2HZIA

Abl kinase domain in complex with pd180970
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
268
structure length
268
Chain Sequence
DKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Structural biology contributions to the discovery of drugs to treat chronic myelogenous leukaemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2hziA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2hziA01
2W1EA 1S9IA 2V7AA 3NMUF 1JLUE 2YACA 3KN6A 2VUWA 4BCHA 4CZTA 4QP8A 4O7ZA 2A2AA 2QONA 3OMVA 4MBJA 4D5KA 5TR6A 1FMOE 3EQGA 3QTZA 2BPMA 2CGUA 4FV7A 4KIQA 4M0ZA 3NCZA 3A7FA 5EW3A 1H0VA 2GTMA 3D0EA 3ZRLA 4EK3A 4O7VA 4MXXA 4QMSA 4CQEA 5K9IA 4FC0A 3F9NA 2AC3A 3RNYA 1K2PA 1CSNA 5JMSA 5B0XA 4Z3VA 3CTHA 3QXPA 3RGFA 1H28A 4GMYA 4MYGA 5EFQA 4QMPA 5E92A 4AWIA 3WZEA 2A0CX 4IB3A 2YZLA 3H0ZA 2JFMA 5IQBA 3LPBA 4JOAA 1FGKA 1M7NA 4M3QA 2EB3A 3SXFA 5JRQA 3V5PA 5M09A 3GP0A 4FNZA 3MH0A 2G2FA 2ITYA 4O0RA 4TWOA 4QYHA 4XLIA 3TV7A 2J2IB 1E1XA 3G6HA 3QWKA 4DH8A 3L8VA 3VBXA 4EZ7A 4O83A 1GZKA 2UV2A 3ZLXA 2PE2A 4ZTRA 3HV6A 3U87A 3KCFA 2YWVA 1YI4A 2X4FA 3R1YA 2JGZA 4X3FA 3GU4A 4GFMA 3Q4TA 4MCVA 2A19B 4RT7A 3A4OX 3I5NA 4AGDA 2UW5A 5C9CA 4FOBA 3ORZA 4O7YA 4S2ZA 1H8FA 3O7LD 4RVKA 5BVEA 5L3AA 2GSFA 2X39A 3GQLA 3MTFA 2RFNA 3WZJA 1DI9A 4OLIA 5K5NA 4V05A 3RZFA 2GNHA 2QU5A 3R9HA 3UP7A 2WTVA 3KXMA 5EYKA 3PIXA 2BFYA 4GVAA 4ZLYA 5AP7A 2HXLA 4I5MA 3TCPA 3W33A 5DT3A 5BVKA 3ZS5A 5J9YA 4UN0C 1FMKA 3GC8A 4JR7A 1ZZLA 2VD5A 2J4ZA 2QR8A 3W10A 3GUBA 4YBKA 3DB8A 3NGAA 4Q5EA 3ZDIA 3W2CA 4TY1A 2YLFA 3ET7A 5A4QA 4OBPA 3UC3A 3C9WA 4BYIA 2HELA 1BUHA 2GFSA 2YEXA 3UQCA 4V0GB 3MIYA 3COIA 4CRLA 2W4KA 4C58A 4DN5A 5DG5A 2VAGA 4UMRA 1PRYA 4HCVA 4HOKA 4ASZA 3LCTA 4ASDA 3G15A 4OBOA 2PVJA 4D2SA 3WF6A 3NAXA 3OP5A 4O86A 3GC0A 2XK6A 3WE4A 4QOXA 4JJRA 5GZ9A 2PMIA 4AZEA 4FEUA 4O0XA 3ZU7A 3EQBA 3HDMA 4R1VA 4AZVA 2FA2A 5BMSA 4FTMA 2XCHA 2OLCA 3FQSA 2C0OA 5M4CA 2F4JA 2C0TA 3CGOA 2WMQA 3VS5A 4OTHA 1YVJA 2G2HA 4KAOA 3ITZA 2XIXA 4O6EA 3MSSA 5BYZA 4OUCA 4BTJA 3CXWA 2C3IB 2IZUA 3KF4A 3ROYA 3I6WA 1M2QA 3EQHA 3OUKA 4O7NA 4R6VA 5KHWA 2HZIA 2X2LA 2BMCA 4QP4A 4A7CA 4D9TA 4YHJA 3BPRA 1VEBA 1YHSA 2YIYA 3UNZA 4APPA 3WILA 1RQQA 3BHTA 5IKWA 3JXWA 2IN6A 3FMDA 4W8DA 2QG5A 4IX4A 3UIMA 1XJDA 4BWPA 5M55A 1JSTA 3FMHA 3E63A 5DT0A 3QQKA 3PWYA 2R3IA 3VWAA 2YM6A 4QP3A 5L8KA 4CG8A 5CSPA 3HA8A 4GW8A 1O9UA 1TKIA 2A4LA 3EJ1A 2BVAA 3GENA 4HJOA 4DGMA 5M07A 2RF9A 3LM0A 4WSQA 1PXKA 5K3YA 5FG8A 4FMQA 2OH0E 4GKHA 3PPZA 5TO8A 3VO3A 4PPAA 1UU8A 3QHRA 3DAEA 4I5HA 4O82A 5EI6A 4OTDA 3NWWA 4I0RA 3RCJA 3OBJA 5A4CA 3UOHA 4I24A 3RP9A 1KE9A 4EQCA 5I3OA 4PL4A 4M7IA 4F70A 3HVCA 2VV9A 4KNBA 4X6QC 5CEQA 4DHFA 4EH7A 1XQZA 2JLDA 4RWJA 1S9JA 4FV2A 4L8MA 5TT7A 4AW5A 2BDFA 2GCDA 4FVQA 5DLSA 4IADA 4XV1A 5C03A 3S00A 3C4EA 4ACMA 3DDPA 1H1PA 3FMMA 3R8MA 2ZDUA 3DZOA 3MTLA 5AX9A 5CF5A 4IAYA 3QTUA 4CFVA 4GFOA 1W84A 3E5AA 4S34A 5AR8A 1B6CB 3V8WA 4QNAA 3D5VA 3A61A 2CGVA 3C7QA 3FZRA 3QUPA 3ZEPA 3IW8A 4AF3A 5E90A 5HEZA 2CKOA 4BZDA 2UZUE 1ZMUA 2IVSA 1L8TA 3F61A 4IZ7A 4LG4A 2C4GA 5CQWA 2WNTA 4KUJA 3KB7A 3BELA 1R0PA 4NTSA 4PDOA 4AP7A 4KRDA 1ZLTA 4FL3A 4M69B 5AV2A 3PJ2A 1ZYCA 3SKCA 4D58A 1Q41A 2ZJWA 4HGLA 4AFJA 2IZTA 4I20A 5I0BA 3BQRA 3QCYA 3SA0A 4R1YA 2IZSA 3V6SA 3V5JA 3P23A 4BDHA 1R39A 4AGWA 4WBOA 5EQEA 2B53A 3QCSA 5HG7A 5HE3A 2YDIA 4RJ7A 5AAFA 4AS0A 4BIBA 2C3KA 5FEDA 2ZYBA 2X4ZA 3LFBA 5JKGA 3QGYA 4L44A 3DJ7A 3PXZA 2YZAA 3CQUA 2J0IA 2XNMA 4UMQA 4NWMA 4HYHA 5C01A 4ASXA 3PWDA 2W1CA 2XCKA 4I93A 3ID6C 2OZAA 2R64A 3F3ZA 5CENA 3U8WA 3UGCA 3DQXA 4XG7A 3ZO1A 3NCGA 5EH0A 1ZRZA 3MW1A 4USDA 3GOPA 5A3XA 3R7YA 5JQ5A 4RBLA 5JFXA 3QX4A 5AUTA 4D2VA 5M08A 3CKWA 1WVXA 1YXUA 2OO8X 4AXAA 4USFA 1L3RE 4LL5A 3K2LA 3IGGA 4YGAA 1UKHA 5AJQA 2BFXA 1SM2A 4C2VA 4CQGA 2C5YA 1KUTA 4NH1A 4ONAA 4CMOA 4EZ5A 3ZHPC 5DYJA 4EC8A 4IB5A 5E1SA 4DC2A 2ITNA 2F2CB 4RRVA 3IOKA 3ZH8A 5G6VA 1XH5A 5AR3A 5KMIA 3FEGA 4XOYA 3R1SA 4I21A 2G15A 4TT7A 2OWBA 2W9ZB 3FUPA 4BGHA 3UO6A 1YI6A 3OEZA 4BHNA 4FKLA 4O2ZA 4W4YA 4YJVA 4CCUA 3DXPA 2Y0AA 3NUUA 4XBUA 3VULA 1YDSE 2VWVA 4EYMA 2YM7A 2BAKA 3A99A 3C4CA 4IFGA 3MY0A 2F7XE 3IDCA 2W1HA 3KY2A 3R2BA 2WMSA 4NW6A 4RIWB 1XO2B 2OJJA 3Q4UA 4I23A 5IH4A 4H05A 1UU9A 2XKDA 2ITOA 4X2NA 3NUYA 3KXZA 3NDMA 4GU9A 2R4BA 2ONLA 1Q62A 3R1NA 3LFDA 2WMVA 3D94A 5A4TA 3K54A 3PRIA 2IPXA 2WGJA 3Q53A 4W4WA 2QI8A 3RTPA 1H1SA 3PVUA 4FT9A 1OPKA 3FWQA 4DTKA 5DR6A 2A27A 4HW7A 4K18A 3UJGA 4NU1A 2W1ZA 2VZ6A 4GUEA 2YHVA 4XV2A 4TYGA 5B2KA 1MRYA 3W16A 2BILB 4E73A 3QTWA 2A1AB 4RG0A 1H1QA 3A8WA 2FVDA 3OF0A 5AP5A 4DEEA 4E4LA 2O3PA 4IEBA 1V1KA 3ALOA 5DGZA 2W9FB 3AC1A 3N4UA 3W32A 1ATPE 4IX3A 4WA9A 3I81A 2V0DA 3DZQA 4I6QA 3LFCA 5EHLA 3A8XA 4YLLA 2R3NA 2RIOA 3CD3A 3FY0A 4RVLA 4B8MA 4IB0A 1PY5A 4K1BA 3MVLA 3EN4A 5LARA 4EBWA 2P2IA 5E7RA 5EQPA 5IQDA 2IVVA 2HENA 3KL8A 4O27B 2XRUA 3G2FA 4XS2A 4L7FA 1O6LA 3T8OA 3FV8A 1DAYA 4FGRA 1YRPA 3RALA 2BIKB 4PRJA 3UMWA 1NVQA 3HX4A 4ZSJA 4AOJA 5AV4A 3MB6A 2IWIA 5CTPA 2OG8A 5JZJA 4JXFA 5EKOA 4XLVA 2QKRA 2E9UA 4IFCA 3NPCA 3FPMA 3QRTA 3OXTA 4F64A 1PMNA 4CYJA 2P0CA 2VWZA 3GFWA 3MVMA 5GHVA 3CY2A 1OL7A 4F1OA 3FMLA 2EU9A 2XNOA 4BY9E 5IA3A 3BIZA 4FKRA 4PPCA 5E8YA 4BZNA 2XM9A 1WMKA 1YW2A 1DAWA 5TKDA 3REPA 4E5BA 1XKKA 2Z02A 3QRKA 2QVSE 2GHMA 2HY0A 4R5SA 3HUBA 5T6KA 1JPAA 2BTRA 4BDEA 1ZYSA 3BEGA 2BR1A 2CJMA 5C26A 3MFUA 1UNGA 5CEMA 3FKLA 3P1AA 4GT3A 4XEYA 4C37A 5B2LA 4EEVA 5IQFA 3LJ1A 3DB6A 5AUVA 1OPLA 1XH8A 1WBNA 1REKA 4D9UA 4PV0A 2RL5A 2PU8A 2VTQA 4FZDB 3VBTA 3W2RA 3OCBA 1LUFA 5DI1A 3OS3A 5FXSA 4BWKA 2PMOX 2OIDA 3DBCA 4LMNA 2ZV7A 3AQVA 2UW3A 4Y73A 5JFSA 3HAVA 4YJOA 1HOWA 2UVYA 1BI7A 2VNYA 4BDGA 4DCEA 1TQPA 3Q5ZA 4G9RA 4PQNA 3ZOSA 4FSYA 5A9UA 4LOQA 1XWSA 3QD4A 4NIFB 5KZ0A 4F65A 2QOLA 4HNFA 3ZXZA 1I44A 1UU3A 2O63A 3JVSA 3KRRA 3OCGA 4QYEA 2R0UA 3HV5A 4H39A 4S33A 4DFXE 4ZAUA 4FF8A 1BLXA 4IW0A 4EH9A 5A4EA 4W9WA 3C51A 2XIRA 4F0IA 2JIVA 2YJRA 2XKEA 4I92A 2X81A 2JAMA 2Q0NA 4D1ZA 2QOOA 3FZOA 5CYIA 5AIRA 4F6UA 2W06A 1CKJA 3Q2MA 3O23A 4MD8E 5EHOA 2LAVA 3PXFA 4A9UA 2GTNA 1Q3WA 4QMQA 3VS2A 3RM6A 4O7RA 4KWPA 5HLPA 3MA6A 3TZ9A 2HZ4A 1SMHA 4ITHA 4NCTA 4O91A 4FTOA 3F66A 3VIDA 5HBJA 3EFJA 5GZAA 4E26A 4R3RA 3U54A 3NSZA 2EVAA 2O2UA 5L2WA 2QOHA 5L8LA 4Z7HA 4YJQA 2R3QA 4WBBB 3ETAA 1O6KA 1Z57A 4CRSA 4MF0A 5AUXA 5FRIA 4ZTMA 3RWQA 5LWMA 4ORKA 4M66A 5GINE 4G9CA 4J99A 3ORTA 3P79A 1GZNA 2Y6OA 4WNKA 3LHJA 4HZRA 3U4UA 4DT8A 3P5KA 2B9IA 3CS9A 4HVDA 2F2UA 5LVOA 3HUCA 4AA4A 1W83A 2ETKA 5EG3A 3ZDUA 4U80A 3S95A 2QODA 4YTFA 3UZTA 3AOXA 4O96A 5FD2A 5J79A 3LFQA 5A6NA 3TM0A 4LYNA 2BDWA 2W05A 4UV0A 3QALE 4I1ZA 3HMMA 3W2SA 4YSJA 3VN9A 5JK3A 4YUQA 4FL1A 3VVHA 1H25A 4GKIA 4EWHA 2JEDA 5AAEA 2WQNA 2ZOQA 3O8UA 4HPTE 3TXOA 3PP0A 3BGZA 2JC6A 4QNYA 2P3GX 4W4VA 5CAOA 4JDHA 4PMTA 4WNOA 3BE2A 3L8SA 4GK4A 3FJQE 3PJCA 4UWBA 3GB2A 3SLSA 4OT6A 4M12A 2QNJA 3C0IA 4P5QA 3VBVA 3VW6A 4F9BA 4YURA 4RZVA 5J1VA 4QYGA 3R7OA 3VQHA 5JFVA 2C6KA 3BRBA 3CQWA 3BLHA 4LV8A 5HE2A 3FL5A 4O38A 3H30A 3HMPA 4QRCA 3FMKA 1H4LA 1J1BA 2IO6A 3GT8A 4UXLA 4O0YA 1F3MC 4FV1A 4UXQA 4D5HA 5IUHA 2XZSA 4UWYA 3CEKA 1ZMWA 4JDIA 1U54A 2C6EA 1QPJA 4JT3A 4BDJA 4D2RA 3PVGA 4L53A 3G9LX 4ARKA 1WVYA 2J6MA 2WEIA 3CD8A 3L8XA 3EFLA 5EI8A 3SW7A 2VU3A 4BDBA 4IVCA 2G1TA 2B55A 1WBVA 1W82A 2Q0BA 4F9CA 1KE6A 3SG9A 5G1XA 2GU8A 2XK7A 5CU2A 3OUNB 3D4QA 3I0QA 4QTDA 3ROCA 5DBXA 3Q52A 3QTQA 2PVMA 5GJDA 5FDPA 1LPUA 3O17A 3VS3A 5J95A 3B8RA 3NYOA 5IQGA 3PLSA 2R3RA 4F4PA 2CN5A 4YHTA 5AR2A 2R9SA 4EQMA 1P5EA 4E6DA 4ANQA 2ITQA 4AOTA 4U40A 5M53A 4BIDA 3SX9A 5IEYA 2WTCA 3ZEWA 3UO4A 2VO6A 5D12A 4TXCA 1JAMA 4RA4A 4EHEA 3ZRKA 5M51A 4YSMA 4AW1A 3SXRA 3ZC5A 4G5JA 4V04A 1YWNA 4MNEA 4OTPA 3CBLA 5FM3A 2R5TA 5EKNA 3MJ1A 4BTFA 2OICA 4I0TA 3DBEA 2JAVA 4EH2A 3EL7A 2QLQA 1JWHA 1H01A 2WELA 2VWXA 4FTAA 4O2PA 5HCYA 3PZHA 5DH3A 4JX7A 3UYTA 5BYLA 4WT6A 4AZTA 2OXDA 5IMXA 2WPAA 3DNDA 3ZLYA 4MKCA 5AUWA 3QCQA 4ZLOA 3A7GA 5LVPA 2UZDA 4E6QA 5H8BA 5IG1A 2V55A 2EXMA 4TYHA 2VWWA 3HA6A 5EM8A 4D1SA 5HU3A 4WD5A 1A48A 3IW6A 1URCA 1GNGA 1BL6A 5HLNA 3WF5A 3UQFA 1FVVA 1ZARA 2PE1A 1YKRA 3MVHA 4MBIA 5HLWA 1FBNA 3KXHA 4CFUA 4QTBA 3EMGA 3FZPA 3SVVA 5AUZA 5DMZA 5AFVA 2BTSA 2QHNA 3MFTA 4ZY5A 2R2PA 2PMLX 4ANNA 3K5UA 1PYXA 3VS0A 3RMFA 2Z2WA 3ODZX 3E8EA 1FGIA 2VTIA 3SRVB 3H9RA 4NZWB 1OECA 3TUDA 5LVNA 4FNYA 2ZB0A 2VTTA 5CSVA 1YHWA 2UZNA 5HD4A 2ZVAA 5E8TA 4C62A 3RJCA 2P2HA 3P7AA 3F5PA 3Q04A 4M14A 3VBYA 4BI0A 4ZZOA 4QP1A 4QMYA 4DLJA 3JR1A 3N51A 4L43A 3ZSIA 3Q6UA 4WUAA 1JQHA 3PY0A 4U42A 4OTQA 4EQUA 4QTEA 5BVDA 5FXRA 3RAHA 2WOTA 4OTWA 4QMTA 1OMWA 1UWHA 4UZDA 3WZKA 2OJFE 1KV2A 3WYXA 4M15A 3LOKA 4CNHA 1KE8A 1YI3A 3P9JA 1T45A 1Q8YA 2ETRA 3ZTXA 4L01A 3JS2A 3DBFA 4KRCA 5AV3A 4FOCA 3VUGA 4AX8A 3O0GA 4R8QA 5DVRA 4IDTA 4GJ2A 4QP9A 5F1ZA 4ZSEA 2W99B 5CALA 3UC4A 5K0XA 3VS1A 5CT7A 4ZEGA 4FTRA 3FXZA 3OG7A 3PA4A 5FQDC 1P4OA 5CNOA 4AUAA 3LZBA 3O8TA 2CKQA 4JDJA 5L2QA 4GEOA 3GU5A 4NFNA 4IM3A 3VUHA 1WFCA 1ZXEA 4W8EA 4XG2A 5HTIA 5I9XA 5KMOA 2UVZA 3CPCA 4OW8A 3B8QA 5HZNA 1SNUA 4H3PA 1QL6A 3UQGA 1NVRA 3LKMA 3NYVA 4MH7A 4UZHA 1IA9A 4NTTA 2CN8A 4FG7A 1NVSA 4FYOA 3A4PA 3IECA 4FV8A 4JG7A 4RJ3A 2C6DA 4C0TA 3DXNA 4ZS0A 3PVWA 5F4NA 3TZMA 5HKMA 4L42A 4WOVA 2X1NA 4FSNA 3ZSGA 4IB1A 4UX9A 1GAGA 2F7EE 3ATTA 4RJ5A 3D7TB 4FTIA 4YJRA 3UMXA 5EDPA 4R3CA 5J5SA 1UA2A 4IC7A 4ALWA 3O96A 1WBPA 4FSQA 3RPRA 4DGOA 5HX8A 4R3PA 1JKSA 3R8VA 2UW7A 4FTNA 3O50A 5ANOA 1Q8WA 5D10A 3R83A 5FEEA 4BCFA 4ASEA 3QQUA 5DHJA 1H08A 1SVGA 3CCNA 3QZIA 2OSCA 2RG5A 3PJ1A 3HDNA 3U9NA 2W5AA 4I4FA 4IWOA 4C2WA 4U41A 3I7CA 1Q97A 4X2JA 4C4IA 3VRYA 4LGGA 3R01A 4PMSA 4U5JA 5KZIA 4Z16A 2GQGA 5AP3A 4EHZA 3UNJA 5IU2A 3C5IA 4W9XA 4FNWA 5JH6A 2C5XA 3KK9A 4H3QA 4Z55A 4R78A 4JQ8A 5D11A 5ANGA 4E4XA 2WQOA 3OWLA 3O71A 3JY9A 4KSPA 4GYGA 3V8TA 4F7LA 4J96A 4MXCA 3MB7A 2W5HA 1PXOA 4IAKA 3R7EA 5HORA 1K3AA 4PDPA 5IH5A 4C59A 2IG7A 3EYHA 3UVRA 3COKA 1OM1A 3EWHA 2Y6MA 3A60A 1WBSA 3W2QA 3N9XA 4I6HA 1OIYA 2WZJA 3V01A 2E9NA 2OU7A 4MBLA 4RC3A 4DAWA 4DFBA 3LXNA 2ZV8A 2PPQA 4O0SA 4EI4A 3EQRA 4J98A 5D9HA 2Z7LA 2JFLA 4LOPA 1PXIA 2FYSA 2OJ9A 2PMNX 2XUUA 3GEQA 3O8PA 4AN9A 3TUCA 3IW5A 2IZRA 3NIZA 4TTHB 4D4YA 4FBXA 3SHEA 4FKVA 2C3LA 3DKOA 5BX0A 4QTCA 3SGCA 3GU8A 3QTSA 3KRJA 5F20A 3V04A 3TL8A 4F1MA 2KTYA 3MJ2A 2XB7A 4JX3A 3THBA 4Y5QA 4YPDA 1E9HA 3QLFA 4QD6A 1OKWA 4RIXB 4GS6A 4DITA 4C38A 1R78A 2JD5A 1M17A 3R9DA 3NVMB 2Z7SA 5CZHA 1OGUA 2GHLA 3LM5A 4F9YA 4ANMA 5E8ZA 4EK8A 1V0OA 3IW4A 1XBBA 2Z60A 4FV9A 4U3ZA 5L8JA 2XK8A 4E8AA 4O84A 3VBWA 2PY3A 3C4WA 1O6YA 1XBCA 2PUIA 3H3CA 1SYKA 1YXSA 3NZ0A 3LMHA 3BYSA 5ITAA 4PTGA 4QMWA 4DEAA 3QFVA 4QPMA 2PE0A 3E7VA 4O1OA 3G51A 3ELJA 2C6MA 2J5EA 4TPTA 3UP2A 4EH4A 5A6OA 5EOBA 5F95A 5KX8A 4UALA 4ZSLA 4AACA 2ITPA 4KSQA 4GT5A 4EK5A 2BZJA 2ZV9A 2IW6A 2WIPA 3NYNA 4I4EA 4J95A 5FGKA 2YM4A 3NUNA 4FKPA 4AU8A 4YZ9A 4U45A 3QRUA 3HP5A 3KA0A 2WMAA 2R3MA 4KIKA 3PIZA 1B38A 3VW8A 3TEIA 1CDKA 2HIWA 2YCSA 3ORIA 2JIUA 4QMXA 2DUVA 4QMOA 3FHRA 1Q8TA 3BKBA 2X8IA 3G33A 4MD7E 4RMZA 2J0LA 5E8UA 1DM2A 5AA9A 1M2RA 3PA5A 4ZMEA 5LQFA 4A9SA 3P86A 3PPJA 3DDQA 3FY2A 3QQFA 2FGIA 5ETFA 3NEWA 3FLNC 3GBZA 1OIQA 3DAKA 2C6LA 3KVXA 4AT3A 3IO7A 5HO6A 3E87A 4NIFA 2CCHA 2HOGA 1PF8A 2XS0A 4AZFA 2FSOX 5C8NA 2W1IA 4K9YA 5FUTA 4GU6A 4HCTA 1G5SA 2KULA 4FT0A 5HICA 2WMTA 2OIBA 3UO5A 4EONA 3M1SA 4JLCA 4RLLA 4UMTA 4YU2A 4J53A 3R8LA 3LCKA 3CE3A 4NJDA 3MH3A 5C8MA 2OW3A 4Q9SA 3I7BA 4U0IA 4FTLA 3LW0A 4I41A 4Y46A 3RM7A 2XNNA 3KCKA 3R63A 5L2SA 2WIHA 4WNMA 4GIIA 4UWCA 3HP2A 5F9EA 3TJDA 4Z9LA 1UKIA 4NKSA 3RHKA 3SXSA 2VWUA 2QO2A 3EKKA 2EXEA 2JKKA 2VTPA 2OI4X 5FXQA 2X7GA 4BCPA 5AEPA 4ZP5A 2DS1A 5HO7A 2E9OA 4BGGA 2X8DA 1W98A 2J0JA 5DR2A 1APME 4FT3A 4RWLA 4ZJJA 3HMOA 3PP1A 3UG1A 1AQ1A 3ZM4A 4OBQA 2ZDTA 4E6AA 2SRCA 4EH3A 3F5GA 4O81A 3CKXA 4CFFA 3LJ2A 4DE4A 3CIKA 4A4LA 1A06A 2BCJA 1U46A 3DKFA 3FMNA 5EK7A 4D1XA 3MDYA 4C36A 4GH2A 1UVRA 1U5QA 2XMYA 4IM2A 3TNWA 4TN6A 4A07A 1CMKE 3NYXA 2X6EA 1ZOHA 4DTAA 3KULB 4JBQA 5HGIA 4ZXTA 5I5ZA 4JAIA 3V3VA 3FKNA 4CFMA 3QTXA 1LP4A 1OL5A 4G3CA 4C4EA 4WIHA 4GCJA 4AZSA 4DBXA 1Y57A 4I3ZA 5AA8A 4FEVA 2UVXA 4NW5A 5B7VA 4C34A 2C5OA 2R3FA 3F82A 3F2RA 4V01A 3JYAA 5I9YA 2BZIB 3R7IA 3R9NA 3F6XA 2BKKA 3NX8A 3FL4A 4IDVA 4XX9A 3PRFA 2QOIA 3HV3A 4BDIA 3ERKA 5D1JA 3M2WA 3BGPA 2QO7A 1I09A 4FZ6A 4G3FA 3IGOA 3TV4A 4HVIA 1CKIA 1RDQE 3EKNA 4J1RA 5FLFA 4FVPA 2YCRA 5ETIA 4K8AA 1DI8A 3D5UA 3EYGA 1VYWA 3F7WA 4FI1A 5CU3A 3QA8A 3UYSA 3WOWA 4AFEA 2YAAA 3POOA 5KCVA 1FINA 2ITZA 2X2MA 3KMWA 3UIUA 4MXYA 5CEIA 4M84A 3NNWA 5D41A 4PNKA 5DIAA 3AG9A 1NA7A 5FP6A 3WBLA 1MRVA 2CDZA 5CEOA 3LAUA 4C3FA 4F7JA 3LIJA 3R2YA 1Y6AA 4PUZA 5A54A 1BYGA 3W55A 1ZYDA 2PWLA 1J1CA 1IG1A 4L3JA 4M97A 5JRSA 1AD5A 4JG8A 1OIUA 3EOCA 4QP2A 5EM7A 5LMKA 1QPDA 5AP4A 5KMJA 3DOGA 4BRXA 3D5WA 3EQPA 2OJGA 2HCKA 4G5PA 2PVHA 1ZYLA 2I0HA 3FKOA 4O6LA 4W4XA 1M14A 2NO3A 2CNQA 5CI7A 3U55A 2GFCA 4FTTA 5DNRA 1YWVA 1ZY4A 5ICPA 5FBOA 5IISA 1UU7A 2C0IA 3LQ5A 4F6SA 5BVWA 3BGQA 3DTWA 3EQIA 4ZJIA 2B9JA 4IJPA 2X7OA 3ZUTA 5IMEA 1KE5A 3R71A 2IJMA 1OBDA 2UW6A 3F88A 3HYHA 3R28A 4QP7A 3ATSA 4IWDA 4DYMA 1JKTA 4CT1A 3QYZA 4I94A 3FLSA 2BDJA 3DTCA 2UZBA 1ZZ2A 2PVYA 3OWJA 4ZOGA 2VTLA 4R7HA 1WBOA 4JAJA 3BI6A 3RBWA 1Q24A 3ZM9A 1IASA 4F7NA 3QUDA 2F57A 2BROA 1QCFA 4FKUA 4F6WA 3QZGA 3FI8A 2Y9QA 2OK1A 3Q96A 3QD3A 5E8XA 3HL7A 3UOLA 3NRMA 2QO9A 4MEDA 2VWYA 4X3FB 2WMRA 3BWJA 2PVKA 3GQIA 4B8LA 3VUKA 3QF9A 4A4OA 5HBHA 4FVRA 4FTJA 1XH7A 4Y85A 1Z9XA 3H0YA 5CF4A 3IONA 5HX6A 4EH5A 3ENHA 5CANA 5KE0A 4M13A 3KU2A 5IA2A 4CMUA 4WG4A 3UOJA 5FTGA 4PWNA 4HZSA 4CKRA 5HBEA 3ZUVA 3LQ8A 4ID7A 2O8YA 4E6CA 3FXXA 2PVFA 2HW6A 4ALUA 2GNLA 3W1FA 4GK3A 4BDDA 3FI4A 4CFWA 4CKJA 5IPJA 3MPAA 4G16A 4D2WA 5CY3A 3EQCA 3LE6A 2BRNA 2VRXA 3QKLA 4A9TA 4BCMA 4FUYA 4MVFA 2RFEA 1YDTE 3W18A 4BR3A 3DJ5A 4N6YA 3R9OA 2XEZA 2PSQA 4P2KA 4ZSAA 5C1QB 2XM8A 3BV3A 3RWPA 2UZTA 3C13A 2I0VA 1YHVA 2B7AA 3MH2A 3ZSHA 4L3LA 4KINA 2GS7A 2QR7A 3VNTA 4PMMA 4ANLA 3QC4A 3QRIA 2HK5A 2XKFA 5EDQA 3PE2A 4C61A 2HY81 5JQ8A 5JT2A 3ZO4A 1PMVA 1W7HA 5JGAA 4CTCA 2ESMA 4Q9ZA 2C5NA 3A2CA 2OFVA 3UIXA 4PMPA 3DFCB 1Z5MA 3MESA 4KKHA 4E1ZA 2OKRA 4X2GA 2Y7JA 3EH9A 2PUUA 1PJKA 3R73A 4M67A 3FHIA 1QPEA 4EOJA 3QKKA 5FDXA 5CT0A 3E3PA 3G0FA 4PX6A 4U8ZA 1P4FA 2XJ2A 2YCQA 4MHAA 3HV7A 4C33A 4EORA 4LRMA 4Y95A 1PXJA 4OT5A 4K2RA 1KV1A 2QCSA 2ZB1A 3KMUA 4KS7A 2VWBA 1KOBA 4IBMA 4RQKA 3ULZA 2YA9A 1FVTA 3BZ3A 3D14A 2G01A 3KEXA 4LV5A 2PVRA 2X6DA 3OVVA 4YZBA 4FUXA 5BMMA 2H8HA 4IAIA 2FH9A 3KF7A 2XNEA 4BICA 2WU6A 4IVDA 1XHAA 3KXXA 4UEUA 2JDRA 3L9MA 3PFQA 4BI1A 4O0VA 4F63A 4N0SA 3T3UA 1IAJA 3C50A 5ANEA 2J7TA 2PZ5A 5HO8A 5AMNA 1BL7A 4BCKA 2Z8CA 5HIEA 2P33A 3KQ7A 2IW9A 3NNXA 4D4SA 4NFMA 4DGNA 3QRJA 1GJOA 3ANRA 4FIEA 4U97A 3EZVA 3EN7A 3IKAA 3MY5A 4FX3A 3TJCA 4X7QA 4C8BA 1XH9A 2VN9A 3R02A 1GIHA 2CNVA 3DPKA 5CI6A 3WZUA 1ZY5A 1MQ4A 2R3HA 4FTCA 4BVUA 1ERKA 3H10A 4QO9A 4CEGA 5GNKA 4RZWA 4CG9A 1OUYA 1PXLA 4FV4A 3QQJA 4GT4A 5EYCA 3VF8A 4O0TA 4EH8A 1T46A 4FIHA 3MYGA 5J87A 3R7VA 3IW7A 3HV4A 3R8UA 5L2TA 3ACJA 3F3WA 5EW8A 4UYAA 3NUPA 2J0MB 3LQ3A 4TKSA 1OUKA 4IZAA 4WRGA 4YLKA 2CGWA 1YOLA 4J97A 4JIKA 5AR7A 5LXMA 4OAVB 5EOLA 4XUFA 2WO6A 4IE9A 3R8PA 2XNGA 4EOOA 4IXPA 3OCSA 5DR9A 4X3FC 5KBRA 5DEWA 1JKLA 2OXYA 1F5QA 3AMBA 4KIPA 3I0OA 4ZJVA 2ITWA 3OW4A 2W4OA 2BKZA 4X21A 3JVRA 2CMWA 3NVKI 3NW5A 4XH6A 3AT3A 4DFNA 4A9RA 4AOIA 2XBAA 3JUHA 3AC4A 3U6JA 3GCPA 4A9YA 2LGCA 5CLPA 3HMNA 4NM5A 3TIYA 3EN6A 4OTRA 3BCEA 3KC3A 4KB8A 4Q2AA 4AE6A 4XMOA 5HOAA 3BYOA 4QMZA 3OW3A 2WQEA 2ZAZA 3PG3A 2X9FA 2CCIA 4N6ZA 3LXPA 5CU4A 1BX6A 5A14A 4BDFA 4HYSA 1JSVA 3U9CA 2UZLA 4XNEA 3Q6WA 4I5PA 4G6OA 4R7IA 5IF1A 4LGHA 4B6LA 3E3BX 1OKVA 4KKGA 1JSUA 2R3OA 1Q61A 3E8DA 4NK9A 5CSXA 4ZMFA 3VJNA 1E1VA 3POZA 4E4NA 4DFYA 2YDKA 4GYIA 4BBMA 3TG1A 4AZWA 1YXTA 2X9EA 4NUSA 2JDTA 3WF9A 5C4LA 3MA3A 4ZZNA 4U3YA 2X2KA 2UW0A 3BU5A 2VTSA 4GFGA 4V0GA 3RPVA 3KXNA 4CYIA 5TE0A 1W0XC 4XRLA 3TDVA 3UE4A 4BCGA 2JIIA 5AX3A 4G3EA 1SVHA 2GS6A 2XA4A 3UDBA 3K5VA 5IEVA 2PZRA 5FTOA 2XF0A 1M52A 2OZAB 4EOLA 4RIXA 4XV3A 3FMEA 1BMKA 2BZKB 2VO7A 4RGJA 2VX1A 3CQEA 3L9LA 4P90A 4LI5A 4YJNA 4KBKA 3SV0A 4XG9A 3GXLA 2YIQA 1IR3A 4L00A 4WG5A 4LQMA 4XP0A 5D7VA 1AGWA 5HD7A 2XYNA 2WQBA 4J8MA 3R22A 4YTIA 1GOLA 2GDOA 4GG7A 5IDPA 3Q2JA 5E9EA 3MPMA 3TIZA 5LVLA 2VTOA 3KRLA 4XV9A 5AR5A 2VO3A 4D0XA 4F7SA 3U6HA 4CV8A 4YZCA 3EHAA 1F0QA 3FYJX 2GMXA 3KVWA 3OXZA 2JDOA 3I79A 3QD0A 4FKSA 4GJ3A 5EHYA 5GJFA 2C47A 3A7HA 4EC9A 5AP0A 4BKJA 1SZMA 2UW4A 4WUNA 5CVHA 3MGYA 3QYWA 4FZ7A 2HWPA 3CTJA 4CFXA 3UPZA 5TOZA 5H9BA 4PY1A 1Q5KA 3KGAA 4FV5A 4H1MA 4H1JA 4KBCA 4F9WA 5IEXA 2XK3A 4QTAA 4J8NA 4G31A 4TL0A 3LXLA 4WO5A 3D2IA 4UYNA 4EH6A 4CSVA 4KD1A 3EN5A 5C27A 1PYEA 3K3JA 4G6NA 3RK9A 4AQCA 2PUNA 3RPSA 2E9PA 2Z7QA 3LCSA 5JFWA 4X2FA 4YZMA 3PPKA 3TZ7A 2YDJA 1Y8GA 5ANKA 4YTHA 4EUUA 3PJ8A 1OVEA 1QMZA 3AMAA 3FAAA 5KO1A 4L46A 4EZ3A 2ZV2A 3WIKA 1MUOA 2OFUA 4ZY4A 5HCZA 2PUPA 3GC7A 4EOKA 3F2AA 5IQEA 5HI2A 4H36A 2YCFA 3QAME 4XG3A 3UTOA 4PNIA 4ANSA 4PF4A 2XKCA 5EYDA 3LMIA 2QU6A 3OHTA 4ITJA 1JNKA 1HCKA 4GUBA 4FIJA 4BHZA 4I5CA 2FO0A 4FGBA 3BBTB 2YABA 3VS6A 4CXAA 1R1WA 2JBPA 3CR0A 4S32A 5E8VA 3C0HA 4JRVA 3VUIA 1QPCA 3DAJA 3O7LB 3LLAA 5IQAA 1FQ1B 2Z7RA 3I4BA 5FBNC 2WKMA 3QBNA 4BCNA 1B39A 2REIA 4QYYA 4PTCA 5CQUA 4Y72A 5FWKK 4ACHA 2DQ7X 1ZMVA 1OIRA 2GQSA 4IH8A 4O7SA 3C1XA 3VJOA 3AD5A 3SOCA 2AYPA 4JL9A 5EQYA 4FKWA 3NNUA 2AUHA 3PLAE 4FV3A 1LR4A 3LFAA 3Q9YA 2GQRA 2NNWB 4RFZA 2C6IA 3UZPA 2PTKA 1V0BA 1Q3DA 5BVOA 3SC1A 2R7IA 3GCUA 4IZ5A 3P7CA 4HPUE 4M69A 3TACA 3W2OA 3QTIA 3WF7A 2RFDA 2VX3A 3P78A 3P08A 3PZEA 3VBQA 5CAUA 1R0EA 4ZIMA 3R04A 3AC2A 3PE1A 2J50A 3OWPA 4BDAA 3N4VA 4QYFA 4TZRA 2VGOA 4X2KA 4L67A 4OTFA 4GV1A 4HYUA 5HG5A 4FSZA 2BZHB 4D2PA 4Y8DA 2H96A 2XNBA 4ACDA 4CGAA 3HAMA 4CLJA 3TWJA 2BALA 3W8QA 4GIHA 3TZ8A 3ZO2A 5DA3A 1MP8A 5JN2A 4JRNA 3N4TA 3VUDA 4FEXA 3OD6X 4L3PA 3BHHA 1LEZA 1A9UA 2F9GA 4YZNA 3G6GA 3TN8A 3HLLA 4U7ZA 4OAUC 3OXIA 2GNGA 3SAYA 4PDYA 4HYIA 4S31A 2R3KA 2QURA 2X8EA 1J3HA 1U5RA 4ZTHA 2XBJA 1OKYA 2FSMX 5AV0A 3JPVA 5M4FA 5KNJA 5CEKA 3QLGA 2QOQA 3QZFA 2JDVA 3PIYA 1UWJA 2YM5A 1PXNA 4YC6A 4G2FA 3V6RA 2C5VA 4NKAA 2F49A 4MTAA 4YNEA 4ZTQA 4OTGA 3VUMA 3PXRA 4FV0A 1U4DA 4DBNA 3UNKA 5E4HA 3BHYA 4NEUA 2Y4PA 1IAHA 5BVFA 3GGFA 2C6TA 5FP5A 2CHLA 5JEBA 2X0GA 4X3JA 3PG1A 4PPBA 1ZOEA 4YJUA 4CLIA 2IVUA 3TT0A 4E5AX 5CVFA 3PSBA 1STCE 4BBFA 3QU0A 3LLTA 4TYJA 4RVTA 5J9LA 3ZONA 5EDRA 3TNIA 4CKIA 1U59A 2OBJA 3OWKA 5BNJA 5KMKA 1J91A 5KMLA 4G3GA 3C4ZA 5KUPA 3ZYAA 5LMBA 3UPXA 3LFSA 3QD2B 1GZOA 4RIWA 2ONLC 4N4SA 4AT4A 2W1DA 3HRBA 3ORMA 4EK6A 3RAKA 3RPYA 4MD9E 4EK4A 2VTAA 3CTQA 3O51A 2QC6A 4KBAA 2GS2A 2PZIA 3R7GA 5T3QA 5IDNA 3AT2A 5CASA 4E4MA 2GNJA 4PDSA 1Y91A 3KK8A 5CSWA 4PTEA 2FSTX 4EBVA 2PULA 4R7BA 4UMPA 2HW7A 3ULIA 4XG8A 4AE9A 2J51A 3Q5IA 5H3QA 4CCBA 5CVGA 3C5UA 4IAAA 2WMUA 4FSMA 3ALNA 5LMAA 1PMUA 3DGKA 3ZFMA 3ANQA 1WZYA 2C6OA 1PMEA 1W8CA 1H1WA 4YP8A 4FR4A 4M68A 3VHKA 4MXOA 3FE3A 4K11A 4L7SA 3COMA 4U44A 4RFYA 4HGSA 5AIKA 5IUGA 3TDWA 2VWIA 4NYEA 5HVJA 3GCSA 3ORXA 4LUDA 3EZRA 3EFWA 3RI1A 4IM0A 3FMJA 3TKUA 2YFXA 4U79A 1H00A 5ANDA 3IQ7A 5DFPA 4FEWA 4ITIA 4JNWA 4BTKA 2WB8A 4RLKA 4DH3A 1JKKA 4YMJA 5M4IA 3KREA 1H07A 5AM6A 3QCXA 3FLQA 3BLRA 3R6XA 3OOGA 3DCVA 4RWIA 4WKQA 3COHA 3ZFXA 3MFRA 3A7JA 1KE7A 4ZSGA 4QQCA 4FSUA 3FBVA 5AWMA 5HNGA 3SOAA 3ZZWA 4U9AA 4LOOA 5HE1A 4I6BA 2GNIA 1VR2A 5DE2A 4FTKA 1YOJA 4ZTNA 2QHMA 1RW8A 2YERA 5FM2A 4HCUA 3UVQA 5LOHA 2UZVA 4MQ1A 2R0IA 4R77A 3DFAA 5DRBA 1WBTA 4KA3A 4C3PA 1U54B 3OTUA 2H9VA 4BCIA 5GIOE 2CPKE 5KMNA 1PXPA 3FPQA 4C4HA 2G2IA 3VHEA 3QL8A 2QOFA 2QLUA 3HGKA 4II5A 3RVGA 2C3JA 5CAPA 1GIIA 1UNHA 2W4JA 4F9AA 2XYUA 3ZO3A 4PP7A 3DJ6A 2QOKA 3WF8A 2I0YA 4EHVA 4FNXA 3U4WA 3HMIA 1OL1A 3PSDA 4AGCA 4RX8A 2WTIA 4DINA 3R30A 4YC8A 3S4QA 2BUJA 3QC9A 4RFMA 2W1FA 5KKRB 4EOMA 3DK7A 4BZOA 3L9NA 2RKUA 3PXYA 3ZUUA 5KBQA 3GFEA 5E1EA 4NM0A 4HGEA 3DKCA 2UUEA 4ALVA 2WD1A 4EJNA 4TWCA 5L4QA 1YXXA 5IZFA 1G8AA 4RX9A 4ZY6A 4FKJA 3QXOA 3MH1A 2I0EA 4WSYA 3MY1A 3H9FA 5H8EA 3MFSA 5EM5A 3RKBA 4JQEA 1Q99A 2GHGA 3TV6A 2ITVA 2XEYA 4MNEB 1XH6A 4M8TA 4QT1A 4RIYB 4DFUA 4EOSA 4USEA 4LRJA 2WMXA 3FC1X 4FZFB 4ERKA 1J7UA 2R7BA 2XK4A 3ZLSA 1XBAA 4IVAA 4O0UA 2FSLX 3FI2A 4E93A 1OZ1A 3R00A 3LJ0A 4O0WA 4EKLA 3CP9A 4QQTA 4KABA 4DEGA 4IMYA 5I9WA 1UV5A 3FI3A 4NCTC 4OTIA 3IDPA 3OTVA 5B2MA 4AW2A 2R3PA 4CVAA 3OT8A 2PHKA 3OFMA 1ND4A 3VC4A 2WMBA 3NR9A 4TYHB 4FKIA 5DOSA 3M42A 1PHKA 3ZC6A 4G6LA 3D5XA 4O21A 3GI3A 2WTWA 1Q4LA 3UODA 4D2TA 1OI9A 1Q8UA 2W0JA 4LM5A 5AUYA 4L45A 5ACKA 3EB0A 4H3BA 3S2PA 5CAQA 3UZRA 3MVJA 3TKHA 3LVPA 3PY1A 3RHXA 5J7BA 5ETCA 2YAKA 3F3TA 1REJA 3TNPC 4XG6A 4C4FA 1JOWB 5FEQA 4BKZA 2UZWE 4IC8A 1OL6A 1IA8A 2XK9A 5CZIA 3PDTA 5HIBA 4FIGA 2E2BA 3PXKA 4IQ6A 5IA1A 4GVJA 5GIPE 3FLZA 3EQDA 3PYYA 4FODA 1TQIA 4TWPA 3R21A 3DNEA 4UBAA 4BTMA 4NM3A 3QGWA 4TRLA 3O2MA 4PL3A 3A62A 3NNVA 2FB8A 3DBDA 4FYNA 2UW9A 5L6WL 2C68A 3V5TA 5CWZA 5J5TA 4EKKA 3W8LA 2B9FA 4DG2E 1URWA 4FK6A 2VTHA 4RWKA 3EN9A 3MIAA 3A7IA 4AN2A 4WNPA 3IG7A 2ITUA 4GG5A 5K4IA 3FSFA 3AD4A 4BI2A 3PTGA 4BN1A 3QQHA 4CZUA 2CSNA 4Z7GA 2C1AA 4K0YA 4X0MA 5CEPA 2O0UA 4YJSA 2WMWA 4XRJA 3P4KA 4XP2A 3CC6A 3P0MA 4FEQA 2V22A 4QMVA 5BQ0A 1YDRE 4HVHA 3GCQA 4DLIA 1M7QA 4P4CA 2JKOA 4FIFA 5HTCA 4DEHA 2P4IA 4I6FA 4L52A 5HTBA 2QQ7A 2YIWA 2JITA 4IWPA 3RZBA 3WI6A 2F7ZE 4C02A 5K4JA 2OF4A 5K0KA 3H4JA 2UZOA 3D15A 2NRYA 4H58A 3R9RA 4IANA 5HU9A 4DF3A 3GC9A 4Q5HA 4HNIA 3DXQA 3IS5A 3NIEA 4MK0A 3ODYX 3BYVA 4HVSA 3JY0A 4JQ7A 3V5LA 5L6OA 4UY9A 2VTJA 4RIOA 5KHXA 5DN3A 5BYYA 2HXQA 4JG6A 3F7ZA 3Q32A 5KKRC 3BQCA 5AP2A 4E3CA 5I9VA 3G90X 3E7OA 4RJ4A 1OL2A 2B52A 1CKPA 3V5WA 4FKTA 4G34A 4IIRA 3NW6A 3II5A 4C57A 5C4KA 4XYFA 5HIDA 4A4XA 2ERKA 2YWPA 5ACBC 2EXCX 4D55A 1P2AA 3ZRMA 2XH5A 2WQMA 3D83A 3QUEA 3R1QA 4DH5A 3C4FA 5CX9A 4XCUA 2PVNA 3DT1A 2RSVA 1CM8A 3SW4A 3L1SA 2V7OA 3FZTA 4JDKA 3BWFA 4F08A 5HNIX 3ORKA 4B4LA 5AP1A 4BC6A 2J0KA 1PKDA 4K33A 3E62A 5HESA 5CXZA 4N57A 5ANIA 4B9DA 3AXWA 1IEPA 2JBOA 3AC8A 3KXGA 4FE2A 4EOIA 3BYUA 5J1WA 2BIYA 2DYLA 3D2KA 3D9VA 1Q8ZA 1OITA 4O1PA 2Q83A 3C4XA 3MI9A 4YJTA 2WOUA 2R3GA 3D7ZA 1YQJA 3V51A 4LUEA 1H0WA 3TUBA 1GIJA 4K77A 3EIDA 3RCDA 3TNQB 3BX5A 3WYYA 1Y8YA 4XOZA 4F99A 4RJ8A 3RPOA 4DG3E 3I5ZA 4WRSA 4BCQA 3BU6A 1H26A 5HG9A 3PY3A 3PA3A 2VTMA 5CAVA 3RK7A 4B7TA 2I1MA 4G1WA 4X6RA 4TYEA 4IVBA 5EI2A 3UOKA 5JGBA 3ORNA 4TNBA 3IDBA 4J7BA 1H24A 3ZXTA 2QOBA 2W7XA 3CGFA 3KFAA 3PUPA 4RQVA 5ETAA 4DCAA 5CSHA 2EUFB 4YJPA 2B54A 4F0FA 4BKYA 1BI8A 4RX5A 1H1RA 4ZLZA 2NRUA 2GNFA 3MN3A 5JSMA 3CY3A 2V62A 3TNHA 4U43A 5IA5A 4DG0E 3BEAA 3BYMA 3DS6A 4AGUA 4GSBA 1OB3A 4FKQA 5EM6A 3Q9XA 4EHGA 2B9HA 5ANJA 4ANOA 3SRVA 3E93A 3MBLA 5I9UA 5HCXA 3GVUA 3MPTA 2ERZE 3WIGA 5BUJA 1YXVA 4FG8A 1SNXA 4RVMA 3BBWA 3AGLA 5H2UA 4DH7A 3UG2A 4LGDA 5L2IA 4AG8A 2BRGA 4D28A 2VX0A 4FK3A 4ACCA 5CF8A 3VRZA 3HECA 4IJ9A 1GY3A 3FZ1A 4IX6A 5M06A 5HG8A 1ZWSA 3CLYA 1MRUA 1SVEA 3GOKA 4APCA 4CFNA 2OZOA 5GZ8A 5JGDA 2CKPA 1M2PA 1PW2A 3B2TA 4MQ2A 4GRBA 3TTIA 4AT5A 4RX7A 3PJ3A 2ZM3A 1VJYA 2G9XA 3QHWA 4P5ZA 4GL9A 4QQJA 2OJIA 2HAKA 3DBQA 3F5UA 3FZSA 3GCVA 3I1AA 3PXQA 4FZAB 4A06A 4F09A 3IPHA 4UMUA 4FTQA 3AMYA 3LFFA 4JBVA 4AAAA 3LXKA 1NY3A 2EWAA 3LFEA 4FT5A 5E91A 5KMMA 3FDNA 1ZAOA 3RK5A 3K3IA 3GNIB 3E8CA 2VGPA 4AA5A 4KS8A 3TKIA 2XIZA 4XJ0A 3R7UA 2XJ0A 2O5KA 3T3VA 4QMMA 5AADA 4KIKB 1PKGA 3IK3A 3T9TA 4FSWA 4DFLA 5HVKA 2RG6A 4BWXA 4BDKA 3NUAA 2BAJA 3BLQA 4YR8A 2QOCA 4QPSA 5BVNA 2V5QA 4WG3A 4OR5A 5DRDA 5A46A 3TI1A 4RC4A 3LCOA 5HE0A 4XBRA 4DEIA 5M56A 3L9PA 1VZOA 3D7TA 2ZM4A 3FLWA 3OCTA 2CNUA 3LFNA 3RAIA 1TVOA 3MS9A 1R3CA 2YM8A 3BHUA 3BV2A 3F69A 4EJ7A 2EB2A 4FSRA 4C35A 2QG7A 4TYIA 1NXKA 1WBWA 4MWIA 5T68A 4CV9A 3QX2A 4RC2A 1WCCA 3RAWA 5IA4A 4BF2A 2B0QA 1ZOGA 4NT4A 3WZDA 1ZYJA 4MX9A 3ZCLA 5EYMA 4E5WA 1XH4A 2ITTA 5AR4A 3HRCA 4TNDA 5HNBA 5AM7A 2PZPA 2YITA 3I6UA 4BCJA 3B2WA 2YM3A 5FTQA 5F94A 3SDJA 3UBDA 5CU6A 2OH4A 3ACKA 3QZHA 4WHZA 3TTJA 3OY1A 2XIKA 2I6LA 3UIBA 3U6IA 5CNNA 4ACGA 4BBEA 5D7AA 2NPQA 2WTKB 2YISA 4O22A 3F3UA 5A4LA 4FTUA 5CU0A 3QQLA 4FT7A 4L6QA 5HVYA 4I22A 4MXZA 5IQCA 1VYZA 3VF9A 3W2PA 1V0PA 4L68A 3MWUA 3NLBA 2YLEA 3G0EA 3FQHA 4BCOA 2XRWA 3FLYA 2OXXA 3P7BA 2O65A 5LWNA 2HZ0A 4PP9A 4RA5A 5LCJA 1NW1A 3G9NA 2GPHA 4DT9A 3E64A 3OBGA 2YJSA 2RGPA 1PXMA 3KMMA 3DK3A 4LRKA 4MNFA 3ZBFA 5BUEA 1G3NA 4XG4A 4YNOA 5EW9A 2B4SB 4O7LA 1YWRA 3CSVA 3KRWA 1MQBA 3I60A 2RFSA 5L6PA 5LMKC 4BGQA 2CKEA 3CPBA 1HCLA 5LCKA 1LEWA 3OY3A 5DT4A 5I3RA 3HKOA 2R3LA 3WE8A 3Q4CA 4G3DA 4JS8A 1KOAA 4Y5HA 4EUTA 3ORPA 1KSWA 3F5XA 3L8PA 3ZLWA 1JVPP 4LFIA 3E8NA 4N70A 3F2NA 2JKQA 4FICA 3Q9WA 3AC5A 2BRBA 4FL2A 4KKEA 5AUUA 2H34A 5IH6A 5AV1A 2QKWB 3CJFA 4LL0A 4DA5A 2WEVA 4CTBA 2AC5A 3DK6A 2B1PA 3NUSA 4HGTA 3E92A 2BAQA 4RPVA 5M44A 2W5BA 2H6DA 2VNWA 3AD6A 4YHFA 3PSCA 1BKXA 2OF2A 4QMLA 4FKGA 5IUIA 1WVWA 1XR1A 4QMUA 4IAZA 4K6ZA 3ENMA 3OC1A 4XP3A 4YBJA 4BB4A 4LMUA 4RSSA 3PVBA 2XJ1A 5IA0A 3FC2A 1J7IA 4NM7A 3ZMMA 4C3RA 2DWBA 4PL5A 4JR3A 1RE8A 4EOQA 3SQQA 4CD0A 2Y4IB 3AGMA 2YIXA 4R5YA 4D0WA 4E20A 3F3VA 2C30A 3IOPA 4FSTA 2PYWA 3QQGA 3NUXA 1YOMA 3NS9A 3AT4A 2HYYA 4DEBA 3MV5A 2J9MA 3Q3BA 1G8SA 1TQMA 2BHHA 2VO0A 3FYKX 4NJ3A 1K9AA 2XIYA 4TW9A 4YPSA 5AP6A 3VS4A 4G17A 2P55A 4JI9A 1P14A 3OROA 4FV6A 4NL0A 2JKMA 2W1GA 4YLJA 3HEGA 3QWJA 4ZTLA 5J7HA 5DPVA 4QPAA 4L9IA 4C7TA 3VQUA 3GU6A 4JVGA 3AC3A 4CMTA 4DEDA 2ACXA 5TF9A 4FKOA 4BYJA 4IAFA 3R8ZA 4ERWA 4DTBA 3E88A 3ORLA 2ITXA 4BFMA 2IVTA 2PL0A 5BUIA 3OOMA 2BHEA 3ZFYA 4MAOA 3OT3A 4KIOA 3UVPA 4EL9A 2WTDA 2WXVA 4DGLC 4ENXA 3OZ6A 5CF6A 3DU8A 4IACA 5J9ZA 4EOPA 2W17A 3FSKA 2C69A 4F1TA 2C1BA 2YN8A 4JIAA 4J71A 2ZMDA 3QKMA 4Y83A 3S0OA 2XNPA 3HRFA 4JBOA 3VUTA 3EL8A 4YTCA 3WARA 2ETMA 5E8SA 4RIYA 4S30A 1JBPE 2J90A 2W96B 3CJGA 4IWQA 5J8IA 4IHPA 4NSTA 3GU7A 4ZZMA 5HQ0A 4F0GA 5DEYA 3QTRA 1FVRA 5CXHA 2IW8A 4ANBA 3U51A 2QD9A 3LMGA 3Q4ZA 3RINA 4C4JA 5C8KA 4OGRA 4M0YA 4P7EA 3S1HA 2NP8A 4CZYB 2WTKC 3Q60A 2HWOA 2R3JA 3T9IA 4E7WA 2O64A 3FXWA 2XP2A 3LCDA 3NAYA 5JZNA 2PK9A 4FIIA 4DH1A 1KWPA 4J52A 3S3IA 1J7LA 2FUMA 2X7FA 3DV3A 2E9VA 4FG9A 3BE9A 2I40A 1GZ8A 4JBPA 4TWNA 2WAJA 3EQFA 5I9ZA 2BRHA 2OIQA 1Y6BA 4BIEA 2CLXA 4MF1A 5M57A 1UNLA 4C4GA 4MXAA 4RJ6A 3ZZEA 5GJGA 2JDSA 4UB7A 2UZEA 4BDCA 2BRMA 3ZBXA 4BL1A 1RJBA 4ENYA 3OEFX 3H9OA 3G5DA 4QMNA 1FPUA 2VTRA 5CS6A 1CTPE 4DFZE 2CGXA 4HVGA 3VAPA 4EWQA 5IQIA 4B99A 4MWHA 2PVLA 3KULA 4CT2A 1H27A 3SD0A 2ZM1A 3NW7A 3DLSA 3DQWA 2WFYA 3DY7A 2I7QA 2HZNA 1NT2A 4IX5A 3DKGA 3KN5A 3M11A 5LVMA 1OPJA 2WHBA 5HHWA 1IRKA 4YC3A 5DWRA 1OKZA 2XVDA 4U81A 3Q9ZA 2VTNA 2OGVA 4IZYA 5AAGA 1X8BA 2YIRA 3KRXA 1WAKA 4ZTSA 1FOTA 4O7TA 1OBGA 2WU7A 5H8GA 4AA0A 4DGGA 2CLQA 4XHKB 3R0TA 4I0SA 4EYJA 4O7WA 2ZMCA 4QQ5A 5K5XA 3KKVA 3BHVA 2J5FA 4D4RA 3HZTA 2UW8A 5M4UA 2WTJA 4U6RA 2Y4IC 3FQEA 4YZDA 3V8SA 3VS7A 4AW0A 4B0GA 5I4NA 5LJJA 3EFKA 3DA6A 4QP6A 4YO4A 2PZYA 4ZK5A 5IQHA 2Y8OA 3HNGA 3SG8A 4AN3A 4FA2A 3RNIA 4D4VA 1EH4A 3DLZA 3QA0A 5E8WA 1DS5A 4YO6A 5BPYA 4GK2A 3BU3A 4ZS4A 3C0GA 3V5QA
chains in the Genus database with same CATH superfamily
2W1EA 1S9IA 2V7AA 3NMUF 1JLUE 2YACA 3KN6A 2VUWA 4BCHA 4CZTA 4QP8A 4O7ZA 2A2AA 2QONA 3OMVA 4MBJA 4D5KA 5TR6A 1FMOE 3EQGA 3QTZA 2BPMA 2CGUA 4FV7A 4KIQA 4M0ZA 3NCZA 3A7FA 5EW3A 1H0VA 2GTMA 3D0EA 3ZRLA 4EK3A 4O7VA 4MXXA 4QMSA 4CQEA 5K9IA 4FC0A 3F9NA 2AC3A 3RNYA 1K2PA 1CSNA 5JMSA 5B0XA 4Z3VA 3CTHA 3QXPA 3RGFA 1H28A 4GMYA 4MYGA 5EFQA 4QMPA 5E92A 4AWIA 3WZEA 2A0CX 4IB3A 2YZLA 3H0ZA 2JFMA 5IQBA 3LPBA 4JOAA 1FGKA 1M7NA 4M3QA 2EB3A 3SXFA 5JRQA 3V5PA 5M09A 3GP0A 4FNZA 3MH0A 3W0SA 2G2FA 2ITYA 4O0RA 4TWOA 4QYHA 4XLIA 3TV7A 2J2IB 1E1XA 3G6HA 3QWKA 4DH8A 3L8VA 3VBXA 4EZ7A 4O83A 1GZKA 2UV2A 3ZLXA 2PE2A 4ZTRA 3HV6A 3U87A 3KCFA 2YWVA 1YI4A 2X4FA 3R1YA 2JGZA 4X3FA 4MUQA 3GU4A 4GFMA 3Q4TA 4MCVA 2A19B 4RT7A 3A4OX 3I5NA 4AGDA 2UW5A 5C9CA 4FOBA 3ORZA 4O7YA 4S2ZA 1H8FA 3O7LD 4RVKA 5BVEA 5L3AA 2GSFA 2X39A 3GQLA 3MTFA 2RFNA 3WZJA 1DI9A 4OLIA 5K5NA 4V05A 3RZFA 2GNHA 2QU5A 3R9HA 3UP7A 2WTVA 3KXMA 5EYKA 3PIXA 2BFYA 4GVAA 4ZLYA 5AP7A 3AKKA 2HXLA 4I5MA 3TCPA 3W33A 5DT3A 5BVKA 3ZS5A 5J9YA 4O4DA 4UN0C 1FMKA 3GC8A 4JR7A 1ZZLA 2VD5A 2J4ZA 2QR8A 3W10A 3GUBA 4YBKA 3DB8A 3NGAA 4Q5EA 3ZDIA 3W2CA 4TY1A 2YLFA 3ET7A 5A4QA 4OBPA 3UC3A 3C9WA 4BYIA 2HELA 1BUHA 2GFSA 2YEXA 3UQCA 4V0GB 3MIYA 3COIA 4CRLA 2W4KA 4C58A 4DN5A 5DG5A 2VAGA 4UMRA 1PRYA 4HCVA 4HOKA 4ASZA 3LCTA 4ASDA 3G15A 4OBOA 2PVJA 4D2SA 3WF6A 3NAXA 3AKLA 3OP5A 4O86A 3GC0A 2XK6A 3WE4A 4QOXA 4JJRA 5GZ9A 2PMIA 4AZEA 4FEUA 4O0XA 3ZU7A 4LDTA 3EQBA 3HDMA 4R1VA 4AZVA 2FA2A 5BMSA 4FTMA 2XCHA 2OLCA 3FQSA 2C0OA 5M4CA 2F4JA 2C0TA 3CGOA 2WMQA 3VS5A 4OTHA 1YVJA 2G2HA 4KAOA 3ITZA 2XIXA 4O6EA 3MSSA 5BYZA 4OUCA 4BTJA 3CXWA 2C3IB 2IZUA 3KF4A 3ROYA 3I6WA 1M2QA 3EQHA 3OUKA 4O7NA 4R6VA 5KHWA 2HZIA 2X2LA 2BMCA 4QP4A 3ML1A 4A7CA 4D9TA 4YHJA 3BPRA 1VEBA 1YHSA 2YIYA 3UNZA 4APPA 3WILA 1RQQA 3BHTA 5IKWA 3JXWA 2IN6A 3FMDA 4W8DA 2QG5A 4IX4A 3UIMA 1XJDA 4BWPA 5M55A 1JSTA 3FMHA 3E63A 5DT0A 3QQKA 3PWYA 2R3IA 3VWAA 2YM6A 4QP3A 5L8KA 4CG8A 5CSPA 3HA8A 4GW8A 1O9UA 1TKIA 2A4LA 3EJ1A 2BVAA 3GENA 4HJOA 4DGMA 4AAYA 2RF9A 5M07A 3LM0A 4WSQA 1PXKA 5K3YA 5FG8A 4FMQA 2OH0E 4GKHA 3PPZA 5TO8A 3VO3A 4PPAA 1UU8A 3QHRA 3DAEA 4I5HA 4DHZA 4O82A 5EI6A 4OTDA 3NWWA 4I0RA 3RCJA 3OBJA 5A4CA 3UOHA 2XANA 4I24A 3RP9A 1KE9A 4EQCA 5I3OA 4PL4A 4M7IA 4F70A 3HVCA 2VV9A 4KNBA 4X6QC 5CEQA 4DHFA 4EH7A 1XQZA 2JLDA 4RWJA 1S9JA 4FV2A 4L8MA 5TT7A 4AW5A 2BDFA 2GCDA 4FVQA 5DLSA 4IADA 4XV1A 5C03A 3S00A 3C4EA 4ACMA 3DDPA 1H1PA 3FMMA 3R8MA 2ZDUA 3DZOA 3MTLA 5AX9A 5CF5A 4IAYA 3QTUA 4CFVA 4GFOA 1W84A 3E5AA 4S34A 5AR8A 1B6CB 3V8WA 4QNAA 3D5VA 3A61A 2CGVA 3C7QA 3FZRA 3QUPA 3ZEPA 3IW8A 4AF3A 5E90A 5HEZA 2CKOA 4BZDA 2UZUE 1ZMUA 2IVSA 1L8TA 3F61A 4IZ7A 4LG4A 2C4GA 5CQWA 2WNTA 4KUJA 3KB7A 3BELA 1R0PA 4NTSA 4PDOA 4AP7A 4KRDA 1ZLTA 2AEGA 4FL3A 4M69B 5AV2A 3PJ2A 1ZYCA 3SKCA 4D58A 1Q41A 2ZJWA 4HGLA 4AFJA 2IZTA 4I20A 5I0BA 3BQRA 3QCYA 3SA0A 4R1YA 2IZSA 3V6SA 3V5JA 3P23A 4BDHA 1R39A 4AGWA 4WBOA 5EQEA 2B53A 3QCSA 5HG7A 5HE3A 2YDIA 4RJ7A 5AAFA 4AS0A 4BIBA 2C3KA 5FEDA 2ZYBA 2X4ZA 3LFBA 5JKGA 3QGYA 4L44A 3DJ7A 3PXZA 2YZAA 3CQUA 2J0IA 2XNMA 4UMQA 4NWMA 4HYHA 5C01A 4ASXA 3PWDA 2W1CA 2XCKA 4I93A 3ID6C 2OZAA 2R64A 3F3ZA 5CENA 3U8WA 3UGCA 3DQXA 4XG7A 3ZO1A 3NCGA 5EH0A 1ZRZA 3MW1A 4USDA 3GOPA 5A3XA 3R7YA 5JQ5A 4RBLA 5JFXA 3QX4A 5AUTA 4D2VA 5M08A 3CKWA 1WVXA 1YXUA 2OO8X 4AXAA 4USFA 1L3RE 4LL5A 3K2LA 3IGGA 4YGAA 1UKHA 5AJQA 2BFXA 1SM2A 4C2VA 4CQGA 2C5YA 1KUTA 4NH1A 4ONAA 4CMOA 4EZ5A 3ZHPC 5DYJA 4EC8A 4IB5A 5E1SA 4DC2A 2ITNA 2F2CB 4RRVA 3IOKA 3ZH8A 5G6VA 1XH5A 5AR3A 5KMIA 3FEGA 4XOYA 3R1SA 4I21A 2G15A 4TT7A 2OWBA 2W9ZB 3FUPA 4BGHA 3UO6A 1YI6A 3OEZA 4BHNA 4FKLA 4O2ZA 4W4YA 4YJVA 4CCUA 3DXPA 2Y0AA 3NUUA 4XBUA 3VULA 1YDSE 2VWVA 4EYMA 2YM7A 2BAKA 3A99A 3C4CA 4IFGA 3MY0A 2F7XE 3IDCA 2W1HA 3KY2A 3R2BA 3BL9A 2WMSA 4NW6A 4RIWB 1XO2B 2OJJA 3Q4UA 4I23A 5IH4A 2NYAA 1UU9A 2XKDA 2ITOA 4X2NA 3NUYA 3KXZA 3NDMA 4GU9A 2R4BA 2ONLA 1Q62A 3R1NA 3LFDA 2WMVA 3D94A 5A4TA 3K54A 3PRIA 2IPXA 2WGJA 3Q53A 4W4WA 2QI8A 3RTPA 1H1SA 3PVUA 4FT9A 1OPKA 3FWQA 4DTKA 5DR6A 3W0QA 2A27A 4HW7A 4K18A 3UJGA 4NU1A 2W1ZA 2VZ6A 4GUEA 2YHVA 4XV2A 4TYGA 5B2KA 1MRYA 3W16A 2BILB 4E73A 3QTWA 2A1AB 4RG0A 1H1QA 3A8WA 2FVDA 3OF0A 5AP5A 4DEEA 4E4LA 2O3PA 4IEBA 1V1KA 3ALOA 5DGZA 3BL7A 2W9FB 3AC1A 3N4UA 3W32A 1ATPE 4IX3A 4WA9A 3I81A 2V0DA 3DZQA 4I6QA 3LFCA 5EHLA 3A8XA 4YLLA 2R3NA 2RIOA 3CD3A 3FY0A 4RVLA 4B8MA 4IB0A 1PY5A 4K1BA 3MVLA 3EN4A 5LARA 4EBWA 2P2IA 5E7RA 5EQPA 5IQDA 2IVVA 2HENA 3KL8A 4O27B 2XRUA 3G2FA 4XS2A 4L7FA 1O6LA 3T8OA 3FV8A 1DAYA 4FGRA 1YRPA 3RALA 2BIKB 4PRJA 3UMWA 1NVQA 3HX4A 4ZSJA 4AOJA 5AV4A 3MB6A 2IWIA 5CTPA 2OG8A 5JZJA 4JXFA 5EKOA 4XLVA 2QKRA 2E9UA 4IFCA 3NPCA 3FPMA 3QRTA 3OXTA 4F64A 1PMNA 4CYJA 2P0CA 2VWZA 3GFWA 3MVMA 5GHVA 3CY2A 1OL7A 4F1OA 3FMLA 2EU9A 2XNOA 4BY9E 5IA3A 3BIZA 4FKRA 4PPCA 5E8YA 4BZNA 2XM9A 1WMKA 1YW2A 1DAWA 5TKDA 3REPA 4E5BA 1XKKA 2XAOA 2Z02A 3QRKA 2QVSE 2GHMA 2HY0A 4R5SA 3HUBA 5T6KA 1JPAA 2BTRA 4BDEA 1ZYSA 3BEGA 2BR1A 2CJMA 5C26A 3MFUA 1UNGA 5CEMA 3FKLA 3P1AA 4GT3A 4XEYA 4C37A 5B2LA 4EEVA 5IQFA 3LJ1A 3DB6A 5AUVA 1OPLA 1XH8A 1WBNA 1REKA 4D9UA 4PV0A 2RL5A 2PU8A 2VTQA 4FZDB 3VBTA 3W2RA 3OCBA 1LUFA 5DI1A 3OS3A 5FXSA 4BWKA 2PMOX 2OIDA 3DBCA 4LMNA 2ZV7A 3AQVA 2UW3A 4Y73A 5JFSA 3HAVA 4YJOA 1HOWA 2UVYA 1BI7A 2VNYA 4BDGA 4DCEA 4BJJB 1TQPA 3Q5ZA 4G9RA 4PQNA 3ZOSA 4FSYA 5A9UA 4LOQA 1XWSA 3QD4A 4NIFB 5KZ0A 4F65A 2QOLA 4HNFA 3ZXZA 1I44A 1UU3A 2O63A 3JVSA 3KRRA 3OCGA 4QYEA 2R0UA 3HV5A 4H39A 4S33A 4DFXE 4ZAUA 4FF8A 1BLXA 4IW0A 4EH9A 5A4EA 4W9WA 3C51A 2XIRA 4F0IA 2JIVA 2YJRA 2XKEA 4I92A 2X81A 2JAMA 2Q0NA 4D1ZA 2QOOA 3FZOA 5CYIA 5AIRA 4F6UA 2W06A 1CKJA 3Q2MA 3O23A 4MD8E 5EHOA 2LAVA 3PXFA 4A9UA 2GTNA 3UDZA 1Q3WA 4QMQA 4DDGA 3VS2A 3RM6A 4O7RA 4KWPA 5HLPA 3MA6A 3TZ9A 2HZ4A 1SMHA 4ITHA 4NCTA 4O91A 4FTOA 3F66A 3VIDA 5HBJA 3EFJA 5GZAA 4E26A 4R3RA 3U54A 3NSZA 2EVAA 2O2UA 5L2WA 4JMQA 2QOHA 5L8LA 4Z7HA 4YJQA 2R3QA 4WBBB 3ETAA 1O6KA 1Z57A 4CRSA 4MF0A 5AUXA 5FRIA 4ZTMA 3RWQA 5LWMA 4ORKA 4M66A 5GINE 4G9CA 4J99A 3ORTA 3P79A 1GZNA 2Y6OA 4WNKA 3LHJA 4HZRA 3U4UA 4DT8A 3P5KA 2B9IA 3CS9A 4HVDA 2F2UA 5LVOA 3HUCA 4AA4A 1W83A 2ETKA 5EG3A 3ZDUA 4U80A 3S95A 2QODA 4YTFA 3UZTA 3AOXA 4O96A 5FD2A 5J79A 3LFQA 5A6NA 3TM0A 4LYNA 2BDWA 2W05A 4UV0A 3QALE 4I1ZA 3HMMA 3W2SA 4YSJA 3VN9A 5JK3A 4YUQA 4FL1A 3VVHA 1H25A 4GKIA 4EWHA 2JEDA 3TYKA 5AAEA 2WQNA 2ZOQA 3O8UA 4HPTE 3TXOA 3PP0A 3BGZA 2JC6A 4QNYA 2P3GX 4W4VA 5CAOA 4JDHA 4PMTA 4WNOA 3BE2A 3L8SA 4GK4A 3FJQE 3PJCA 4UWBA 3GB2A 3SLSA 4OT6A 4M12A 2QNJA 3C0IA 4P5QA 3VBVA 3VW6A 4F9BA 4YURA 4RZVA 5J1VA 4QYGA 3R7OA 3VQHA 5JFVA 2C6KA 3BRBA 3BLHA 3CQWA 4LV8A 5HE2A 3FL5A 4O38A 3H30A 3HMPA 4QRCA 3FMKA 1H4LA 1J1BA 2IO6A 3GT8A 4UXLA 4O0YA 1F3MC 4FV1A 4UXQA 4D5HA 5IUHA 2XZSA 4UWYA 3CEKA 1ZMWA 4JDIA 1U54A 2C6EA 1QPJA 4JT3A 4BDJA 4D2RA 3PVGA 4L53A 3G9LX 2AQXA 1WVYA 2J6MA 2WEIA 3CD8A 3L8XA 3EFLA 5EI8A 4ARKA 2VU3A 3SW7A 4BDBA 4IVCA 2G1TA 2B55A 1WBVA 1W82A 2Q0BA 4F9CA 1KE6A 3SG9A 5G1XA 2GU8A 2XK7A 5CU2A 3OUNB 3D4QA 3I0QA 4QTDA 3ROCA 5DBXA 3Q52A 3QTQA 2PVMA 5GJDA 5FDPA 1LPUA 3O17A 3VS3A 5J95A 3B8RA 3NYOA 5IQGA 3PLSA 2R3RA 4F4PA 2CN5A 4YHTA 5AR2A 2R9SA 4EQMA 1P5EA 4E6DA 4ANQA 2ITQA 4AOTA 4U40A 5M53A 4BIDA 3SX9A 5IEYA 2WTCA 3ZEWA 3UO4A 2VO6A 5D12A 4TXCA 1JAMA 4RA4A 4EHEA 4FJVA 3ZRKA 5M51A 4YSMA 4AW1A 3SXRA 3ZC5A 4G5JA 4V04A 1YWNA 4MNEA 4OTPA 3CBLA 5FM3A 2R5TA 5EKNA 3MJ1A 4BTFA 2OICA 4I0TA 3DBEA 2JAVA 4EH2A 3EL7A 2QLQA 1JWHA 1H01A 2WELA 2VWXA 4FTAA 4O2PA 5HCYA 3PZHA 1OGYA 5DH3A 4JX7A 3UYTA 5BYLA 4WT6A 4AZTA 2OXDA 5IMXA 2WPAA 3DNDA 3ZLYA 4MKCA 5AUWA 3QCQA 4ZLOA 3A7GA 5LVPA 2UZDA 4E6QA 5H8BA 5IG1A 2V55A 2EXMA 4TYHA 2VWWA 3HA6A 5EM8A 4D1SA 5HU3A 4WD5A 1A48A 4QDVA 3IW6A 1URCA 1G8JA 1GNGA 1BL6A 5HLNA 3WF5A 3UQFA 1FVVA 1ZARA 2PE1A 1YKRA 3MVHA 4MBIA 5HLWA 1FBNA 3KXHA 4CFUA 4QTBA 3EMGA 3FZPA 3SVVA 4DHIB 5AUZA 5DMZA 5AFVA 2BTSA 2QHNA 3MFTA 4ZY5A 2R2PA 2PMLX 4ANNA 3K5UA 1PYXA 3VS0A 3RMFA 2Z2WA 3ODZX 3E8EA 1FGIA 2VTIA 3SRVB 3H9RA 4NZWB 1OECA 3TUDA 5LVNA 4FNYA 2ZB0A 2VTTA 5CSVA 1YHWA 2UZNA 5HD4A 2ZVAA 5E8TA 4C62A 3RJCA 2P2HA 3P7AA 3F5PA 3Q04A 4M14A 3VBYA 4BI0A 4ZZOA 4QP1A 4QMYA 4DLJA 3JR1A 3N51A 4L43A 3ZSIA 3Q6UA 4WUAA 1JQHA 3PY0A 4U42A 4OTQA 4EQUA 4QTEA 5BVDA 5FXRA 3RAHA 2WOTA 4OTWA 4QMTA 1OMWA 1UWHA 4UZDA 3WZKA 2OJFE 1KV2A 3WYXA 4M15A 3LOKA 4CNHA 1KE8A 1YI3A 3P9JA 1T45A 1Q8YA 2ETRA 3ZTXA 4L01A 3JS2A 3DBFA 4KRCA 5AV3A 4FOCA 3VUGA 4AX8A 3O0GA 4R8QA 5DVRA 4DHJA 4IDTA 4GJ2A 4QP9A 5F1ZA 4ZSEA 2W99B 5CALA 3UC4A 5K0XA 3VS1A 5CT7A 4ZEGA 2X0PA 4FTRA 3FXZA 3OG7A 3PA4A 5FQDC 1P4OA 5CNOA 4AUAA 3LZBA 3O8TA 2CKQA 4JDJA 5L2QA 4GEOA 3GU5A 4NFNA 4IM3A 3VUHA 1WFCA 1ZXEA 4W8EA 4XG2A 5HTIA 5I9XA 5KMOA 2UVZA 3CPCA 4OW8A 3B8QA 5HZNA 1SNUA 4H3PA 1QL6A 3UQGA 1NVRA 3LKMA 3NYVA 4MH7A 4UZHA 1IA9A 4NTTA 2CN8A 4FG7A 1NVSA 4FYOA 3A4PA 3IECA 4FV8A 4JG7A 4RJ3A 2C6DA 4C0TA 3DXNA 4ZS0A 3PVWA 5F4NA 3TZMA 5HKMA 4L42A 4WOVA 2X1NA 4FSNA 3ZSGA 4IB1A 4UX9A 1GAGA 2F7EE 3ATTA 4RJ5A 3D7TB 4FTIA 4YJRA 3UMXA 5EDPA 4R3CA 5J5SA 1UA2A 4IC7A 4ALWA 3O96A 1WBPA 4FSQA 3RPRA 4DGOA 5HX8A 4R3PA 1JKSA 3R8VA 2UW7A 4FTNA 3O50A 5ANOA 1Q8WA 5D10A 3R83A 5FEEA 4BCFA 4ASEA 3QQUA 5DHJA 1H08A 1SVGA 3CCNA 3QZIA 2OSCA 2RG5A 3PJ1A 3HDNA 3U9NA 2W5AA 4I4FA 4IWOA 4C2WA 4U41A 3I7CA 1Q97A 4X2JA 4C4IA 3VRYA 4LGGA 3R01A 4PMSA 4U5JA 5KZIA 4Z16A 2GQGA 5AP3A 4EHZA 3UNJA 5IU2A 3C5IA 4W9XA 4FNWA 5JH6A 2C5XA 4QEBA 3KK9A 3W0MA 4H3QA 4Z55A 4R78A 4JQ8A 5D11A 5ANGA 4E4XA 2WQOA 3OWLA 3O71A 3JY9A 4KSPA 4GYGA 3V8TA 4F7LA 4J96A 4MXCA 3MB7A 2W5HA 1PXOA 4IAKA 3R7EA 5HORA 1K3AA 4PDPA 5IH5A 4C59A 2IG7A 3EYHA 3UVRA 3COKA 1OM1A 3EWHA 2Y6MA 3A60A 1WBSA 3W2QA 3N9XA 4I6HA 1OIYA 2WZJA 3V01A 2E9NA 2OU7A 4MBLA 4RC3A 4DAWA 4DFBA 3LXNA 2ZV8A 2PPQA 4O0SA 4EI4A 3EQRA 4J98A 5D9HA 2Z7LA 2JFLA 4LOPA 1PXIA 2FYSA 2OJ9A 2PMNX 2XUUA 3GEQA 3O8PA 4AN9A 3VONA 3TUCA 3IW5A 2IZRA 3NIZA 4TTHB 4D4YA 4FBXA 3SHEA 4FKVA 2C3LA 3DKOA 5BX0A 4O4EA 4QTCA 3SGCA 3GU8A 3QTSA 3KRJA 5F20A 3V04A 3TL8A 4F1MA 2KTYA 3MJ2A 2XB7A 4JX3A 3THBA 4Y5QA 3KIOC 4YPDA 1E9HA 3QLFA 4QD6A 1OKWA 4RIXB 4GS6A 4DITA 4C38A 1R78A 2JD5A 1M17A 3R9DA 3NVMB 2Z7SA 5CZHA 1OGUA 2GHLA 3LM5A 4F9YA 3BLAA 4ANMA 4FRFA 5E8ZA 4EK8A 3PUFC 1V0OA 3IW4A 1XBBA 2Z60A 4FV9A 4U3ZA 5L8JA 2XK8A 4E8AA 4O84A 4F78A 3VBWA 2PY3A 3C4WA 1O6YA 1XBCA 2PUIA 3H3CA 1SYKA 1YXSA 3NZ0A 3LMHA 3BYSA 5ITAA 4PTGA 4QMWA 4DEAA 3QFVA 4QPMA 2PE0A 3E7VA 4O1OA 3G51A 3ELJA 2C6MA 2J5EA 4TPTA 3UP2A 4EH4A 5A6OA 5EOBA 5F95A 5KX8A 4UALA 4ZSLA 4AACA 2ITPA 4KSQA 4GT5A 4EK5A 2BZJA 2ZV9A 2IW6A 2WIPA 3NYNA 4I4EA 4J95A 5FGKA 2YM4A 3NUNA 4FKPA 3W0RA 4AU8A 4YZ9A 4U45A 3QRUA 3HP5A 3KA0A 2WMAA 2R3MA 4KIKA 3PFYA 3PIZA 1B38A 3VW8A 3TEIA 1CDKA 2HIWA 2YCSA 3ORIA 2JIUA 4QMXA 2DUVA 4QMOA 3FHRA 1Q8TA 3BKBA 2X8IA 3G33A 4MD7E 4RMZA 2J0LA 5E8UA 1DM2A 5AA9A 1M2RA 3PA5A 4ZMEA 5LQFA 4A9SA 3P86A 3PPJA 3DDQA 3FY2A 2IF8A 3QQFA 2FGIA 5ETFA 3NEWA 3FLNC 3GBZA 1OIQA 3DAKA 2C6LA 4BJJA 3KVXA 4AT3A 3IO7A 5HO6A 3E87A 4NIFA 2CCHA 2HOGA 1PF8A 2XS0A 4AZFA 2FSOX 5C8NA 2W1IA 4K9YA 5FUTA 4GU6A 4HCTA 1G5SA 2KULA 4FT0A 5HICA 2WMTA 2OIBA 3UO5A 4EONA 3M1SA 4JLCA 4RLLA 4UMTA 4YU2A 4J53A 3R8LA 3LCKA 3CE3A 4NJDA 3MH3A 5C8MA 1W2FA 2OW3A 4Q9SA 3I7BA 4U0IA 4FTLA 3LW0A 4I41A 4Y46A 3RM7A 2XNNA 3KCKA 3R63A 5L2SA 2WIHA 4QDEA 4WNMA 4GIIA 4UWCA 3HP2A 5F9EA 3TJDA 4Z9LA 1UKIA 4NKSA 3RHKA 3SXSA 2VWUA 2QO2A 3EKKA 2EXEA 2JKKA 2VTPA 2OI4X 5FXQA 2X7GA 4BCPA 5AEPA 4ZP5A 2DS1A 5HO7A 2E9OA 4BGGA 2X8DA 1W98A 2J0JA 5DR2A 1APME 4FT3A 4RWLA 4ZJJA 3HMOA 3PP1A 3UG1A 1AQ1A 3ZM4A 4OBQA 2ZDTA 4E6AA 2SRCA 4EH3A 3F5GA 4O81A 3CKXA 4CFFA 3LJ2A 4DE4A 3CIKA 4A4LA 1A06A 2BCJA 1U46A 3DKFA 3FMNA 5EK7A 4D1XA 3MDYA 4C36A 4GH2A 1UVRA 1U5QA 2XMYA 4IM2A 3TNWA 4TN6A 4A07A 1CMKE 3NYXA 2X6EA 1ZOHA 4DTAA 3KULB 4JBQA 5HGIA 4ZXTA 5I5ZA 4JAIA 3V3VA 3FKNA 4CFMA 3QTXA 1LP4A 1OL5A 4G3CA 4C4EA 4WIHA 4GCJA 4AZSA 4DBXA 1Y57A 4I3ZA 5AA8A 4FEVA 2UVXA 4NW5A 5B7VA 4C34A 2C5OA 2R3FA 3F82A 3F2RA 4V01A 3JYAA 5I9YA 2BZIB 3R7IA 3R9NA 3F6XA 2BKKA 3NX8A 3FL4A 4IDVA 4XX9A 3PRFA 2QOIA 3HV3A 4BDIA 3ERKA 5D1JA 3M2WA 3BGPA 2QO7A 1I09A 4FZ6A 4G3FA 3IGOA 3TV4A 4HVIA 1CKIA 1RDQE 3EKNA 4J1RA 5FLFA 4FVPA 2YCRA 5ETIA 4K8AA 1DI8A 3D5UA 3EYGA 1VYWA 3F7WA 4FI1A 5CU3A 3QA8A 3UYSA 3WOWA 4AFEA 2YAAA 3POOA 5KCVA 1FINA 2ITZA 2X2MA 3KMWA 3UIUA 4MXYA 5CEIA 4M84A 3NNWA 5D41A 4PNKA 5DIAA 3AG9A 1NA7A 5FP6A 3WBLA 1MRVA 2CDZA 5CEOA 3LAUA 2IEWA 4C3FA 4F7JA 3LIJA 3R2YA 1Y6AA 4AXCA 4PUZA 5A54A 1BYGA 3W55A 1ZYDA 2PWLA 1J1CA 1IG1A 4L3JA 4M97A 5JRSA 1AD5A 4JG8A 1OIUA 3EOCA 4QP2A 5EM7A 5LMKA 1QPDA 5AP4A 5KMJA 3DOGA 4BRXA 3D5WA 3EQPA 2OJGA 2HCKA 4G5PA 2PVHA 1ZYLA 2I0HA 3FKOA 4O6LA 4W4XA 1M14A 2NO3A 2CNQA 5CI7A 3U55A 2GFCA 4FTTA 5DNRA 1YWVA 1ZY4A 5ICPA 5FBOA 5IISA 1UU7A 2C0IA 3LQ5A 4F6SA 5BVWA 3BGQA 3DTWA 3EQIA 4ZJIA 2B9JA 4IJPA 2X7OA 3ZUTA 5IMEA 1KE5A 3R71A 2IJMA 1OBDA 2UW6A 3F88A 3HYHA 3R28A 4QP7A 3ATSA 4IWDA 4DYMA 1JKTA 4CT1A 3QYZA 4I94A 3FLSA 2BDJA 2X0OA 2UZBA 1ZZ2A 2PVYA 3DTCA 3OWJA 4ZOGA 2VTLA 4R7HA 1WBOA 4JAJA 3BI6A 3RBWA 1Q24A 3ZM9A 1IASA 4F7NA 3QUDA 2F57A 2BROA 1QCFA 4FKUA 4F6WA 3QZGA 3FI8A 2Y9QA 2OK1A 3Q96A 3QD3A 5E8XA 3HL7A 3UOLA 3NRMA 2QO9A 4MEDA 2VWYA 4X3FB 2WMRA 3BWJA 2PVKA 3GQIA 4B8LA 3VUKA 3QF9A 4A4OA 5HBHA 4FVRA 4FTJA 1XH7A 4Y85A 1Z9XA 3H0YA 5CF4A 3IONA 5HX6A 4EH5A 3ENHA 5CANA 5KE0A 4M13A 3KU2A 5IA2A 4CMUA 4WG4A 3UOJA 5FTGA 4PWNA 4HZSA 4CKRA 5HBEA 3ZUVA 3LQ8A 4ID7A 2O8YA 4E6CA 3FXXA 2PVFA 2HW6A 4ALUA 2GNLA 3W1FA 4GK3A 4BDDA 3FI4A 4CFWA 4CKJA 5IPJA 4H05A 3MPAA 4G16A 4D2WA 5CY3A 3EQCA 3LE6A 2BRNA 2VRXA 3QKLA 4A9TA 4BCMA 4FUYA 4MVFA 2RFEA 1YDTE 3W18A 4BR3A 3P5JC 3DJ5A 4N6YA 3R9OA 2XEZA 1W2DA 2PSQA 4P2KA 4ZSAA 5C1QB 2XM8A 3BV3A 3RWPA 2UZTA 3C13A 2I0VA 1YHVA 2B7AA 3MH2A