1G3NA 3G0FA 4TY1A 3E87A 5HCXA 4D9UA 5LVOA 2BTRA 2BKZA 2YIYA 2YITA 2Z2WA 2XRWA 3MVJA 4NK9A 4O21A 4BGHA 5IF1A 3DXPA 4MVFA 4RVMA 2RGPA 4KINA 2QD9A 3PA3A 1VJYA 2OFVA 3FKNA 1SVEA 3AMBA 1ST4A 5JKGA 1V1KA 3BGPA 4E4NA 3IGOA 3OWJA 1P4FA 4HZRA 2WQEA 2W96B 3W2PA 4AZVA 4L01A 4OTIA 4QPSA 3ANRA 3VAPA 5M07A 4FVPA 2XIKA 3KL8A 5AUYA 2HENA 5ANKA 5AR7A 4OT6A 2WTKB 4BYJA 4PP7A 4D4RA 5BYLA 1YXXA 3PIYA 4NFNA 3EKNA 4L43A 1G8JA 1R39A 4KIQA 4BDKA 5E90A 1W82A 1YI6A 4FV9A 4IZ5A 3D15A 2J2IB 2IEWA 4ZY5A 4C36A 4USFA 2WB8A 3DT1A 4QTDA 2YM3A 3AC8A 4MD9E 3KXZA 4C62A 5HG7A 4F4PA 3NNWA 4YHJA 5BVEA 3HAVA 4DTAA 1OBDA 3Q5IA 3C0GA 3OCTA 3SOAA 2R3QA 2V0DA 3ANQA 4AE9A 4YHTA 1TKIA 3KCKA 5I5ZA 5ICPA 3PIXA 4FICA 4RC4A 2IN6A 5E92A 3OT3A 5FBOA 5IMXA 2OF2A 1ZRZA 2P0CA 3CKXA 1U59A 5GIPE 4EOQA 3NMUF 4B6LA 3UDZA 5D41A 2XCHA 3MFTA 4IEBA 5I9WA 4IXPA 5CEOA 1YDRE 5KHXA 1OM1A 4NFMA 4HCUA 2X4ZA 4I6QA 4FR4A 4EH5A 3TZMA 4IWQA 5CEQA 4QOXA 2RG6A 4GVAA 3BV3A 3RHKA 3PE1A 3HDMA 4GG5A 4HJOA 3RKBA 2XARA 3R9NA 2YIWA 5IQDA 4RX7A 1HCLA 4CV9A 1KOAA 4DH7A 4UZHA 1V0PA 1YDSE 3F3WA 5FTOA 4CD0A 4P90A 4N70A 4YO6A 3TUBA 4TPTA 3ZFMA 4GK4A 1MRYA 5GZ9A 3V51A 5ITAA 4R5YA 3ACJA 1J91A 4IFGA 4X2NA 3G2FA 1IEPA 5AP7A 3RCDA 3AD4A 5L8KA 3FMKA 2XJ0A 3BGZA 1Q61A 3P0MA 3OP5A 3PFQA 4TYJA 4E7WA 1BX6A 2IZUA 2VWXA 4MEDA 5GNKA 4BCMA 4BWKA 1FQ1B 4KWPA 5K3YA 4NKAA 3BWFA 2X1NA 4IZ7A 4ZS4A 4IM2A 3E3BX 5BYYA 3U4UA 2C6EA 3VULA 3AOXA 3CJFA 4AZEA 2BDJA 2Y7JA 5J95A 1ZZLA 1LEZA 3KK8A 3ORIA 2P33A 2XK4A 5EDRA 3PPKA 3LJ0A 5CF8A 3AMAA 5H8EA 5EOBA 5FM3A 3TT0A 2YZLA 4AXFA 1JSTA 3LMHA 4RPVA 3VHEA 3CR0A 5CS6A 2A4LA 3UP7A 2B55A 3FKLA 5CU2A 2PE0A 2FVDA 3A7GA 4LGGA 2C68A 3AQVA 4R77A 2CMWA 3R7YA 2E2BA 4ARKA 4C58A 2CSNA 5EW8A 3SVVA 3U87A 4F1OA 2VTOA 2VV9A 4K6ZA 2JKKA 3UIXA 2OG8A 3KULA 4F7JA 1IAJA 1TQIA 2CGXA 1Q4LA 4ITIA 2XAMA 2J5FA 5KMKA 3BYUA 4L44A 3CPCA 4NTSA 4F78A 5L8JA 4ZTNA 3KIOC 3CLYA 4FTTA 4WUAA 4DG0E 2W99B 5HVYA 5DE2A 5ANEA 5CVGA 1R1WA 2QURA 4NCTA 3FYKX 4YC6A 3A4PA 1WBSA 1IR3A 4TL0A 4R3RA 4DFXE 1U54A 1JKLA 3IDBA 2WTWA 3NR9A 4BWPA 4F1MA 5C8KA 2C6DA 1F5QA 3GU5A 5HORA 3WF7A 3MVMA 1M2PA 4P5QA 5HBHA 3TNWA 4ANNA 3W55A 4I0RA 4IAFA 3UG2A 3F2NA 3COMA 5D11A 3W2QA 3QC4A 4IAZA 5C8MA 5B2KA 3OWLA 2HY0A 1L8TA 2CKEA 1ZYDA 3RAWA 1J3HA 2F9GA 3E63A 3ALOA 3O17A 1DS5A 3RI1A 4CFUA 4EORA 3DB8A 3VJNA 2VTPA 3LQ3A 3UMXA 2BVAA 2RKUA 3F69A 4AOJA 4A4XA 5AAFA 2GQRA 4IB5A 5CXHA 5LXMA 3NCZA 2W5HA 2AYPA 3R83A 4NM5A 2BCJA 2IF8A 4E6QA 4JAJA 1Q5KA 1WAKA 4FTLA 1UKHA 2X7FA 1Q8YA 3QYWA 3ZFYA 4PX6A 3P78A 4JX7A 1JKSA 2QOKA 4MXOA 3VIDA 1OL6A 4CZYB 5K0KA 1J7LA 1W7HA 4G16A 1OKWA 4CT2A 4PL4A 2RFSA 3NYNA 3NUXA 4Y46A 4ZJJA 4D2PA 3U54A 1J1CA 2HZ4A 2WQOA 3Q52A 3QTXA 2R3MA 4OAVB 5EQEA 4MQ2A 4H36A 4O27B 4B7TA 5KHWA 4U3ZA 4L9IA 4M67A 5AR2A 2PWLA 1CKPA 5FXRA 2R3GA 5H8GA 3MN3A 3M11A 4AXEA 3ITZA 4BICA 4X3JA 2QOOA 2W7XA 3VBYA 3VS5A 3FXWA 3KULB 4I24A 4E1ZA 2UZBA 5CEPA 4FTKA 3QUDA 2QR7A 2F7EE 4YO4A 4YZNA 4YNEA 3VUDA 1YHSA 3KFAA 3MPAA 4RJ8A 2X0QA 3RM7A 3FC2A 3QRIA 3QRKA 3QU0A 4A9TA 1AGWA 3NFFB 3BQRA 2JFLA 2E9OA 3GQIA 3V04A 5I3OA 5HNIX 4BBEA 2OH0E 3FE3A 1Q8UA 4Z7HA 3DK3A 2Y6MA 1A9UA 4AZWA 4BIEA 5C9CA 2PVNA 4D0WA 1H08A 3EQCA 1DI9A 1U54B 2XNNA 3QZIA 4PF4A 2XUUA 5ANDA 2VUWA 4O0RA 5EH0A 3I4BA 3BYOA 1ZOEA 4IBMA 4IVDA 2XRUA 2VAGA 3WARA 5HZNA 5AR5A 4D1ZA 4FSMA 2BZIB 2VWYA 3MFUA 5L3AA 2Q0BA 4G3EA 4M68A 4GV1A 4OTDA 5JQ5A 4YPDA 3FEGA 3DAEA 4IZYA 4NW5A 2VU3A 5GINE 5A6NA 3BYVA 2UZEA 4CYJA 1J7UA 3IDPA 2J0KA 3C4ZA 4DDGA 3KY2A 2VWZA 3OTUA 5L4QA 3TZ8A 5LMBA 2P55A 3IW6A 4I5PA 3NFGB 3AMYA 2P2HA 4FKGA 3O8PA 4YNOA 3UOJA 2OH4A 4PV0A 3TL8A 2YAKA 2X7OA 3U9CA 4YLKA 5D12A 1PMEA 4EOLA 3BU3A 3DLZA 3FZOA 2X9EA 1VEBA 1XH6A 2JITA 3QYZA 5TOZA 4E26A 5AFVA 1NT2A 2W1ZA 5F1ZA 2GS6A 2PTKA 4IQ6A 4EK5A 3Q6WA 5JEBA 4FA2A 3TACA 5I0BA 2P2IA 4D1SA 3POOA 1PXOA 2W9ZB 2O3PA 4GT5A 3MA6A 1R0EA 2B9JA 3KKVA 3OXTA 3ZYAA 3LFQA 1XQZA 4O2ZA 4DE4A 3ALNA 2WNTA 4RZVA 2PVYA 4XG7A 1OVEA 2Z7SA 5KMIA 4RC3A 5CNOA 3O50A 1J1BA 3NX8A 4O7LA 2R3OA 4GW8A 3SRVA 3EFKA 5LVMA 2O64A 3UOHA 2FB8A 4ZSLA 4C4IA 4E20A 2ETKA 5H9BA 4CQGA 5HTIA 4IW0A 3RHXA 4C57A 1OGUA 3Q9XA 3EJ1A 4PL5A 4C4JA 5L2QA 4UZDA 1KE8A 1V0BA 4L7FA 3F5UA 1FINA 3KMWA 3D94A 4FV0A 3OZ6A 4NSTA 3H0ZA 5DR2A 3TKHA 3QKMA 4C35A 4D4SA 5LVNA 2WGJA 1NVSA 3PA5A 3FMEA 3QC9A 5J7HA 4JVGA 2X7GA 4FSWA 3ZUVA 4Z3VA 5DBXA 3D5VA 3DU8A 3VW6A 5AP1A 2WMXA 4IADA 5CZIA 3QQHA 2C30A 3GCQA 5E8YA 3K3JA 4LL0A 4QQ5A 3EWHA 1GIIA 4ANBA 3GCUA 4B8LA 4IIRA 4JBPA 1MRUA 5AA9A 4C59A 3A62A 1Q99A 3EH9A 4RJ5A 2ITTA 5IU2A 1OL7A 1YKRA 4ASZA 3ERKA 2XBJA 3WYYA 4TYGA 3CTHA 3DAKA 4PTEA 5CAVA 4M8TA 1QL6A 2C5VA 2OXXA 2A1AB 3E8CA 1GJOA 3GBZA 4FGBA 3I81A 3R8MA 2E9VA 3GI3A 4YZBA 3HRCA 3TIYA 4FNYA 5A4CA 4ZIMA 4XG9A 4ERWA 4IC7A 1GZOA 5HVJA 3KA0A 3FI3A 3D0EA 3GCSA 4D55A 5M4UA 2WEIA 1H01A 1WVYA 2JEDA 3IOKA 3MFRA 3P7BA 4LUEA 5DIAA 3HAMA 4AX8A 2JC6A 5M09A 4N6YA 2HZIA 1H1SA 2SRCA 3ELJA 3ETAA 4PTCA 1LP4A 5HEZA 4MD7E 4KIOA 3QKLA 3V01A 5J5TA 4UALA 4BCHA 1NY3A 2G9XA 4NTTA 1G8AA 4LMUA 4AA0A 3OW3A 5I4NA 4WIHA 3H9OA 5CI6A 3F5GA 5BX0A 2VTTA 1CKIA 3PJ3A 4BCPA 4BYIA 2W4JA 1A06A 1PRYA 2VD5A 3UDSA 2JDSA 4HNIA 4FG9A 1MQBA 3LCSA 1H26A 2ZV7A 3SG8A 2OI4X 4C4FA 3FBVA 3Q53A 2ZV2A 4D2TA 3RK7A 2E9NA 3HV7A 4TWCA 1O9UA 1UA2A 3TI1A 4ZOGA 1PHKA 3PWDA 3ZBXA 5LMKC 4WRSA