2HZIA

Abl kinase domain in complex with pd180970
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
268
structure length
268
Chain Sequence
b'DKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Structural biology contributions to the discovery of drugs to treat chronic myelogenous leukaemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2hziA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2hziA01
4NM3A 5L2WA 2BVAA 2I0EA 3W55A 2ZB1A 5LVPA 2BRBA 2WTKB 1WBWA 4EQCA 3DY7A 1ZWSA 3D94A 3HYHA 4XLVA 3RNIA 2JKKA 3PY1A 3R63A 4BCPA 4QQTA 3FYKX 3C4FA 3FMDA 3WF5A 4KD1A 2GU8A 3IQ7A 4X21A 4AA4A 4C35A 1OBGA 2IN6A 2OZAB 4FVQA 1U46A 1YKRA 4F1TA 3DFCB 2NPQA 2ITNA 2YWVA 4DFYA 2F7ZE 3FKLA 3TN8A 5IA3A 2CNQA 5A4EA 5TE0A 4EQUA 3MI9A 3W2CA 4LRMA 4AGWA 3DQXA 4TT7A 4L43A 3GU4A 3GCUA 3QTUA 2VTQA 5DVRA 4U45A 2WELA 2XNBA 1XO2B 3F3WA 4J99A 4RVTA 4O7ZA 2XYUA 1H26A 5FD2A 3GU5A 2HWOA 2CNVA 3RKBA 3RAKA 5HQ0A 3FZSA 3FPQA 2W1DA 1G5SA 3BQCA 3HRCA 2XMYA 4O7RA 4X3JA 4I22A 3ZCLA 2R2PA 3PUPA 1SVHA 3R01A 4S33A 4XMOA 3TV6A 5D7VA 1BLXA 4NTTA 3O8UA 3W16A 5DR9A 4ZTNA 4YZCA 3ZZEA 5B2MA 5FEQA 5HZNA 5A3XA 2HXQA 2IVUA 4FNWA 4FVRA 2QKRA 3QRKA 3MVMA 3RI1A 5L6WL 4R7HA 3KRXA 4EONA 3SC1A 1XBBA 4BCMA 4IZ7A 4FKVA 2XRWA 4ALWA 4IZAA 3VN9A 3R9DA 4LL5A 1PMUA 1JVPP 3MH1A 3E8DA 4MX9A 4FT5A 1ZMWA 4IHPA 3E5AA 5E8ZA 5HX8A 3DXPA 5H2UA 5HBEA 2XYNA 5EM5A 2XVDA 3VUHA 2XIRA 4O7TA 1YXVA 2OJJA 4EHVA 2BRNA 3H9OA 4AT4A 3D2KA 1L3RE 4JBQA 5I9WA 2C1BA 5BVDA 1OKWA 4EKKA 5CAVA 1H1SA 5M51A 3F88A 2C6IA 2JIUA 3QTXA 4UMQA 4GFMA 4ZJJA 3R7IA 3ZSIA 3UO5A 2YWPA 4Q5EA 4TL0A 3PY3A 4IDVA 4W9WA 2WMRA 3EH9A 3Q96A 3D15A 1AD5A 3ALOA 4I21A 4RWIA 4QQCA 3SRVA 3FL5A 1ZARA 3NS9A 5BMMA 5JZNA 3DJ5A 4W8EA 1UNHA 2QO7A 4TNDA 2DS1A 1A48A 4FTQA 4L6QA 5D11A 1REKA 5LJJA 4UEUA 3UIMA 4MXZA 4F70A 2UZUE 3U9NA 4S30A 3BYUA 3V5WA 4QYHA 3LMGA 2G2HA 2JLDA 3A8XA 3VUMA 2XIXA 4C02A 4YC3A 3QKMA 4EH4A 1XH6A 2H6DA 3CY2A 3P08A 3R8LA 4A4OA 3O17A 4E1ZA 2PMOX 2C3LA 3ORPA 3FYJX 3MH3A 4MKCA 5IEXA 4DFUA 5E8WA 3ETAA 3LM0A 4FKQA 4YTCA 1IEPA 5E8VA 2H8HA 3DKFA 4C3FA 3O7LD 3G2FA 4ZEGA 2EXEA 4Y5QA 3DDQA 4A06A 5GZ8A 1J1CA 2WPAA 2XCKA 3GCVA 4BYIA 2JFMA 2PE2A 4ZSEA 5DRBA 5KZ0A 4BCQA 5I9YA 3FQHA 5CASA 3H9FA 5TT7A 5KKRC 4N70A 1REJA 4CKIA 4AQCA 3HGKA 3NNXA 3DNDA 4C4GA 3BYSA 5HO8A 4BKZA 1Q4LA 1RDQE 4OBOA 4AGUA 3WE8A 4R7IA 4X6QC 2R3GA 4MQ1A 2ETKA 4M13A 2JDVA 4USDA 2WTVA 5AP7A 5EM8A 3A61A 1WBOA 3G15A 3QGYA 3RTPA 1CDKA 3IOPA 4AW2A 4FGBA 4AP7A 5CYIA 4QMSA 2RF9A 4O7YA 2WQBA 2YAKA 4DITA 3UVQA 5JK3A 2H34A 2GHMA 4GVJA 5HCYA 1AGWA 1P4OA 4IB5A 2CCHA 4CCUA 1OUKA 5GNKA 3ORXA 5CF8A 3F3VA 3PRIA 5AUTA 2QQ7A 4AW0A 2HELA 3NUYA 4I5HA 3JPVA 5DEWA 4APCA 4CFXA 2QO2A 4L9IA 5CAPA 4KIOA 4QPAA 4AU8A 1MQBA 3KKVA 2KTYA 5T68A 2VWWA 4XG6A 3EWHA 2AUHA 3KXMA 3BYOA 4W4XA 3NUSA 4BYJA 2ITYA 4DLIA 3NMUF 3OCSA 4OTWA 5IDPA 3U9CA 5FDXA 4KIQA 2WOTA 1YDRE 2JITA 2QOLA 3ALNA 1LP4A 5AR7A 3CQWA 3FLQA 4BCNA 2ZV2A 4NCTA 4QOXA 4AF3A 3CXWA 1XHAA 2XRUA 4J98A 4UWBA 3HV7A 1K2PA 3OD6X 5HE0A 2IWIA 2E9OA 3GB2A 4HPTE 5H9BA 2HXLA 2WAJA 3OW4A 4BCIA 4D2RA 4GYGA 1FGIA 4A9RA 2HCKA 2VD5A 3Q3BA 1CKJA 1M2QA 3CE3A 3ODYX 4FKSA 3AOXA 5AV3A 4I6FA 4Z55A 2WTKC 2A0CX 2R3IA 4UY9A 3HNGA 4FKWA 1MQ4A 4QMOA 2WB8A 4C36A 1OIUA 4YR8A 4O2ZA 3ZC6A 3GC9A 1H0WA 4FSWA 4QP9A 2J0LA 4C34A 3NZ0A 4EHEA 3OWJA 4KBKA 3NW5A 4JT3A 4FV8A 4TYHA 3PP0A 4MXCA 4ZSGA 3KXXA 1Q97A 2VX1A 2X7GA 3FMJA 4HGLA 3NDMA 3MH2A 5D7AA 2ITXA 1ERKA 3UQCA 2ITOA 4MNFA 1MP8A 2ITUA 3TXOA 3MTFA 4ZTLA 2FVDA 3PPZA 4EJ7A 4D1SA 2GNGA 4CEGA 4UX9A 2UW9A 5EQEA 3H9RA 4GW8A 3R2BA 2GPHA 3LCTA 4JX7A 2XZSA 5GZ9A 5M4FA 4QMTA 5K5NA 5IQDA 1QPCA 4F7JA 4D28A 2QG5A 1VYWA 2WMAA 3LAUA 4TRLA 4EH9A 2JFLA 4DGOA 3QYZA 5L3AA 3HMMA 5BNJA 1G8AA 3QUDA 5BYYA 2HK5A 4Y46A 5AUXA 3I81A 1PXPA 1SVGA 2IZRA 3WZEA 4BDIA 4R1VA 4JQEA 1SVEA 5FTQA 3CD8A 3FMMA 1KE9A 3BKBA 3RVGA 5AR2A 1SYKA 1UU7A 2I0HA 2UW7A 5I9UA 3NUNA 5HG9A 3F69A 2C5XA 5BUIA 4X3FA 2Y4IB 2YIRA 5TR6A 5DR2A 2GHGA 3NUAA 1J91A 4AN9A 1IASA 2YN8A 3QAME 4KIKA 3BYVA 3FAAA 3I60A 3EN7A 4QP3A 5CZHA 3MTLA 4M0YA 3HX4A 3LFNA 3TL8A 4ZIMA 3VHEA 2PVNA 3P79A 5LMBA 3CTHA 3VS4A 3I6WA 3RGFA 3GEQA 5E8SA 3W10A 3SXRA 2WGJA 1JKLA 2WZJA 3HMPA 2ZV9A 1TVOA 3LW0A 5G1XA 3ZUVA 5HNIX 5IEVA 5JEBA 3CPCA 4E6AA 5JMSA 3MDYA 5JFSA 5CF4A 5E90A 3FEGA 4IJ9A 1OKZA 3H4JA 5I3RA 5IF1A 2PPQA 4GKIA 4AZWA 3V8SA 3F9NA 5JKGA 3ZO4A 4R77A 3KXNA 4O0SA 4E6QA 4TWPA 2CSNA 2V22A 4WNOA 4KIPA 4EOSA 1JSVA 3CJFA 1PY5A 2PE0A 2ITVA 3FI2A 3QUEA 2IPXA 1JBPE 2HZ4A 3R9HA 4TXCA 1XH7A 4X2JA 3SHEA 4TYHB 4GT5A 4YPSA 4BF2A 4GKHA 4OTRA 3GFWA 4XYFA 4CLJA 3BHUA 1KE7A 4XRJA 4I41A 4LGHA 1GIIA 3Q60A 3G0FA 4G2FA 4W4WA 2RL5A 2VTLA 3QUPA 3PSDA 3R0TA 3CP9A 4P5ZA 4RWLA 4AZVA 5EHLA 2W96B 5H8BA 3OTVA 3DJ6A 4L46A 3FXZA 4DFZE 4PQNA 1J7LA 2I1MA 4FTRA 5DLSA 4BBMA 2OK1A 4L8MA 5AM7A 3CPBA 1ZMUA 3G9NA 3N9XA 4UWYA 4V05A 2BZHB 4FEXA 4B99A 5BVWA 2PUNA 2O3PA 3QRIA 3RPOA 5DE2A 2PTKA 3DDPA 3Q04A 3AT3A 4RQVA 1AQ1A 4O2PA 1KWPA 3Q2JA 4G3CA 4DH3A 3ULIA 4L3LA 2IO6A 4ERWA 3L8PA 3ZOSA 4JG7A 1PKDA 1SZMA 3FZRA 4JNWA 2RFNA 4BDBA 5J7BA 4NKAA 3F6XA 5IQIA 5J1WA 1K9AA 5TOZA 3DAJA 4X3FB 2IVTA 3NNWA 4IM0A 4V0GA 3VRYA 3E62A 5TF9A 4FNYA 2WTWA 4H36A 2WKMA 3NIZA 5AX3A 4IWQA 3GOPA 4C4IA 5CU4A 2CKPA 1GJOA 1E9HA 2Z02A 3MVJA 1WMKA 5JRSA 3QTSA 3QD0A 3FI4A 1NY3A 4X7QA 1BL7A 4DTBA 2PVJA 4YBKA 3PIXA 4ACCA 4FIHA 3EFLA 1GIJA 3IW8A 4IAFA 5E8XA 2XB7A 4FI1A 2YABA 3EFKA 4H39A 4Y5HA 5ACBC 3TWJA 3NRMA 5DEYA 5LQFA 4KNBA 4CG8A 3FLZA 3O50A 2O63A 5EOBA 3P86A 4C4HA 4C38A 3HL7A 4E4MA 4I1ZA 4NFMA 2C6LA 4U5JA 1H01A 4F6WA 3MY5A 3QC4A 4FTIA 4OTGA 1FGKA 5J5SA 3OCTA 4I4FA 4IDTA 4RVLA 3R7UA 3CQUA 3O71A 2YERA 2I7QA 2XK6A 5CU2A 4EUTA 3LCSA 2PUPA 3R8UA 3LPBA 3FMHA 2C6OA 4I92A 1OL1A 3PJ1A 3VBTA 1SMHA 4HGSA 4RPVA 3VF8A 1E1XA 4F7LA 2HZNA 3V5PA 5EM6A 2ZM1A 4GK4A 4G5JA 2VX3A 3AGLA 3EN5A 4DH1A 3QTQA 5DT0A 2F2CB 3N4TA 2VWZA 3W2OA 2QG7A 3NW7A 4P2KA 3VVHA 3BE2A 4C61A 4AGCA 3D5UA 5ANIA 3BU6A 2GTMA 2PZIA 2UW8A 3D5XA 2R0IA 4FSQA 4DEBA 4UN0C 2OH4A 3QF9A 3AC1A 5IQEA 3LMHA 4FKPA 4IX6A 3ULZA 4EOKA 2BRGA 1U54A 1HCLA 1IR3A 3MVHA 2C6TA 3GU8A 3O8TA 3R7VA 2BAKA 2GQGA 2OO8X 4D1XA 5IA0A 4GSBA 5AR8A 4V0GB 3RHXA 3PFQA 4I94A 2JGZA 2W7XA 4QP7A 3GU7A 3AGMA 5AP1A 4H3QA 5J95A 4PTEA 3W18A 4Z9LA 4E5AX 4OTQA 3K3IA 4YLLA 4R5YA 1CSNA 1OITA 3SXSA 4FKIA 3TTIA 3KXGA 3ZRKA 3FLWA 1KE5A 4BKYA 4D2TA 2WQNA 3RWPA 5DN3A 1B6CB 4DEIA 4EOIA 3QX4A 3UYTA 4CVAA 3VW6A 3IONA 4KBCA 3C13A 3QFVA 1UU3A 2BDWA 3R6XA 4S2ZA 2IZTA 3GCPA 3KRJA 3MA6A 3IK3A 3O8PA 3POZA 2ZV7A 4I6HA 4QTCA 4ANMA 3D9VA 1I44A 2X9EA 2XP2A 4GL9A 4IBMA 4G6NA 4HGEA 4BICA 3L9LA 5KCVA 3HA6A 3NYNA 4QTEA 3TI1A 5J1VA 4IVDA 4DT8A 3MWUA 3HMNA 5EFQA 3NWWA 3U8WA 4ZJVA 3A99A 1HCKA 2B0QA 2XNPA 2Y4IC 1Z57A 3F3TA 2C3IB 3NSZA 3NUXA 2WMTA 1ZYCA 2NP8A 1VYZA 4NCTC 3EQGA 3MB6A 3TIZA 4BI0A 2XJ1A 4QYYA 1YI4A 2ZOQA 4MTAA 3TUBA 2XK9A 2XJ2A 2JIIA 3COIA 2W1HA 4I0SA 5EHOA 5AA8A 2QOOA 3LXPA 3KULA 2YHVA 3EJ1A 4OTHA 4OW8A 5CNOA 5J87A 2R3MA 4ITJA 2QKWB 4R1YA 2GTNA 4RT7A 1MRUA 1QPJA 4OR5A 4L7SA 5DHJA 4ZTQA 3EMGA 2OFUA 2YIQA 1R39A 1M7QA 1OB3A 1ZMVA 4O0YA 4U97A 5JRQA 4BDJA 4PX6A 4UXLA 4EOJA 3F2AA 2EB2A 2C5OA 3NVKI 5K4IA 4ITHA 3RK5A 4FL2A 3LQ5A 1XH4A 3OEZA 4G3FA 4QP8A 4X2KA 3IW6A 2OI4X 3BX5A 4QMWA 4BZDA 1UU8A 3QU0A 4ZLOA 1IAHA 2UZWE 4GIHA 1U54B 3SAYA 4MF1A 1BI8A 4LQMA 4MD7E 3DKCA 3P7AA 5BQ0A 3LCOA 3O23A 2BROA 5DNRA 1WZYA 2JAMA 4NL0A 2P0CA 4MWIA 3G6GA 5AX9A 4C33A 3ORZA 5HG5A 3DLSA 5HBJA 5T6KA 3ORMA 3PWDA 3C4ZA 4GRBA 3UDBA 2W4JA 4DEEA 2EXMA 1FQ1B 3O0GA 3CQEA 4BI2A 4U3ZA 3KL8A 5A4TA 2GS7A 1JSTA 4NUSA 2Z7LA 3ATTA 2QOKA 2GMXA 4BZNA 3LJ0A 2QOFA 3ACKA 5T3QA 4JG8A 3VIDA 4YU2A 1G8SA 4FODA 3AQVA 2XNOA 4LGDA 5HE2A 3V6RA 4FTKA 3TNIA 4N6ZA 4CZTA 2YM8A 4QNYA 5L8KA 4FGRA 4CFMA 4F4PA 4BDDA 5AP4A 5BX0A 3AC3A 4IACA 4O0WA 5HCXA 3CLYA 4BDEA 2YCQA 4F08A 4PPBA 3FI3A 4UMUA 3HMIA 4CFWA 3ZLWA 1NW1A 4D1ZA 3EHAA 3QA0A 4D4YA 3KXHA 4GU6A 5CY3A 2WIHA 5M07A 3BCEA 3D7TA 4ALUA 3R28A 3ZXTA 3QLGA 4X3FC 4WRGA 1BX6A 1UU9A 1CTPE 5AV4A 4AT3A 4NFNA 4AZFA 5GIOE 4CG9A 4JAJA 4JR7A 4ZSJA 3Q9ZA 1DAWA 3K2LA 4GUEA 2I40A 4AE9A 4BI1A 2Z2WA 3A4OX 4KSPA 5EW3A 5I9XA 5DWRA 5E7RA 1T46A 4HGTA 3LE6A 3KULB 3UC3A 3WF6A 5JSMA 1O6LA 2Y4PA 2VTSA 5M4IA 3F7ZA 3PJCA 3KCFA 5CSPA 3OWLA 4QMXA 5AR4A 5AUWA 1H1PA 3GBZA 3EN6A 2CLQA 3ZDIA 2CPKE 3QQJA 5IKWA 2QLUA 3LLTA 4Y8DA 1PMNA 3CSVA 5KO1A 5EI2A 3V51A 3QKLA 3G9LX 4ID7A 2XNGA 4UYNA 2G2IA 4JIAA 2GNFA 3NLBA 5EM7A 2VX0A 3R1YA 2HZ0A 3F7WA 2OLCA 3JXWA 3OY1A 4O6LA 5IH5A 4RRVA 4Y83A 2ZMCA 4YZ9A 4XG9A 4KABA 2QURA 3C4CA 4AZEA 3F3ZA 2VGOA 1H07A 1W98A 4QO9A 4LUDA 2YLEA 4AN3A 3TUCA 2WO6A 3RM7A 4F0IA 1OUYA 4NW6A 4YJTA 3LFSA 2UW0A 2UZLA 3QRJA 4HCUA 5EYCA 1TQIA 1U5RA 2Y8OA 3FZ1A 4FICA 4GT4A 4RC2A 1IA8A 4RGJA 4X2NA 3WIGA 4FIGA 4M14A 4M0ZA 4E6CA 2BHEA 3DXNA 2FB8A 2P3GX 4QYFA 3TIYA 3ZYAA 4PDOA 4YJNA 5HO7A 3CGOA 3F2NA 3QA8A 1GAGA 3Q4ZA 4U7ZA 4UXQA 4EBVA 4ZLYA 2VTNA 3HAMA 4WKQA 4C58A 5FUTA 3MY0A 4IC8A 5M08A 4TN6A 4ZS0A 3AC2A 2PSQA 3KQ7A 4QMPA 5M55A 4WG5A 2WMSA 3VULA 3A60A 4C2VA 5KMNA 1ZRZA 3D7TB 3VJNA 3UIBA 4BGQA 2VWVA 5FP5A 5HVJA 4ASZA 4BBEA 4CV8A 4IZ5A 3UNKA 3LHJA 4D2VA 2KULA 3HP5A 3MIYA 3ZEPA 4FKOA 5AAGA 1VJYA 4FSZA 5KUPA 4RLKA 4CLIA 4E20A 2J50A 4JG6A 4D4VA 2A27A 4IADA 4MF0A 4CSVA 2R7BA 2X8DA 4EQMA 2CGUA 3LFCA 3SGCA 5JT2A 3PA3A 2BZIB 4NWMA 3QXPA 3IW7A 3ET7A 2V7AA 2Z8CA 3FC2A 3KFAA 4L3PA 4C3RA 4DC2A 4ZXTA 3R22A 3WOWA 4O83A 2IZUA 4YHTA 1H1WA 2ACXA 3NX8A 3HAVA 4JX3A 3RNYA 2W1FA 4CFFA 4WIHA 5H8EA 3KVXA 4EK5A 3PTGA 5FRIA 4G17A 3H0ZA 4GU9A 5C4LA 3ZO3A 5AAEA 5M57A 1GOLA 3BYMA 3COHA 3JVRA 4TNBA 5C01A 2RIOA 3K3JA 5EYDA 5HVYA 3SV0A 3FZPA 5FBOA 3PJ8A 5I4NA 5JFWA 4OBPA 2R3JA 2J90A 4WA9A 3S3IA 5CXHA 3C5UA 4A9YA 3I5ZA 2JDOA 4P7EA 2E9PA 4M69B 3LVPA 2R3LA 2HAKA 1J1BA 3SKCA 3PRFA 3RAIA 3JYAA 3BPRA 3W32A 3N4UA 4Q9SA 5IQBA 3U55A 3A62A 4XOZA 3OS3A 2WTCA 3L1SA 2XKDA 4O0UA 3VQHA 2R7IA 2OICA 4LM5A 4BCOA 3ANRA 5JH6A 3QC9A 2C6MA 2C0OA 3TDWA 1OL6A 2X8IA 4I6BA 3QHWA 2FSOX 5IMEA 4HYIA 3R00A 2I0YA 5L8JA 2R3HA 1W7HA 2W9ZB 2DUVA 3HUCA 4AW5A 5L2IA 5IQFA 5KBRA 3NNVA 3NNUA 1VR2A 2ERKA 2OBJA 4DTAA 4R3RA 4BHZA 2G2FA 3UODA 3W2SA 2JDSA 4E26A 5C4KA 4FSNA 3FPMA 2FH9A 3SW4A 1A06A 3PPKA 2C68A 3OG7A 5IUHA 4KUJA 4BTFA 4D9TA 2RFSA 2IW8A 3TKUA 4XUFA 5HI2A 4FV1A 4JRNA 1JWHA 3DS6A 3QX2A 1FOTA 1JOWB 1XH5A 1RW8A 2C0TA 4Z16A 3NYXA 2XJ0A 4WNPA 3F2RA 4MD9E 3TEIA 3GT8A 3PVGA 4QP4A 3SA0A 3ZFYA 1OI9A 3T8OA 4GIIA 4K6ZA 5EI8A 3UVPA 2JC6A 4AXAA 5CSHA 3R7GA 3WF9A 4FEUA 4YJRA 2C69A 4D5KA 4F7NA 4EC8A 2EB3A 3A7GA 3JS2A 4G3EA 4ITIA 2J0IA 4DFXE 4C2WA 5BUJA 3W2PA 4JL9A 4JBOA 4LYNA 1H27A 4IAIA 1NXKA 4QT1A 3MH0A 2IJMA 3H3CA 3TACA 2YDJA 2YIWA 4JDHA 4E73A 2EUFB 5A6NA 1PJKA 4MCVA 2GS6A 4RLLA 1OGUA 1ZZLA 3EL8A 2GFSA 4FEQA 5IH6A 3HV5A 5ACKA 5DYJA 2C5VA 5E8TA 3A7JA 2X2MA 3UIXA 5BMSA 4LV5A 4GT3A 2VWXA 5CWZA 5D12A 1YQJA 2ERZE 4CMTA 4NK9A 4OTIA 2YAAA 3Q53A 2R3NA 2WD1A 3WF7A 3N4VA 3MFSA 1WBTA 4AX8A 4I5PA 3I7BA 3VS2A 4F6UA 3C7QA 4HVDA 4FTMA 5F9EA 4TWOA 3Q4TA 5C8MA 4XG4A 3R7OA 3VS5A 2H9VA 2QOCA 1OIQA 3PWYA 3R7YA 4JI9A 3VUIA 4U0IA 5CALA 5J5TA 2PVYA 3OXIA 3QALE 4XLIA 1Q99A 3ROCA 3BHVA 3MPAA 3OT8A 4M15A 4U40A 3ZHPC 2X8EA 3LCKA 2YDKA 2WEVA 4I5MA 4O7VA 2J5FA 3FY0A 3EYGA 4FZAB 2Y9QA 2Z60A 2VTHA 5AFVA 4J52A 3ODZX 2JKOA 3C1XA 1WBNA 4L52A 4XH6A 2NO3A 1DAYA 2CKQA 2OG8A 3UE4A 2J0MB 3GQIA 4IB0A 4DF3A 4KS7A 2ETMA 2FGIA 4ACMA 5A4CA 4A9TA 4UBAA 5HCZA 3MYGA 1UWHA 4G6LA 4HNIA 4AFJA 3GGFA 1H24A 3UC4A 4EOLA 2B4SB 3GP0A 3LFDA 3E3PA 2X81A 1UNGA 3LFFA 2BR1A 3T9IA 4K11A 1JNKA 2OIQA 3HVCA 4RSSA 5CI7A 1S9IA 3FL4A 3UQGA 2JD5A 3SRVB 4DA5A 2C3KA 4KA3A 3I0QA 4FSTA 4C4FA 3PDTA 5AAFA 3EL7A 4AZSA 4RFYA 3SXFA 2NRUA 1PYXA 4FV3A 1FMKA 3IKAA 1BKXA 4W4YA 5K3YA 5TKDA 1PXIA 3BBTB 4B8LA 1YHWA 5ICPA 3DQWA 5FEDA 4OT5A 2BMCA 1KOAA 4RX7A 4JR3A 4ZY6A 2V0DA 2YCFA 4UMPA 1NVQA 3E93A 4S31A 4YP8A 4G1WA 4TZRA 4M84A 2XH5A 3UG2A 4TYEA 4EK6A 5DR6A 1PW2A 1KE6A 3OROA 3V5TA 2YCRA 2ZDUA 3FMNA 3IGGA 1W0XC 4EHGA 3R30A 3DKOA 1O6KA 4YO4A 4RC3A 3NUPA 4CYIA 2C30A 2B9JA 2P4IA 4AA5A 4I4EA 4QTDA 2H96A 2JDRA 4FV7A 1R1WA 3RM6A 5EI6A 3LJ1A 2EU9A 4YZDA 3PXZA 3RZBA 3UP7A 3C51A 4EEVA 1XWSA 2WQMA 3QBNA 4PNKA 4FV2A 2F9GA 3QZHA 3C0IA 3F5PA 4GYIA 3MESA 4YLJA 3QZFA 2JDTA 4F9CA 4IVCA 3GUBA 2Y6OA 3KU2A 2QOIA 2C4GA 4ERKA 1FVRA 2IG7A 4YZMA 3DZQA 4IFCA 4OLIA 4TPTA 4UZDA 2JIVA 5AP2A 4OGRA 2NRYA 4IW0A 4F09A 4I3ZA 4AS0A 2X2KA 5GIPE 4WNMA 4QMYA 4U44A 4XG8A 3QRTA 3BRBA 4FG7A 2CKEA 3Q9WA 5AP5A 1PXKA 4O7WA 2C1AA 4A4XA 4HVSA 3AMYA 4PV0A 4HPUE 2W4OA 4ACDA 2WQOA 4C59A 4PNIA 3QQUA 3SOAA 3FZTA 4ZY5A 2PYWA 3W2RA 2R3PA 1RE8A 2ZDTA 1YOMA 1OIRA 4MXXA 3DK7A 2OF2A 2WMWA 3LQ8A 5HICA 4D58A 3DLZA 4FE2A 1B38A 1BMKA 1IG1A 4P5QA 1NVSA 3P78A 1QCFA 3ZS5A 1ZYLA 3BU3A 3NIEA 5A9UA 3QWKA 2P2IA 4YSMA 4AOJA 1DI8A 4H3PA 2W06A 2ZB0A 4EOQA 3DBQA 4IC7A 3E88A 3OTUA 2VTRA 4PDYA 4JQ8A 3E3BX 4FV9A 4L01A 3V6SA 3QQKA 3DBDA 4RJ3A 4K8AA 3WF8A 4L7FA 5LVNA 3PG3A 3WYYA 1EH4A 3M2WA 3FSFA 3TT0A 4O1OA 4FTUA 4NZWB 3VS6A 4HW7A 1O9UA 3NPCA 3U4WA 1FVVA 4J97A 4O84A 4XP2A 5ANGA 1Q62A 4DAWA 2UUEA 3PJ3A 3N51A 3OBJA 3A7FA 4XNEA 4BGGA 4MNEA 4HVIA 4FSRA 2VWBA 3PSCA 3EFWA 3QLFA 4W9XA 3FXXA 4E93A 2DYLA 2PVKA 3E7OA 4WD5A 3UPZA 1PKGA 5CSVA 2OWBA 2W1ZA 5J9YA 5FXSA 1Y8YA 2BALA 4FSMA 4DEDA 2F7XE 1YDSE 3OXZA 2X6DA 3HA8A 2XF0A 3IDCA 3RAHA 4BN1A 1STCE 2YZLA 2J0KA 5BYZA 2QD9A 3EFJA 4NU1A 2PMLX 4NM7A 4QYEA 5KMIA 3P23A 4F9YA 4MXOA 1G3NA 5HTCA 4DH7A 5EKOA 1ZOHA 2WQEA 3ORTA 4BCKA 2YDIA 4DG2E 4BY9E 2UW4A 5DI1A 4FK3A 4XV2A 3NR9A 5IUIA 4FKRA 2B55A 3BHTA 4XBRA 1UVRA 3VUKA 2XM8A 1L8TA 1YHSA 5CAOA 4IAYA 4HYUA 3MVLA 2J0JA 4C37A 3FV8A 5HD7A 1BI7A 2IZSA 5AUVA 4RBLA 4IX3A 4I24A 4YNOA 3AG9A 2HZIA 2R3QA 3K54A 3R8ZA 3F5GA 4BBFA 4CKRA 4AAAA 5HIBA 4FEWA 4PL3A 3QTWA 3UMXA 5HLPA 3DJ7A 5HKMA 5HU3A 4BVUA 3EQIA 5F1ZA 4LG4A 2BIYA 5A46A 5J8IA 2C6DA 2V7OA 3R83A 3ZM4A 5HORA 3UQFA 3PVWA 2WNTA 3S95A 2UZTA 5KZIA 4ENYA 3LQ3A 3BI6A 2UZDA 4RIXA 4NM5A 1ZOEA 1OKYA 1I09A 4LFIA 3CCNA 5EYMA 3U6HA 4GG7A 5IISA 3ELJA 1SNXA 4KIKB 1U5QA 4BTMA 3EQCA 5D41A 2JAVA 2PHKA 4AT5A 4JDKA 3FMKA 4WBBB 1Q41A 5CEKA 4K9YA 2CDZA 2PUIA 5AUZA 2GS2A 3EB0A 2LAVA 4U80A 3VBYA 4B0GA 3OW3A 2QO9A 5B0XA 4CQEA 4FC0A 5HG7A 5CF6A 4FTLA 5C8KA 3UNJA 3I0OA 2GDOA 4NTSA 5AV0A 3EZRA 3T3VA 3VS0A 2BFYA 3ZXZA 4X2FA 2OGVA 1Q3WA 4MNEB 4CMOA 2REIA 4HVHA 2X9FA 3OZ6A 4YTIA 5C27A 2YA9A 3BLQA 4FZFB 4QMNA 3LFQA 3QGWA 4PPAA 4ZMFA 4ZSAA 2R3FA 5I3OA 1YI6A 3AXWA 4RX8A 2O65A 4DFLA 2C6KA 5E1SA 3H30A 4O22A 1YXUA 4HCVA 4D4SA 4EYJA 3TV4A 1Q8ZA 3A2CA 5DRDA 4A4LA 5A14A 4FKJA 5E8UA 2C5NA 2PVHA 3WIKA 5DGZA 1KUTA 3LM5A 2VUWA 4PL4A 4BDKA 3U54A 1LUFA 5L8LA 5HGIA 1M2PA 4QNAA 4GJ2A 2OFVA 4C7TA 4AG8A 4AN2A 3ZUTA 2YM4A 4EZ7A 5CAUA 1WBPA 2QODA 3KRLA 1H08A 3G0EA 2BPMA 4EOPA 4FA2A 5KMOA 4RJ4A 2XEYA 3R8VA 2FSTX 4DGGA 4F7SA 5L6PA 3F5UA 1F0QA 4OUCA 4FIFA 2GSFA 1ZAOA 4MQ2A 1RJBA 2Y6MA 4X6RA 3RALA 1OPLA 3KCKA 3R1NA 4IQ6A 3Q5ZA 4HCTA 3BV2A 5HESA 4V01A 3UO6A 1Q24A 4DGMA 4KRDA 4IX4A 5CQUA 4O27B 2YITA 3BEAA 3V8WA 5M4CA 4ANOA 5A54A 3E7VA 3F82A 4PTCA 3AMAA 4QRCA 3TZ9A 3H10A 3M42A 1UWJA 2BKZA 4TWCA 1WBVA 3QRUA 4RIXB 4KKGA 2R3OA 1DS5A 3OVVA 5G6VA 4CV9A 3NVMB 3PYYA 5K0KA 2I0VA 4D2SA 4DEHA 2R3KA 3S4QA 4EH8A 4F9AA 4YJVA 1M2RA 3QKKA 4HZRA 1XBAA 3AC5A 3KB7A 1NA7A 3FDNA 3OHTA 3PZHA 1WAKA 3PXKA 4FR4A 3R8MA 4ANSA 4I23A 1PXMA 3DBCA 2VTTA 4FKTA 5AR3A 5C03A 3SD0A 5HD4A 3OFMA 2BHHA 3QD3A 2QU6A 3HDNA 5I0BA 1GZNA 4BDFA 2WOUA 4ZY4A 5K0XA 3PE1A 4JQ7A 4EWQA 5GJDA 5LVMA 3KK9A 3D14A 5CS6A 4G3GA 4O0VA 3QCXA 3QHRA 1W83A 4CMUA 1MRYA 3E87A 2BILB 4FT9A 4JIKA 5EDPA 5CANA 4FKUA 5KE0A 2EVAA 4XX9A 1KOBA 5A4LA 1W8CA 1M14A 5DPVA 4ZLZA 4XS2A 1F3MC 3WI6A 3UNZA 3C4EA 3AC8A 4RA4A 1GIHA 3U6IA 1Y6BA 4XG7A 1U4DA 2VWIA 5CVFA 1XH9A 3HKOA 5IA4A 4W4VA 3RK9A 2J5EA 4LOOA 1F5QA 3NCZA 4B4LA 4CXAA 2CNUA 4DCAA 3PY0A 2BKKA 2O0UA 5K9IA 3EQDA 2B7AA 1JQHA 2BCJA 2VN9A 4IB1A 4MWHA 3ZDUA 5CAQA 3WE4A 1TQPA 4ZP5A 4UWCA 2XNNA 4E7WA 3TNQB 2ITZA 4J8NA 2PVFA 4S32A 1FPUA 2QC6A 5KNJA 4DGLC 3DBEA 5D10A 5B2KA 4N0SA 4PY1A 1V0PA 4YZBA 5IQCA 4JOAA 2XKFA 4E4XA 3BHHA 3EN4A 4D9UA 4QQ5A 4QMQA 2JBOA 4FZDB 2F7EE 1WVWA 5AIKA 3KN5A 1YW2A 5ETCA 4DBXA 4NM0A 3M11A 5DMZA 5KMKA 4EKLA 4DH5A 4MXYA 3UPXA 2OXXA 5CLPA 5AJQA 3E64A 5HO6A 4WBOA 1K3AA 5IQGA 3E8EA 4GJ3A 4FV4A 5HNGA 4RA5A 3DA6A 3MGYA 4YZNA 4ONAA 4EI4A 4JVGA 3PXYA 3HLLA 1GZ8A 3R73A 2RKUA 4ASDA 3F66A 4EH5A 4EBWA 2QCSA 4BIEA 4O81A 3FLYA 3KEXA 4UV0A 2PZPA 3KN6A 2VTPA 4EH3A 4PDSA 4AFEA 4WG4A 4K1BA 2QNJA 5CEPA 1J7IA 2OJGA 3OF0A 5LCKA 5LWNA 1J7UA 2CKOA 2FSMX 5ANJA 4II5A 3LOKA 3OOGA 1PXNA 3U4UA 1R3CA 4H1MA 5ETFA 5KMMA 3RPVA 1TKIA 2E2BA 4KBAA 4QMLA 5AV2A 3HV3A 3QQHA 5F95A 3VW8A 4R78A 3SQQA 3HV4A 4CFVA 3ZFXA 5DT3A 1QPEA 1GZKA 2WXVA 1H4LA 5JGAA 2W1GA 4F99A 3Q52A 4FTAA 3FMEA 4U42A 3EZVA 4FIIA 1NT2A 5AUYA 4ZTMA 5AP0A 3WARA 2RFDA 2WTDA 2OH0E 3R1QA 2OKRA 4IAAA 3QZGA 3SW7A 4ACHA 3PJ2A 5BYLA 3P7BA 4BWPA 4LMUA 5CSWA 4EH2A 1GZOA 3T3UA 3P7CA 2BDFA 2R5TA 4M66A 4NJDA 4C4EA 3CGFA 2XUUA 2B52A 3I79A 4CYJA 3FBVA 4IAKA 4H1JA 4RQKA 3VQUA 5K5XA 1FBNA 2O2UA 2WEIA 5GZAA 4ENXA 1V0OA 3SVVA 1DM2A 5LXMA 2XS0A 1XJDA 3D4QA 4RWKA 4FUXA 3MS9A 4F0FA 2G15A 4TYIA 3KMWA 5TO8A 5HU9A 2O5KA 4JXFA 4M7IA 5E1EA 5JN2A 4NYEA 2CHLA 1OPJA 4CFUA 4GV1A 3OEFX 5HE3A 3RCDA 2AC3A 4DFBA 1OKVA 4HZSA 1ZZ2A 2QVSE 4I93A 3U6JA 4IWOA 5HVKA 2R9SA 5A6OA 3K5UA 4AUAA 4EZ5A 3NUUA 2R0UA 4BIDA 4GH2A 2BZKB 4FTOA 4ASEA 4CRSA 3ZM9A 4Q2AA 3MIAA 4F9BA 4ZOGA 2G1TA 3HRBA 2X7FA 4AACA 1XBCA 3FSKA 2C47A 3UJGA 5I9ZA 1CKPA 4KB8A 5FWKK 3O2MA 4O82A 4PMMA 3R04A 1UKIA 2RFEA 3CS9A 3CIKA 1PXJA 3AT2A 1YI3A 3QZIA 4TW9A 4DEGA 4XEYA 3DV3A 1LEWA 4XG2A 4CFNA 2PVMA 2OXDA 3P0MA 3FHRA 4QTAA 4YHJA 4MAOA 5JGDA 3QTRA 1J3HA 3B8RA 2HENA 4L68A 4CD0A 5JGBA 2V62A 1O6YA 3RCJA 3GENA 1YOLA 3MY1A 3V04A 2J51A 2UV2A 5L2TA 2WTIA 4O1PA 2UW6A 4H3BA 2BUJA 5IPJA 1QMZA 4RJ6A 4MK0A 4RFMA 4TYGA 2VWYA 1JAMA 3MPMA 5EQPA 2XK8A 5FM3A 4PP7A 4RJ8A 3JVSA 3L9PA 4KAOA 5CENA 5M09A 4BCHA 3WZJA 4DG0E 3VBXA 1YXTA 3ZLXA 3VUDA 3G33A 3F5XA 4A07A 1SNUA 4YO6A 5F94A 5HE1A 3ZFMA 3R9RA 1VEBA 3DOGA 4Y73A 3WBLA 4A9UA 4M67A 5LMKA 2XCHA 4FG9A 4RIOA 5HIEA 4BRXA 1Q8WA 2FYSA 1H25A 5FBNC 1WFCA 3FLSA 3A7IA 3ZZWA 4I0TA 4D5HA 5L2SA 2B9FA 1ZLTA 4BL1A 2W1CA 1PMVA 2RG5A 2O8YA 2XK7A 1UA2A 4HNFA 1OBDA 3ZEWA 4RJ7A 5JZJA 4YBJA 5KMJA 2UVYA 3QD4A 4ALVA 3UOKA 3IDPA 2ITTA 1P5EA 4E4NA 5IG1A 4G3DA 4ANNA 1XH8A 4FKGA 4FZ6A 5ANEA 2PVRA 4C0TA 5BVOA 1Q8TA 4P90A 4X2GA 2QR7A 5AP3A 5DIAA 5FTOA 3B2TA 3DU8A 4RVMA 3TUDA 3II5A 3DB6A 2PY3A 4FVPA 4LGGA 4XG3A 4YJSA 4GK2A 3W2QA 4E3CA 2V55A 3ZBFA 1GNGA 4M12A 4Y95A 5EKNA 2B1PA 3C0HA 5IEYA 2J6MA 5FM2A 5B7VA 2WMBA 3CKXA 5ITAA 4DN5A 3BBWA 4CTBA 2XIKA 4CNHA 3PXQA 2VO0A 4G9CA 4NW5A 3DBFA 3DAKA 2J7TA 3FKOA 4IMYA 3Q6WA 4ZK5A 4HYHA 2WMUA 1H00A 5DFPA 5CEQA 1PXOA 4E5BA 3D0EA 2BTSA 3E8NA 5BPYA 5HTIA 4PF4A 4WSYA 4J96A 3V5QA 2Z7RA 2F49A 4FT3A 3CY3A 3VJOA 1YDTE 4YJQA 3KMMA 5EHYA 3RBWA 3B8QA 4XCUA 4GK3A 3BEGA 4AOIA 2C0IA 1PYEA 2GNLA 2ONLA 5B2LA 5BUEA 5J9ZA 3DXQA 5M06A 4FTJA 3QYWA 3ZC5A 3UP2A 3IOKA 3HECA 3ZONA 3G90X 3ZH8A 2Q0BA 3C4XA 3CJGA 3ERKA 2GNJA 4JBPA 4ZJIA 4O0RA 4WRSA 2Z7QA 4ZTHA 2OXYA 4XJ0A 4CT1A 4F0GA 2GFCA 4WUNA 4OTPA 4G16A 1HOWA 4EJNA 5HG8A 3MJ1A 4YMJA 3U87A 2OJ9A 3MJ2A 3V5LA 4MBLA 3VS1A 5E8YA 3MFUA 3SOCA 5ANKA 3HP2A 3P9JA 2PL0A 4HJOA 2ETRA 1P4FA 4EC9A 2YJSA 3LXKA 1ATPE 5EDQA 3VHKA 2PUUA 4UB7A 5FQDC 4IWPA 2Q83A 4GEOA 1Z5MA 3HMOA 5E92A 3VAPA 4XV9A 4FTNA 1PXLA 5FP6A 1XR1A 4E6DA 3A4PA 3GCQA 1H28A 3QCYA 4E5WA 2PZYA 4BR3A 2E9UA 3D83A 5IU2A 4APPA 4IM3A 4WSQA 2YFXA 3B2WA 3DK6A 3NAXA 4FK6A 4IWDA 5HHWA 3V01A 3SDJA 1ZY4A 2YM3A 4PTGA 5CVHA 4C62A 2E9VA 5KBQA 4LOQA 5KX8A 4LRKA 4WT6A 4ANBA 3MA3A 3UO4A 2R3RA 1WVYA 5EW8A 1DI9A 4RVKA 1JPAA 2Y7JA 2ESMA 4PMTA 5LMAA 1OMWA 2XK4A 3DB8A 4FNZA 2PK9A 2XIZA 5HX6A 3GNIB 3QWJA 4K77A 4DGNA 3HDMA 3C4WA 2ITQA 4AW1A 4FUYA 4B8MA 5GINE 2B53A 3QCSA 5CT0A 3BGPA 2WMXA 3BGZA 1FINA 3KRRA 5AIRA 3LIJA 1Y91A 4MH7A 3O7LB 4O0XA 3NYOA 4W8DA 2YIYA 4FF8A 3ZRMA 1CKIA 3ORKA 4CCBA 3DFAA 4EL9A 4ZAUA 2C6EA 2JEDA 4IXPA 4OTFA 5F4NA 4AGDA 1FMOE 3UG1A 3PXRA 3AC4A 3UZTA 4BDHA 3C9WA 4RX5A 3V5JA 2AYPA 5LARA 3ZUUA 2XK3A 5LCJA 4YJOA 1JLUE 3MPTA 1B39A 3CD3A 4BB4A 4BDAA 3ZBXA 4FSUA 2I6LA 3D5VA 3GFEA 3UZPA 3VBWA 4QMUA 3ZMMA 4L53A 4F9WA 4YGAA 2WU6A 3DCVA 4QMZA 4DYMA 3C50A 4MBIA 3PE2A 4KWPA 4O7NA 3FJQE 2CJMA 4FX3A 3EIDA 3BIZA 3IDBA 5AEPA 1Y8GA 4FL3A 3TJCA 4OAVB 2XKCA 3OWPA 3PLAE 5K4JA 4RIWA 5AWMA 3FWQA 3UMWA 3JY9A 3R1SA 1IRKA 4L3JA 4O96A 4TKSA 4FOCA 5L2QA 3OWKA 4H05A 1E1VA 4YHFA 3KVWA 5FGKA 2W05A 2YACA 3OCGA 3I1AA 2HW7A 3MFRA 3ORNA 1V1KA 4IVAA 1YWVA 3W1FA 2VV9A 4CQGA 3DGKA 3ATSA 4F6SA 5ANOA 4JJRA 4XBUA 2VO6A 2IW9A 2YISA 3I5NA 2VNWA 3KK8A 3OMVA 3FKNA 3G51A 4GS6A 3TZ8A 3FE3A 3FMLA 3ITZA 5GJFA 1M17A 4WHZA 5E4HA 1FVTA 3U51A 4HOKA 4FYNA 1KE8A 3EN9A 2GHLA 4H58A 3PPJA 3W33A 4DT9A 3OUNB 4BWKA 3BU5A 2PWLA 3HV6A 5LWMA 1VZOA 5CXZA 4R6VA 4NEUA 5CT7A 4P4CA 5M56A 4WNKA 4D2WA 2X4ZA 4M3QA 4RZWA 1UNLA 3TNPC 3TV7A 1TQMA 4M97A 4XRLA 3EYHA 4B9DA 4BTKA 3Q32A 4FZ7A 3E8CA 3EQHA 3KMUA 5EK7A 5BVNA 3OBGA 3W8LA 4IVBA 4Y72A 3S2PA 4I20A 1MUOA 1ZYSA 4ORKA 1Y6AA 3G5DA 4OT6A 4FYOA 3GVUA 5CX9A 3AD4A 2OW3A 2VWUA 2O64A 4RG0A 5CEOA 1JKKA 1MRVA 3RHKA 1JSUA 5CF5A 2FUMA 3QXOA 3IGOA 3RMFA 3LXLA 3UIUA 3ZTXA 2R64A 2CCIA 3HUBA 4L42A 1LEZA 2UZNA 2ZAZA 4G34A 4FT0A 3I7CA 1LPUA 4RWJA 3WZKA 4C4JA 2P33A 4CZUA 2BZJA 2Q0NA 3ENMA 4BDCA 2YIXA 3CC6A 3HRFA 4U9AA 3FUPA 3MSSA 3MV5A 4RIWB 2GQSA 1R78A 1YHVA 4G6OA 3MFTA 4YNEA 4UMTA 4FTTA 3VUGA 3WZUA 4UMRA 2A4LA 2YLFA 2UZEA 4RC4A 5AP6A 3W8QA 2OSCA 1OIYA 1OM1A 1H1RA 3PA5A 4RFZA 3UTOA 3POOA 2HY81 2PMNX 5FXQA 3SX9A 3ANQA 4PDPA 4FBXA 2XEZA 2VTMA 2BDJA 4IX5A 2RG6A 4O91A 1KV1A 5M4UA 4PPCA 2HY0A 4QMMA 4BZOA 3QTZA 2W99B 2EXCX 4PL5A 2OIBA 4TTHB 2C5YA 4GG5A 3R21A 1QPDA 4D4RA 3LFAA 3GQLA 5IDNA 4XV1A 3TG1A 5I9VA 3UZRA 2PULA 4FL1A 3UGCA 2B9IA 5FEEA 5KHXA 5FLFA 5I5ZA 3EKNA 3TNHA 3KXZA 1PRYA 3K5VA 3R2YA 5C9CA 4E8AA 2FA2A 2VGPA 1YWRA 4S34A 5LOHA 1ND4A 1ZY5A 5LMKC 3BLRA 1OECA 3IPHA 3BLHA 4NSTA 4O86A 3FXWA 1Q3DA 2XNEA 4FNXA 5AADA 3DT1A 2EWAA 4DEAA 1BUHA 4R3CA 4YC8A 4R5SA 4D0WA 3LJ2A 1CM8A 1P14A 4BFMA 4DINA 5JQ5A 2W4KA 4R3PA 2X7OA 4LUEA 3ZU7A 2IW6A 1YRPA 3GC0A 4F1MA 2LGCA 2CLXA 3BGQA 5H8GA 4F63A 3AD5A 4ZZOA 3VWAA 3BELA 2CGXA 5C26A 4CKJA 3P5KA 3TJDA 4FIEA 4AZTA 4BDGA 4NJ3A 1Q61A 3TZMA 2GCDA 3KREA 3CEKA 3DZOA 4R8QA 4TY1A 3R8PA 2ZJWA 2IVSA 2QOHA 3CBLA 4BGHA 3Q2MA 1YOJA 2ITWA 2UVXA 3F61A 4WOVA 5KMLA 4FMQA 4UALA 5EH0A 1URCA 4QP1A 4U79A 4KKHA 2VU3A 4XP3A 3L8XA 4YPDA 4LI5A 2VAGA 3PG1A 4NIFA 4YTFA 3KY2A 4CRLA 5AUUA 4F65A 3IO7A 2YM6A 1PMEA 1A9UA 2YZAA 4QQJA 4ZS4A 4ASXA 3O96A 4IH8A 3EQPA 3ZRLA 2UW5A 2ZM3A 5IA1A 3D2IA 5ETAA 3PIYA 3PVBA 4GVAA 2ONLC 3FZOA 4N4SA 5LVOA 3QQFA 5EQYA 3IG7A 2UZVA 2XIYA 3DTCA 4L45A 3AD6A 2DQ7X 3CKWA 2QHMA 4MYGA 4C57A 2F4JA 2W9FB 3P1AA 4QMVA 5EYKA 4OBQA 3LFBA 4EWHA 4IM2A 4GMYA 4RMZA 2OZOA 2F2UA 4PMSA 5HBHA 3EOCA 3TKIA 1WCCA 3CTQA 1APME 3RINA 4BHNA 5CEIA 4DHFA 1URWA 5HEZA 2W1EA 5IUGA 2VTJA 4I6QA 4BCFA 2JKMA 2VTOA 5L6OA 4JDIA 3D5WA 3L8SA 5HNBA 3VF9A 2GNHA 3GXLA 3TKHA 4OAUC 1GY3A 4PMPA 3COMA 4O7SA 2PVLA 3KF4A 4AOTA 4I5CA 5J9LA 2G01A 2IVVA 5GHVA 2PE1A 4EK4A 3DAEA 1UKHA 4ZTRA 3FLNC 2PZRA 4FT7A 3MN3A 2WFYA 2G9XA 2YM7A 4RIYA 3RJCA 3GCSA 3FY2A 1OPKA 3BE9A 4GFOA 2ZV8A 5AR5A 4BCJA 4B7TA 3DNEA 3ENHA 2HYYA 5CTPA 2W5HA 2JKQA 4PRJA 1YXSA 1QL6A 4FV5A 4L00A 2BFXA 4DH8A 3S0OA 1IA9A 3RPRA 3LCDA 1UV5A 3EQFA 2CGVA 3ZLSA 1U59A 2OU7A 2QI8A 4L67A 4GFGA 3R9OA 2NNWB 4FEVA 2C3JA 5CQWA 1PHKA 3VBVA 1OL2A 4WO5A 4ZSLA 1OL5A 5IMXA 1S9JA 3SG9A 5JQ8A 3V3VA 4C8BA 3JR1A 3QTIA 3CTJA 4QD6A 4U8ZA 3EKKA 4DLJA 3KRWA 3BV3A 2XA4A 2HW6A 2OF4A 2X0GA 3PA4A 3A7HA 1ZXEA 3ACJA 3IECA 3IW5A 2OIDA 4DG3E 2VO3A 2ZVAA 4MHAA 3ZSHA 2VTAA 2W17A 4AWIA 2HIWA 4NIFB 5HTBA 4KSQA 2YJRA 4IFGA 3DKGA 1ZOGA 3A8WA 4YLKA 3S1HA 2ZYBA 4JS8A 4O21A 5CI6A 2HOGA 3ZLYA 5HOAA 3ROYA 4O6EA 3DPKA 4USFA 1Y57A 2V5QA 5DT4A 5IA5A 1RQQA 1M52A 2W1IA 4J71A 3Q4CA 4MBJA 2X4FA 2XM9A 4EK8A 4EZ3A 2R4BA 2ZMDA 3LXNA 1PF8A 4JBVA 3TTJA 1V0BA 4MEDA 4ZMEA 3UYSA 3NGAA 2QHNA 4G5PA 4OTDA 3NW6A 5H3QA 4DCEA 5IZFA 2UVZA 4L44A 4BCGA 4YSJA 4RX9A 3LKMA 3NEWA 3QQGA 3LMIA 2QU5A 3OP5A 3MW1A 4QPMA 4EYMA 5FTGA 4YURA 2BIKB 3SG8A 4M8TA 2QLQA 3JUHA 4YUQA 3F3UA 5A4QA 5CU3A 3OT3A 3WILA 2RSVA 3GC7A 2JBPA 3AMBA 3MBLA 3Q5IA 3JY0A 4U6RA 4YJUA 4JDJA 5J7HA 3CR0A 2WMVA 4RIYB 3GOKA 3WYXA 3RPYA 5FDPA 5L4QA 2QOQA 2J2IB 2WU7A 3TDVA 5J79A 2XBJA 2ITPA 3R71A 3EQRA 4PUZA 5DBXA 4EH7A 2HWPA 2UW3A 4WUAA 2CGWA 3KA0A 2RGPA 3PSBA 4FTCA 2GQRA 4FSYA 1SM2A 2QONA 4ZZNA 2P2HA 4U43A 5HLNA 4K18A 4LOPA 3I4BA 5CU0A 5KHWA 2P55A 2BTRA 3UOJA 4IB3A 2ZM4A 4FIJA 4FV6A 4IANA 2OJFE 2YM5A 3VC4A 3RPSA 3VBQA 4ANLA 4LMNA 4QYGA 4EUUA 4Q9ZA 4ZZMA 3R02A 3L8VA 4IIRA 1Q8UA 4IE9A 3ZO1A 1R0PA 2VRXA 4NT4A 2VNYA 4N6YA 5BVEA 3ORLA 4TWNA 4DBNA 2X1NA 3RK7A 3BHYA 3ZSGA 4G9RA 5ETIA 5GJGA 3VS3A 5ANDA 4EH6A 4BTJA 1Q5KA 3D7ZA 5BVKA 4AA0A 3BWFA 3PP1A 3LFEA 2PZ5A 4HYSA 4J1RA 4G31A 4EORA 4YJPA 4ZTSA 4E4LA 2Z7SA 1R0EA 1XKKA 5CVGA 1T45A 3GC8A 4Z7HA 4UYAA 3OXTA 3T9TA 2W5BA 3OCBA 3Q9XA 2A19B 2B54A 1P2AA 3QCQA 5CEMA 4MXAA 4GUBA 3TZ7A 4BWXA 5EG3A 3R7EA 4AE6A 1X8BA 2X2LA 4Z3VA 4GCJA 2CN5A 3EQBA 3ID6C 2CN8A 1XQZA 1JKSA 2OJIA 4QPSA 3QD2B 5JFXA 3SLSA 2QR8A 2WTJA 4I0RA 3NCGA 2X39A 3FHIA 5DA3A 3IW4A 4Q5HA 3MB7A 2W5AA 1WBSA 1BL6A 5DOSA 3FQEA 4RJ5A 3BWJA 3OOMA 3OUKA 4WG3A 1H0VA 2J4ZA 2E9NA 2PMIA 3M1SA 1BYGA 1H8FA 3IS5A 5EOLA 3GU6A 3PZEA 4O0TA 2FO0A 4Y85A 4ACGA 4ANQA 1OZ1A 3OC1A 3DK3A 3PIZA 5FXRA 5EW9A 4PWNA 4QP6A 3UOHA 1W82A 5AMNA 4BKJA 4DFNA 3TNWA 4FKLA 3TM0A 4TYJA 4JRVA 5D1JA 1JKTA 5CU6A 3PLSA 5IH4A 2FSLX 3RP9A 3G6HA 2GNIA 4K2RA 4XHKB 2VO7A 3L9MA 4Z7GA 5AV1A 3HEGA 2XBAA 5JFVA 4R7BA 3VO3A 4KS8A 4U41A 3VUTA 4A9SA 1YWNA 3VRZA 1Q8YA 4J7BA 4U81A 3RWQA 1OL7A 4O7LA 3E92A 4FG8A 4X0MA 2CMWA 4J95A 2VZ6A 3R9NA 3WZDA 4BC6A 5M44A 1NVRA 3FC1X 4CGAA 3Q9YA 1ZYJA 2XNMA 4CZYB 5FG8A 4J53A 5AM6A 2BRMA 4EOOA 4BIBA 3O51A 3KGAA 2OZAA 4XV3A 4YC6A 5CNNA 5C1QB 3GI3A 4B6LA 5KKRB 3V8TA 4RZVA 3VNTA 4EK3A 2F57A 1LR4A 2A1AB 3BQRA 4IJPA 4KINA 5D9HA 5DH3A 4NH1A 3RAWA 4A7CA 3L9NA 5M53A 4QP2A 4YTHA 5F20A 5C8NA 2BRHA 5IA2A 2UZOA 3FI8A 4N57A 2WMQA 4HVGA 5DG5A 3NAYA 4CT2A 1YXXA 3NYVA 5IQHA 1M7NA 2A2AA 4O38A 3TCPA 4USEA 4FV0A 4UZHA 2DWBA 2SRCA 2UZBA 4EOMA 2Y0AA 2VTIA 1CMKE 3E63A 1OVEA 3Q6UA 4MD8E 4JAIA 5LVLA 4EHZA 5HLWA 1IAJA 3ORIA 3COKA 3P4KA 5IQAA 3BZ3A 4M69A 3VS7A 4PP9A 4ARKA 1KSWA 2BAJA 2QOBA 4NKSA 5E9EA 4KKEA 1Z9XA 3HZTA 4XOYA 5HIDA 4MVFA 3C5IA 3I6UA 4V04A 5AA9A 2WHBA 4IZYA 3RZFA 4IEBA 3LZBA 2PU8A 1W84A 4J8MA 4LL0A 2W0JA 4FOBA 3S00A 1KV2A 4M68A 4U3YA 5CSXA 1H1QA 3C0GA 4K0YA 3KF7A 2J9MA 3PVUA 3THBA 3KC3A 5EDRA 4D2PA 3UVRA 2YCSA 2XKEA 5E91A 2AC5A 4F64A 3REPA 4KRCA 2X6EA 2WIPA 4XP0A 3DTWA 4C3PA 4D55A 3H0YA 3ZO2A 2B9HA 3OY3A 4JLCA 3UBDA 3QQLA 3UOLA 3LLAA 4IAZA 4LRJA 1YVJA 4DTKA 3AT4A 4CTCA 3FQSA 4QTBA 1WVXA 4LV8A 4DE4A 3PXFA 2BAQA 3Q4UA 1ZYDA 4K33A 2YEXA 5CZIA 4F1OA 4D0XA 5BVFA 3QL8A
chains in the Genus database with same CATH superfamily
4NM3A 5L2WA 2BVAA 2I0EA 3W55A 2ZB1A 5LVPA 2BRBA 2WTKB 1WBWA 4EQCA 3DY7A 1ZWSA 3D94A 3HYHA 4XLVA 3RNIA 2JKKA 3PY1A 3R63A 4BCPA 4QQTA 3FYKX 3C4FA 3FMDA 3WF5A 4KD1A 2GU8A 3IQ7A 4X21A 4AA4A 4C35A 1OBGA 2IN6A 2OZAB 4FVQA 1U46A 1YKRA 4F1TA 3DFCB 2NPQA 2ITNA 2YWVA 4DFYA 2F7ZE 3FKLA 3TN8A 5IA3A 2CNQA 5A4EA 5TE0A 4EQUA 3MI9A 3W2CA 4LRMA 4AGWA 3DQXA 4TT7A 4L43A 3GU4A 3GCUA 3QTUA 2VTQA 5DVRA 4U45A 2WELA 2XNBA 3AKLA 1XO2B 3F3WA 4J99A 4RVTA 4O7ZA 2XYUA 1H26A 5FD2A 3GU5A 2HWOA 2CNVA 3RKBA 3RAKA 5HQ0A 3FZSA 3FPQA 2W1DA 1G5SA 3BQCA 3HRCA 2XMYA 4O7RA 4X3JA 4I22A 3ZCLA 2R2PA 3PUPA 1SVHA 3R01A 4S33A 4XMOA 3TV6A 5D7VA 1BLXA 4NTTA 3O8UA 3W16A 5DR9A 4ZTNA 4YZCA 3ZZEA 5B2MA 3W0OA 5FEQA 5HZNA 5A3XA 2HXQA 2IVUA 4FNWA 4FVRA 2QKRA 3QRKA 3MVMA 3RI1A 5L6WL 4R7HA 3KRXA 4EONA 3SC1A 4AXFA 1XBBA 4BCMA 4IZ7A 4FKVA 2XRWA 4ALWA 4IZAA 3VN9A 3R9DA 4LL5A 1PMUA 1JVPP 3MH1A 3E8DA 4MX9A 4FT5A 1ZMWA 4IHPA 3E5AA 5E8ZA 5HX8A 3DXPA 5H2UA 5HBEA 2XYNA 5EM5A 2XVDA 3VUHA 2XIRA 4O7TA 1YXVA 2OJJA 4EHVA 2BRNA 3H9OA 4AT4A 3D2KA 1XMMA 1L3RE 4JBQA 5I9WA 2C1BA 5BVDA 1OKWA 4EKKA 5CAVA 1H1SA 5M51A 3F88A 2C6IA 2JIUA 3QTXA 4UMQA 4GFMA 4ZJJA 3R7IA 3ZSIA 3UO5A 4BJJB 4DDGA 2YWPA 4Q5EA 4TL0A 3PY3A 4IDVA 4W9WA 2WMRA 3EH9A 3Q96A 3D15A 1AD5A 3ALOA 4I21A 4RWIA 4QQCA 3SRVA 3FL5A 1ZARA 3NS9A 5BMMA 5JZNA 3DJ5A 4W8EA 1UNHA 2QO7A 4TNDA 2DS1A 1A48A 4FTQA 4L6QA 5D11A 1REKA 5LJJA 4UEUA 3UIMA 4MXZA 4F70A 2UZUE 3U9NA 4S30A 3BYUA 3V5WA 4QYHA 3LMGA 2G2HA 2JLDA 3A8XA 3VUMA 2XIXA 4C02A 4YC3A 3QKMA 4EH4A 1XH6A 2H6DA 3CY2A 3P08A 3R8LA 4A4OA 3O17A 4E1ZA 5BV3A 1TFFA 2PMOX 2C3LA 3ORPA 2X0QA 3FYJX 3MH3A 4MKCA 5IEXA 4DFUA 5E8WA 3ETAA 3LM0A 4FKQA 4YTCA 1IEPA 5E8VA 2H8HA 3DKFA 4C3FA 3O7LD 3G2FA 4ZEGA 2EXEA 4Y5QA 3DDQA 4A06A 5GZ8A 1J1CA 2WPAA 2XCKA 3GCVA 4BYIA 2JFMA 2PE2A 4ZSEA 5DRBA 5KZ0A 4BCQA 5I9YA 3FQHA 5CASA 3H9FA 5TT7A 5KKRC 4N70A 1REJA 4CKIA 4AQCA 3HGKA 3NNXA 3DNDA 4C4GA 3BYSA 5HO8A 4BKZA 1Q4LA 1RDQE 4OBOA 4AGUA 3WE8A 4R7IA 4X6QC 2R3GA 4MQ1A 2ETKA 4M13A 2JDVA 4USDA 2WTVA 5AP7A 5EM8A 3A61A 1WBOA 3G15A 3QGYA 3RTPA 1CDKA 3IOPA 4AW2A 4FGBA 4AP7A 5CYIA 4QMSA 2RF9A 4O7YA 2WQBA 2YAKA 4DITA 3UVQA 5JK3A 2H34A 2GHMA 4GVJA 5HCYA 1AGWA 1P4OA 4IB5A 2CCHA 4CCUA 1OUKA 5GNKA 3ORXA 5CF8A 3F3VA 3PRIA 5AUTA 2QQ7A 4AW0A 2HELA 3NUYA 4I5HA 3JPVA 5DEWA 4APCA 4CFXA 2QO2A 4L9IA 5CAPA 4KIOA 4QPAA 4AU8A 1MQBA 3KKVA 2KTYA 5T68A 2VWWA 1TZDA 4XG6A 3EWHA 2AUHA 3KXMA 3BYOA 4W4XA 3NUSA 4BYJA 2ITYA 4DLIA 3NMUF 3OCSA 4OTWA 5IDPA 3U9CA 5FDXA 4KIQA 2WOTA 1YDRE 2JITA 2QOLA 3ALNA 1LP4A 5AR7A 3CQWA 3FLQA 4BCNA 2ZV2A 4NCTA 4QOXA 4AF3A 3CXWA 1XHAA 2ZFYA 2XRUA 4J98A 4UWBA 3HV7A 1K2PA 3OD6X 5HE0A 2IWIA 2E9OA 3GB2A 4HPTE 5H9BA 2HXLA 2WAJA 3OW4A 4BCIA 4D2RA 4GYGA 1FGIA 4A9RA 2HCKA 2VD5A 3Q3BA 1CKJA 1M2QA 3CE3A 3ODYX 4FKSA 3AOXA 5AV3A 4I6FA 4Z55A 2WTKC 2A0CX 2R3IA 4UY9A 3HNGA 4FKWA 1MQ4A 4QMOA 2WB8A 2X0PA 4C36A 1OIUA 4YR8A 4O2ZA 3ZC6A 3GC9A 1H0WA 4FSWA 4QP9A 2J0LA 4C34A 3NZ0A 4EHEA 3OWJA 4KBKA 3NW5A 4JT3A 4FV8A 4TYHA 3PP0A 4MXCA 4ZSGA 3KXXA 1Q97A 2VX1A 2X7GA 3FMJA 4HGLA 3NDMA 3MH2A 5D7AA 2ITXA 1ERKA 3UQCA 2ITOA 4MNFA 1MP8A 2ITUA 3TXOA 3MTFA 4ZTLA 2FVDA 3PPZA 4EJ7A 4D1SA 2GNGA 4CEGA 4UX9A 2UW9A 5EQEA 3H9RA 4GW8A 3R2BA 2GPHA 3LCTA 4JX7A 2XZSA 5GZ9A 5M4FA 4QMTA 5K5NA 5IQDA 1QPCA 4F7JA 4D28A 2QG5A 1VYWA 2WMAA 3LAUA 4TRLA 4EH9A 2JFLA 4DGOA 3QYZA 5L3AA 3HMMA 5BNJA 1G8AA 3QUDA 5BYYA 2HK5A 4Y46A 5AUXA 3I81A 1PXPA 1SVGA 2IZRA 3WZEA 4BDIA 4R1VA 4JQEA 1SVEA 5FTQA 3CD8A 3FMMA 1KE9A 3BKBA 3RVGA 5AR2A 1SYKA 1UU7A 2I0HA 2UW7A 5I9UA 3NUNA 1ST0A 5HG9A 3F69A 2C5XA 5BUIA 4X3FA 2Y4IB 2YIRA 5TR6A 5DR2A 2GHGA 3NUAA 1J91A 4AN9A 1IASA 2YN8A 3QAME 4KIKA 3BYVA 3FAAA 3I60A 3EN7A 4QP3A 5CZHA 3MTLA 4M0YA 3HX4A 3LFNA 4O4BB 3TL8A 4ZIMA 3VHEA 2PVNA 3P79A 5LMBA 3CTHA 3VS4A 3I6WA 3RGFA 3GEQA 5E8SA 3W10A 3SXRA 2WGJA 1JKLA 2WZJA 3HMPA 2ZV9A 1TVOA 3LW0A 5G1XA 3ZUVA 5HNIX 5IEVA 5JEBA 3CPCA 4E6AA 5JMSA 3MDYA 5JFSA 5CF4A 5E90A 3FEGA 4IJ9A 1OKZA 3H4JA 5I3RA 5IF1A 2PPQA 4GKIA 4AZWA 3V8SA 3F9NA 5JKGA 3ZO4A 3KIOC 4R77A 3KXNA 4O0SA 4E6QA 4TWPA 2CSNA 2V22A 4WNOA 4KIPA 4EOSA 1JSVA 3CJFA 1PY5A 2PE0A 2ITVA 3FI2A 3QUEA 2IPXA 1JBPE 2HZ4A 3R9HA 4TXCA 1XH7A 4X2JA 3SHEA 4TYHB 4GT5A 4YPSA 4BF2A 4GKHA 4OTRA 4FJVA 3GFWA 4XYFA 4CLJA 3BHUA 3UDZA 1KE7A 4XRJA 4I41A 4LGHA 1GIIA 3Q60A 3G0FA 4G2FA 4W4WA 2RL5A 2VTLA 3QUPA 3PSDA 3R0TA 3CP9A 4P5ZA 4RWLA 4AZVA 5EHLA 2W96B 5H8BA 3OTVA 3DJ6A 4L46A 3FXZA 4DFZE 4PQNA 1J7LA 2I1MA 4FTRA 5DLSA 4BBMA 2OK1A 4L8MA 5AM7A 3CPBA 1ZMUA 3G9NA 4MUQA 3N9XA 4UWYA 4V05A 2BZHB 4FEXA 4B99A 4JMQA 5BVWA 2PUNA 2O3PA 3QRIA 3RPOA 5DE2A 2PTKA 3DDPA 3Q04A 3AT3A 4RQVA 1AQ1A 4O2PA 1KWPA 3Q2JA 4G3CA 4DH3A 3ULIA 4L3LA 2IO6A 4ERWA 3L8PA 3ZOSA 4JG7A 1PKDA 1SZMA 3FZRA 4JNWA 2RFNA 4BDBA 5J7BA 4NKAA 3F6XA 5IQIA 5J1WA 1K9AA 5TOZA 3DAJA 4X3FB 2IVTA 3NNWA 4IM0A 4V0GA 3VRYA 3E62A 5TF9A 4FNYA 2WTWA 4H36A 2WKMA 3NIZA 5AX3A 4IWQA 3GOPA 4C4IA 5CU4A 2CKPA 1GJOA 1E9HA 2Z02A 3MVJA 1WMKA 5JRSA 3QTSA 3QD0A 3FI4A 1NY3A 4X7QA 1BL7A 4DTBA 2PVJA 4YBKA 3PIXA 4ACCA 4FIHA 3EFLA 1GIJA 3IW8A 4IAFA 5E8XA 2XB7A 4F78A 4FI1A 2YABA 3EFKA 4H39A 4Y5HA 5ACBC 3TWJA 3NRMA 5DEYA 5LQFA 4KNBA 4CG8A 3FLZA 3O50A 2O63A 5EOBA 3P86A 4C4HA 4C38A 3HL7A 4E4MA 4I1ZA 4NFMA 2C6LA 4U5JA 1H01A 4F6WA 3MY5A 3QC4A 4FTIA 4OTGA 1FGKA 5J5SA 3OCTA 4I4FA 4IDTA 4RVLA 3R7UA 3CQUA 3O71A 2YERA 2I7QA 2XK6A 1G8JA 5CU2A 4EUTA 3LCSA 2PUPA 3R8UA 3LPBA 3FMHA 2C6OA 4I92A 1OL1A 3PJ1A 4O4FA 3VBTA 1SMHA 4HGSA 4RPVA 3VF8A 1E1XA 4F7LA 2HZNA 3V5PA 5EM6A 2ZM1A 4GK4A 4G5JA 2VX3A 3AGLA 3EN5A 4DH1A 3QTQA 5DT0A 2F2CB 3N4TA 2VWZA 3W2OA 2QG7A 3NW7A 4P2KA 3VVHA 3BE2A 4C61A 4AGCA 3D5UA 5ANIA 3BU6A 2GTMA 2PZIA 2UW8A 3D5XA 2R0IA 4FSQA 4DEBA 4UN0C 2OH4A 3QF9A 3AC1A 5IQEA 3LMHA 4FKPA 4IX6A 3ULZA 4EOKA 4QDEA 2BRGA 1U54A 1HCLA 1IR3A 3MVHA 2C6TA 3GU8A 3O8TA 3R7VA 2BAKA 2GQGA 2OO8X 4D1XA 5IA0A 4GSBA 5AR8A 4V0GB 3RHXA 3PFQA 4I94A 4O4CA 2JGZA 2W7XA 4QP7A 3GU7A 3AGMA 5AP1A 4H3QA 5J95A 4PTEA 3W18A 4Z9LA 4E5AX 4OTQA 3K3IA 4YLLA 4R5YA 1CSNA 1OITA 3SXSA 4FKIA 3TTIA 3KXGA 3ZRKA 3FLWA 1KE5A 4BKYA 4D2TA 2WQNA 3RWPA 5DN3A 1B6CB 4DEIA 4EOIA 3QX4A 3UYTA 4CVAA 3VW6A 3IONA 3O5AA 4KBCA 3C13A 3QFVA 1UU3A 2BDWA 3R6XA 4S2ZA 2IZTA 3GCPA 3KRJA 3MA6A 3IK3A 3O8PA 3POZA 2ZV7A 4I6HA 4QTCA 4ANMA 4AAYA 3D9VA 1I44A 2X9EA 2XP2A 4GL9A 4IBMA 4G6NA 4HGEA 4BICA 3L9LA 5KCVA 3HA6A 3NYNA 4QTEA 3TI1A 5J1VA 4IVDA 4DT8A 3MWUA 3HMNA 5EFQA 3NWWA 3U8WA 4ZJVA 3A99A 1HCKA 2B0QA 2XNPA 2Y4IC 1Z57A 3F3TA 2C3IB 3NSZA 3NUXA 2WMTA 1ZYCA 2NP8A 1VYZA 4NCTC 3EQGA 3MB6A 3TIZA 4BI0A 2XJ1A 4QYYA 1YI4A 2ZOQA 4MTAA 3TUBA 2XK9A 2XJ2A 2JIIA 3COIA 2W1HA 4I0SA 5EHOA 5AA8A 2QOOA 3LXPA 3KULA 2YHVA 3EJ1A 4OTHA 4OW8A 5CNOA 5J87A 2R3MA 4ITJA 2QKWB 4R1YA 2GTNA 4RT7A 1MRUA 1QPJA 4OR5A 4L7SA 5DHJA 3AKJA 4ZTQA 3EMGA 2OFUA 2YIQA 1R39A 1M7QA 1OB3A 1ZMVA 4O0YA 4U97A 5JRQA 4BDJA 4PX6A 4UXLA 4EOJA 3F2AA 2EB2A 2C5OA 3NVKI 5K4IA 4ITHA 3RK5A 4FL2A 3LQ5A 1XH4A 3OEZA 4G3FA 4QP8A 4X2KA 3IW6A 2OI4X 3BX5A 4QMWA 4BZDA 1UU8A 3QU0A 4ZLOA 1IAHA 2UZWE 4GIHA 1U54B 3SAYA 4MF1A 1BI8A 4LQMA 4MD7E 3DKCA 3P7AA 5BQ0A 3LCOA 3O23A 2BROA 5DNRA 1WZYA 2JAMA 4NL0A 2P0CA 4MWIA 3G6GA 5AX9A 4C33A 3ORZA 5HG5A 3DLSA 5HBJA 3UDSA 5T6KA 3ORMA 3PWDA 3C4ZA 4GRBA 3UDBA 2W4JA 4DEEA 2EXMA 1FQ1B 3O0GA 3CQEA 4BI2A 4U3ZA 3KL8A 5A4TA 2GS7A 1JSTA 4NUSA 2Z7LA 3ATTA 2QOKA 2GMXA 4BZNA 3LJ0A 2QOFA 3ACKA 5T3QA 4JG8A 3VIDA 4YU2A 1G8SA 4FODA 3AQVA 2XNOA 4LGDA 5HE2A 3V6RA 4FTKA 3TNIA 4N6ZA 4CZTA 2YM8A 4QNYA 5L8KA 4FGRA 4CFMA 4F4PA 4BDDA 5AP4A 5BX0A 3AC3A 4IACA 4O0WA 5HCXA 3CLYA 4BDEA 2YCQA 4F08A 4PPBA 3FI3A 4UMUA 3HMIA 4CFWA 3ZLWA 1NW1A 4D1ZA 3EHAA 3QA0A 4D4YA 3KXHA 4GU6A 5CY3A 2WIHA 5M07A 3BCEA 3D7TA 4ALUA 3R28A 3ZXTA 3QLGA 4X3FC 4WRGA 1BX6A 1UU9A 1CTPE 5AV4A 4AT3A 4NFNA 2NYAA 4AZFA 5GIOE 4CG9A 4JAJA 4JR7A 4ZSJA 3Q9ZA 1DAWA 3K2LA 4GUEA 2I40A 4AE9A 4BI1A 2Z2WA 3A4OX 4KSPA 5EW3A 5I9XA 5DWRA 5E7RA 1T46A 4HGTA 3LE6A 3KULB 3UC3A 3WF6A 5JSMA 1O6LA 2Y4PA 2VTSA 5M4IA 3F7ZA 3PJCA 3KCFA 5CSPA 3OWLA 4QMXA 5AR4A 5AUWA 1H1PA 3NFFB 3GBZA 3EN6A 2CLQA 3ZDIA 2CPKE 3QQJA 5IKWA 2QLUA 3LLTA 4Y8DA 1PMNA 3CSVA 5KO1A 5EI2A 3V51A 3QKLA 3G9LX 4ID7A 2XNGA 4UYNA 2G2IA 4JIAA 2GNFA 3NLBA 5EM7A 2VX0A 3R1YA 2HZ0A 3F7WA 2OLCA 3JXWA 3OY1A 4O6LA 5IH5A 4RRVA 4Y83A 2ZMCA 4YZ9A 4XG9A 4KABA 2QURA 3C4CA 4AZEA 3F3ZA 3VONA 2VGOA 1H07A 1W98A 4QO9A 4LUDA 2YLEA 4AN3A 3TUCA 2WO6A 3RM7A 4F0IA 1OUYA 4NW6A 4YJTA 3LFSA 2UW0A 2UZLA 3QRJA 4HCUA 5EYCA 1TQIA 1U5RA 2Y8OA 3FZ1A 4FICA 4GT4A 4RC2A 1IA8A 4RGJA 4X2NA 3WIGA 4FIGA 4M14A 4M0ZA 4E6CA 2BHEA 3DXNA 2FB8A 2P3GX 4QYFA 3TIYA 3ZYAA 2X0OA 4PDOA 4YJNA 5HO7A 3CGOA 3F2NA 3QA8A 1GAGA 3Q4ZA 4U7ZA 4UXQA 4EBVA 4ZLYA 2VTNA 3HAMA 4WKQA 4C58A 5FUTA 3MY0A 4IC8A 5M08A 4TN6A 4ZS0A 3AC2A 2PSQA 3KQ7A 4QMPA 5M55A 4WG5A 2WMSA 3VULA 3A60A 4C2VA 5KMNA 1ZRZA 3D7TB 3VJNA 3UIBA 4BGQA 3TMOA 2VWVA 5FP5A 5HVJA 4ASZA 4BBEA 4CV8A 4IZ5A 3UNKA 3LHJA 4D2VA 2KULA 3HP5A 3MIYA 3ZEPA 2XANA 4FKOA 5AAGA 1VJYA 4FSZA 5KUPA 4RLKA 4CLIA 4E20A 2J50A 4JG6A 4D4VA 2A27A 4IADA 4MF0A 4CSVA 2R7BA 2X8DA 4EQMA 2CGUA 3LFCA 3SGCA 5JT2A 3PA3A 2BZIB 4NWMA 3QXPA 2IF8A 3IW7A 3ET7A 2V7AA 2Z8CA 3FC2A 3KFAA 4L3PA 4C3RA 4DC2A 4ZXTA 3R22A 3WOWA 4O83A 2IZUA 4YHTA 1H1WA 2ACXA 3NX8A 3HAVA 4JX3A 3RNYA 2W1FA 4CFFA 4WIHA 5H8EA 3KVXA 4EK5A 3PTGA 5FRIA 4G17A 3H0ZA 4GU9A 5C4LA 3ZO3A 5AAEA 5M57A 1GOLA 3BYMA 3COHA 3JVRA 4TNBA 5C01A 2RIOA 3K3JA 5EYDA 5HVYA 3SV0A 3FZPA 5FBOA 3PJ8A 5I4NA 5JFWA 4OBPA 2R3JA 2J90A 4WA9A 3S3IA 5CXHA 3C5UA 4A9YA 3I5ZA 2JDOA 2IEWA 4P7EA 2E9PA 4M69B 3LVPA 2R3LA 2HAKA 1J1BA 3SKCA 3PRFA 3RAIA 3JYAA 3BPRA 3W32A 3N4UA 4Q9SA 5IQBA 3U55A 3A62A 4XOZA 3OS3A 2WTCA 3L1SA 2XKDA 4O0UA 3VQHA 2R7IA 2OICA 4LM5A 4BCOA 3ANRA 5JH6A 3QC9A 2C6MA 2C0OA 3TDWA 1OL6A 2X8IA 4I6BA 3QHWA 2FSOX 5IMEA 4HYIA 3R00A 2I0YA 5L8JA 2R3HA 1W7HA 2W9ZB 2DUVA 3HUCA 4AW5A 5L2IA 5IQFA 5KBRA 3NNVA 3NNUA 1VR2A 2ERKA 2OBJA 4DTAA 4R3RA 4BHZA 2G2FA 3UODA 3W2SA 2JDSA 4E26A 5C4KA 4FSNA 3FPMA 2FH9A 3SW4A 1A06A 3PPKA 2C68A 3OG7A 5IUHA 4KUJA 4BTFA 4D9TA 2RFSA 2IW8A 3TKUA 4XUFA 5HI2A 4FV1A 4JRNA 1JWHA 3DS6A 3QX2A 1FOTA 1JOWB 1XH5A 1RW8A 2C0TA 4Z16A 3NYXA 2XJ0A 4WNPA 3F2RA 4MD9E 3TEIA 3GT8A 3PVGA 4QP4A 3SA0A 3ZFYA 1OI9A 3T8OA 4GIIA 4K6ZA 5EI8A 3UVPA 2JC6A 4AXAA 5CSHA 3R7GA 3WF9A 4FEUA 4YJRA 2C69A 4D5KA 4F7NA 4EC8A 2EB3A 3A7GA 3JS2A 4G3EA 4ITIA 2J0IA 4DFXE 4C2WA 5BUJA 3W2PA 4JL9A 4JBOA 4LYNA 1H27A 4IAIA 1NXKA 4QT1A 3MH0A 3W0PA 2IJMA 3H3CA 3TACA 2YDJA 2YIWA 4JDHA 4E73A 2EUFB 5A6NA 1PJKA 4MCVA 2GS6A 4RLLA 1OGUA 1ZZLA 3EL8A 2GFSA 4FEQA 5IH6A 3HV5A 5ACKA 5DYJA 2C5VA 5E8TA 3A7JA 2X2MA 3UIXA 5BMSA 4LV5A 4GT3A 2VWXA 5CWZA 5D12A 1YQJA 2ERZE 4CMTA 4NK9A 4OTIA 2YAAA 3Q53A 2R3NA 2WD1A 3WF7A 3N4VA 3MFSA 1WBTA 4AX8A 4I5PA 3I7BA 3VS2A 4F6UA 3C7QA 4HVDA 4FTMA 5F9EA 4TWOA 3Q4TA 5C8MA 4XG4A 3R7OA 3VS5A 2H9VA 2QOCA 1OIQA 3PWYA 3R7YA 4JI9A 3VUIA 4U0IA 5CALA 5J5TA 2PVYA 3OXIA 3QALE 4XLIA 1OGYA 1Q99A 3ROCA 3BHVA 3MPAA 3OT8A 4M15A 4U40A 3ZHPC 2X8EA 3LCKA 2YDKA 2WEVA 4I5MA 4O7VA 2J5FA 3FY0A 3EYGA 4FZAB 2Y9QA 2Z60A 2VTHA 5AFVA 4J52A 3ODZX 2JKOA 3C1XA 1WBNA 4L52A 4XH6A 2NO3A 1DAYA 2CKQA 2OG8A 3UE4A 2J0MB 3GQIA 4IB0A 4DF3A 4KS7A 2ETMA 2FGIA 4ACMA 5A4CA 4A9TA 4UBAA 5HCZA 3MYGA 1UWHA 4G6LA 4HNIA 4AFJA 3GGFA 1H24A 3UC4A 4EOLA 2B4SB 3GP0A 3LFDA 3E3PA 2X81A 1UNGA 3LFFA 2BR1A 3T9IA 4K11A 1JNKA 2OIQA 3HVCA 4RSSA 5CI7A 1S9IA 3FL4A 3UQGA 2JD5A 3SRVB 4DA5A 2C3KA 4KA3A 3I0QA 4FSTA 4C4FA 3PDTA 5AAFA 3EL7A 4AZSA 4RFYA 3SXFA 2NRUA 1PYXA 4FV3A 1FMKA 3IKAA 1BKXA 4W4YA 5K3YA 5TKDA 1PXIA 3BBTB 4B8LA 1YHWA 5ICPA 3DQWA 5FEDA 4OT5A 2BMCA 1KOAA 4RX7A 4JR3A 4ZY6A 2V0DA 2YCFA 4UMPA 1NVQA 3E93A 4S31A 4YP8A 4G1WA 4TZRA 4M84A 2XH5A 3UG2A 4TYEA 4EK6A 5DR6A 1PW2A 1KE6A 3OROA 3V5TA 2YCRA 2ZDUA 3FMNA 3IGGA 1W0XC 4EHGA 3R30A 3DKOA 1O6KA 4YO4A 4RC3A 3NUPA 4CYIA 2C30A 2B9JA 2P4IA 4AA5A 4I4EA 4QTDA 2H96A 2JDRA 4FV7A 1R1WA 3RM6A 5EI6A 3LJ1A 2EU9A 4YZDA 3PXZA 3RZBA 3UP7A 3C51A 4EEVA 1XWSA 2WQMA 3QBNA 4PNKA 4FV2A 2F9GA 3QZHA 3C0IA 3F5PA 4GYIA 3MESA 4YLJA 3QZFA 2JDTA 4F9CA 4IVCA 3GUBA 2Y6OA 3KU2A 2QOIA 2C4GA 4ERKA 1FVRA 2IG7A 4YZMA 3DZQA 4IFCA 4OLIA 4TPTA 4UZDA 2JIVA 5AP2A 4OGRA 2NRYA 4IW0A 4F09A 4I3ZA 4AS0A 2X2KA 5GIPE 4WNMA 4QMYA 4U44A 4XG8A 3QRTA 3BRBA 4FG7A 2CKEA 3Q9WA 5AP5A 1PXKA 4O7WA 2C1AA 4A4XA 4HVSA 3AMYA 4PV0A 4HPUE 2W4OA 4ACDA 2WQOA 4C59A 4PNIA 3QQUA 3SOAA 3FZTA 4ZY5A 2PYWA 3W2RA 3BL9A 2R3PA 1RE8A 2ZDTA 1YOMA 1OIRA 4MXXA 3DK7A 2OF2A 2WMWA 3LQ8A 5HICA 4D58A 3DLZA 4FE2A 1B38A 1BMKA 1IG1A 4P5QA 1NVSA 3P78A 1QCFA 3ZS5A 1ZYLA 3BU3A 3NIEA 5A9UA 3QWKA 2P2IA 4YSMA 4AOJA 1DI8A 4H3PA 2W06A 2ZB0A 4EOQA 3DBQA 4IC7A 3E88A 3OTUA 2VTRA 4PDYA 4JQ8A 3E3BX 4FV9A 4L01A 3V6SA 3QQKA 3DBDA 4RJ3A 4K8AA 3WF8A 4L7FA 5LVNA 3PG3A 3WYYA 1EH4A 3M2WA 3FSFA 3TT0A 4O1OA 4FTUA 4NZWB 3VS6A 4HW7A 1O9UA 3NPCA 3U4WA 1FVVA 4J97A 4O84A 4XP2A 5ANGA 1Q62A 3W0QA 4DAWA 2UUEA 3PJ3A 3N51A 3OBJA 3A7FA 4XNEA 4BGGA 4MNEA 4HVIA 4FSRA 2VWBA 3PSCA 3EFWA 3QLFA 4W9XA 3FXXA 4E93A 2DYLA 2PVKA 3E7OA 4WD5A 3UPZA 1PKGA 5CSVA 2OWBA 2W1ZA 5J9YA 5FXSA 1Y8YA 2BALA 4FSMA 4DEDA 2F7XE 1YDSE 3OXZA 2X6DA 3HA8A 2XF0A 3IDCA 3RAHA 4BN1A 1STCE 2YZLA 2J0KA 5BYZA 2QD9A 3EFJA 4NU1A 2PMLX 4NM7A 4QYEA 5KMIA 3P23A 4F9YA 4MXOA 1G3NA 5HTCA 4DH7A 5EKOA 1ZOHA 2WQEA 3ORTA 4BCKA 2YDIA 4O4EA 4DG2E 4BY9E 2UW4A 5DI1A 4FK3A 4XV2A 3NR9A 5IUIA 4FKRA 2B55A 3BHTA 4XBRA 1UVRA 3VUKA 2XM8A 1L8TA 1YHSA 5CAOA 4IAYA 4DHJA 4HYUA 3MVLA 2J0JA 4C37A 3FV8A 5HD7A 1BI7A 2IZSA 5AUVA 4RBLA 4IX3A 4I24A 4YNOA 3AG9A 2HZIA 2R3QA 3K54A 3R8ZA 3F5GA 4BBFA 4CKRA 4AAAA 5HIBA 4FEWA 4PL3A 3QTWA 3UMXA 5HLPA 3DJ7A 5HKMA 5HU3A 4BVUA 3EQIA 5F1ZA 4LG4A 2BIYA 5A46A 5J8IA 2C6DA 2V7OA 3R83A 3ZM4A 5HORA 3UQFA 3PVWA 2WNTA 3S95A 2UZTA 5KZIA 4ENYA 3LQ3A 3BI6A 2UZDA 4RIXA <