3V04A

Discovery of novel allosteric mek inhibitors possessing classical and non-classical bidentate ser212 interactions.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
322
structure length
289
Chain Sequence
MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Discovery of Novel Allosteric Mitogen-Activated Protein Kinase Kinase (MEK) 1,2 Inhibitors Possessing Bidentate Ser212 Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 289
sequence length 322
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3v04A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3v04A01
3MPAA 4UYNA 2XB7A 3SLSA 3TTIA 2PZIA 3LXLA 3GU7A 3PA5A 2IVSA 3PDTA 5E8YA 4KNBA 4RIWB 3RPOA 4OR5A 1AGWA 2OICA 2YITA 4XRJA 4D4VA 3WILA 3NCGA 1Y8GA 3AC4A 4CVAA 3QCQA 3PXZA 5EOLA 1W83A 2CGWA 1OL7A 5FEQA 2QG7A 1WFCA 3RK9A 4HNFA 2WGJA 4QMSA 4BCNA 4O7TA 2G2HA 4PX6A 2R3KA 4L42A 4EWHA 5JK3A 5AEPA 4IDVA 4QPAA 3TIZA 2W0JA 1UNHA 3FC1X 5HHWA 2F4JA 3HECA 4I92A 1L8TA 3SXRA 4GU9A 5BVNA 2O2UA 2XNEA 1G5SA 3GEQA 4O22A 4R6VA 3GNIB 4YNOA 3HA8A 2LAVA 4GK3A 5AA8A 1B39A 4K18A 5F20A 4ZJJA 3R6XA 3FLWA 1K2PA 5CF4A 1O6YA 3EZRA 1OIUA 3FL5A 4FT0A 4FV1A 3UMWA 4ANBA 4C3FA 3FSFA 4GS6A 1XH6A 2CNVA 4E4XA 2P3GX 3BLHA 4EH3A 1F3MC 1UNLA 5J5TA 4PP9A 2KTYA 3WZKA 5DT0A 1Q24A 3W55A 4ZZOA 4LOOA 4DEDA 4RIXA 2YA9A 4ERWA 2Y4PA 4ANSA 3LKMA 1EH4A 2C0OA 4LOPA 4KBCA 5AR5A 2ZM3A 3KMUA 4F9CA 3WARA 5HVKA 4PY1A 1R0PA 3LMGA 4OTWA 3GBZA 5FG8A 5DE2A 2ITYA 1YI4A 1YWVA 3FHIA 3Q3BA 4FV3A 1IA8A 4B4LA 1HOWA 4I0TA 3UVRA 4DH8A 2UW3A 3P5KA 4IZ5A 4J7BA 4PMMA 5GIPE 1MRUA 4FIFA 2OKRA 4NTTA 2BRGA 2GTMA 4EJNA 1XBBA 3W33A 1XR1A 5J79A 4NT4A 4EC9A 3COIA 1TQIA 2W1DA 4W4VA 3QYZA 1OITA 4FE2A 4U40A 3ZBFA 3WYYA 4DGLC 5E8TA 3VUDA 1F5QA 2OH0E 1ZY4A 3CTHA 4E26A 4MXAA 4MWIA 4RQVA 3Q9ZA 1R3CA 4IM2A 4IC7A 3N51A 3LFBA 3F9NA 3BGQA 4W4XA 4G9CA 3RAIA 1Q3WA 2YJRA 1V1KA 3NUPA 4NEUA 4RA4A 5F94A 4LYNA 4G1WA 5HIDA 4FBXA 3CKWA 4D1XA 1XH5A 4FIIA 5L2TA 3Q4ZA 4NM0A 5AAFA 1XH4A 2GU8A 1WBTA 4RWLA 3HP5A 5EYMA 5CAUA 2VN9A 3PE1A 4DLIA 1IG1A 4FKTA 3MS9A 4NWMA 3RJCA 2J2IB 3KCFA 3U87A 2QO9A 4C62A 1WVWA 1KV1A 3FLZA 4FG9A 4AT3A 4F6SA 5LWMA 4MXYA 2OIDA 4AN3A 2VWWA 3C4ZA 2X7FA 1MP8A 4V04A 4BYIA 3R0TA 4IVCA 2OXDA 2UZTA 5HKMA 1CKIA 3WYXA 4CT1A 5AUZA 3UIMA 3G15A 3PSDA 4M13A 5HO7A 4XV1A 2C3JA 3DFAA 1Y91A 5JFVA 1W7HA 3OXIA 3COMA 3RAWA 3ZC5A 1PKDA 4ONAA 3ZM9A 5GZ8A 3AC5A 3QTRA 2WZJA 1V0OA 2UVZA 5IA2A 4DG2E 3JY9A 4H3QA 3V51A 3FI2A 2W06A 2WMAA 3I7BA 3NIEA 2PY3A 1J1CA 2IWIA 4BHZA 3TNPC 1OKYA 1KE7A 3H0ZA 5KMJA 3BHHA 4YP8A 3Q4UA 3GXLA 4QP7A 3WIGA 2W9ZB 3DK6A 4FOBA 3SGCA 3QGYA 2YDKA 5KUPA 2R3FA 2OG8A 2AUHA 2F7EE 5DLSA 5ETAA 5AWMA 4F7JA 3VQHA 3QA0A 5DBXA 4O7WA 4GT4A 4I3ZA 5CU4A 3V8WA 4DGNA 2FYSA 3U9CA 3ZFYA 5IH6A 1W0XC 4O21A 1UU7A 4NJ3A 2WMTA 4QQCA 1OBGA 3MPMA 4BDKA 3A62A 4CD0A 4F0FA 3P78A 4OBPA 3ZTXA 2PVFA 4G6LA 1SZMA 2F49A 3OXZA 4IJ9A 4HGEA 4TZRA 3MH2A 3QKLA 1BLXA 4KS8A 3UOHA 3MY0A 4DF3A 5DPVA 1OGUA 2IVTA 2ETMA 4J53A 4PP7A 3DZOA 5CT0A 4N57A 1YOJA 4TW9A 3PSBA 5AR2A 3PSCA 4YHFA 4OBQA 3E3BX 5GJFA 3W8QA 4CEGA 2OF2A 4JDIA 4YLJA 2BTRA 4YC8A 5FXQA 3OZ6A 5IQDA 3PLSA 4DA5A 2AC3A 2P2HA 3GI3A 5EHOA 1JKKA 4ANMA 4KBKA 4MHAA 2VWBA 5CEMA 3N4UA 3BIZA 3DXNA 3P4KA 3IS5A 3ID6C 4UWYA 3SAYA 4A4XA 2NPQA 4UWBA 4HVGA 1AD5A 4G16A 2J5EA 4EBWA 5JZJA 2R3JA 3NR9A 2BVAA 3KRLA 2W05A 2J0JA 2W5BA 1X8BA 4JBPA 4FSQA 4WKQA 4F4PA 4C33A 3R7OA 2PL0A 4D4SA 3NVKI 4U7ZA 3Q32A 3V5TA 3NYVA 4GUBA 3TV6A 3F3VA 4Y85A 3UO6A 5DR6A 4YZ9A 3ZDIA 3OEZA 1OB3A 3CEKA 1PXPA 4L9IA 4R7IA 4RX5A 4U3YA 3Q9WA 5J9LA 3MFTA 3FKOA 1LR4A 3DAJA 3LFNA 3S3IA 3Q4TA 1RJBA 4AZWA 4CCUA 1Q5KA 3LE6A 4FTLA 4O7LA 1G3NA 4N70A 4QMUA 3TT0A 1ZYLA 4A9YA 4BKZA 4RBLA 3E7OA 3E3PA 1ZZLA 3EQIA 2V62A 3F66A 3VS2A 3ORIA 5IUGA 4NCTC 1UNGA 1JPAA 4MF0A 3R1YA 1WCCA 4KUJA 3ZFXA 4GKIA 1XBAA 3AMAA 3G2FA 4ZSAA 3GOPA 3QHRA 5G6VA 5IMXA 5L4QA 5L6OA 3FLQA 3QWKA 3NUYA 5LVPA 5HE2A 1W8CA 1UKIA 3FYJX 3FYKX 3ORXA 2X0GA 4OTDA 4XHKB 3NMUF 4FTTA 4EZ5A 3PIYA 4PRJA 4XG4A 4FZ6A 3TIYA 4DITA 4DTKA 3KCKA 1M2QA 3K54A 2GTNA 5AP1A 3CD3A 4DH1A 2OJJA 4FSNA 2ZVAA 4HYIA 2Z8CA 5ANGA 5AP5A 4IZYA 2B9JA 3UOKA 3O8PA 4YHTA 3QU0A 2X9EA 3TEIA 4CCBA 4BDBA 3ACKA 2BR1A 5E8VA 4PMPA 5I3RA 1PW2A 3QRJA 3W2PA 4YJUA 3OD6X 4FV5A 4AE6A 3BWFA 5LVLA 1RQQA 3ZXZA 5AAEA 2R64A 4GH2A 5IQFA 1XH7A 1YXTA 3F2AA 4MWHA 3VHEA 2GHLA 5M4FA 5AR4A 5C27A 4DCAA 1AQ1A 4FTCA 4Y5QA 1IR3A 2CGVA 3RMFA 3PIXA 3KXZA 4UEUA 3LM0A 3RWQA 2P33A 3KXNA 3UOLA 4EORA 4YZMA 4M69B 2YM8A 5FEDA 3RM7A 5JN2A 3ULIA 4CYIA 1H00A 2VX3A 2GQRA 5GJDA 4PDPA 3TL8A 4FTKA 2JKOA 4ORKA 3LQ5A 2YCQA 4DEEA 3G0EA 4IVBA 4C37A 5E1EA 2YIYA 4J8NA 5DMZA 5IDPA 5L2WA 3C4XA 3LCDA 3RTPA 2GDOA 4XV9A 5IF1A 4X2NA 3TCPA 2GNLA 5DHJA 5HO6A 1MRVA 3ELJA 4RC2A 4YJTA 3I1AA 3V5WA 3WI6A 5DFPA 1KOBA 2QOBA 4AW2A 3LFAA 4JRVA 1Q8WA 2OWBA 5TKDA 3TXOA 5I9ZA 3QA8A 4JL9A 4NH1A 4EH8A 1ZLTA 2X2LA 3P08A 3NNVA 3QLFA 1GZOA 2XNBA 4EBVA 3FMHA 5CANA 4FX3A 3TJDA 1JBPE 3UP7A 5M09A 2Y0AA 4JIKA 4U41A 4YLKA 4MQ1A 2JD5A 1U54B 3AMBA 4HYHA 5CNNA 2ITPA 2PU8A 2QG5A 2WTKC 5FXRA 3EMGA 3QKKA 1FPUA 4EJ7A 2VTAA 5K9IA 1PXOA 3VVHA 2PPQA 4G3GA 4GFOA 2J51A 3QRKA 2I0YA 2CKEA 3PY3A 3VHKA 2SRCA 4AT4A 4AW1A 1TKIA 3CCNA 2R3IA 3DZQA 3EFLA 1B6CB 4B99A 3ZFMA 4PUZA 5K0XA 4DE4A 5A4QA 3ZXTA 4BIBA 2JDOA 2YN8A 3G5DA 2J90A 1YDSE 5K5NA 3ULZA 2AYPA 4O0WA 4FSUA 4FSRA 3BHTA 4L6QA 4U6RA 4DH5A 5KHWA 2QC6A 3DNDA 4RG0A 4EQCA 1UU8A 4G31A 3GCSA 2C6KA 1BL7A 2X4FA 4NIFA 4MCVA 2CNQA 4CG8A 2ZM4A 1OMWA 2F2UA 4CFWA 4AA5A 3B2WA 3DAKA 3QXPA 3VQUA 3FMDA 2W5HA 4FV6A 4MAOA 3GQLA 4V05A 5EM5A 5GZAA 3UG1A 1VEBA 5CEKA 1WAKA 4BR3A 4C38A 1R78A 4FYOA 2ITNA 4QMWA 1Y6BA 5C8MA 4BDHA 3M11A 1XH9A 4NW6A 5D12A 4RQKA 5CEIA 5FD2A 5EHYA 4BCPA 3ZLSA 4JX3A 5DEWA 5AR8A 4BBEA 1H27A 2ZMCA 4NTSA 4ZTSA 2G2IA 5JZNA 4KSPA 3NW5A 3TUBA 5L6WL 5JQ5A 4CG9A 5HE3A 2WPAA 2J7TA 2R0UA 3NUAA 3F7WA 3Q2MA 3QRIA 3ZLYA 4BKJA 3A61A 3KXHA 5IA4A 4FEVA 1U5QA 4FTJA 1E1XA 4L00A 4PNKA 3KXXA 4ZY5A 4FTUA 3CP9A 4YJVA 4RLLA 1OBDA 1YDRE 4EK5A 1VYWA 4QMXA 4QYYA 3HV6A 2R5TA 3REPA 3UIBA 2C6LA 4AAAA 5C4LA 5D11A 2PVNA 3BLRA 2R3MA 2DQ7X 2XYNA 1J7IA 2C3KA 2PE1A 3I6WA 4CFXA 3EQCA 3V01A 3PY1A 1JWHA 3E64A 3WF8A 3S0OA 4CKRA 2YAAA 3A7JA 2ONLC 4RJ4A 3FL4A 3HP2A 4XG7A 2XNGA 3EN5A 2JBOA 3FZ1A 5E7RA 2UW4A 4RVMA 1JOWB 2GNIA 3CY2A 4KB8A 3FAAA 3HLLA 2XIKA 4FL1A 3AC2A 4O96A 2J6MA 4FTOA 2VNYA 5HLWA 3U6JA 2JIVA 4IZ7A 3ZS5A 4FVPA 3I6UA 4L3LA 3MVHA 2VWIA 2B52A 3QZHA 4TYHB 2VGPA 3O8TA 5TE0A 4O7VA 3DQWA 4RJ6A 3D94A 3AC8A 4F1TA 2BTSA 1GZKA 3GENA 4FKLA 3DS6A 2VTMA 3IO7A 3LLTA 3VUHA 5JFSA 4FYNA 4H05A 3DBFA 4IX4A 3TV7A 3ZC6A 3K5VA 4CRSA 3F5PA 4ITJA 4QO9A 4BDJA 2CKOA 2IZRA 4X2JA 4ZK5A 2BZKB 2CSNA 5EHLA 5CI6A 4WUAA 4L8MA 1YXSA 5HNBA 4DINA 1R39A 2B53A 2X8EA 4JIAA 3OT8A 3DCVA 4LGGA 2F2CB 2B7AA 3VS5A 4AZTA 5EKNA 2Z2WA 3JY0A 4PL4A 3ZO4A 4CV9A 2XBJA 5C8NA 3UNKA 2Y6OA 2CGUA 4DYMA 4U97A 3EL7A 1OIRA 4IANA 5AAGA 3RHKA 3QBNA 3VULA 2XNOA 5LOHA 2O63A 2UZLA 4OW8A 3PWYA 5HBEA 3ZRKA 2H6DA 4FSMA 4YGAA 4AP7A 1M52A 1YHSA 2QLQA 3EN6A 4HCTA 3Q53A 4N4SA 1PXKA 3MH0A 2YIQA 4U44A 4JOAA 4FKOA 3FI8A 4CZUA 3TDWA 4G2FA 4GCJA 3QCXA 3R8MA 3QCYA 3HEGA 4EYMA 4XX9A 4CV8A 4E5BA 3JUHA 3HNGA 1CKJA 4QQTA 3D5VA 2QHMA 4WUNA 5CYIA 4EHZA 5CSXA 4FGBA 4HVHA 3ZCLA 2XNNA 2QI8A 4BCFA 3QF9A 3UC4A 3C0GA 3F6XA 4C34A 1TQPA 3H30A 1WBSA 4ZIMA 3RALA 5M51A 3UE4A 1H1PA 4ZTNA 4KABA 4NM5A 2UZWE 3QTIA 4KRCA 3QX2A 4MKCA 2YM5A 1WVYA 5HE1A 4USDA 1VR2A 3QUDA 3KN6A 1UU3A 2C6MA 4M8TA 4HGSA 4NJDA 4Z7GA 5AIKA 4MNEB 4RC4A 3R7VA 4CZTA 4J98A 3MESA 4QMOA 3QALE 3LCTA 3QRUA 4ARKA 4V01A 4AXAA 4L52A 3D5UA 1ZOHA 4XCUA 2QOCA 4Y72A 4WHZA 4RFMA 5DG5A 3G90X 2G9XA 1JSTA 2PUPA 2QOOA 4PPBA 4CFNA 1G8AA 2ESMA 3H4JA 4I24A 2VO0A 4G6OA 4IIRA 3SX9A 3VUIA 4D0WA 4QP9A 5M4UA 2DWBA 3EZVA 3F82A 3R9DA 2VTIA 3UQFA 2XNPA 3CJFA 3OWJA 3F69A 3QYWA 4F9BA 5I3OA 3PXRA 4J1RA 3CSVA 2Y4IB 3BPRA 2C6DA 4QMLA 5H8GA 3HYHA 1ERKA 3DKCA 3OW3A 4CMTA 5FGKA 4ALVA 3FC2A 3ERKA 4FV2A 3AMYA 2WTVA 2GQGA 5AX9A 3ZUUA 5AMNA 4F0GA 5BYLA 2WD1A 2RFDA 4K33A 4HPUE 5A4CA 3RPVA 1O6KA 2O8YA 2G15A 3BX5A 5ETIA 5LCJA 4I22A 3OBJA 2C5YA 4QNAA 5BQ0A 3QQUA 5IQHA 4BWPA 4AQCA 2PHKA 3ZOSA 5CU2A 4FKQA 3MTFA 3P86A 5ACKA 4FK3A 4K0YA 4XP3A 2OZAB 5CU3A 4MBJA 3PA4A 3C13A 2CCHA 4OTGA 1XWSA 3E62A 4LI5A 3GVUA 4F1OA 4LUDA 1UA2A 2IW9A 3SHEA 4BI2A 2BZIB 5AR3A 4EYJA 4EKKA 4UN0C 4JVGA 5FM3A 3PJCA 4H3PA 1OUKA 3OG7A 5HG8A 4OTQA 3RZBA 3PG3A 5HBJA 4WNKA 1XJDA 2ZV7A 2BRBA 4RVKA 1P4FA 5FXSA 5IH5A 4XNEA 2VTOA 5C9CA 4F09A 5J1VA 3JYAA 2XH5A 2HENA 5C8KA 4AN2A 4UX9A 2QURA 4Y5HA 3DBQA 5IA1A 2FH9A 4RZWA 2WXVA 4HVIA 3NCZA 5HEZA 5CTPA 3SOAA 4WO5A 4TWOA 2VGOA 2ZJWA 3OCBA 3W2CA 5C26A 5IQIA 1H08A 2QKRA 4BDDA 1P2AA 3BGZA 4BICA 2WELA 4IFGA 3TZ7A 2V7AA 3EQHA 2XCKA 2XKFA 4ASXA 1OZ1A 5HZNA 4ASDA 5H3QA 3FQHA 5CEQA 2BAQA 3VBXA 3A7IA 3PUPA 3O0GA 3OWLA 4G3DA 5BMMA 1FVVA 4I94A 4YBKA 1Y6AA 2WEVA 5L3AA 2GSFA 1MRYA 4NUSA 4WIHA 2RL5A 3H0YA 3R21A 2HZNA 3BGPA 5CWZA 3JVRA 4I6BA 3VAPA 3VUGA 4XLIA 2BRHA 3IOPA 3MH1A 3KC3A 3C4CA 4EZ3A 2RGPA 3IW7A 4G3FA 4KA3A 2EXEA 2J0IA 2WHBA 2X1NA 4EQUA 3A8WA 5KX8A 2J0MB 4TWNA 4BGHA 3H9RA 4D2PA 3U6HA 2B9IA 3QTSA 4B8MA 2OLCA 5EYCA 3Q5IA 5KMLA 4E93A 1PYEA 2IVUA 3O2MA 3OT3A 5DNRA 4UXLA 3LMIA 5CLPA 3D14A 4QYFA 4OUCA 5K5XA 4O27B 3MIAA 3COKA 4WNMA 4HW7A 2YIXA 5H8BA 3ZSIA 3UZPA 1JKLA 5E8SA 2OJIA 3FI4A 4YC6A 2C6TA 4ZZMA 3LOKA 3DBEA 3RNYA 1QL6A 5FBOA 2XMYA 4JI9A 4U0IA 3TM0A 3NIZA 3P9JA 4NCTA 1Q62A 3CGFA 4MXCA 4R5YA 4CT2A 2C6IA 3LCKA 3AC1A 3ODZX 3OUNB 3ITZA 1KSWA 1P4OA 2BRNA 2GS6A 4FEQA 3F3WA 4AGUA 1KV2A 1M17A 1XKKA 1ZXEA 3WE4A 4RIWA 4RZVA 5AM6A 5EQEA 4Q5EA 1KE9A 1YOLA 2FSMX 2JAVA 2XK3A 5K3YA 4LRMA 3GC7A 2VO3A 3DXPA 1PMEA 1WBPA 1ZARA 5HE0A 3W8LA 1PXMA 5EI2A 1STCE 4ERKA 2A0CX 4FZDB 2RFEA 4I6QA 3CKXA 2CLQA 4L43A 4D1ZA 2C47A 4BHNA 4GK4A 3SRVA 3SXSA 2HCKA 3NUUA 5BX0A 1J91A 2X81A 4EH5A 3FY0A 3O50A 4XP2A 4UZHA 1OL1A 4Z16A 3LFEA 4QP4A 1NVQA 2GS7A 3MVMA 4I6FA 4NM7A 5G1XA 3KKVA 5ACBC 2C1BA 3EYHA 1FQ1B 1ZWSA 3QD3A 2HYYA 3C7QA 4UWCA 2AC5A 2C5OA 1O9UA 5HICA 4N6YA 2IN6A 4KS7A 2WQEA 3UZTA 3UODA 1OKVA 4TXCA 1IAHA 1BKXA 2UZBA 3I0QA 4DFUA 1RW8A 3U55A 5TF9A 4FTMA 4WRSA 2YDJA 4IX3A 3KMMA 5FWKK 2Z02A 4XBUA 4CFVA 3NAXA 4M14A 4DFLA 5HNIX 5IQCA 4G6NA 1U5RA 5D41A 2A1AB 4BVUA 4L01A 3PJ1A 5JMSA 3RINA 1K9AA 4TT7A 4LGHA 4OTIA 4F64A 3W1FA 4H58A 4IJPA 4MXXA 1PHKA 2BDFA 4L53A 2W1HA 3DFCB 3W2RA 4DTBA 3DDPA 4G34A 3DKOA 4BN1A 1J3HA 4YR8A 3TN8A 4DEBA 3L8VA 4GMYA 4YJPA 4WA9A 4CZYB 3RBWA 3TNIA 2V5QA 3PFQA 3OCGA 2R3NA 4YO6A 4UMRA 3S1HA 4L45A 4BFMA 2CGXA 3PVBA 4DH7A 4F6UA 2F9GA 2W1ZA 3HV7A 1XHAA 2OIBA 5E1SA 4BGQA 4O7NA 3FY2A 4D9UA 5HNGA 4FKPA 4XUFA 4DCEA 4EK8A 5E8XA 2WU7A 3MFRA 2NRYA 3UO4A 3RPYA 4LL5A 2DUVA 2R3LA 5ANDA 1BL6A 5BVKA 3NUNA 2OO8X 4FKIA 2ACXA 3UC3A 4ZLZA 2P4IA 5JQ8A 4QD6A 3GT8A 4LG4A 3DJ7A 2RF9A 5BMSA 2BZHB 3AXWA 4M15A 1K3AA 4O6EA 1KWPA 4EL9A 2RSVA 4KIKA 2XJ0A 4A07A 2Y4IC 5M55A 3I81A 4NW5A 3RK5A 4QOXA 2GQSA 5E9EA 3DJ6A 3HZTA 2FO0A 2PVJA 4MYGA 4X6RA 5CXHA 4B6LA 4BGGA 3NGAA 3POOA 2H34A 3OTUA 3PXQA 4FIJA 3T3UA 5M56A 4QTEA 2QOLA 2YEXA 4O83A 4DT9A 2XJ1A 3SKCA 4FL3A 4Y73A 2VWUA 3P7CA 5IUIA 3LQ3A 3DY7A 3EQDA 5KMIA 5DYJA 2OJ9A 2JDVA 3PP0A 2YERA 3FZSA 2KULA 5B0XA 3IDPA 4TY1A 4S31A 3FLNC 4E6CA 4YBJA 1ZOGA 4PPAA 5AX3A 4AW5A 4WOVA 3UBDA 3V8TA 4QTCA 5CENA 5IDNA 5ANOA 5C03A 3KEXA 3QZIA 4OLIA 2BFXA 1BI7A 3F88A 4F7SA 4LRJA 5AP2A 4IB3A 3IG7A 4C3RA 2HXLA 1XQZA 4GRBA 4OAUC 4FTQA 3ZH8A 3NDMA 4EWQA 2JLDA 2VTNA 4JQ8A 1E1VA 3S00A 2FA2A 3QCSA 3A60A 3VNTA 4ZEGA 4NSTA 1YWNA 4X3FB 4ZSGA 4D2TA 3QRTA 2YLEA 3W16A 4BDEA 5CQWA 4ASZA 2QU5A 4G17A 3UJGA 2OK1A 5F1ZA 2XA4A 5F9EA 2XKCA 3HDMA 3BWJA 4I23A 3K5UA 4YLLA 5IA0A 4W9WA 3VUMA 2GNJA 2QO7A 3IONA 4IADA 4DTAA 5FDXA 4A9RA 4RJ5A 4F70A 4YTCA 3C5IA 3EFKA 5EQPA 4M97A 2QR7A 2WMVA 5TT7A 2BZJA 1YKRA 2C69A 3UPXA 4CFUA 3IW6A 3M42A 2ZMDA 3VF8A 3BZ3A 3Q96A 4PMTA 3ZUVA 2EWAA 5B2MA 5HTBA 3LMHA 2GNHA 3CS9A 3BEGA 2ONLA 4FNZA 3TG1A 1JKTA 3AT4A 3DK7A 4C7TA 4AOJA 3HMMA 3MV5A 2HELA 4WG4A 3VC4A 1Z9XA 2ITTA 5B2LA 2Y6MA 2VWXA 4FNYA 3C1XA 4K77A 1M7QA 3R1SA 4IEBA 4DEHA 5KBQA 4ZTLA 2BROA 3DB6A 3P1AA 4C3PA 1UKHA 3KA0A 4M67A 4W8EA 4HVSA 4W8DA 4QMQA 5D1JA 2A4LA 5J9ZA 2R3OA 5I9WA 3DBDA 2OJFE 1H26A 3OW4A 1PJKA 2BAKA 2YWPA 4I1ZA 1VYZA 4R7HA 4DFBA 2C30A 4EK4A 4GEOA 4AGCA 2GHMA 5A54A 4IM0A 2UZVA 3QTWA 5I9UA 2DS1A 4PNIA 4GG5A 3ZUTA 2O65A 1ZMUA 3OTVA 3U54A 2UW5A 3KFAA 4WG5A 3EQFA 5BPYA 5JFWA 3HVCA 4BF2A 2LGCA 3F5XA 3AC3A 3R04A 5CEOA 3LM5A 3A7FA 4ZSLA 1JAMA 4L3JA 2WMQA 3ZO3A 3EKNA 3BYVA 3N9XA 5HVYA 1OL6A 5KNJA 2QO2A 3ZSGA 5IEVA 2H96A 2W99B 3LW0A 3V6SA 2QCSA 4ZMEA 4ZZNA 1Y57A 3VS1A 3CY3A 4TKSA 3VJNA 2BCJA 4RFZA 4M3QA 3D7TB 3HGKA 2PVKA 1IEPA 2HWPA 3UMXA 3F61A 3MDYA 4IWOA 2VX1A 3SA0A 2G2FA 3FHRA 2F7ZE 2W1CA 3L9PA 5E8ZA 4MVFA 3GU5A 4DG0E 3R9OA 4FKVA 3BCEA 3LXPA 2YCSA 3EKKA 3DXQA 1S9IA 4I93A 4XEYA 5FTGA 4QP1A 1PMVA 2ERKA 4EOSA 5EG3A 5BUEA 4QYEA 2PMIA 1M2RA 2PMOX 4MD8E 4AZSA 3ETAA 5E90A 4CTBA 2C0TA 1UU9A 4Q2AA 4X2KA 3QGWA 5T6KA 3TNWA 3ZSHA 3V5LA 5LMKC 4TNBA 4YZNA 1H24A 4QMZA 1Y8YA 1YW2A 4IB5A 5IG1A 5CY3A 4EOPA 3SV0A 5DR9A 2W1IA 4V0GB 3TKUA 1ZYSA 4TWPA 1LPUA 3FLYA 3PG1A 2YHVA 4HZSA 3H9OA 5HD7A 5IEXA 2WOUA 4Y83A 4RWIA 3FEGA 3SOCA 4HGTA 4FTRA 3NZ0A 3LCSA 3OFMA 4LM5A 4ZTQA 5J8IA 4BDCA 1U46A 3A7GA 3QHWA 3PVGA 1WBNA 4GJ2A 2R3HA 4UXQA 5LMAA 4BZDA 2UW0A 3F3UA 2IZUA 5EI8A 5F4NA 5A9UA 4MD9E 4M69A 1S9JA 3LXNA 4RJ8A 3HV4A 5HI2A 4E1ZA 5E8WA 2FSTX 4FKUA 5HG5A 5A46A 1NT2A 4K9YA 3BV3A 2ETRA 2YZAA 4FTAA 3T9TA 3R9RA 3R71A 5EDQA 2XS0A 3JXWA 3UDBA 3WZJA 3ZYAA 5HVJA 4FUXA 4IX6A 3CR0A 3PJ8A 4QMMA 4O0YA 4YZCA 4BCGA 4LMNA 3S2PA 3N4TA 4F9YA 4OT6A 1XO2B 2JIUA 2ZV8A 5D7VA 3KB7A 4JQEA 4KD1A 4U42A 3IOKA 4M66A 4P2KA 5I9VA 4GT3A 3VN9A 3R8LA 2YZLA 1DI8A 3ZZWA 5AP4A 5IA5A 3RPSA 4LUEA 1YWRA 3HRFA 3LJ2A 3R2YA 4MBIA 2A19B 3E8NA 4P7EA 1U54A 2B9FA 4ACMA 2ITZA 3KRJA 1T46A 4FT5A 3L8PA 4Z3VA 1ZYCA 3W2SA 5IA3A 4FA2A 4GJ3A 4BCOA 2JBPA 2IZTA 4J95A 3RK7A 3SQQA 3L9NA 3LHJA 5H9BA 5HX6A 3H9FA 3ODYX 1MQBA 4ANOA 3V8SA 4EOLA 2J4ZA 3HRBA 3Q52A 2CN5A 4GVJA 3QQHA 2YABA 3DTCA 3R2BA 1GZ8A 4HZRA 1HCLA 2W4JA 1GOLA 4H3BA 4O38A 3HDNA 2JGZA 3PPZA 4QNYA 1GIHA 3FZOA 5BYYA 3MYGA 3OS3A 2A2AA 2UZNA 3D2IA 2B1PA 3IKAA 3DPKA 3POZA 1WMKA 1Q8UA 3FQSA 3QQJA 5ANKA 4NKSA 5BNJA 2J0LA 3U6IA 4PPCA 3EQRA 5EDPA 3IK3A 1T45A 1ZOEA 3CC6A 4MQ2A 5FTQA 5LCKA 3O17A 4R3PA 5AADA 3V6RA 1H1QA 2HY81 5J7HA 3L8SA 3ZBXA 2UZDA 1QPCA 3C9WA 3PTGA 4XBRA 3O51A 4H39A 1SMHA 4GL9A 2V22A 4EUTA 4FSYA 2R2PA 4AF3A 4D4RA 1WBVA 2BIKB 3D15A 4X2GA 3UQGA 4HJOA 4CMOA 3TJCA 3BYUA 3EN4A 4D0XA 2VAGA 3SG8A 1APME 3NYXA 5A6OA 5DT3A 5L2IA 4EOOA 2VTPA 3KULB 4IQ6A 5LWNA 2YM7A 1IAJA 1ZMWA 5CQUA 3MGYA 3PP1A 4HYSA 4FV8A 3O96A 3ORNA 3OXTA 3PWDA 2PMNX 2JAMA 4X3FC 4Z9LA 3CPBA 3LXKA 3UYTA 5I9XA 3CD8A 3SC1A 4FZ7A 5HBHA 4I5MA 3KRWA 4BBFA 3EQBA 1UWHA 2GMXA 4HNIA 4JQ7A 3SVVA 1LUFA 5M57A 4I41A 5DWRA 5ITAA 3MPTA 3OF0A 4FSZA 2I7QA 2YJSA 4C2VA 5A4LA 5EYDA 3Q2JA 4AA4A 1KE6A 3ANQA 4N0SA 2W17A 3C0IA 4BTKA 4QMVA 1A9UA 1KE5A 5KMNA 2YLFA 3KMWA 3VBQA 2O5KA 5IPJA 3TDVA 3NSZA 3UP2A 1PXLA 2UVYA 3DLSA 4IAKA 4ZSEA 5IQAA 3NRMA 2NO3A 3VF9A 3R1QA 4AFEA 3FSKA 4O81A 4BTFA 1Z57A 2EXCX 4QMNA 2XM8A 4C57A 1PMNA 1ZMVA 2WTIA 4IX5A 1OI9A 4F9AA 5KMMA 2W4KA 4ITIA 4BCJA 1GIJA 5J5SA 2WQNA 3AQVA 4GIHA 3BLQA 2WKMA 3U4UA 3GB2A 4TYHA 4F7NA 5M07A 4GV1A 4OBOA 4PDYA 1OL5A 5I0BA 4XG3A 1ZZ2A 2CLXA 3C0HA 3FZPA 3BELA 1ZRZA 3PXYA 2R3PA 5T68A 3ZM4A 1PKGA 2WFYA 3D2KA 3QFVA 5AUWA 2NRUA 3DTWA 2Q0NA 3NW6A 5A14A 5IQGA 3BI6A 2GNFA 4U80A 1O6LA 4I4FA 2GFSA 4MX9A 5EK7A 3V04A 3BHVA 4FSWA 3BBWA 2PK9A 4GFGA 3F3TA 4S30A 5HU3A 3CTQA 3WOWA 3LFSA 3AD5A 4D2VA 3FZRA 3G0FA 3D4QA 3DBCA 4Q9ZA 3VW6A 2PVYA 4K1BA 5J95A 1HCKA 4F65A 1H0WA 4O2ZA 2BFYA 3DV3A 5I9YA 4FEXA 3RHXA 3VS7A 2VZ6A 2QNJA 2BHEA 4R1VA 2FUMA 3R7YA 1KOAA 4QQJA 5EFQA 2YFXA 2C5VA 4S33A 3QXOA 4DLJA 3MJ1A 5HCXA 2RFSA 5CU0A 4EOIA 2JDSA 4FV9A 4QP8A 4AGDA 4BBMA 4FKSA 4O6LA 1JVPP 3OCTA 2OSCA 3OHTA 3AG9A 4C61A 2PUIA 2Y8OA 3UOJA 3DB8A 5B2KA 3EFWA 2BRMA 3PZHA 5IEYA 2UW7A 4JDJA 1W98A 2VTJA 2ZDTA 4IVDA 4MXZA 2QQ7A 3UNJA 4ENXA 4XG2A 2I40A 3EWHA 4E20A 3S95A 3LAUA 3BBTB 4BCMA 5BUIA 4MNEA 5F95A 3A7HA 3SG9A 5CX9A 4DBNA 4M68A 3V5PA 4X7QA 5E92A 4E4LA 1QPDA 2WNTA 2XVDA 3LJ1A 3UZRA 4RRVA 3R01A 4C0TA 3HMOA 4C2WA 4CXAA 5IMEA 4C8BA 1PXNA 2XIXA 2YM6A 3RAKA 4GK2A 4USEA 4ID7A 3KL8A 3RCJA 4E4MA 5AP7A 4IAFA 3EN7A 1H28A 2JDTA 5JGBA 2XIZA 5M4CA 3CQUA 3O8UA 4R5SA 2BKKA 5IQBA 4YJSA 1U4DA 2WMXA 1YXXA 3TTJA 2PULA 1GIIA 4JXFA 3TI1A 3C4FA 3V5JA 4FV4A 5CEPA 3I60A 4F63A 5CAVA 2Z7RA 3OEFX 3OWKA 3IPHA 1M7NA 2V55A 4LRKA 2EVAA 3E8CA 1Q8YA 4BWKA 3UNZA 3CGOA 4O1OA 3IW8A 5CAOA 4U9AA 3QWJA 5ETFA 3V5QA 4RPVA 2O3PA 1H8FA 4YSMA 3GCVA 4H36A 5KZIA 3R8UA 3TACA 4ZJVA 2Y9QA 4NL0A 2BDJA 5D7AA 2O64A 4QP6A 5HQ0A 5LMBA 3SD0A 4YSJA 5IUHA 1KUTA 4RVTA 4YPDA 3KRRA 3TWJA 4UMTA 4EEVA 1M14A 4GYGA 5GNKA 1SYKA 4AGWA 2YCRA 4BIEA 4X21A 2OZAA 3CJGA 4S32A 4ZJIA 3KGAA 2B55A 2JKKA 5HG9A 4IAAA 3UGCA 4DFNA 2REIA 4DG3E 4CFMA 5AUXA 2PZRA 2WIPA 2P55A 3AOXA 4FG7A 4E6AA 2CKQA 3PYYA 4L46A 4D1SA 4RIYA 2E9PA 4XJ0A 4G3CA 2VX0A 3VS0A 5DIAA 5KKRB 5FTOA 4FNWA 4XLVA 3R7IA 3HX4A 4ZY6A 4ZLOA 4MBLA 2UW8A 1A06A 3RI1A 1OPJA 1VJYA 2F7XE 2OI4X 3WZEA 4DEAA 4J71A 1JKSA 3QTXA 4BWXA 5LVMA 1W82A 3LJ0A 4XOZA 3BQRA 3G9NA 4KIOA 2HZIA 4F6WA 3R02A 4F0IA 4NM3A 1LP4A 3DKGA 4MD7E 4YZBA 3A4OX 5H8EA 1Q4LA 4XV3A 4XOYA 1FVTA 1OECA 3E63A 3NUSA 3PJ3A 4M0YA 5IQEA 3PXFA 4FEWA 3QQGA 4AW0A 4BRXA 2HOGA 3AGLA 3OOMA 5CF8A 4O0UA 4FTIA 4H1MA 3BV2A 4DFXE 4AACA 5LVNA 1QPJA 4JBQA 2XEYA 3ROYA 5FRIA 1SNXA 4ZS0A 5HCZA 3HUCA 2PE2A 3F3ZA 4C59A 1F0QA 4B8LA 1FVRA 4TYIA 4Y46A 4BCIA 4EZ7A 3A4PA 3ZZEA 4ANLA 2Z60A 4IACA 3MI9A 4AZVA 1FMKA 3F5UA 4M12A 3GUBA 1NVRA 4BCHA 3QKMA 5AUUA 5IZFA 2R9SA 4FI1A 4CMUA 3TUCA 1JSUA 3FBVA 4UMPA 4I4EA 1QCFA 2RIOA 5TOZA 4RX9A 2QODA 4WBBB 3CQEA 5I5ZA 1YRPA 4G9RA 4LL0A 3B8RA 3BE2A 2W5AA 1FGKA 2X8DA 2XIRA 3FMKA 3I0OA 3LLAA 4IFCA 5KZ0A 4PDOA 4E5AX 3NEWA 2B4SB 2IG7A 2X7GA 4BI1A 2XIYA 2ZM1A 3RPRA 4I5CA 4JS8A 4AOIA 4L68A 4LQMA 4YO4A 4EI4A 5M08A 2R3RA 3MY5A 1ZYDA 4J8MA 3G6HA 3MIYA 3ORZA 3ATSA 4O0RA 4GKHA 3NYOA 4E6QA 4O7YA 2GPHA 4DT8A 3CIKA 1FMOE 4S2ZA 2G1TA 5FEEA 1YI3A 2EB2A 4D2RA 5JFXA 2XRWA 4S34A 5J9YA 2XNMA 3BHYA 3Q9XA 1YXVA 4APPA 3ZU7A 1REKA 2CKPA 1YDTE 2WOTA 1JQHA 4IWPA 3FJQE 4IB1A 1YI6A 5ANEA 1A48A 4FT9A 1ND4A 3DNEA 5JKGA 4OAVB 2PMLX 3GC9A 4AA0A 4U45A 2R4BA 4KKEA 3KY2A 4P5QA 5GZ9A 2IW8A 3W2OA 1GJOA 1YOMA 3ZLXA 3DGKA 1BYGA 4FMQA 5LMKA 3PRIA 4RJ7A 4TNDA 5CSVA 4L3PA 4IM3A 3PY0A 2OH4A 4HGLA 2PVMA 5CZIA 4BI0A 5FBNC 4FG8A 3EFJA 4ZTHA 3IDBA 5CVFA 4DEIA 3L1SA 3ORPA 4A9TA 1R1WA 4EHEA 1VZOA 3NNWA 3MFUA 3BU6A 4X6QC 2J9MA 5FDPA 4O7ZA 4I20A 4OTHA 2O0UA 4BYJA 3JS2A 2VUWA 2QHNA 3BE9A 4RWKA 2UW9A 3K3IA 2E9NA 4AX8A 1NY3A 3RGFA 2CJMA 2JKMA 3QAME 5AJQA 4TYGA 2EB3A 4R1YA 2BILB 4FL2A 5D9HA 3SRVB 3VUTA 4AUAA 2HAKA 2PZ5A 4FNXA 2UZEA 3VBVA 3MN3A 2X6DA 1PYXA 2CMWA 5J87A 4FKGA 3LQ8A 5KMKA 1RDQE 2XCHA 4F1MA 2VD5A 4TWCA 2Q83A 4ZXTA 3D5WA 3KF4A 4OT5A 4RA5A 4HYUA 3RM6A 2J5FA 5FLFA 3E93A 2QOIA 4BTMA 3WF5A 4YUQA 3TNQB 4AE9A 3TUDA 3Q60A 3COHA 2NNWB 5CS6A 3QTUA 2HZ0A 4RWJA 3CPCA 4UALA 4RIXB 4IAYA 5HESA 5J1WA 5K4JA 4FGRA 3HMNA 3LFQA 4IWDA 4JR7A 3MVLA 3ROCA 2BMCA 3OMVA 2RKUA 5AV1A 4MXOA 5AV4A 1Z5MA 5E4HA 3V3VA 2WTJA 1CKPA 5AIRA 5L2QA 1SNUA 3ACJA 3OCSA 3QZFA 4GU6A 3R63A 3F7ZA 4IAIA 4M84A 4PMSA 4KINA 2YIRA 4FF8A 4RVLA 4CYJA 5JRQA 1WVXA 5AV0A 3RCDA 3WZDA 4ACGA 2QOFA 4FTNA 3FPQA 2CPKE 3B8QA 2UVXA 3Q4CA 3QQFA 4QTAA 3SXFA 1OVEA 4YZDA 5BVWA 2OF4A 4N6ZA 5CU6A 5LQFA 3KU2A 5ANJA 4FVQA 3M1SA 5HORA 2VWVA 5JEBA 5H2UA 3KF7A 4B7TA 2BIYA 4NZWB 4HVDA 4EKLA 3R9HA 2VWYA 3RKBA 4HCVA 4ZOGA 2IZSA 4YTFA 2WTKB 2CHLA 4DFZE 3PVWA 2XF0A 3IGOA 3VBTA 2PTKA 3BHUA 5L8KA 4APCA 5KCVA 2PZPA 3U9NA 3OVVA 1KE8A 3P7AA 4NKAA 4XG6A 5KO1A 4Y95A 5BVFA 4EC8A 1G8SA 5HIBA 2HK5A 2CDZA 4HCUA 3ORKA 4RFYA 2XK9A 1I09A 1Q3DA 3R83A 4C58A 3W18A 4IBMA 3QL8A 1H4LA 3VRYA 4KIKB 5EW8A 4LFIA 4TTHB 1V0BA 4LGDA 4E8AA 4MEDA 4BCQA 1Q8ZA 4K11A 3MSSA 2EXMA 2OXYA 4C02A 3D0EA 1SVHA 2B54A 2C3IB 4UMUA 2XM9A 3EH9A 2BALA 3AD4A 3PRFA 4FSTA 5AUVA 4FT7A 4F08A 3G51A 1H1RA 4TRLA 3QD0A 1YHVA 4O7SA 5HX8A 3AD6A 4JDHA 1W84A 3KN5A 3FQEA 5FUTA 2J50A 3M2WA 3QD4A 3VS3A 4X3FA 4YJNA 2PE0A 4FV7A 4ZTRA 3UVPA 5JSMA 5KKRC 4IHPA 1M2PA 3DU8A 4A9SA 4DBXA 4JG8A 3TZ9A 2OU7A 3NUXA 3E87A 4PDSA 2PZYA 4A9UA 4KAOA 5E8UA 2X2MA 4PWNA 5JGAA 1PMUA 5HU9A 1JNKA 1QPEA 4TYJA 4FEUA 2EUFB 3QLGA 2PSQA 4YU2A 5AA9A 4ZMFA 4FVRA 5HTCA 5M06A 1OPLA 3OY3A 4USFA 2WQMA 2W1FA 1JSVA 4CQEA 4QMTA 1URCA 3KK8A 4ITHA 4PF4A 4J97A 4KWPA 5DRBA 2C3LA 4JG6A 3OROA 4E3CA 2WO6A 5A3XA 5C4KA 4EOJA 5DN3A 1SVGA 2JIIA 5EQYA 5IH4A 4PL5A 3FLSA 2YCFA 3UG2A 3DQXA 2BAJA 1OIYA 5JGDA 1Q8TA 1UVRA 1PY5A 4R77A 2VNWA 2ZB1A 3ATTA 2BUJA 5EM8A 2BKZA 4MK0A 4YJRA 2GNGA 4F99A 2ZV9A 1PRYA 3D83A 3L9LA 3MBLA 1IRKA 4BDAA 1FGIA 5JT2A 3BYSA 2W1GA 4X3JA 5C01A 4KKGA 3LPBA 2W7XA 4U8ZA 2VO7A 3IGGA 1XH8A 3C4EA 4GT5A 3ZRLA 3AT3A 2PUUA 3PLAE 4YTHA 5A4TA 2RG6A 3KVXA 4R3RA 4EH6A 3OY1A 3QTQA 1DI9A 2WMBA 3IW5A 3EQPA 4ANQA 3ZEWA 1NXKA 3ZONA 3NS9A 4C36A 1FBNA 3NLBA 2EU9A 1QMZA 2WMSA 4L44A 3D7TA 3U4WA 4I0SA 3P79A 5CASA 4FT3A 3ZO2A 3H3CA 3DJ5A 2QOQA 4JDKA 4O0XA 3VBYA 1Q41A 3JVSA 3DDQA 4ANNA 4ZTMA 2C6EA 2X7OA 5HTIA 4BTJA 1YXUA 1OUYA 3UIXA 5IISA 2IO6A 3R22A 4EHGA 4CTCA 3O23A 3RZFA 4Z7HA 2GCDA 2HWOA 3GFWA 4FOCA 5J7BA 5EW3A 2Z7SA 3FDNA 3PJ2A 5ANIA 1NW1A 2QU6A 4U5JA 4YJQA 4AG8A 4G5JA 2JDRA 3EL8A 4GUEA 3UTOA 3R7EA 4JJRA 4M0ZA 4YMJA 3UQCA 4V0GA 2C5NA 4AFJA 5CALA 4P5ZA 2WIHA 2YM3A 2HY0A 4KIPA 4ZS4A 5AUTA 4CRLA 3C5UA 4XMOA 4WT6A 4W9XA 3ZO1A 1IASA 4Z55A 3E8DA 2C4GA 2PWLA 3EOCA 4DN5A 3PE2A 2OIQA 2WMUA 4K6ZA 4MNFA 4BZOA 3TZMA 3LFDA 5A6NA 4L7SA 2VTHA 1BUHA 2PUNA 3CTJA 5FP6A 2VTSA 2OBJA 2XK8A 3MB7A 2CNUA 3NAYA 1H0VA 2WTWA 5CNOA 2I0EA 1DS5A 5CSHA 3ALOA 4J99A 5GINE 2UUEA 5CXZA 4GW8A 2X9FA 4UY9A 3U8WA 5AV3A 3CQWA 4RMZA 4XG8A 5DH3A 4CSVA 4UBAA 4FV0A 5CZHA 2IJMA 3HMPA 4EOMA 5CVHA 4GYIA 5IU2A 2W9FB 5ETCA 4TL0A 2V7OA 4G5PA 4PTEA 3TV4A 3QX4A 2GFCA 4IVAA 2H9VA 2QLUA 4WBOA 5EDRA 4ZP5A 3R9NA 3NX8A 2OJGA 4I5HA 3EB0A 3P7BA 4YTIA 3W2QA 3SW7A 3UIUA 1J7LA 4C35A 2X4ZA 4FKRA 2G01A 4O86A 2HIWA 2E9VA 3PPKA 4D5KA 1GNGA 4XS2A 5DRDA 5B7VA 4PTCA 4D2WA 2PVHA 4D5HA 1REJA 3DLZA 3BYMA 4KKHA 4OTFA 5DOSA 2QONA 4EK3A 4CLJA 3LVPA 3EQGA 2HXQA 4O82A 4Y8DA 4JRNA 3HV3A 3GC8A 3R8VA 5L6PA 2B0QA 2UW6A 1OM1A 3BEAA 3MA6A 3ZDUA 3F2RA 2R7BA 3MH3A 2R3GA 4IE9A 1OIQA 4IW0A 4O0SA 3GCPA 3SW4A 4CLIA 5HCYA 1CDKA 4AOTA 1CSNA 2A27A 2VU3A 2VTQA 3OP5A 3Q9YA 4D55A 3FPMA 5EM6A 3CXWA 4H1JA 3IECA 4FIEA 4EHVA 4A4LA 4IB0A 2XRUA 3FZTA 2RFNA 2UZOA 3I79A 3KRXA 4NFMA 4ZSJA 4YJOA 2C0IA 3BU5A 3QQLA 4RIOA 4WRGA 3R1NA 4O1PA 4QP2A 5LVOA 3FMEA 3PVUA 3ZLWA 1J1BA 4FICA 2V0DA 5FQDC 3LIJA 4DH3A 2NP8A 5CSWA 4EOKA 1WBOA 3LCOA 3FMMA 5HOAA 2ERZE 4A4OA 3OUKA 1B38A 1H25A 2VWZA 2OZOA 3NWWA 5CT7A 3WF9A 2WAJA 5D10A 2OFUA 2Z7QA 4EK6A 4ZY4A 3RP9A 2WB8A 3CLYA 3ALNA 4UZDA 4JX7A 4D4YA 4IZAA 5EW9A 4LOQA 3WIKA 4JT3A 3T9IA 5GIOE 3T3VA 4YNEA 2GHGA 5JRSA 4NIFB 3Q6UA 1GY3A 2C5XA 3Q6WA 3K2LA 3OC1A 4ASEA 1CM8A 4O7RA 3G9LX 4KBAA 2DYLA 4DFYA 2PYWA 2I0VA 3Q04A 5M4IA 3HA6A 4JAJA 2PVRA 3IW4A 4R78A 2JEDA 3PXKA 2XJ2A 2ITOA 3EHAA 5A4EA 3L9MA 1U59A 1MQ4A 3KULA 4FUYA 5M44A 4PL3A 4ALUA 4IDTA 3KK9A 3O71A 1Q99A 5DI1A 2XYUA 3ENHA 3EN9A 2CCIA 3UPZA 3F2NA 4O84A 2IPXA 4FIGA 3DOGA 1LEZA 4F7LA 4A06A 4R7BA 4BCKA 2YDIA 3SDJA 2JITA 4CGAA 4AN9A 5CAPA 2FSLX 3QUPA 3ORMA 4BKYA 3S4QA 3DKFA 4JG7A 2C6OA 2CN8A 2XP2A 4AWIA 2WU6A 4BDIA 3THBA 2XK7A 1DAWA 3GQIA 3FXZA 3NPCA 4LV8A 3H10A 4EONA 3MY1A 4BY9E 2GS2A 3ANRA 2ITQA 3VBWA 2I0HA 4YHJA 5AP0A 3E92A 5L8JA 4II5A 4QPSA 1R0EA 4LV5A 4E7WA 4QYGA 4TN6A 3GP0A 2HW6A 3K3JA 1ATPE 2ETKA 3ORLA 1XBCA 3QC9A 5DVRA 4O0VA 3R7UA 2HZ4A 1SM2A 3DK3A 4MH7A 5EI6A 5LARA 1TVOA 3QTZA 2JFMA 3RVGA 2WTDA 3O7LB 1H07A 4DEGA 3R73A 4C4IA 3ZMMA 2FSOX 4K8AA 5ICPA 5DT4A 3A8XA 4RX7A 2H8HA 4IXPA 3UYSA 2QOKA 2UV2A 1JLUE 2ZDUA 2BPMA 4L67A 2ITUA 2WQOA 4L7FA 3EJ1A 4PQNA 1OL2A 1PXJA 2ZAZA 4TYEA 4CFFA 3OOGA 3NW7A 2IVVA 2FB8A 2OXXA 4HOKA 3HRCA 5TR6A 3TKIA 3W10A 5KMOA 4XP0A 4OTPA 5AR7A 4AU8A 4E6DA 4OGRA 3A99A 2YACA 4JR3A 5AV2A 5L8LA 4C4HA 5EYKA 4B0GA 2ITVA 4XG9A 3VWAA 4WNPA 4D2SA 4AS0A 3O7LD 1OKWA 3VS6A 4A7CA 3IDCA 4FZFB 4QT1A 5EOBA 3MVJA 4HPTE 3E8EA 4EQMA 4UMQA 4Q9SA 3GCUA 3TZ8A 1Q97A 4GG7A 2VTRA 3I5ZA 5JH6A 3I7CA 3R28A 1PXIA 2VTLA 3D5XA 4XH6A 5FM2A 4E73A 2YWVA 4XV2A 5AFVA 4E4NA 3WF6A 4OTRA 1MUOA 3HL7A 4EOQA 2E9UA 2Z7LA 4AT5A 5CI7A 3UVQA 3CE3A 3PZEA 4KRDA 3E7VA 4YC3A 4IWQA 4JLCA 4C4JA 4C4EA 3I4BA 3FWQA 3FMNA 4K2RA 2I6LA 3QQKA 3HV5A 2HW7A 4R3CA 5L2SA 4ZAUA 5LJJA 4FIHA 2BDWA 1YHWA 2I1MA 3IQ7A 4PTGA 5E91A 2Q0BA 4CKJA 4CQGA 2X39A 2ZOQA 1H1WA 3A2CA 5FP5A 4DC2A 1NA7A 4FODA 4J52A 4JBVA 4WD5A 3GC0A 4FC0A 4ENYA 4I0RA 1IA9A 3JR1A 3P23A 2WMWA 3E88A 4QTDA 1CMKE 3AT2A 2ZV2A 4P4CA 2WMRA 3WF7A 4U43A 4B9DA 1E9HA 4WSQA 4BB4A 2XEZA 1YVJA 2XBAA 3BQCA 3FMJA 2PVLA 3GU4A 3HAVA 3CBLA 2JKQA 3FE3A 5CSPA 5EM7A 4G3EA 5DR2A 1TQMA 2FGIA 4IH8A 2Y7JA 3QC4A 2QR8A 4FKWA 4JNWA 5TO8A 4XRLA 3QUEA 3KQ7A 3LFFA 4ACCA 4I21A 3I5NA 5AP6A 2ITXA 2P2IA 4QQ5A 4FZAB 1WZYA 5IKWA 4DHFA 3NVMB 4FR4A 2VRXA 3BRBA 5I4NA 2JFLA 2C1AA 4DAWA 1YQJA 5CVGA 3NYNA 4U3ZA 4D58A 2QOHA 3VJOA 2OW3A 3C4WA 3R30A 4CKIA 2W4OA 3FUPA 4FKJA 4BC6A 3KREA 1NVSA 4W4YA 5DA3A 5BUJA 2VO6A 5AM7A 4BDFA 1I44A 2ZYBA 3WBLA 1UWJA 2R7IA 3EIDA 2X8IA 3QZGA 4RC3A 4PV0A 3PPJA 4ACDA 5T3QA 5GHVA 4DGGA 3FXWA 3N4VA 3VRZA 2JC6A 4DGOA 5CF6A 4KSQA 3RNIA 1GAGA 3C50A 4XYFA 5EH0A 4IC8A 4EH2A 2J0KA 1BX6A 4QYHA 3GCQA 1UV5A 1FINA 3WZUA 2R3QA 3PIZA 3ET7A 4UYAA 2OGVA 4WG3A 1ZYJA 4C4FA 3FKNA 4ZLYA 1OKZA 2QD9A 1Q61A 3QD2B 5BVOA 3D9VA 4F9WA 1DAYA 1V0PA 5CAQA 4BIDA 4QP3A 2C68A 2QKWB 3OWPA 3GU6A 3P0MA 5KE0A 2F57A 1H1SA 2RG5A 4DGMA 3W32A 3KXMA 4YPSA 3D7ZA 3UO5A 2XZSA 1CTPE 3ORTA 4M7IA 3MA3A 3Q5ZA 3GGFA 4RJ3A 3II5A 1P5EA 4EH9A 4X0MA 5C1QB 4O0TA 5CF5A 3VIDA 2XUUA 2BHHA 3C51A 4O2PA 1H01A 1FOTA 3FV8A 3R00A 4R8QA 2X2KA 4GSBA 3BKBA 4EUUA 5K0KA 3ZEPA 1P14A 3R7GA 2E2BA 4QPMA 3VS4A 3GOKA 4RLKA 3L8XA 3ENMA 3FMLA 4NK9A 4BZNA 3MTLA 4C4GA 3RAHA 4RIYB 3MJ2A 4X2FA 2ITWA 4P90A 4RGJA 3LZBA 4LMUA 5EKOA 4QTBA 2YIWA 4GFMA 3HAMA 4EH7A 4J96A 5HD4A 2YAKA 4JAIA 3T8OA 4E5WA 4IMYA 2XKDA 2OFVA 4IAZA 4ACHA 3EYGA 2WEIA 3KVWA 5HLPA 2P0CA 5BYZA 1RE8A 4MF1A 4D28A 2XK4A 4ALWA 2WTCA 4O91A 1OPKA 5GJGA 3F5GA 2YISA 1BMKA 5HG7A 3U51A 5HO8A 1ZY5A 4AZEA 2YM4A 3E5AA 5KBRA 3R8PA 4W4WA 2UZUE 4QMPA 5LXMA 1SVEA 4RT7A 4U81A 3FXXA 5BVEA 3ZRMA 4QMYA 2E9OA 1WBWA 3NNXA 5AP3A 1URWA 2R0IA 3OBGA 5DEYA 5HGIA 3MFSA 1BI8A 3HMIA 2B9HA 2VV9A 4GVAA 3RWPA 3WE8A 3DAEA 3MW1A 3AGMA 5K4IA 4WSYA 3DT1A 1L3RE 1PF8A 3JPVA 4JBOA 4I5PA 1DM2A 1LEWA 3FI3A 4NFNA 4BL1A 4BDGA 4YURA 2IW6A 2X6EA 1GZNA 3HUBA 3NNUA 4WNOA 5KHXA 4D9TA 2W96B 5AUYA 4EH4A 5HIEA 5HLNA 2ZB0A 3HKOA 2XKEA 4QRCA 3FKLA 3R8ZA 4GIIA 4AZFA 3G6GA 3KXGA 3ZHPC 4TPTA 3TNHA 3GFEA 3DA6A 3MWUA 3MB6A 4RX8A 4CNHA 3G33A 4Q5HA 5DGZA 4MTAA 4NU1A 4RSSA 3VW8A 5BVDA 1J7UA 3BU3A 4FK6A 4I6HA 3VO3A 5M53A 3BYOA 4NYEA 3LFCA 3VUKA 3GU8A 2FVDA 4UV0A 2XK6A 4KIQA 3PA3A 3TKHA 2VTTA 2WQBA 4UB7A 2QVSE 1ZAOA 2W1EA 4U79A 3B2TA
chains in the Genus database with same CATH superfamily
3MPAA 4UYNA 2XB7A 3SLSA 3TTIA 2PZIA 3LXLA 3GU7A 3PA5A 2IVSA 3PDTA 5E8YA 4KNBA 4RIWB 3RPOA 4OR5A 1AGWA 2OICA 2YITA 4XRJA 4D4VA 3WILA 3NCGA 1Y8GA 3AC4A 4CVAA 3QCQA 3PXZA 1TZDA 5EOLA 2XALA 1W83A 2CGWA 1OL7A 5FEQA 2QG7A 1WFCA 3RK9A 4HNFA 2WGJA 4QMSA 4BCNA 4O7TA 2G2HA 4PX6A 2R3KA 4L42A 4EWHA 5JK3A 5AEPA 4IDVA 4QPAA 3TIZA 2W0JA 1UNHA 3FC1X 5HHWA 2F4JA 3HECA 4I92A 1L8TA 3SXRA 4GU9A 5BVNA 2O2UA 2XNEA 1G5SA 3GEQA 4O22A 4R6VA 3GNIB 4YNOA 3HA8A 2LAVA 4GK3A 5AA8A 1B39A 4K18A 5F20A 4ZJJA 3R6XA 3FLWA 1K2PA 5CF4A 1O6YA 3EZRA 1OIUA 3FL5A 4FT0A 4FV1A 3UMWA 4ANBA 4C3FA 3FSFA 4GS6A 1XH6A 1XMMA 2CNVA 4E4XA 2P3GX 3BLHA 4EH3A 1F3MC 1UNLA 5J5TA 4PP9A 2KTYA 3WZKA 4AXDA 5DT0A 1Q24A 3W55A 4ZZOA 3W0MA 4LOOA 4DEDA 4RIXA 2YA9A 4ERWA 2Y4PA 4ANSA 3LKMA 1EH4A 2C0OA 4LOPA 4KBCA 5AR5A 2ZM3A 3KMUA 4F9CA 3WARA 5HVKA 4PY1A 1R0PA 3LMGA 4OTWA 3GBZA 5FG8A 5DE2A 4QEBA 2ITYA 1YI4A 1YWVA 3FHIA 3Q3BA 4FV3A 1IA8A 4B4LA 1HOWA 4I0TA 3UVRA 4DH8A 2UW3A 3P5KA 4IZ5A 4J7BA 4PMMA 5GIPE 1MRUA 4FIFA 2OKRA 4NTTA 2BRGA 2GTMA 4EJNA 1XBBA 3W33A 1XR1A 5J79A 4NT4A 4EC9A 3COIA 1TQIA 2W1DA 4W4VA 3QYZA 1OITA 4FE2A 4U40A 3ZBFA 3WYYA 4DGLC 5E8TA 3VUDA 1F5QA 2OH0E 1ZY4A 3CTHA 4E26A 4MXAA 4O4DA 4MWIA 4RQVA 3Q9ZA 1R3CA 4IM2A 4IC7A 3N51A 3LFBA 3F9NA 3BGQA 4W4XA 4G9CA 3RAIA 1Q3WA 2YJRA 1V1KA 3NUPA 4NEUA 4RA4A 5F94A 4LYNA 4G1WA 5HIDA 4FBXA 3CKWA 4D1XA 1XH5A 4FIIA 5L2TA 3Q4ZA 4NM0A 5AAFA 1XH4A 2GU8A 1WBTA 4RWLA 3HP5A 5EYMA 5CAUA 2VN9A 3PE1A 4DLIA 1IG1A 4FKTA 3MS9A 4NWMA 3RJCA 2J2IB 3KCFA 3U87A 2QO9A 4C62A 1WVWA 1KV1A 3FLZA 4FG9A 4AT3A 4F6SA 5LWMA 4MXYA 2OIDA 4AN3A 2VWWA 3C4ZA 2X7FA 1MP8A 4V04A 4BYIA 3R0TA 4IVCA 2OXDA 2UZTA 5HKMA 1CKIA 3WYXA 4CT1A 5AUZA 3UIMA 3G15A 3PSDA 4M13A 5HO7A 2IEWA 4XV1A 2C3JA 3DFAA 1Y91A 5JFVA 3BL9A 1W7HA 3OXIA 3COMA 3RAWA 3ZC5A 1PKDA 4ONAA 3ZM9A 5GZ8A 4DHJA 3AC5A 3QTRA 2WZJA 1V0OA 2UVZA 5IA2A 4DG2E 3JY9A 4H3QA 3V51A 3FI2A 2W06A 2WMAA 3I7BA 3NIEA 2PY3A 1J1CA 2IWIA 4BHZA 3TNPC 1OKYA 1KE7A 3H0ZA 5KMJA 3BHHA 4YP8A 3Q4UA 3GXLA 4QP7A 3WIGA 2W9ZB 3DK6A 4FOBA 3SGCA 3QGYA 2YDKA 5KUPA 2R3FA 2OG8A 2AUHA 2F7EE 5DLSA 5ETAA 5AWMA 4F7JA 3VQHA 3QA0A 5DBXA 4O7WA 4GT4A 4I3ZA 5CU4A 3V8WA 4DGNA 2FYSA 3U9CA 3ZFYA 5IH6A 1W0XC 4O21A 1UU7A 4NJ3A 2WMTA 4QQCA 1OBGA 3MPMA 4BDKA 3A62A 4CD0A 4F0FA 3P78A 4OBPA 3ZTXA 2PVFA 4G6LA 1SZMA 2F49A 3OXZA 4IJ9A 4HGEA 4TZRA 3MH2A 3QKLA 1BLXA 4KS8A 3UOHA 3MY0A 4DF3A 5DPVA 1OGUA 2IVTA 2ETMA 4J53A 4PP7A 3DZOA 5CT0A 4N57A 4FRFA 1YOJA 4TW9A 3PSBA 5AR2A 3PSCA 4O4FA 4YHFA 4OBQA 3E3BX 5GJFA 3W8QA 4CEGA 2OF2A 4JDIA 4YLJA 2BTRA 4YC8A 5FXQA 3OZ6A 5IQDA 3PLSA 4DA5A 2AC3A 2P2HA 3GI3A 5EHOA 1JKKA 4ANMA 4KBKA 4MHAA 2VWBA 5CEMA 3N4UA 3BIZA 3DXNA 3P4KA 3IS5A 3ID6C 4UWYA 3SAYA 4A4XA 2NPQA 4UWBA 4HVGA 1AD5A 4G16A 2J5EA 4EBWA 5JZJA 2R3JA 3NR9A 2BVAA 3KRLA 2W05A 2J0JA 2W5BA 1X8BA 4JBPA 4FSQA 4WKQA 4F4PA 4C33A 3R7OA 2PL0A 4D4SA 3NVKI 4U7ZA 3Q32A 3V5TA 3TYKA 3NYVA 4GUBA 3TV6A 3F3VA 4Y85A 3UO6A 5DR6A 4YZ9A 3ZDIA 3OEZA 1OB3A 3CEKA 1PXPA 4L9IA 4R7IA 4RX5A 4U3YA 3Q9WA 5J9LA 3MFTA 3FKOA 1LR4A 3DAJA 3LFNA 3S3IA 3Q4TA 1RJBA 4AZWA 4CCUA 1Q5KA 3LE6A 4FTLA 4O7LA 1G3NA 4N70A 4QMUA 3TT0A 1ZYLA 4A9YA 4BKZA 4RBLA 3E7OA 3E3PA 1ZZLA 3EQIA 2V62A 3F66A 3VS2A 3ORIA 5IUGA 4NCTC 1UNGA 1JPAA 4MF0A 3R1YA 1WCCA 4KUJA 3W0OA 3ZFXA 4GKIA 1XBAA 3AMAA 3G2FA 4ZSAA 3GOPA 3QHRA 5G6VA 5IMXA 5L4QA 5L6OA 3FLQA 3QWKA 3NUYA 5LVPA 5HE2A 1W8CA 1UKIA 3FYJX 3FYKX 3ORXA 2X0GA 4OTDA 4XHKB 3NMUF 4FTTA 4EZ5A 3PIYA 4PRJA 4XG4A 4FZ6A 3TIYA 4DITA 4DTKA 3KCKA 1M2QA 3K54A 2GTNA 5AP1A 3CD3A 4DH1A 2OJJA 4FSNA 2ZVAA 4HYIA 2Z8CA 5ANGA 5AP5A 4IZYA 2B9JA 3UOKA 3O8PA 4YHTA 3QU0A 2X9EA 3TEIA 4CCBA 4BDBA 3ACKA 2BR1A 5E8VA 4PMPA 5I3RA 1PW2A 3QRJA 3W2PA 4YJUA 3OD6X 4FV5A 4AE6A 3BWFA 5LVLA 1RQQA 3ZXZA 5AAEA 2R64A 4GH2A 5IQFA 1XH7A 1YXTA 3F2AA 4MWHA 3VHEA 2GHLA 5M4FA 5AR4A 5C27A 4DCAA 1AQ1A 4FTCA 4Y5QA 1IR3A 2CGVA 3RMFA 3PIXA 3KXZA 4UEUA 3LM0A 3RWQA 2P33A 3KXNA 3UOLA 4EORA 4YZMA 1W2FA 4M69B 2YM8A 5FEDA 3RM7A 5JN2A 3ULIA 4CYIA 1H00A 2VX3A 2GQRA 5GJDA 4PDPA 3TL8A 4FTKA 2JKOA 4ORKA 3LQ5A 2YCQA 4DEEA 3G0EA 4IVBA 4C37A 5E1EA 2YIYA 4J8NA 5DMZA 5IDPA 5L2WA 3C4XA 3LCDA 3RTPA 2GDOA 4XV9A 5IF1A 4X2NA 3TCPA 2GNLA 5DHJA 5HO6A 1MRVA 3ELJA 4RC2A 4YJTA 3I1AA 3V5WA 3WI6A 5DFPA 1KOBA 2QOBA 4AW2A 2XAOA 3LFAA 4JRVA 1Q8WA 2OWBA 5TKDA 3TXOA 5I9ZA 3QA8A 4JL9A 4NH1A 4EH8A 1ZLTA 2X2LA 3P08A 3NNVA 3QLFA 1GZOA 2XNBA 4EBVA 3FMHA 5CANA 4FX3A 3TJDA 1JBPE 3UP7A 5M09A 2Y0AA 4JIKA 4U41A 4YLKA 4MQ1A 2JD5A 1U54B 3AMBA 4HYHA 5CNNA 2ITPA 2PU8A 2QG5A 2WTKC 5FXRA 3EMGA 3QKKA 1FPUA 4EJ7A 2VTAA 5K9IA 1PXOA 3VVHA 2PPQA 4G3GA 4GFOA 2J51A 3QRKA 2I0YA 2CKEA 3PY3A 3VHKA 2SRCA 4AT4A 4AW1A 1TKIA 3CCNA 2R3IA 3DZQA 3EFLA 1B6CB 4B99A 3ZFMA 4PUZA 5K0XA 4DE4A 5A4QA 3ZXTA 4BIBA 2JDOA 2YN8A 3G5DA 2J90A 1YDSE 5K5NA 3ULZA 2AYPA 4O0WA 4FSUA 4FSRA 3BHTA 4L6QA 4U6RA 4DH5A 5KHWA 2QC6A 3DNDA 4RG0A 4EQCA 1UU8A 4G31A 3GCSA 2C6KA 1BL7A 2X4FA 4NIFA 4MCVA 2CNQA 4CG8A 2ZM4A 1OMWA 2F2UA 4CFWA 4AA5A 3B2WA 3DAKA 3QXPA 3VQUA 3FMDA 2W5HA 4FV6A 4MAOA 3GQLA 4V05A 5EM5A 5GZAA 3UG1A 1VEBA 5CEKA 1WAKA 4BR3A 4C38A 1R78A 4FYOA 2ITNA 4QMWA 1Y6BA 5C8MA 4BDHA 3M11A 1XH9A 4NW6A 5D12A 4RQKA 5CEIA 5FD2A 5EHYA 4BCPA 3ZLSA 4JX3A 5DEWA 5AR8A 4BBEA 1H27A 2ZMCA 4NTSA 4ZTSA 2G2IA 5JZNA 4QDVA 4KSPA 1W2CA 3NW5A 3TUBA 5L6WL 5JQ5A 4CG9A 5HE3A 2WPAA 2J7TA 2R0UA 3NUAA 3F7WA 3Q2MA 3QRIA 3ZLYA 4BKJA 3A61A 3KXHA 5IA4A 4FEVA 1U5QA 4FTJA 1E1XA 4L00A 4PNKA 3KXXA 4ZY5A 4FTUA 3CP9A 4YJVA 4RLLA 1OBDA 1TFFA 1YDRE 4EK5A 1VYWA 4QMXA 4QYYA 3HV6A 2R5TA 3REPA 3UIBA 2C6LA 4AAAA 5C4LA 5D11A 2IF8A 3BLRA 2PVNA 2R3MA 2DQ7X 2XYNA 1J7IA 2C3KA 2PE1A 3I6WA 4CFXA 3EQCA 4I6LA 3V01A 3PY1A 1JWHA 3E64A 3WF8A 3S0OA 4O4BB 4CKRA 2YAAA 3A7JA 2ONLC 4RJ4A 3FL4A 3HP2A 4XG7A 3W0QA 2XNGA 3EN5A 2JBOA 3FZ1A 5E7RA 2UW4A 4RVMA 1JOWB 2GNIA 3CY2A 4KB8A 3FAAA 3HLLA 2XIKA 4FL1A 3KIOC 3AC2A 4O96A 2J6MA 4FTOA 2VNYA 5HLWA 3U6JA 2JIVA 4IZ7A 3ZS5A 4FVPA 3I6UA 4L3LA 3MVHA 2VWIA 2B52A 3QZHA 4TYHB 2VGPA 3O8TA 5TE0A 4O7VA 3DQWA 4RJ6A 3W0NA 3D94A 3AC8A 4F1TA 2BTSA 1GZKA 3GENA 4FKLA 3DS6A 2VTMA 3IO7A 3LLTA 3VUHA 5JFSA 1OGYA 4FYNA 4H05A 3DBFA 4IX4A 3TV7A 3ZC6A 3K5VA 4CRSA 3F5PA 4ITJA 4QO9A 4BDJA 2CKOA 2IZRA 4X2JA 4ZK5A 2BZKB 2CSNA 5EHLA 5CI6A 4WUAA 4L8MA 1YXSA 5HNBA 4DINA 1R39A 2B53A 2X8EA 4JIAA 3OT8A 3DCVA 4LGGA 2F2CB 2B7AA 3VS5A 4AZTA 5EKNA 2Z2WA 3JY0A 4PL4A 3ZO4A 4CV9A 2XBJA 5C8NA 3UNKA 2Y6OA 2CGUA 4DYMA 4U97A 3EL7A 1OIRA 4IANA 5AAGA 3RHKA 3QBNA 3VULA 2XNOA 5LOHA 2O63A 2UZLA 4OW8A 3PWYA 5HBEA 3ZRKA 2H6DA 4FSMA 4YGAA 4AP7A 1M52A 1YHSA 2QLQA 3EN6A 4MUQA 4HCTA 3Q53A 4N4SA 1PXKA 3MH0A 2YIQA 4U44A 4JOAA 4FKOA 3FI8A 4CZUA 3TDWA 4G2FA 4GCJA 3QCXA 3R8MA 3QCYA 3HEGA 4EYMA 4XX9A 4CV8A 4E5BA 3JUHA 3HNGA 1CKJA 4QQTA 2X0OA 3D5VA 2QHMA 4WUNA 5CYIA 4EHZA 5CSXA 4FGBA 4HVHA 3ZCLA 2XNNA 2QI8A 4BCFA 3QF9A 3UC4A 3C0GA 3F6XA 4C34A 1TQPA 3H30A 1WBSA 4ZIMA 3RALA 5M51A 3UE4A 1H1PA 4ZTNA 4KABA 4NM5A 2UZWE 3QTIA 4KRCA 3QX2A 4MKCA 2YM5A 1WVYA 5HE1A 4USDA 1VR2A 3QUDA 3KN6A 1UU3A 2C6MA 4M8TA 4HGSA 4NJDA 4Z7GA 5AIKA 4MNEB 4RC4A 3R7VA 4CZTA 4J98A 3MESA 4QMOA 3QALE 3LCTA 3QRUA 4ARKA 4V01A 4AXAA 4L52A 3D5UA 1ZOHA 4XCUA 2QOCA 4Y72A 4WHZA 4RFMA 5DG5A 3G90X 2G9XA 1JSTA 2PUPA 2QOOA 4PPBA 4CFNA 1G8AA 2ESMA 3H4JA 4I24A 2VO0A 4G6OA 4IIRA 3SX9A 3VUIA 4D0WA 4QP9A 5M4UA 2DWBA 3BLAA 3EZVA 3F82A 3R9DA 2VTIA 3UQFA 2XNPA 3CJFA 3OWJA 3F69A 3QYWA 4F9BA 5I3OA 3PXRA 4J1RA 3CSVA 2Y4IB 3BPRA 2C6DA 4QMLA 5H8GA 3HYHA 1ERKA 3DKCA 3OW3A 4CMTA 5FGKA 4ALVA 3FC2A 3ERKA 4FV2A 3AMYA 2WTVA 2GQGA 5AX9A 3ZUUA 5AMNA 4F0GA 5BYLA 2WD1A 2RFDA 4K33A 4HPUE 5A4CA 1G8KA 3RPVA 1O6KA 2O8YA 2G15A 3BX5A 5ETIA 5LCJA 4I22A 3OBJA 2C5YA 4QNAA 5BQ0A 3QQUA 5IQHA 4BWPA 4AQCA 2PHKA 3ZOSA 5CU2A 4FKQA 3MTFA 3P86A 5ACKA 4FK3A 4K0YA 4XP3A 2OZAB 5CU3A 4MBJA 3PA4A 3C13A 2CCHA 4OTGA 1XWSA 3E62A 4LI5A 3GVUA 4F1OA 4LUDA 1UA2A 2IW9A 4O4EA 3SHEA 2BZIB 5AR3A 4BI2A 4EKKA 4EYJA 4UN0C 4JVGA 5FM3A 3W0PA 3PJCA 4H3PA 1OUKA 3OG7A 5HG8A 4OTQA 3RZBA 3PG3A 5HBJA 4WNKA 1XJDA 2ZV7A 2BRBA 4RVKA 1P4FA 5FXSA 5IH5A 4XNEA 2VTOA 5C9CA 4F09A 5J1VA 3JYAA 2XH5A 2HENA 5C8KA 4AN2A 4UX9A 2QURA 4Y5HA 3DBQA 5IA1A 2FH9A 4RZWA 2WXVA 4HVIA 3NCZA 5HEZA 5CTPA 3SOAA 4WO5A 4TWOA 2VGOA 2ZJWA 3OCBA 3W2CA 5C26A 5IQIA 1H08A 2QKRA 4BDDA 1P2AA 3BGZA 4BICA 2WELA 4IFGA 3TZ7A 2V7AA 3EQHA 2XCKA 2XKFA 4ASXA 1OZ1A 5HZNA 4ASDA 5H3QA 3FQHA 5CEQA 2BAQA 3VBXA 3A7IA 3PUPA 3O0GA 3OWLA 4G3DA 5BMMA 1FVVA 4I94A 4YBKA 1Y6AA 2WEVA 5L3AA 2GSFA 1MRYA 4NUSA 4WIHA 2RL5A 3H0YA 3R21A 2HZNA 3BGPA 5CWZA 3JVRA 4I6BA 3VAPA 3VUGA 4XLIA 2BRHA 3IOPA 3MH1A 3KC3A 3C4CA 4AXEA 4EZ3A 3W0RA 2RGPA 3IW7A 4G3FA 4KA3A 2EXEA 2J0IA 2WHBA 2X1NA 4EQUA 3A8WA 5KX8A 2J0MB 4TWNA 4BGHA 3H9RA 4D2PA 3U6HA 2B9IA 3QTSA 4B8MA 2OLCA 5EYCA 3Q5IA 5KMLA 4E93A 1PYEA 2IVUA 3O2MA 3OT3A 5DNRA 4UXLA 3LMIA 5CLPA 3D14A 4QYFA 4OUCA 5K5XA 4O27B 3MIAA 3COKA 4WNMA 4HW7A 2YIXA 5H8BA 3ZSIA 3UZPA 1JKLA 5E8SA 2OJIA 3FI4A 4YC6A 2C6TA 4ZZMA 3LOKA 3DBEA 3RNYA 1QL6A 5FBOA 2XMYA 4JI9A 4U0IA 3TM0A 3NIZA 3P9JA 4NCTA 1Q62A 3CGFA 4MXCA 4R5YA 4CT2A 2C6IA 3LCKA 3AC1A 3ODZX 3OUNB 3ITZA 1KSWA 1P4OA 2BRNA 2GS6A 4FEQA 3F3WA 4AGUA 1KV2A 1M17A 1XKKA 1ZXEA 3WE4A 4RIWA 4RZVA 5AM6A 5EQEA 4Q5EA 1KE9A 1YOLA 2FSMX 2JAVA 2XK3A 5K3YA 4LRMA 4F78A 3GC7A 2VO3A 3DXPA 1PMEA 1WBPA 1ZARA 5HE0A 3W8LA 1PXMA 5EI2A 1STCE 4ERKA 2A0CX 4FZDB 2RFEA 4I6QA 3CKXA 2CLQA 4L43A 4D1ZA 2C47A 4BHNA 4GK4A 3SRVA 3PUFC 3SXSA 2HCKA 3NUUA 5BX0A 1J91A 2X81A 4EH5A 3FY0A 3O50A 4XP2A 4UZHA 1OL1A 4Z16A 3LFEA 4QP4A 1NVQA 2GS7A 3MVMA 4I6FA 4NM7A 5G1XA 3KKVA 5ACBC 2C1BA 3EYHA 1FQ1B 1ZWSA 3QD3A 2HYYA 3C7QA 4UWCA 2AC5A 2C5OA 1O9UA 5HICA 4N6YA 2IN6A 4KS7A 2WQEA 3UZTA 3UODA 1OKVA 4TXCA 1IAHA 1BKXA 2UZBA 3I0QA 4DFUA 1RW8A 3U55A 5TF9A 4FTMA 4WRSA 2YDJA 4IX3A 3KMMA 5FWKK 2Z02A 4XBUA 4CFVA 3NAXA 4M14A 4DFLA 5HNIX 5IQCA 4G6NA 1U5RA 5D41A 2A1AB 4BVUA 4L01A 3PJ1A 2X0PA 5JMSA 3RINA 1K9AA 4TT7A 4LGHA 4OTIA 4F64A 3W1FA 4H58A 4IJPA 4MXXA 1PHKA 2BDFA 4L53A 2W1HA 3DFCB 3W2RA 4DTBA 3DDPA 4G34A 3DKOA 4BN1A 1J3HA 4YR8A 3TN8A 4DEBA 3L8VA 4GMYA 4YJPA 4WA9A 4CZYB 3RBWA 3TNIA 2V5QA 3PFQA 3OCGA 2R3NA 4YO6A 4UMRA 3S1HA 4L45A 4BFMA 2CGXA 3PVBA 4DH7A 4F6UA 2F9GA 2W1ZA 3HV7A 1XHAA 2OIBA 5E1SA 4BGQA 4O7NA 3FY2A 4D9UA 5HNGA 4FKPA 4XUFA 4DCEA 4EK8A 5E8XA 2WU7A 3MFRA 2NRYA 3UO4A 3RPYA 4LL5A 2DUVA 2R3LA 5ANDA 1BL6A 5BVKA 3NUNA 2OO8X 4FKIA 2ACXA 3UC3A 4ZLZA 2P4IA 5JQ8A 4QD6A 3GT8A 4LG4A 3DJ7A 2RF9A 5BMSA 2BZHB 3AXWA 4M15A 1K3AA 4O6EA 1KWPA 4EL9A 2RSVA 4KIKA 2XJ0A 4A07A 2Y4IC 5M55A 3I81A 4NW5A 3RK5A 4QOXA 2GQSA 5E9EA 3DJ6A 3HZTA 2FO0A 2PVJA 4MYGA 4X6RA 5CXHA 4B6LA 4BGGA 3NGAA 3POOA 2H34A 3OTUA 3PXQA 4FIJA 3T3UA 5M56A 4QTEA 2QOLA 2YEXA 4O83A 4DT9A 2XJ1A 3SKCA 4FL3A 4Y73A 2VWUA 3P7CA 5IUIA 3LQ3A 3DY7A 3EQDA 5KMIA 4LDTA 2OJ9A 2JDVA 3PP0A 2YERA 3FZSA 5DYJA 2KULA 5B0XA 3IDPA 4TY1A 4S31A 3FLNC 4E6CA 4YBJA 1ZOGA 4PPAA 5AX3A 4AW5A 4WOVA 3UBDA 3V8TA 4QTCA 5CENA 5IDNA 5ANOA 5C03A 3KEXA 3QZIA 4OLIA 2BFXA 1BI7A 3F88A 4F7SA 4LRJA 5AP2A 4IB3A 3W0SA 3IG7A 2NYAA 4C3RA 2HXLA 1XQZA 4GRBA 4OAUC 4FTQA 3ZH8A 3NDMA 4EWQA 2JLDA 2VTNA 4JQ8A 1E1VA 3S00A 2FA2A 3QCSA 3A60A 3VNTA 4ZEGA 4NSTA 1YWNA 4X3FB 4ZSGA 4D2TA 3QRTA 2YLEA 3W16A 4BDEA 5CQWA 4ASZA 2QU5A 4G17A 3UJGA 2OK1A 5F1ZA 2XA4A 5F9EA 2XKCA 3HDMA 3BWJA 4I23A 3K5UA 4YLLA 5IA0A 4W9WA 3VUMA 3UDSA 2GNJA 2QO7A 3IONA 4IADA 4DTAA 5FDXA 4A9RA 4RJ5A 4F70A 4YTCA 3C5IA 3EFKA 5EQPA 4M97A 2QR7A 2WMVA 5TT7A 2BZJA 1YKRA 2C69A 3UPXA 4CFUA 3IW6A 3M42A 2ZMDA 3VF8A 3BZ3A 3Q96A 4PMTA 3ZUVA 2EWAA 5B2MA 5HTBA 3LMHA 2GNHA 3BEGA 3CS9A 2ONLA 4FNZA 3TG1A 1JKTA 3AT4A 3DK7A 4C7TA 4AOJA 3HMMA 3MV5A 2HELA 4WG4A 3VC4A 1Z9XA 2ITTA 5B2LA 2Y6MA 2VWXA 4FNYA 3C1XA 4K77A 1M7QA 3R1SA 4IEBA 4DEHA 5KBQA 4ZTLA 2BROA 3DB6A 3P1AA 4C3PA 1UKHA 3KA0A 4M67A 4W8EA 4HVSA 4W8DA 4QMQA 5D1JA 2A4LA 5J9ZA 2R3OA 5I9WA 3DBDA 2OJFE 1H26A 3OW4A 1PJKA 2BAKA 2YWPA 4I1ZA 1VYZA 4R7HA 4DFBA 2C30A 4EK4A 4GEOA 4AGCA 2GHMA 5A54A 4IM0A 2UZVA 3QTWA 5I9UA 2DS1A 4PNIA 4GG5A 3ZUTA 2O65A 1ZMUA 3OTVA 3U54A 2UW5A 3KFAA 4WG5A 3EQFA 5BPYA 5JFWA 3HVCA 4BF2A 2LGCA 3F5XA 3AC3A 3R04A 5CEOA 3LM5A 3A7FA 4ZSLA 1JAMA 4L3JA 2WMQA 3ZO3A 3EKNA 3BYVA 3N9XA 5HVYA 1OL6A 5KNJA 2QO2A 3ZSGA 5IEVA 2H96A 2W99B 3LW0A 3V6SA 2QCSA 4ZMEA 4ZZNA 1Y57A 3VS1A 3CY3A 4TKSA 3VJNA 2BCJA 4RFZA 4M3QA 3D7TB 3HGKA 2PVKA 1IEPA 2HWPA 3UMXA 3F61A 3MDYA 4IWOA 2VX1A 3SA0A 2G2FA 3FHRA 2F7ZE 3P5JC 2W1CA 3L9PA 5E8ZA 4MVFA 3GU5A 4DG0E 3R9OA 4FKVA 3BCEA 3LXPA 2YCSA 3EKKA 3DXQA 1S9IA 4I93A 4XEYA 4AAYA 5FTGA 4QP1A 1PMVA 2ERKA 4EOSA 5EG3A 5BUEA 4QYEA 2PMIA 1M2RA 2PMOX 4MD8E 4AZSA 3ETAA 5E90A 4CTBA 2C0TA 1UU9A 4Q2AA 4X2KA 3QGWA 5T6KA 3TNWA 3ZSHA 3V5LA 5LMKC 4TNBA 4YZNA 1H24A 4QMZA 1Y8YA 1YW2A 4IB5A 5IG1A 5CY3A 4EOPA 3SV0A 5DR9A 2W1IA 4V0GB 3TKUA 1ZYSA 4TWPA 1LPUA 3FLYA 3PG1A 2YHVA 4HZSA 3H9OA 5HD7A 5IEXA 2WOUA 4Y83A 4RWIA 3FEGA 3SOCA 4HGTA 4FTRA 3NZ0A 1ST0A 3LCSA 3OFMA 4LM5A 4ZTQA 5J8IA 4BDCA 1U46A 4AQKA 3A7GA 3QHWA 3PVGA 1WBNA 4GJ2A 2R3HA 4UXQA 5LMAA 4BZDA 2UW0A 3F3UA 2IZUA 5EI8A 5F4NA 5A9UA 4MD9E 4M69A 1S9JA 3LXNA 4RJ8A 3HV4A 5HI2A 4E1ZA 5E8WA 2FSTX 4FKUA 5HG5A 5A46A 1NT2A 4K9YA 3BV3A 2ETRA 2YZAA 4FTAA 3T9TA 3R9RA 3R71A 5EDQA 2XS0A 3JXWA 3UDBA 3WZJA 3ZYAA 5HVJA 4FUXA 4O4CA 4IX6A 3CR0A 3PJ8A 4QMMA 4O0YA 4YZCA 4BCGA 4LMNA 3S2PA 3N4TA 4F9YA 4OT6A 1XO2B 2JIUA 2ZV8A 5D7VA 3KB7A 4JQEA 4KD1A 4U42A 3IOKA 1XMLA 4M66A 4P2KA 5I9VA 4GT3A 3VN9A 2AEGA 3R8LA 2YZLA 1DI8A 3ZZWA 5AP4A 5IA5A 3RPSA 4LUEA 1YWRA 3HRFA 3LJ2A 3R2YA 4MBIA 2A19B 3E8NA 4P7EA 1U54A 2B9FA 4ACMA 2ITZA 3KRJA 1T46A 4FT5A 3L8PA 4Z3VA 1ZYCA 3W2SA 3PFYA 5IA3A 4FA2A 4GJ3A 4BCOA 2JBPA 2IZTA 4J95A 3RK7A 3SQQA 3L9NA 3LHJA 5H9BA 5HX6A 3H9FA 3ODYX 1MQBA 4ANOA 3V8SA 4EOLA 2J4ZA 3HRBA 3Q52A 2CN5A 4GVJA 3QQHA 2YABA 3DTCA 3R2BA <