2HZIA

Abl kinase domain in complex with pd180970
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
268
structure length
268
Chain Sequence
DKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Structural biology contributions to the discovery of drugs to treat chronic myelogenous leukaemia.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2hziA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2hziA01
2Y6OA 4HPUE 3EQIA 4JBVA 4YNEA 3PJ1A 4EZ7A 3HP2A 3R71A 2P2HA 4N6YA 4V04A 4IJ9A 4XRJA 5E90A 4C7TA 3HUCA 3WARA 4MXZA 3Q6WA 3POOA 4FSRA 3TNPC 4XCUA 5DI1A 2WB8A 3IOKA 3I0QA 4RFZA 3GCSA 5JRQA 3NLBA 3FYKX 2BRGA 5C8KA 4S2ZA 3NMUF 1WVXA 4G9CA 4RFYA 4CEGA 4DGLC 2ZV9A 4I5MA 1V1KA 2UZBA 4PPAA 3V51A 2CN8A 3ZRMA 3DBDA 3BRBA 2YM7A 1OIYA 4ZZOA 2ITVA 5CAQA 3AG9A 2QODA 4XUFA 4YHTA 5LVOA 3FKOA 4C57A 4AZFA 5CQWA 5C03A 5D9HA 5AAEA 4BGGA 4CYIA 1FVRA 4DFYA 4ZP5A 4QP4A 3WZKA 2GFCA 1UVRA 4YZMA 5IA4A 1YKRA 3LKMA 4U40A 4DHFA 1H1QA 2J0JA 4EH5A 3W8LA 3SA0A 1NVSA 3QQJA 3UOHA 5CAPA 4DE4A 3VS4A 4GKIA 2QHMA 3OWLA 4BBEA 4BICA 3I79A 1UU3A 4EL9A 1T46A 4I92A 1WBSA 4L44A 5CI7A 5TT7A 3NWWA 3TEIA 5DA3A 4I6HA 4QMLA 3RHXA 5H3QA 2WTKB 4FV1A 5HE2A 4CFUA 5C8NA 2GTNA 2RIOA 3ERKA 4EH2A 4IM0A 4RC2A 3R7EA 1XBCA 4MKCA 3FZTA 2OJJA 4UV0A 4RA5A 4O83A 1K3AA 3MY5A 3FI8A 5M56A 4FZ6A 3WZEA 3NUPA 5KHXA 4M3QA 2QCSA 3L8VA 3DZQA 5E8WA 4Q9ZA 3C0GA 3QZFA 4Y5HA 2RG5A 3N51A 4LRJA 2YACA 4YJVA 5CT7A 3UOKA 2JAMA 4EOIA 3NUYA 5HX6A 3UO4A 3RNIA 1Q8ZA 4F9BA 1YDTE 4BCFA 3R7VA 4NCTA 2C1BA 3BQCA 4FIIA 2QOCA 4QMUA 4N70A 2E9OA 2C4GA 3L8PA 2R9SA 2B9FA 2Y9QA 4QMTA 3MVHA 3QXPA 1L3RE 2ZB1A 2YLFA 5EOBA 3ORIA 1OVEA 3PJ2A 2YIXA 1PY5A 5FP6A 5IA1A 3QQLA 1AD5A 1XJDA 5C4KA 4Q5HA 3MV5A 1PHKA 3HV6A 4XBUA 1XWSA 2OXYA 2R3JA 5J87A 3H9OA 4RLLA 4EH4A 5DGZA 3R7IA 4DTAA 2I0HA 4JR3A 1U5QA 4QMYA 1ZY5A 1A06A 4MK0A 4R5SA 3LAUA 5HHWA 5D7VA 5AV4A 1HCLA 3SLSA 4TL0A 3U6HA 4X2FA 4FR4A 5CVGA 2PZPA 1GZNA 4U44A 3QQGA 3F61A 4GIIA 1KE7A 2R64A 4RIXB 2BMCA 3QYWA 3BBTB 1H4LA 3MA6A 4G17A 4DBNA 3P78A 4L68A 2XBJA 1YWVA 4MWIA 4O0VA 4G1WA 4IMYA 4J8NA 1VR2A 3Q32A 5DN3A 1SMHA 5HOAA 4GFMA 1J91A 4NW6A 3E64A 2R5TA 1MRYA 4GL9A 3N4VA 3Q4TA 2PUNA 3LOKA 4YGAA 4QQCA 5L6PA 3GC8A 1QPEA 4CKJA 5FEEA 4G3DA 4KRCA 5AP3A 4HOKA 4QNYA 3LHJA 4HCTA 3SRVA 4C3RA 3OHTA 4MHAA 2WQNA 3R8UA 5CXZA 4A9SA 1LR4A 3BLQA 5A4CA 4M15A 5ANKA 2VO6A 1UWJA 3DBFA 5BVOA 5CEQA 4F6SA 5L2WA 5LQFA 3W10A 1VJYA 5CQUA 5E1SA 1ZWSA 4D5HA 4JS8A 4XX9A 3B8QA 5K0KA 3VBTA 5LARA 3O8PA 1APME 4JX7A 4MAOA 4D4RA 2PMNX 4LI5A 4W4XA 1OGUA 5FUTA 2R3FA 3MPAA 1RJBA 1U54B 3CSVA 3UMXA 3ZLWA 3SXRA 3DJ7A 3IK3A 3AD6A 3IQ7A 1F3MC 5L2TA 3THBA 4Y83A 4FKIA 3UOLA 3Q4ZA 5M4FA 3FLZA 5IA0A 4QMXA 2W9ZB 4KSQA 1A9UA 3TT0A 2UZOA 4IWOA 5M06A 4N6ZA 5FM3A 4NL0A 4DH8A 5M07A 4FTCA 4U41A 1U54A 4UMUA 4XG6A 3Q4UA 4U8ZA 3FZ1A 3DB6A 4LFIA 1H1RA 3HECA 4O96A 2BHEA 3SOCA 4U45A 3O71A 3O96A 4X21A 4BCQA 4DH7A 5HGIA 4QT1A 5F1ZA 4BDJA 4PP7A 4UWYA 5DMZA 2WZJA 2WQEA 2Z7RA 3ZM4A 4FTJA 5BNJA 5ETIA 4EKKA 3ANQA 5KHWA 4ZLZA 3WYYA 5K3YA 4BWKA 4EOJA 4IAZA 4E20A 2QG7A 4NT4A 3ZO4A 3EQFA 3PFQA 3SDJA 3DDQA 1MQ4A 3LZBA 3K5VA 4YZBA 2BIYA 5A46A 2EXEA 2VTNA 4EUUA 1J7LA 5BUIA 3PDTA 3ZUTA 3ULZA 1ZY4A 3RTPA 2GNJA 4FTKA 5CY3A 4S31A 3EQBA 4KBKA 4KWPA 5GZ9A 3W8QA 1B38A 3TV7A 4AACA 1U46A 2XA4A 2G2HA 1XH8A 1TQMA 2XNMA 3VUIA 4ZSJA 3S4QA 5BVWA 2J7TA 1OM1A 2JBPA 3PP0A 4O0WA 4BBFA 4M8TA 3NUUA 3D7TB 4XG2A 2F57A 1Q97A 3Q2JA 4ZSLA 2FSOX 3BHUA 4FKWA 4C34A 5BUEA 5HU9A 4EHVA 3E3PA 5AP6A 2XMYA 2PY3A 2R3GA 4O7VA 2W5AA 1FMOE 3IDCA 3RAKA 3GBZA 1YI4A 2YCRA 4UXQA 3PPZA 3ROYA 4P90A 5DR9A 3FQSA 5C8MA 1RW8A 4PDOA 3IW8A 4EK6A 3QRUA 4BWXA 4APPA 2FH9A 2QKRA 3TUDA 4FT9A 3MFTA 4C33A 1PXJA 3LXKA 3BV3A 3OBGA 5HD4A 5EOLA 4LM5A 3ZLSA 3RWPA 4BL1A 4ZY4A 1PXIA 2WTWA 3NYOA 3TZMA 3O0GA 3G33A 5GZ8A 4RZVA 3F3VA 4OTGA 4QMNA 1NY3A 3MB6A 3RCJA 4IWDA 4BDDA 4OAVB 1H01A 5BVEA 5C9CA 4D2VA 5CZHA 4EOOA 3VJOA 3LJ2A 2I7QA 3S3IA 3NAYA 3FXXA 3D15A 4FKGA 2P0CA 3R1NA 5H8GA 2XRWA 4I93A 3R0TA 4LOPA 5HO8A 3DK7A 5CI6A 2QOBA 3TTIA 3CQEA 3ORKA 4HNIA 5DFPA 1M2RA 5AP0A 3NSZA 4HGEA 2FYSA 2UW9A 3DJ6A 3C4FA 1H08A 3BHHA 4NTTA 2CLXA 5HG8A 1H00A 3V5LA 1ZRZA 3RINA 4BZDA 4F1OA 2OJGA 2J5FA 1KV1A 2XIXA 1WZYA 5AA9A 5EG3A 3IO7A 3R8ZA 2C6OA 1BI8A 3A7HA 2RL5A 3FV8A 1Q41A 3G6HA 3C5UA 5HIDA 1GIJA 1ZLTA 3ZYAA 4DN5A 3I6UA 5T6KA 1VZOA 2W99B 4CMTA 2YN8A 4ORKA 3F9NA 4M13A 5KNJA 4FNYA 4FTUA 3O2MA 2A4LA 3DGKA 3Q9ZA 4JLCA 4MF1A 4GFGA 3FZPA 1XHAA 3BCEA 4M67A 5EW3A 4DEDA 2X39A 5I5ZA 1Q61A 1Y91A 3G15A 4D4SA 2QR7A 3HMOA 5EK7A 3U6IA 3FI4A 2DUVA 5AA8A 4FK3A 2CSNA 2C6EA 2HY81 3D7ZA 1PF8A 4EH7A 4EH3A 2J0KA 4BCGA 2Y4IB 1LUFA 3MVMA 5CSPA 2XM9A 4AA4A 5CEMA 2WIPA 3OEFX 2JBOA 3EQDA 2I0YA 1P14A 3OP5A 4BI2A 2IJMA 4MBIA 3GC0A 4Z7GA 4QMWA 2X2LA 4KNBA 4M84A 4QMOA 1ZMUA 1JKLA 3OWJA 1GZKA 2OH0E 3PG1A 4ITJA 3UVPA 4DYMA 1OMWA 3MJ2A 3LFEA 2WQMA 3VF8A 4EK4A 4EUTA 4AA0A 3KKVA 1H1SA 5HVKA 1XBBA 3KF4A 4L67A 4UMTA 1ZZLA 1PJKA 2VZ6A 3LFAA 3ZLXA 4IDVA 2H96A 3FMJA 4O84A 2XK3A 3MH0A 5CVFA 4M0YA 3QA8A 4FOBA 2Z7SA 1GOLA 3VJNA 5L8JA 2PVNA 3KFAA 2BPMA 3ODYX 4DITA 4FI1A 4C8BA 4BDEA 3FMHA 5H8EA 3HMIA 5HESA 3UYTA 2CNUA 4O1OA 4FEVA 5IQDA 3QD3A 3PRFA 3KVWA 4L3PA 2IO6A 3L9MA 4TT7A 4G3CA 5GJGA 4DLIA 3VVHA 1WBTA 3VW6A 2ETMA 1M2PA 3R9OA 3R1SA 3A4PA 3E92A 4GJ3A 5EQYA 1FVVA 1YRPA 1JKSA 3FL4A 4XV1A 3W2PA 4TYHB 2E2BA 3P79A 3PE1A 4MVFA 2UZDA 4NIFA 4RC4A 4X7QA 3GOKA 3R8LA 5I9XA 3K3JA 2WAJA 4HJOA 5L2SA 3SHEA 3VULA 4O27B 3ATTA 4CG9A 1KE8A 2H6DA 1PXNA 4G6LA 1XH6A 2X2KA 4HGTA 5DR6A 4A4LA 4KIQA 2FSTX 3UZTA 4YBJA 3MY1A 2QG5A 3OY1A 4CVAA 4KBCA 2P33A 4QTCA 2JFMA 4TYIA 5E8YA 4A06A 3QRIA 4HYHA 5EM7A 3O51A 4GK3A 4IWQA 4XOYA 3UP7A 3VQUA 3ZUUA 4EJNA 3JS2A 1XKKA 2QD9A 4B4LA 5FEQA 4RG0A 5JRSA 1H0WA 4LG4A 3UVRA 4BY9E 5AUVA 4EQMA 5DT0A 3TKUA 3LCKA 3VUDA 3ZRKA 1JAMA 1HCKA 1W98A 2XNNA 4JQ7A 2BZIB 5CSVA 3P5KA 5AR4A 3UE4A 4MBJA 3QC4A 1MP8A 3L8SA 2X6DA 5HNGA 4N57A 5E9EA 2XIRA 4A4OA 4MXCA 2UZTA 4WO5A 4YPSA 4FIHA 2JFLA 2OU7A 5HIEA 3QGYA 3DTCA 1Y6AA 2W1DA 3R02A 5BYLA 2AC5A 3LM5A 2YDJA 5I0BA 4ACMA 3UOJA 3FMEA 4FIEA 3QLFA 4OTQA 4KS8A 3RWQA 2WMVA 3CQUA 4FSUA 4UX9A 2PTKA 4U43A 3V5TA 4EWHA 3LFBA 4ZTRA 5BYYA 2C0IA 5KMJA 4FEXA 1UKIA 5JH6A 5AX9A 2CDZA 2YFXA 4FX3A 2RFNA 4YZ9A 4QPSA 4EQUA 4RX9A 5J9YA 3C50A 3NVKI 3LCOA 3CR0A 3A8WA 4E4LA 4DEBA 2C6KA 2XNPA 5AADA 3D2IA 3DKOA 2YZAA 5FBOA 1YXTA 2P3GX 3VUMA 5M4CA 4AN9A 5T68A 2G2IA 3AXWA 3R2YA 1JOWB 1ZYLA 3K5UA 4GU9A 5B2LA 4R78A 2GHMA 3A62A 4MCVA 4DA5A 3IW7A 4QMVA 5HCZA 2YA9A 4KABA 3KA0A 3QUPA 2W1EA 3E3BX 3OXZA 3CGOA 3V6SA 2ITQA 4FKUA 3PY1A 4IWPA 1JSTA 2DS1A 3HV7A 3IGOA 1Q62A 4K1BA 2X0GA 4O6EA 5HZNA 1PYEA 2JKMA 3WF8A 2VTMA 3A7IA 4CFXA 4IHPA 5JFWA 2CKPA 3HLLA 5KMLA 4K33A 5ETFA 5IUHA 2QOQA 4PL3A 5CU6A 3EKKA 5HVJA 3U4UA 5M08A 4BBMA 3RAHA 1T45A 3EZVA 4U9AA 5CASA 3QAME 3NEWA 3BU3A 2IPXA 2W17A 3RHKA 2YCQA 4FICA 3KXMA 4JDHA 3WE8A 5HORA 5M53A 3POZA 3MTFA 5CEKA 2XF0A 4PDSA 3O7LB 2YWPA 4F7LA 4QPMA 4EOKA 4KKEA 2BAKA 2ZB0A 1FINA 4QRCA 4ZSEA 5I9WA 3KK9A 3SKCA 4B9DA 2G01A 3W32A 3BYOA 4ZLOA 3CXWA 2HAKA 4DG3E 4FBXA 4K11A 4J95A 2XKFA 4W9WA 5TOZA 2NRYA 4ZJIA 5JMSA 2QOOA 4N0SA 2EXCX 1P5EA 4TWOA 2GFSA 5KBQA 3G9LX 3EWHA 4OUCA 4I4EA 2XK9A 5HO6A 2W4OA 1HOWA 3PP1A 2JIVA 5J95A 4ZIMA 4WHZA 2YHVA 3MPTA 4YPDA 2O65A 2C3IB 3F3WA 5IG1A 2B52A 2VTRA 2WELA 1R39A 2YM8A 4BWPA 4MQ2A 3N4TA 3SAYA 4W8EA 3ZC6A 4ZZMA 1Q24A 3D5WA 4M14A 2ITUA 5GIPE 1OKVA 2Y7JA 1ZXEA 5I9ZA 2O8YA 2G2FA 3RPSA 1DAYA 1H26A 4ASZA 4EH9A 3CTQA 2EB3A 4NFNA 3QTRA 2UW5A 4GG5A 3DB8A 3FWQA 3OTVA 4BDHA 4PMTA 4X2KA 1R78A 2CHLA 4HYSA 1F0QA 4WBBB 2XNBA 3R9NA 2XNGA 3RPOA 4CFMA 3OEZA 4DLJA 4TYEA 4PMPA 2P4IA 2X4FA 4IAIA 3D14A 4RX8A 3EN7A 5E8XA 5IEVA 3ETAA 2QC6A 3QTSA 4AT4A 2BR1A 4L42A 3C4WA 3EYHA 5TKDA 3TV6A 1JSUA 4CFVA 3LLAA 4HZRA 2VGOA 4NW5A 3Q52A 5IUGA 2HELA 4QP8A 2BRBA 1Q3WA 1NA7A 2VGPA 3A60A 3QD4A 4ITHA 3IG7A 4YTHA 5HE3A 5AR5A 3DOGA 4DFXE 5J5TA 3L1SA 3GFEA 5B0XA 3LXLA 5AP2A 4QMQA 3DNEA 3HRFA 3ODZX 3UZPA 1SM2A 4QP3A 4DC2A 4A9RA 4ASEA 3WOWA 3QWJA 2NPQA 2F7XE 3KULB 5DWRA 3DXQA 4QTEA 1GZ8A 2X8DA 2PSQA 3R00A 4LV5A 1KE5A 4RIYA 2IW9A 4C4GA 4FV2A 4Z16A 4AZVA 5FG8A 5ACKA 3SXSA 4QYFA 2YIYA 2WMRA 3EFLA 4C35A 4R7BA 2PVLA 2VNWA 4RX5A 4FKRA 3VF9A 1CKIA 3LQ8A 3R04A 2QU6A 1M17A 2X1NA 4P2KA 3Q9XA 3ZZWA 3RVGA 3I5ZA 2YM4A 4EK3A 2HCKA 3HMMA 3HRCA 3KRLA 4IX5A 3UODA 1PYXA 3PZHA 3UG2A 3NS9A 3ENHA 4IB1A 4U42A 5DVRA 1FOTA 1MRVA 3S2PA 5C4LA 4XLVA 1ZYJA 2VTJA 3TNWA 1SNXA 1CKJA 3EQGA 4L00A 2ETKA 4FVRA 2WMWA 4CLJA 3DAJA 4YJPA 3VWAA 4IEBA 5KKRC 1R0EA 2Z8CA 4F6WA 3KVXA 3PA3A 4BIBA 4O7WA 4FC0A 4IDTA 5KMMA 1CM8A 4WNPA 3OY3A 4Y8DA 3ZOSA 3LLTA 4CFFA 4RGJA 5F20A 3MDYA 3EZRA 4G3EA 5GIOE 2WMQA 3DT1A 4HGLA 4K0YA 1XH5A 4O0RA 3PIXA 4I24A 5G1XA 3U51A 3HDMA 2I40A 3R63A 4LUDA 1B39A 3M1SA 4LRMA 2WQBA 4O7ZA 3ZUVA 3FHIA 4DEAA 3SD0A 2BKZA 4RIWA 3L9PA 2YIRA 3GC9A 1ZZ2A 4USDA 5DBXA 2I1MA 4YO6A 2C0OA 3B8RA 4GIHA 2C6LA 4M69A 3T9IA 5LXMA 5EI6A 1O6YA 2BUJA 4XV9A 2XJ2A 4ONAA 3DXPA 2Q0NA 3EB0A 4P4CA 2QOHA 4IC7A 3PJ3A 2A27A 4J99A 2ONLA 4XS2A 4W9XA 3NUSA 5JK3A 3C4XA 3H4JA 4O91A 3D94A 2BDWA 1PMNA 2X7FA 4JNWA 3GNIB 2IVVA 2PWLA 1OPLA 3LJ1A 1GIIA 3KQ7A 4RJ8A 1F5QA 3T3UA 4CTBA 1YVJA 2ZDTA 4IADA 1KUTA 2OLCA 4I6BA 4BYIA 4D0XA 2XJ1A 5CVHA 4E6AA 3DKFA 2YCSA 2IZUA 2BAJA 2XK8A 2UZLA 3CPBA 4LOQA 3ELJA 4TRLA 4JAIA 4IVCA 5LCJA 1YXXA 2ITYA 2OXDA 3MI9A 4AGUA 4ALUA 5J9ZA 3ROCA 5EDRA 4ZAUA 1CSNA 3H3CA 4NJDA 2B0QA 2CN5A 4RRVA 2GNFA 2HXLA 3HAVA 4ZS4A 1PXLA 3W2CA 4DINA 4FKVA 1Z57A 3R21A 4FV9A 3FKNA 4QO9A 3PY3A 4HNFA 4QP1A 1E1XA 5AUXA 4F63A 4YJUA 4AOIA 1WVWA 3DKGA 2W06A 4O7SA 5JGAA 3E62A 3R2BA 2C69A 3F7ZA 4RQKA 3R01A 5I9YA 5L2IA 2CGUA 5M55A 4BDBA 4BGHA 2V5QA 3GU8A 4X2GA 5HBJA 3IKAA 4JDJA 1KOAA 1KE9A 3KF7A 2UV2A 3ACKA 1W84A 5I3OA 4EBWA 3NVMB 1PMVA 3DZOA 4TW9A 2HW6A 1BLXA 1Q8WA 4CD0A 1PKDA 3G2FA 3FY2A 2UVXA 2GQGA 3P0MA 4AE6A 4FZFB 4OBQA 1JKTA 3ALNA 4CFNA 2F49A 5HD7A 4D1XA 3SV0A 3ZC5A 3BKBA 1ZOHA 3P7CA 1ZMVA 2GQSA 3DK6A 1J7UA 2R3HA 4J97A 3ZSIA 3UZRA 5CF4A 3SW4A 5AP7A 2X7GA 3RCDA 1P4FA 2WOUA 4J53A 3F2AA 4IVAA 4WIHA 3WZJA 3LQ5A 1G3NA 1SNUA 3QTXA 5FEDA 4IZAA 4S33A 4Y46A 4EOLA 4C58A 4EEVA 2F9GA 4TKSA 2XK6A 4F4PA 4X2NA 5K9IA 3O17A 5CAUA 4UBAA 2QOKA 2VV9A 1PMUA 2B54A 2XRUA 3FC2A 3JVSA 3NIZA 1H0VA 3Q53A 1G8AA 2UZUE 2JKQA 1CTPE 3AOXA 3BGZA 2WU6A 5JT2A 4NM3A 3BI6A 4HVHA 5IEXA 4O0YA 3UO5A 4XG7A 3FJQE 3OCGA 3R1QA 2ACXA 4YSMA 1MUOA 2UVZA 3FBVA 3KCFA 2QHNA 3AT3A 4O38A 3Q6UA 3F5UA 4G3GA 4PY1A 4KAOA 1I44A 2VRXA 4ACGA 5BX0A 2RFSA 2PMLX 3V01A 4BTFA 2C6DA 5I9VA 5IQFA 2C5OA 3FLSA 1YOMA 3KRJA 3EN9A 3UQCA 2XYNA 3KEXA 4BKYA 3COIA 4L52A 4OTIA 3C4EA 2VTTA 3D2KA 3MB7A 4I5CA 3VS7A 4FZ7A 4Y95A 2VWYA 4M7IA 2XNOA 4R3PA 1IASA 1Q8TA 3F5GA 4NM7A 3VS1A 1B6CB 1WCCA 3TZ9A 4ZY6A 4ZTMA 3BLHA 5ETCA 4E1ZA 4D4YA 2PVFA 4WRGA 2RFDA 3I4BA 4F0FA 5JFSA 3W2SA 1JLUE 4Y85A 2X9FA 1WBWA 4C4FA 4DFNA 4YR8A 2HWPA 3NZ0A 3QTWA 1JSVA 4FNXA 4KSPA 5DPVA 5A6NA 2Z02A 2YEXA 4RWKA 3AC2A 2GS6A 3TNHA 4CKRA 4NH1A 4ANNA 3O8UA 2ZV2A 3O50A 3PA4A 3E5AA 3FHRA 4WA9A 3V5JA 4YUQA 4BCIA 2JLDA 5H8BA 4NYEA 4BIDA 2QVSE 1H1WA 4JG7A 1R3CA 3IGGA 3D5UA 3BE2A 3UIMA 2VUWA 5CNNA 4CLIA 4XBRA 2OIQA 2B1PA 3JXWA 2C30A 4E6QA 1H8FA 1WBPA 1YHWA 5HG7A 4RVTA 3R9HA 5FBNC 2WTJA 3UIBA 3CKXA 4YTIA 5KE0A 1NW1A 3NW6A 1LP4A 2JKOA 3CE3A 4YJOA 5CLPA 4WRSA 2PVKA 5AEPA 1VYZA 3QGWA 2OJFE 3MS9A 4RIXA 4YLKA 3PXYA 4ACCA 4D28A 5DNRA 4UMRA 3UMWA 3M11A 2UW8A 4C38A 2JDTA 2PVMA 2QR8A 1XO2B 4H3PA 3R1YA 2H9VA 2R0IA 3F3UA 1ZOEA 3HV5A 5HI2A 4O82A 3DK3A 3ZFXA 4FKJA 2VX3A 2YZLA 4RVLA 4GYIA 3SW7A 4L01A 4PTCA 3TNQB 2XS0A 4RBLA 5M4IA 4FT0A 4DF3A 3DA6A 3GCPA 1IR3A 5B7VA 4IVBA 3EMGA 3Q60A 4C2WA 2X7OA 3MN3A 3H9FA 4PF4A 4RFMA 3PY0A 2ITZA 4AW2A 5IPJA 4DH5A 3F7WA 3PPJA 3AMAA 3FLWA 3OROA 5L4QA 3FMMA 1ATPE 5LMKA 2J6MA 4CGAA 5A6OA 4QMZA 2FUMA 3MH1A 1OPJA 4E5BA 3LCTA 1OI9A 3BGQA 4CT2A 4YZDA 4LRKA 4R8QA 2HZNA 3G90X 2FVDA 4D2RA 2EB2A 2R7BA 3EYGA 3C9WA 3KB7A 3RKBA 3L9LA 4ASXA 5KMIA 3QX2A 3BGPA 4YJQA 3OZ6A 5HG9A 5AUWA 3ZFYA 2JKKA 4BDGA 3QD2B 4AN3A 3MY0A 5IUIA 4WD5A 4USFA 4DT8A 5FLFA 4XYFA 5C01A 4EC8A 3ZM9A 2R3PA 2CCHA 5F4NA 1KV2A 3GFWA 1PXKA 2UZWE 2B7AA 1OL2A 4OW8A 2PK9A 3ORZA 2XK7A 5C27A 5AV3A 4MF0A 4H3BA 3UQGA 5E8SA 3AC4A 3QQHA 3QTQA 2Z7LA 3AD5A 1YXUA 4ZJJA 3SG9A 3HVCA 1REKA 3R7UA 5I4NA 1S9JA 2J4ZA 3I1AA 3SOAA 2Y8OA 3VUKA 1H27A 1V0PA 4BDCA 3DJ5A 3HV4A 4V01A 2F4JA 4X3FC 4AG8A 2PE1A 4DEGA 2VO0A 4BCNA 2WMXA 2YERA 1OIUA 5DIAA 3D9VA 4OTDA 3OD6X 4F7NA 3FMDA 3ZSGA 3VC4A 1H24A 4QQ5A 4QYYA 4KKGA 3OXTA 4X0MA 4MXYA 4CRLA 2OH4A 4CV9A 3D7TA 3QTIA 4CT1A 1OKYA 1WBVA 4G34A 5G6VA 4FYNA 4CRSA 3BHYA 5GNKA 5EI8A 4CKIA 2V7AA 3AGMA 1BKXA 4IB5A 4RQVA 1OKZA 3KXXA 4E26A 3QF9A 3UIXA 5HO7A 5L6OA 2UW6A 4R77A 4XV3A 2C5NA 1UU8A 1K2PA 3QQUA 4XJ0A 3R9DA 4CXAA 2XKCA 2ITNA 2OJ9A 5AV1A 5GJFA 4YZCA 3DQWA 5L3AA 3RPVA 3V8TA 4C3FA 4EQCA 3FMLA 3IONA 4D2TA 5IQCA 3P08A 4IB0A 4TXCA 4BHZA 1X8BA 5CNOA 1K9AA 3QRTA 5EDPA 1L8TA 4I6FA 2OZAB 4I20A 2O0UA 3UJGA 3OUKA 4FV3A 4PPBA 2YM5A 3R22A 3ZHPC 5EYDA 5E8ZA 4W4WA 4H3QA 5DOSA 3VHKA 3BLRA 4YNOA 1GZOA 3BEAA 2CNVA 4S30A 2BTSA 3TN8A 4IFCA 4XV2A 4AS0A 2RGPA 3MVLA 2HXQA 3WI6A 4AAAA 4BCHA 4IX4A 1PXPA 3RK7A 2JC6A 4FIGA 4L9IA 4O86A 3C0HA 2NNWB 4F0IA 3SGCA 1OL7A 2ITXA 5DLSA 5FRIA 1UNLA 3ORNA 3VRZA 4JBQA 4NM5A 4HVGA 5CT0A 4RLKA 3OF0A 3CC6A 2BROA 4BI0A 4GVAA 2O3PA 1VYWA 4QTDA 3R83A 3OW4A 4L3LA 4KB8A 2OWBA 3M42A 3R7OA 1BUHA 4C0TA 2CMWA 5CSXA 4RSSA 3AC1A 4A9TA 4FK6A 4EOPA 1NT2A 3I5NA 3MW1A 3FI2A 3FXWA 3FZOA 5D12A 4ANBA 5IMXA 2IVUA 4FYOA 4RWIA 1YDSE 3S95A 1FVTA 3QFVA 4LMUA 3RM7A 2C3LA 2GPHA 2W0JA 3P7AA 4IIRA 5DE2A 4EOMA 1BL7A 5J9LA 3LFNA 4O81A 3GU5A 5CU3A 3UPXA 4O1PA 4F9CA 3EQRA 4KKHA 3QZIA 2X6EA 5IU2A 5KX8A 1UKHA 3FL5A 2WU7A 4NCTC 2VTQA 2XIKA 3MESA 4HZSA 3BX5A 4PMMA 3EN4A 1OIRA 3AMBA 1YHSA 5J79A 3CD8A 2I6LA 3T9TA 2XK4A 4B8LA 1MQBA 4F7SA 1QPCA 3OS3A 2HYYA 3BU5A 2P2IA 3EQPA 2QURA 3LCDA 3D5VA 3FYJX 3ZCLA 2X4ZA 2XVDA 3FC1X 3LFQA 4FNZA 4DTKA 4V0GB 1OITA 2YITA 4XNEA 3ORTA 2C6TA 5LMBA 3MIAA 1UA2A 2CLQA 3MFRA 4EWQA 4HW7A 2PL0A 1M7NA 3NPCA 1YWRA 3FKLA 1REJA 4AW5A 3O8TA 3HUBA 5EM8A 5LVMA 5AP4A 4V0GA 5FDXA 3OW3A 4L8MA 2OI4X 3UO6A 5IA3A 4YTCA 5E1EA 3C5IA 4XP2A 4AFJA 3R30A 2W05A 3I6WA 5E91A 2IZSA 3UGCA 4P5ZA 3ZDUA 3VW8A 4II5A 3HEGA 5ANJA 3DAEA 2WTVA 1OL5A 4AXAA 5HU3A 5T3QA 3NX8A 3OUNB 2ZJWA 3LM0A 4EOQA 2B9IA 3UYSA 3ZXZA 2I0EA 2VO7A 4FKOA 4TYHA 3P86A 2HWOA 3JVRA 3OMVA 2IVTA 4K18A 4DFLA 2FSMX 5KKRB 2WIHA 3ZXTA 2C5VA 2VWUA 4PNIA 5H9BA 1XH7A 1E9HA 1AGWA 3DKCA 4PNKA 4JVGA 3SVVA 3E87A 3F3ZA 3RP9A 4U3YA 3C13A 3E88A 4U3ZA 4B7TA 2PZYA 3AGLA 3ALOA 3MYGA 3QX4A 4ARKA 4Z3VA 5CEIA 5HTIA 4OTFA 5FDPA 2EXMA 4GW8A 3AMYA 2ZAZA 4YC6A 5AUTA 2EUFB 3WF7A 5CF8A 4UYAA 5K5NA 3LMIA 4P5QA 4RZWA 2BRNA 2FA2A 3EFJA 1KWPA 1YI6A 4LYNA 1PW2A 3Q9WA 3SC1A 3H9RA 2QO7A 3NW5A 4IZ7A 2XBAA 5ETAA 4I4FA 3WILA 4F9AA 3Q96A 4BR3A 3ACJA 3BIZA 2VWXA 3TJCA 4CNHA 4IFGA 3LJ0A 3VS0A 4XG8A 4BI1A 1ZARA 2W4KA 4TY1A 4MNEB 3R8MA 3SG8A 2EVAA 3AD4A 2WXVA 4J96A 4WNOA 4XP3A 4GG7A 2VTHA 1R1WA 4KD1A 3RZBA 1TQPA 3FUPA 4DFBA 4L43A 1Q3DA 4D55A 3ATSA 4ZTNA 3JR1A 3RAWA 4BZNA 3E8NA 2GNIA 4R3RA 2BIKB 4BB4A 5IQBA 2E9NA 2W5HA 4UZHA 2GNGA 3NUNA 4QTAA 4EK8A 3P9JA 5AM7A 4MYGA 1UV5A 3GUBA 4UN0C 4GU6A 2IW8A 5I3RA 2C68A 3QL8A 4MEDA 3JUHA 4O0XA 4Q5EA 3LE6A 3KY2A 4FTLA 3MIYA 2OIDA 4BGQA 3GT8A 2C6IA 2JAVA 4FF8A 5CU2A 2F7EE 3U8WA 3GEQA 4A9UA 4D4VA 2RSVA 3BWFA 1ZYCA 3VBYA 5BMMA 4UB7A 4AWIA 4FZAB 3NIEA 3F88A 2BRMA 5AP1A 3RMFA 4MD9E 5A4LA 3PTGA 4IAYA 4NUSA 4UEUA 3LQ3A 4H39A 3K54A 5KO1A 5JFXA 4A4XA 5TE0A 3N4UA 4KS7A 4YTFA 5M4UA 1FQ1B 4GT4A 2JDRA 3MWUA 2ZOQA 2REIA 3CJGA 3JPVA 3DBEA 3TACA 5HCXA 3DQXA 2XKDA 5A4EA 4C4JA 2R4BA 4K77A 3QQKA 3KRRA 3E63A 4JQEA 1UNHA 4LGDA 4QOXA 4DFZE 4ZTQA 5DHJA 4GVJA 1O9UA 3AC3A 1V0OA 2B9JA 5FXSA 3OVVA 5M09A 3DV3A 1IRKA 2CKQA 2OFVA 3W16A 3BEGA 3ZEPA 1GIHA 4O7NA 4RC3A 3DU8A 1QPDA 1QCFA 2YM6A 3TJDA 4S34A 4FMQA 2BFXA 4XRLA 2GNHA 1OIQA 4YSJA 4RA4A 3UQFA 2E9PA 3VN9A 4RWJA 2WOTA 4EZ5A 3L9NA 3EIDA 4UWCA 5E4HA 3MBLA 3RZFA 4U79A 2XIYA 2LAVA 4D1ZA 3B2TA 3HYHA 4IANA 5AIKA 3GVUA 4U97A 2V22A 1M14A 5ANOA 3F5XA 5IQGA 1OKWA 2A1AB 3GC7A 4I41A 4I21A 3FSKA 5EM6A 2C3JA 4RVMA 5IF1A 4ERWA 3DDPA 3HMNA 2PZRA 4EZ3A 2C5XA 3ITZA 4RT7A 5M44A 5EQEA 3OOGA 3KXNA 4GUEA 2YAKA 4FA2A 4DEHA 4DGMA 3HA8A 2OF4A 3VHEA 3TUCA 3QWKA 3G0FA 3GENA 5KMNA 3MVJA 4WT6A 2XYUA 3I0OA 4Z55A 3M2WA 2V7OA 4BF2A 2F7ZE 4N4SA 5ACBC 4E4NA 4KUJA 2X9EA 4WOVA 3F2NA 2DQ7X 5FTOA 2BAQA 2OW3A 4GK2A 5TF9A 3V5QA 2YABA 2ZV8A 3FLYA 3W18A 4AT3A 5LVNA 5K4IA 4FSTA 2WMSA 3QUDA 2B53A 4JOAA 3CTHA 4R6VA 3SX9A 3MPMA 4FE2A 2ZM4A 3VS2A 2QOFA 5LOHA 3PRIA 4L3JA 4JIKA 4I0RA 2XUUA 4YHFA 4MXXA 1J1BA 3KC3A 4OR5A 4CG8A 4C62A 5AJQA 1UU9A 3RGFA 3EFKA 4DCAA 4PX6A 4XLIA 4CZYB 2VX1A 1BL6A 3NCZA 4D9TA 5HBEA 4XOZA 2R3KA 1QMZA 2F2CB 3HV3A 3FEGA 3RK5A 3ZDIA 1JKKA 4ACDA 3QCSA 3RPRA 2PZ5A 2YCFA 4EJ7A 2WHBA 3ZONA 1LPUA 2GCDA 4O7LA 1O6KA 2G1TA 1FPUA 3E8DA 3NUAA 4QP7A 4APCA 2J0IA 4H36A 5KZ0A 4ID7A 3RI1A 2PE0A 1BMKA 4L6QA 3CIKA 5DRBA 4G6NA 5AUZA 4AGCA 5J5SA 3KGAA 5KBRA 3OFMA 1GAGA 4ZZNA 5BVDA 4GFOA 4KIOA 3EJ1A 2E9VA 3QC9A 1WFCA 5JZJA 4JJRA 2X8EA 3T3VA 3MJ1A 4KIKB 1Q5KA 3KULA 3MTLA 5JQ5A 4RVKA 5C26A 5CU0A 1TQIA 4FODA 4MXOA 4RJ5A 4O0UA 4O6LA 4BCKA 3OG7A 4F09A 4I0SA 2X8IA 3AT4A 4JDIA 2PPQA 5CEPA 3ORMA 3CJFA 4PPCA 5BYZA 1SVGA 3EN5A 4IM3A 4HPTE 4CCUA 1E1VA 2ZYBA 1M7QA 4I0TA 5IA2A 4FG8A 3G51A 4TTHB 3HZTA 4NKSA 4ALWA 4ANLA 1ZAOA 4DFUA 5BVNA 1PRYA 3FZRA 4FV7A 5C1QB 5AR3A 2VTPA 5FD2A 1IAJA 4EH6A 4FL1A 3HA6A 2WFYA 4ZTSA 4AUAA 4CQEA 2W9FB 3KREA 4BTMA 3CGFA 4TNDA 3QBNA 4IH8A 1ZYDA 4JRVA 2BFYA 1U59A 4FNWA 5BVFA 3C7QA 3HL7A 4ANSA 4FVQA 2ITTA 5CX9A 3JY9A 4F9YA 5A4TA 4USEA 4FTMA 2JGZA 3GQLA 1PMEA 4EKLA 1SYKA 5IQAA 3ULIA 4L53A 1JVPP 2WGJA 3FMKA 4HGSA 4MH7A 4NWMA 4IACA 4PRJA 5HNBA 4OTWA 4AOTA 3E7VA 4ZSGA 3GCQA 3TZ7A 4BCJA 5AAGA 2GTMA 3Q5IA 2PMOX 2X2MA 3A2CA 3PXQA 5F95A 3WBLA 3TWJA 2ETRA 4BZOA 1UWHA 2OXXA 3BYMA 3DY7A 3D4QA 5DR2A 5FP5A 3WZUA 4AT5A 3TKIA 4GMYA 1SVHA 4O2ZA 4EH8A 2NRUA 2AYPA 3WF9A 4EORA 4BRXA 3V04A 4NU1A 4BN1A 5EW9A 4NFMA 5KMKA 4GYGA 5M51A 4F08A 3W1FA 2GU8A 3P4KA 4C61A 3QTZA 5HLPA 4G5PA 2UVYA 4Z9LA 3JYAA 3AC8A 4HYIA 4IZYA 1BX6A 3PJCA 4KINA 3IPHA 4KBAA 4O7YA 5E7RA 3GU4A 2XCKA 1DS5A 2UZVA 3FY0A 1IEPA 2GMXA 3ENMA 2A19B 3V6RA 2BRHA 2C6MA 4JBPA 3TKHA 5GHVA 5L2QA 2R3MA 5CXHA 3EQHA 3CS9A 2CNQA 3ORLA 3COHA 5CF6A 4ZOGA 4B6LA 2XZSA 5E92A 2CGWA 4R5YA 4IX6A 1XBAA 2C3KA 1LEWA 5EDQA 2GSFA 4MX9A 3U9CA 4E5WA 5LVPA 1FGIA 5HLWA 5EM5A 5IQHA 4BCMA 2JITA 2FSLX 2YAAA 3NR9A 2CJMA 3OCSA 4BDAA 3R7YA 1DI9A 3FQHA 4DH3A 4PTEA 2XCHA 3LFDA 3ZBXA 3S0OA 3TI1A 1OPKA 3O23A 2WD1A 3PXZA 2R3LA 3F66A 4FSYA 2IW6A 4PL4A 4LGGA 5EYMA 4AQCA 2W7XA 4QP6A 3TIZA 2Z60A 3H0YA 2OO8X 3A7JA 4C3PA 5JGBA 3VBWA 3KK8A 5BUJA 2YM3A 3Q9YA 4GUBA 4FGRA 4XP0A 1A48A 5HICA 4C2VA 2HK5A 3PUPA 4U6RA 3WIKA 4I1ZA 5CALA 1OUYA 2KTYA 4ASDA 3F2RA 5ANIA 1ZYSA 1UNGA 3U6JA 3BELA 1XQZA 3LXPA 3QRKA 3QKLA 2IG7A 2HIWA 3N9XA 2QOLA 3VIDA 4J98A 2JDSA 2W5BA 4CCBA 3BHTA 4Z7HA 3A4OX 1MRUA 2J9MA 5HX8A 3R8PA 2RF9A 2BILB 1DI8A 2OFUA 4EC9A 1Z9XA 3Q3BA 3EL8A 2EU9A 4GV1A 2WEIA 4FVPA 4G5JA 4F1TA 5IDNA 4YHJA 5L6WL 3FE3A 2W1HA 5EH0A 3VQHA 3PSDA 3NNWA 5FTGA 3GGFA 3RM6A 2J51A 2WQOA 4H58A 5HKMA 2VTIA 2OZOA 2CGVA 3VS6A 4F65A 1Y57A 5CANA 5FXRA 1PKGA 2J2IB 4UXLA 1ND4A 4NM0A 4J8MA 1H25A 4F0GA 5CF5A 5HCYA 3GP0A 4L45A 2YIWA 4FEUA 1SVEA 1W82A 2W1CA 1W83A 2V0DA 2YDIA 3MA3A 4R7HA 4RJ6A 2OKRA 4YBKA 3LFCA 2VWZA 3MFSA 4QP2A 4TYJA 3T8OA 3S00A 3WIGA 3U54A 2YJSA 3W2QA 4EYMA 2WPAA 1JBPE 4IAAA 3D5XA 3E93A 3CD3A 4YC8A 2CGXA 3OC1A 3V8SA 3VS5A 4BKZA 3QCQA 3U9NA 3NCGA 5EKOA 1QPJA 3TM0A 4ACHA 4FV8A 4RJ4A 5E8TA 4E3CA 5IMEA 1GJOA 2WMUA 4QMSA 4GEOA 2UW3A 3KRXA 3PSBA 4IVDA 1J3HA 4LMNA 2PVYA 5D10A 4D2SA 4JL9A 3LIJA 5IZFA 2P55A 3QALE 2WMAA 4QPAA 4PP9A 3PE2A 5LMAA 5A54A 4FV4A 5GZAA 4O7RA 2BCJA 3COMA 3I81A 4WNMA 3VRYA 1I09A 3LXNA 3FPMA 3ZFMA 4IX3A 3W33A 1U4DA 5HBHA 3NYVA 3BBWA 3LMGA 3GCUA 4C59A 4ZTHA 5AM6A 4QQJA 4YJSA 3P1AA 3F69A 4YU2A 2IZRA 2BZJA 3UP2A 3QLGA 4DEIA 4AW1A 5FTQA 3SRVB 3F5PA 4Q2AA 3OOMA 4AZEA 3C1XA 2AUHA 1OL6A 5DG5A 5HE0A 4AP7A 4E6DA 4WNKA 2J50A 4XG9A 5AX3A 3WYXA 2I0VA 3OXIA 2NO3A 4OTHA 1CKPA 2E9UA 3G9NA 5B2KA 4BIEA 3U4WA 3HAMA 5HE1A 3RPYA 4I23A 4FTNA 4FIJA 3EL7A 4E4XA 4PWNA 5EHYA 2G15A 5CU4A 4XG4A 4J7BA 4RWLA 4U80A 3EOCA 5IH4A 4ZK5A 3R9RA 2ERKA 4D58A 3TTJA 2QI8A 3HP5A 3PSCA 4XG3A 4C02A 3ZH8A 2ITPA 3QA0A 5HVYA 3BE9A 1JPAA 5CTPA 3RBWA 4FTAA 5KCVA 3TDVA 4AN2A 3GI3A 2GS2A 4C4IA 3ZSHA 4YURA 4QNAA 4XH6A 2ZMCA 4GKHA 2PUIA 4PMSA 4LGHA 1UU7A 3AC5A 4EOSA 4GK4A 4AZTA 4ZXTA 3WE4A 4D2WA 4OGRA 4QMPA 2ONLC 4WKQA 4X2JA 3NRMA 4V05A 3SQQA 4AZSA 2YISA 4ZY5A 5CAOA 4FZDB 2UUEA 4TWPA 2BALA 2BKKA 3B2WA 5JN2A 4QYGA 1FMKA 3BU6A 5AR7A 1CDKA 3W2OA 5DT3A 4TYGA 5L8LA 3G6GA 2OG8A 4G31A 4PV0A 4PUZA 3KMWA 4F7JA 4FL3A 2Z2WA 3BYSA 4DCEA 3KCKA 2J5EA 2DWBA 4O2PA 3IOPA 2V55A 3FAAA 3C4CA 2VO3A 2VU3A 4FG7A 4JI9A 4BHNA 4DT9A 4D1SA 5J1WA 3PZEA 2Q0BA 2G9XA 4FIFA 5EYCA 4HVDA 5A9UA 4DAWA 2O63A 2OIBA 3QCXA 2NP8A 2QO9A 4ITIA 5BMSA 5LWMA 5HNIX 2B4SB 4U81A 2HZIA 4JG8A 4JR7A 3TNIA 1G8SA 3E8EA 2OBJA 2VWBA 4YP8A 3FXZA 4BC6A 2BZHB 2ZMDA 3GCVA 4HYUA 2WTCA 2OICA 3CTJA 3HMPA 4M97A 4BTKA 2WTDA 3DLZA 3NUXA 1H1PA 2W1IA 4O22A 2XP2A 4M12A 4OTPA 5EYKA 4K9YA 3ZO1A 4F64A 4A07A 3QQFA 3HRBA 4QP9A 2PHKA 4AE9A 4BCOA 4BYJA 4BVUA 5DEWA 2GS7A 3DPKA 5CENA 5ANEA 3GQIA 4IC8A 4CSVA 4QQTA 1Q99A 2FB8A 1BI7A 2O5KA 2PVJA 1YI3A 3TIYA 1YWNA 4W4VA 2B55A 3IS5A 5AAFA 4Y5QA 3RJCA 4LUEA 3LFFA 5IEYA 2ZM3A 2V62A 3PG3A 2VTLA 3UTOA 1IAHA 1NXKA 2F2UA 3MSSA 3PPKA 3WF6A 4HVIA 5AUUA 3OBJA 3CLYA 2OZAA 2HW7A 2PE2A 3EH9A 2YLEA 3PVBA 3PVUA 3BHVA 3A8XA 2XJ0A 2VTSA 3CKWA 3UC3A 1BYGA 2VN9A 2W1FA 4UYNA 3V8WA 1IA9A 2RFEA 2J0LA 2PMIA 2HOGA 3V5PA 3G5DA 4IAFA 4WG5A 3REPA 4BTJA 5K4JA 4OAUC 3FDNA 2R3NA 3L8XA 4QD6A 4DEEA 4F6UA 3ORXA 2PVHA 5IA5A 3QKKA 4ENXA 4JAJA 4FG9A 4IE9A 3UPZA 4QYHA 3QZHA 4OT5A 2ERZE 1Y8YA 3QHRA 1URWA 4LL0A 3TG1A 3E7OA 3VUGA 5D1JA 4E5AX 5H2UA 3G0EA 5GINE 4CV8A 4AOJA 4KIPA 4NSTA 3FLNC 4CMOA 1ERKA 5CYIA 5IQEA 1DM2A 4GS6A 2WTKC 4CZUA 1W0XC 3MGYA 4JRNA 1Q8UA 5EI2A 2PUUA 5AV2A 1TKIA 4RJ3A 5JEBA 3PWDA 3QTUA 2BDFA 3KN6A 5FM2A 4C37A 4BCPA 4BDFA 5JZNA 4X6RA 1NVRA 3KMUA 4EHGA 3KXZA 2R2PA 4FUXA 4ANMA 4DGOA 3UC4A 2C0TA 2SRCA 4UWBA 1AQ1A 5HTCA 4EONA 3TDWA 4DH1A 2OGVA 4YLJA 1OBDA 1PXOA 2WKMA 1NVQA 1M2QA 2R3IA 2YDKA 4MWHA 4M68A 3QCYA 3FLQA 3CY3A 3PIZA 4ZMFA 2JIUA 2ITWA 3HX4A 2VWWA 3D0EA 2C47A 1IA8A 3EKNA 3ET7A 3CQWA 4YZNA 5CSHA 3NNVA 4JG6A 2VD5A 5ITAA 3P23A 3RAIA 2UW4A 4I6QA 4IXPA 4MQ1A 3NNXA 5AV0A 5JSMA 4BDKA 5EHLA 3ZBFA 4B99A 3UNJA 5CSWA 4CFWA 4PTGA 4A9YA 4EYJA 4A7CA 4OT6A 1DAWA 1IG1A 4R3CA 5KZIA 4O7TA 4K6ZA 2YIQA 5B2MA 3BYUA 4P7EA 3ZZEA 2ZM1A 4W4YA 4E93A 1OZ1A 4QYEA 4F99A 4FEWA 2AC3A 3R28A 4WBOA 1GNGA 3OT3A 1U5RA 2JDOA 2ITOA 4FOCA 1ZMWA 4FL2A 3LVPA 3PYYA 4GSBA 3DBQA 4NIFB 5F9EA 4ZEGA 3GXLA 3F3TA 4JDKA 3W2RA 2C5YA 2QLQA 3RNYA 4ANOA 4ERKA 4TPTA 1V0BA 3H30A 3TV4A 3GU6A 4WSQA 3I7CA 1YW2A 2QU5A 2IN6A 1EH4A 3QYZA 4PDPA 1YXVA 2QKWB 3IW5A 4ZTLA 3P7BA 4G6OA 3FPQA 3K3IA 4NEUA 2IWIA 4PQNA 4B8MA 5FXQA 1XH9A 3A7FA 1YHVA 5FQDC 5K5XA 2CCIA 4I22A 4U5JA 1YOLA 2FO0A 5ANDA 3TZ8A 4G16A 4FKSA 1OUKA 4G9RA 3H0ZA 4UMQA 3JY0A 3I60A 3NDMA 4DG2E 1PXMA 2EWAA 2ZVAA 3BQRA 3H10A 4H1MA 4LV8A 5DYJA 4MTAA 4OLIA 4XHKB 4JX3A 1GY3A 2LGCA 5D41A 5IH5A 5LMKC 4JQ8A 3ZU7A 3R73A 1WVYA 4JBOA 2DYLA 5F94A 4FSWA 3IDPA 3R6XA 4TWNA 5IQIA 4DGGA 1H07A 3IW6A 4FTOA 4JT3A 2FGIA 3OCTA 4FT5A 3A61A 2R3RA 3QD0A 3DXNA 2JD5A 2VTAA 4JIAA 3Q4CA 4MNEA 5JKGA 5HEZA 2WNTA 1YQJA 4AFEA 2VTOA 5M57A 4NJ3A 4RPVA 4M0ZA 3PWYA 3VBXA 3U55A 3VO3A 4YJNA 3LPBA 4O0SA 4YLLA 4DGNA 3QU0A 3ZO3A 2XIZA 3UG1A 3RALA 5IDPA 3TUBA 3KL8A 1YXSA 4EHZA 5KUPA 4LOOA 4IZ5A 3BWJA 3CBLA 4TNBA 1R0PA 4AGWA 1J1CA 4LL5A 2A2AA 3U87A 3OWPA 5JGDA 2CKOA 3Q5ZA 4FV6A 3F6XA 5HIBA 1FBNA 2W1ZA 4X6QC 3NGAA 4FEQA 1XR1A 3R7GA 5J8IA 3DCVA 2GNLA 2PUPA 1WBNA 2XKEA 1YDRE 4G2FA 3FMNA 4R7IA 4Y72A 3VS3A 4FSMA 4WSYA 1Y8GA 1RDQE 2OK1A 2OF2A 5DH3A 4QMMA 3TCPA 4FKLA 4IB3A 3V3VA 4QTBA 4CQGA 2GQRA 4WUAA 2UZEA 1ZOGA 5TO8A 4E7WA 2W4JA 3KXHA 4NZWB 4YJRA 5IISA 4O0TA 3HGKA 3DNDA 4EK5A 1G5SA 2IZTA 1QL6A 2H8HA 5ANGA 4E4MA 2VAGA 3CPCA 2CKEA 3HDNA 4FTIA 5LWNA 3PVWA 4JXFA 4UALA 2J0MB 4CTCA 2WMTA 4GRBA 4MXAA 2UW7A 5FWKK 5AWMA 3F82A 3BYVA 4WUNA 1CMKE 3Q2MA 4RIOA 4LQMA 5DEYA 5CWZA 1OB3A 4J71A 3C0IA 5LCKA 5HG5A 3COKA 4GT3A 1M52A 3TXOA 1LEZA 4TWCA 4FKPA 3FQEA 4HCUA 4UY9A 3UBDA 3DTWA 3GB2A 3PJ8A 5AP5A 3UNKA 3DAKA 5A14A 3LMHA 4NKAA 4K2RA 4L7SA 2JEDA 2HZ4A 2QONA 4KA3A 4KRDA 5E8VA 3UNZA 4AW0A 4I5PA 4YMJA 5TR6A 4B0GA 3KXGA 1O6LA 2OSCA 4IAKA 3EFWA 3UIUA 1W8CA 1JNKA 5EW8A 4R1VA 2WEVA 4FT3A 2W1GA 4FTRA 4C36A 4C4EA 5LJJA 1WAKA 2VWIA 3LCSA 3FSFA 3PLSA 3ZO2A 2JIIA 5IKWA 1H28A 1KOBA 5HTBA 3BPRA 1W7HA 4IM2A 4W8DA 3KMMA 1FGKA 1Y6BA 2GDOA 2UZNA 4Y73A 3LW0A 3O7LD 4TN6A 2QNJA 5A3XA 3RK9A 4FKQA 3UVQA 5A4QA 4GCJA 3NYXA 3PXFA 4MD8E 5E8UA 3ZLYA 4AX8A 4E73A 3WF5A 4ZSAA 1VEBA 3GU7A 2HENA 4YJTA 4ZLYA 3QXOA 5BPYA 4F1MA 2BHHA 2BVAA 2QO2A 3I7BA 4I94A 3PVGA 4IBMA 5D7AA 3ZRLA 3CY2A 3DFCB 4C4HA 1STCE 2BDJA 4FSNA 2KULA 4X3JA 5CEOA 5CAVA 3C51A 3CEKA 2XNEA 4D0WA 3GOPA 3DBCA 1URCA 4MD7E 4AA5A 5D11A 5K0XA 4FTQA 2RG6A 2HZ0A 3AT2A 1WBOA 3KU2A 5J7HA 4M66A 2C1AA 2Q83A 4PL5A 2XH5A 3MFUA 2VNYA 2BTRA 5L8KA 3IECA 3A99A 1Q8YA 4FGBA 2Y4IC 3C4ZA 4BFMA 4FSQA 5JFVA 1YOJA 4R1YA 4WG4A 4XEYA 3VAPA 3HKOA 5DT4A 4NTSA 5I9UA 2QLUA 4YC3A 3D83A 4HCVA 2CPKE 3QUEA 3EN6A 4ZJVA 2IVSA 2O64A 3QRJA 5DRDA 4WG3A 5CS6A 3EHAA 4BKJA 4TZRA 3PIYA 4FV5A 4DG0E 4XMOA 2UW0A 2Y0AA 4AZWA 2X81A 3BV2A 4ZMEA 2A0CX 4BDIA 3ID6C 3KN5A 2ZDUA 3ORPA 3PLAE 4IJPA 4G3FA 3MH3A 4RIYB 3BZ3A 3ANRA 3ZEWA 4OTRA 2R0UA 3DLSA 4I3ZA 3AQVA 5GJDA 2R7IA 5HQ0A 1OECA 4ANQA 4OBPA 3VUHA 1TVOA 3K2LA 2VWVA 4F70A 3OCBA 3II5A 3DS6A 2GHGA 2R3QA 1P2AA 2OJIA 4RX7A 4GT5A 4UZDA 2YWVA 4FTTA 2R3OA 4KIKA 4NK9A 4Q9SA 2Z7QA 5FGKA 4EBVA 3KRWA 4D2PA 1XH4A 4H1JA 5J7BA 3ZS5A 4E6CA 2WMBA 1WMKA 4FV0A 4AF3A 3EQCA 1S9IA 4AU8A 3MH2A 4IW0A 3W55A 3FZSA 2PVRA 2RKUA 2PULA 2XEYA 4U0IA 2WO6A 3R8VA 2GHLA 2H34A 2Y4PA 4GH2A 2W96B 3OT8A 4I5HA 4K8AA 4EHEA 4EI4A 1RQQA 5AMNA 5AUYA 2YJRA 3ZTXA 3VNTA 2J90A 3E8CA 3SXFA 3NNUA 4MBLA 4RMZA 3VBQA 4L7FA 2PZIA 2XM8A 3QHWA 1OBGA 4U7ZA 4PDYA 3NW7A 3TL8A 1RE8A 2HY0A 5J1VA 5BQ0A 5JQ8A 2B9HA 4L46A 5LVLA 5AR2A 4RIWB 1JWHA 4FKTA 4CMUA 4ALVA 4M69B 1P4OA 5EHOA 1KSWA 3ZMMA 3UDBA 2Y6MA 3CCNA 5HLNA 5AFVA 3IDBA 5EFQA 4DTBA 2O2UA 3PXKA 4ZS0A 3HNGA 3WZDA 4F9WA 3A7GA 2JDVA 2XB7A 4ENYA 3NAXA 3QKMA 4AGDA 1Q4LA 3FI3A 5EKNA 4CZTA 2ESMA 3CP9A 2VX0A 2QQ7A 3NYNA 5CZIA 4OBOA 4D5KA 4S32A 3PA5A 2PU8A 3VUTA 1KE6A 2PYWA 4J52A 4FUYA 4HVSA 3PXRA 3VBVA 5BVKA 4X3FB 1SZMA 4MNFA 4GJ2A 1Z5MA 3LFSA 5KMOA 5IH6A 3OTUA 4J1RA 3DFAA 4E8AA 2ZV7A 2XEZA 4DBXA 3IW4A 1J7IA 4FSZA 5ICPA 2QOIA 2BZKB 3OWKA 4IQ6A 5EQPA 5AIRA 4UMPA 5AR8A 3S1HA 1JQHA 2WTIA 4X3FA 4FT7A 3Q04A 4YO4A 4RJ7A 4D9UA 3V5WA 3QZGA 4CYJA 4H05A 4O21A 1OL1A
chains in the Genus database with same CATH superfamily
2Y6OA 4HPUE 3EQIA 4JBVA 4YNEA 3PJ1A 4EZ7A 3HP2A 3R71A 2P2HA 4N6YA 4V04A 4IJ9A 4XRJA 5E90A 4C7TA 3HUCA 3WARA 4MXZA 3Q6WA 3POOA 4FSRA 3TNPC 4XCUA 5DI1A 2WB8A 3IOKA 3I0QA 4RFZA 3GCSA 5JRQA 3NLBA 3FYKX 2BRGA 5C8KA 4S2ZA 3NMUF 1WVXA 4G9CA 4RFYA 4CEGA 4DGLC 2ZV9A 4I5MA 1V1KA 2UZBA 4PPAA 3V51A 2CN8A 3ZRMA 3DBDA 3BRBA 2YM7A 1OIYA 4ZZOA 2ITVA 5CAQA 3AG9A 2QODA 4XUFA 4YHTA 5LVOA 3FKOA 4C57A 4AZFA 5CQWA 5C03A 5D9HA 5AAEA 4BGGA 4CYIA 1FVRA 4DFYA 4ZP5A 4QP4A 3WZKA 2GFCA 1UVRA 4YZMA 5IA4A 1YKRA 3LKMA 4U40A 4DHFA 1H1QA 2J0JA 4EH5A 3W8LA 3SA0A 1NVSA 3QQJA 3UOHA 5CAPA 4DE4A 3VS4A 4GKIA 2QHMA 3OWLA 4BBEA 4BICA 3I79A 1UU3A 4EL9A 1T46A 4I92A 1WBSA 4L44A 4DDGA 5CI7A 5TT7A 3NWWA 3TEIA 5DA3A 4I6HA 4QMLA 3RHXA 5H3QA 2WTKB 4FV1A 5HE2A 4CFUA 5C8NA 2GTNA 2RIOA 3ERKA 4EH2A 4IM0A 4RC2A 3R7EA 1XBCA 4MKCA 3FZTA 2OJJA 4UV0A 4RA5A 4O83A 1K3AA 3MY5A 3FI8A 5M56A 4FZ6A 3WZEA 3NUPA 5KHXA 4M3QA 2QCSA 3L8VA 3DZQA 5E8WA 4Q9ZA 3C0GA 3QZFA 4Y5HA 2RG5A 3N51A 4LRJA 2YACA 4YJVA 5CT7A 3UOKA 2JAMA 4EOIA 3NUYA 5HX6A 3UO4A 3RNIA 1Q8ZA 4F9BA 1YDTE 4BCFA 3R7VA 4NCTA 2C1BA 3BQCA 4FIIA 2QOCA 4QMUA 4N70A 2E9OA 2C4GA 3L8PA 2R9SA 2B9FA 2Y9QA 4QMTA 3MVHA 3QXPA 1L3RE 3W0PA 2ZB1A 2YLFA 5EOBA 3ORIA 1OVEA 3PJ2A 2YIXA 1PY5A 5FP6A 5IA1A 3QQLA 1AD5A 1XJDA 5C4KA 4Q5HA 3MV5A 1PHKA 3HV6A 4XBUA 1XWSA 2OXYA 2R3JA 5J87A 3H9OA 4RLLA 4EH4A 5DGZA 3R7IA 4DTAA 2I0HA 4JR3A 1U5QA 4QMYA 1ZY5A 1A06A 4MK0A 4R5SA 3LAUA 5HHWA 5D7VA 5AV4A 1HCLA 3SLSA 4TL0A 4BJJB 3U6HA 4X2FA 4FR4A 5CVGA 2PZPA 1GZNA 4U44A 3QQGA 3F61A 4GIIA 1KE7A 2R64A 4RIXB 2BMCA 3QYWA 3BBTB 1H4LA 3MA6A 4G17A 4DBNA 3P78A 4L68A 2XBJA 1YWVA 4MWIA 4O0VA 4G1WA 4IMYA 4J8NA 1VR2A 3Q32A 5DN3A 1SMHA 5HOAA 4GFMA 1J91A 4NW6A 3E64A 2R5TA 1MRYA 4GL9A 3N4VA 3Q4TA 2PUNA 3LOKA 4YGAA 4QQCA 5L6PA 3GC8A 1QPEA 4CKJA 5FEEA 4G3DA 4KRCA 5AP3A 4HOKA 4QNYA 3LHJA 4HCTA 3SRVA 4C3RA 3OHTA 4MHAA 2WQNA 3R8UA 3AKJA 5CXZA 4A9SA 1LR4A 3BLQA 5A4CA 4M15A 5ANKA 2VO6A 1UWJA 3DBFA 5BVOA 5CEQA 4F6SA 5L2WA 5LQFA 3W10A 1VJYA 5CQUA 4LDTA 5E1SA 1ZWSA 4D5HA 4JS8A 4XX9A 3B8QA 5K0KA 3VBTA 5LARA 3O8PA 1APME 4JX7A 4MAOA 4D4RA 2PMNX 4LI5A 4W4XA 1OGUA 5FUTA 2R3FA 3MPAA 1RJBA 1U54B 3CSVA 3W0QA 3UMXA 3ZLWA 3SXRA 3DJ7A 5BV3A 3IK3A 3AD6A 3IQ7A 1F3MC 5L2TA 3THBA 4Y83A 4FKIA 3UOLA 3Q4ZA 5M4FA 3FLZA 5IA0A 4QMXA 2W9ZB 4KSQA 1A9UA 3TT0A 2UZOA 4IWOA 5M06A 4N6ZA 5FM3A 4NL0A 4DH8A 5M07A 4FTCA 4U41A 1U54A 4UMUA 4XG6A 3Q4UA 4U8ZA 3FZ1A 3DB6A 4LFIA 1H1RA 3HECA 4O96A 2BHEA 3SOCA 4U45A 3O71A 3O96A 4X21A 4BCQA 4DH7A 5HGIA 4QT1A 5F1ZA 4BDJA 4PP7A 4UWYA 5DMZA 2WZJA 2WQEA 2Z7RA 3ZM4A 4FTJA 5BNJA 5ETIA 4EKKA 3ANQA 5KHWA 4ZLZA 3WYYA 5K3YA 4BWKA 4EOJA 4IAZA 4E20A 2QG7A 4NT4A 3ZO4A 3EQFA 3PFQA 3SDJA 3DDQA 1MQ4A 3LZBA 3K5VA 4YZBA 2BIYA 5A46A 2EXEA 2VTNA 4EUUA 1J7LA 5BUIA 3PDTA 3ZUTA 3ULZA 1ZY4A 3RTPA 2GNJA 4FTKA 5CY3A 4S31A 3EQBA 4KBKA 4KWPA 5GZ9A 3W8QA 1B38A 3TV7A 4AACA 1U46A 2XA4A 2G2HA 1XH8A 2NYAA 1TQMA 2XNMA 3VUIA 4ZSJA 3S4QA 5BVWA 2J7TA 1OM1A 2JBPA 3PP0A 4O0WA 4BBFA 4M8TA 3NUUA 3D7TB 4XG2A 2F57A 1Q97A 3Q2JA 4ZSLA 2FSOX 3BHUA 4FKWA 4C34A 5BUEA 5HU9A 4EHVA 3E3PA 5AP6A 2XMYA 2PY3A 2R3GA 4O7VA 2W5AA 1FMOE 3IDCA 3RAKA 3GBZA 1YI4A 2YCRA 4UXQA 3PPZA 3ROYA 4P90A 5DR9A 3FQSA 5C8MA 1RW8A 4PDOA 3IW8A 4EK6A 3QRUA 4BWXA 4APPA 2FH9A 2QKRA 3TUDA 4FT9A 3MFTA 4C33A 1PXJA 3LXKA 3BV3A 3OBGA 5HD4A 5EOLA 4LM5A 3ZLSA 3RWPA 4BL1A 4ZY4A 1PXIA 2WTWA 3NYOA 3TZMA 3O0GA 3G33A 5GZ8A 4RZVA 3F3VA 4OTGA 4QMNA 1NY3A 3MB6A 3RCJA 4IWDA 4BDDA 4OAVB 1H01A 5BVEA 5C9CA 4D2VA 5CZHA 4EOOA 3VJOA 3LJ2A 2I7QA 3S3IA 3NAYA 3FXXA 3D15A 4FKGA 2P0CA 3R1NA 5H8GA 2XRWA 4I93A 3R0TA 4LOPA 5HO8A 3DK7A 5CI6A 2QOBA 3TTIA 3CQEA 3ORKA 4HNIA 5DFPA 1M2RA 5AP0A 3NSZA 4HGEA 2FYSA 2UW9A 3DJ6A 3C4FA 1H08A 3BHHA 4NTTA 2CLXA 5HG8A 1H00A 3V5LA 1ZRZA 3RINA 4BZDA 4F1OA 2OJGA 2J5FA 1KV1A 2XIXA 1WZYA 5AA9A 5EG3A 3IO7A 3R8ZA 2C6OA 1BI8A 3A7HA 2RL5A 3FV8A 1Q41A 3G6HA 3C5UA 5HIDA 1GIJA 1ZLTA 3ZYAA 4DN5A 3I6UA 5T6KA 1VZOA 2W99B 4CMTA 2YN8A 4ORKA 3W0RA 3F9NA 4M13A 5KNJA 4FNYA 4FTUA 3O2MA 2A4LA 4O4BB 3DGKA 3Q9ZA 2XAOA 4JLCA 4MF1A 4GFGA 3FZPA 1XHAA 3BCEA 4M67A 5EW3A 4DEDA 2X39A 5I5ZA 1Q61A 1Y91A 3G15A 4D4SA 2QR7A 3HMOA 5EK7A 3U6IA 3FI4A 2DUVA 5AA8A 4FK3A 2CSNA 2C6EA 2HY81 3D7ZA 1PF8A 4EH7A 4EH3A 2J0KA 4BCGA 2Y4IB 1LUFA 3MVMA 5CSPA 2XM9A 4AA4A 5CEMA 2WIPA 3OEFX 2JBOA 3EQDA 2I0YA 1P14A 3OP5A 4BI2A 2IJMA 4MBIA 3GC0A 4Z7GA 4QMWA 2X2LA 4KNBA 4M84A 4QMOA 1ZMUA 1JKLA 3OWJA 1GZKA 2OH0E 3PG1A 4ITJA 3UVPA 4DYMA 1OMWA 3MJ2A 3LFEA 2WQMA 3VF8A 4EK4A 4EUTA 4AA0A 3KKVA 1H1SA 5HVKA 1XBBA 3KF4A 4L67A 4UMTA 1ZZLA 1PJKA 2VZ6A 3LFAA 3ZLXA 4IDVA 2H96A 3FMJA 4O84A 2XK3A 3MH0A 5CVFA 4M0YA 3QA8A 4FOBA 2Z7SA 1GOLA 3VJNA 5L8JA 2PVNA 3KFAA 2BPMA 3ODYX 4DITA 4FI1A 4C8BA 4BDEA 3FMHA 5H8EA 3HMIA 5HESA 3UYTA 2CNUA 4O1OA 4FEVA 5IQDA 3QD3A 3PRFA 3KVWA 4L3PA 2IO6A 3L9MA 4TT7A 4G3CA 5GJGA 4DLIA 3VVHA 1WBTA 3VW6A 2ETMA 1M2PA 3R9OA 3R1SA 3A4PA 3E92A 4GJ3A 5EQYA 1FVVA 1YRPA 1JKSA 3FL4A 4XV1A 3W2PA 4TYHB 2E2BA 3P79A 3PE1A 4MVFA 2UZDA 4NIFA 4RC4A 4X7QA 3GOKA 3R8LA 5I9XA 3K3JA 2WAJA 4HJOA 5L2SA 3SHEA 3VULA 4O27B 3ATTA 4CG9A 1KE8A 2H6DA 1PXNA 4G6LA 1XH6A 2X2KA 4HGTA 5DR6A 4A4LA 4KIQA 2FSTX 3UZTA 4O4DA 4YBJA 3MY1A 2QG5A 3OY1A 4CVAA 4KBCA 2P33A 4QTCA 2JFMA 4TYIA 5E8YA 4A06A 3QRIA 4LV7A 4HYHA 5EM7A 3O51A 4GK3A 4IWQA 4XOYA 3UP7A 3VQUA 3ZUUA 4EJNA 3JS2A 1XKKA 2QD9A 4B4LA 5FEQA 4RG0A 5JRSA 4DDIA 1H0WA 4LG4A 3UVRA 4BY9E 5AUVA 4EQMA 5DT0A 3TKUA 3LCKA 3VUDA 3ZRKA 1JAMA 1HCKA 1W98A 2XNNA 4JQ7A 2BZIB 5CSVA 3P5KA 5AR4A 3UE4A 4MBJA 3QC4A 1MP8A 3L8SA 2X6DA 5HNGA 4N57A 5E9EA 2XIRA 4A4OA 4MXCA 2UZTA 4WO5A 4YPSA 4FIHA 2JFLA 2OU7A 5HIEA 3QGYA 3DTCA 1Y6AA 2W1DA 3R02A 5BYLA 2AC5A 3LM5A 2YDJA 5I0BA 4ACMA 3UOJA 3FMEA 4FIEA 3QLFA 4OTQA 4KS8A 3RWQA 3UDTA 2WMVA 3CQUA 4FSUA 4UX9A 2PTKA 4U43A 3V5TA 4FJVA 4EWHA 3LFBA 4ZTRA 5BYYA 2C0IA 5KMJA 4FEXA 1UKIA 5JH6A 5AX9A 2CDZA 2YFXA 4FX3A 2RFNA 4YZ9A 4QPSA 4EQUA 4RX9A 5J9YA 3C50A 3NVKI 3BLAA 3LCOA 3CR0A 3A8WA 4E4LA 4DEBA 2C6KA 2XNPA 5AADA 3D2IA 3DKOA 4QDVA 2YZAA 5FBOA 1YXTA 2P3GX 3VUMA 5M4CA 4AN9A 5T68A 2G2IA 3AXWA 3R2YA 1JOWB 1ZYLA 3K5UA 4GU9A 5B2LA 4R78A 2GHMA 3A62A 4MCVA 4DA5A 3IW7A 4QMVA 5HCZA 2YA9A 4KABA 3KA0A 3QUPA 2W1EA 3E3BX 3OXZA 3CGOA 3V6SA 2ITQA 3UDSA 4FKUA 3PY1A 4IWPA 4AQKA 1JSTA 2DS1A 3HV7A 3IGOA 1Q62A 4K1BA 2X0GA 4AXDA 4O6EA 5HZNA 1PYEA 2JKMA 3WF8A 2VTMA 3A7IA 4CFXA 4IHPA 5JFWA 2CKPA 3HLLA 5KMLA 4K33A 5ETFA 5IUHA 2QOQA 4PL3A 5CU6A 3EKKA 5HVJA 3U4UA 5M08A 4BBMA 3RAHA 1T45A 3EZVA 4U9AA 5CASA 3QAME 3NEWA 3BU3A 2IPXA 2W17A 3RHKA 2YCQA 4FICA 3KXMA 4JDHA 3WE8A 5HORA 5M53A 3POZA 3MTFA 5CEKA 2XF0A 4PDSA 3O7LB 2YWPA 4F7LA 4QPMA 4EOKA 4KKEA 2BAKA 2ZB0A 1FINA 4QRCA 4ZSEA 5I9WA 3KK9A 3SKCA 4B9DA 2G01A 3W32A 3BYOA 4ZLOA 3CXWA 2HAKA 4DG3E 4FBXA 4K11A 4J95A 2XKFA 4W9WA 5TOZA 2NRYA 4ZJIA 5JMSA 2QOOA 4N0SA 2EXCX 1P5EA 4TWOA 2GFSA 5KBQA 3G9LX 3EWHA 4OUCA 4I4EA 2XK9A 5HO6A 2W4OA 1HOWA 3PP1A 2JIVA 5J95A 4ZIMA 4WHZA 2YHVA 3MPTA 4YPDA 2O65A 2C3IB 3F3WA 5IG1A 2B52A 2VTRA 2WELA 1R39A 2YM8A 4BWPA 4MQ2A 3N4TA 3SAYA 4W8EA 3ZC6A 4ZZMA 1Q24A 3D5WA 4M14A 2ITUA 5GIPE 1OKVA 2Y7JA 1ZXEA 5I9ZA 2O8YA 2G2FA 3RPSA 1DAYA 1H26A 4ASZA 4EH9A 3CTQA 2EB3A 4NFNA 3QTRA 2UW5A 4GG5A 3DB8A 3FWQA 3OTVA 4BDHA 4PMTA 4X2KA 1R78A 2CHLA 4HYSA 1F0QA 4WBBB 2XNBA 3R9NA 2XNGA 3RPOA 4CFMA 3OEZA 4DLJA 4TYEA 4PMPA 2P4IA 2X4FA 4IAIA 3D14A 4RX8A 3EN7A 5E8XA 5IEVA 3ETAA 2QC6A 3QTSA 4AT4A 2BR1A 4L42A 3C4WA 3EYHA 5TKDA 3TV6A 1JSUA 4CFVA 3LLAA 4HZRA 2VGOA 4NW5A 3Q52A 5IUGA 2HELA 4QP8A 2BRBA 1Q3WA 1NA7A 2VGPA 3A60A 3QD4A 4ITHA 3IG7A 4YTHA 5HE3A 5AR5A 3DOGA 4DFXE 5J5TA 3L1SA 3GFEA 5B0XA 3LXLA 5AP2A 4QMQA 3DNEA 3HRFA 3ODZX 3UZPA 1SM2A 4QP3A 4DC2A 4A9RA 4ASEA 3WOWA 3QWJA 2NPQA 2F7XE 3KULB 5DWRA 3DXQA 4QTEA 1GZ8A 2X8DA 2PSQA 3R00A 4LV5A 1KE5A 4RIYA 2IW9A 4C4GA 4FV2A 4Z16A 4AZVA 5FG8A 5ACKA 3SXSA 4QYFA 2YIYA 2WMRA 3EFLA 4C35A 4R7BA 2PVLA 2VNWA 4RX5A 4FKRA 3VF9A 1CKIA 3LQ8A 3R04A 2QU6A 1M17A 2X1NA 4P2KA 3Q9XA 3P5JC 3ZZWA 3RVGA 3I5ZA 2YM4A 4EK3A 2HCKA 3HMMA 3HRCA 3KRLA 4IX5A 3UODA 1PYXA 3PZHA 3UG2A 3NS9A 3ENHA 4IB1A 4U42A 5DVRA 1FOTA 1MRVA 3S2PA 5C4LA 4XLVA 1ZYJA 2VTJA 3TNWA 1SNXA 1CKJA 3EQGA 4L00A 4DHIB 2ETKA 4FVRA 2WMWA 4CLJA 3DAJA 4YJPA 1TZDA 4IEBA 3VWAA 5KKRC 1R0EA 2Z8CA 4F6WA 3KVXA 3PA3A 4BIBA 4O7WA 4FC0A 4IDTA 5KMMA 1CM8A 4WNPA 3OY3A 4Y8DA 3ZOSA 3LLTA 4CFFA 4RGJA 5F20A 3MDYA 3EZRA 4G3EA 5GIOE 2WMQA 3DT1A 4HGLA 4K0YA 1XH5A 4O0RA 3PIXA 4I24A 5G1XA 3U51A 3HDMA 2I40A 3R63A 4LUDA 1B39A 3M1SA 4LRMA 2WQBA 4O7ZA 3ZUVA 3FHIA 4DEAA 3SD0A 2BKZA 4RIWA 3UDZA 3L9PA 2YIRA 3GC9A 1ZZ2A 4USDA 5DBXA 2I1MA 4YO6A 2C0OA 3B8RA 4GIHA 2C6LA 4M69A 3T9IA 5LXMA 5EI6A 1O6YA 2BUJA 4XV9A 2XJ2A 4ONAA 3DXPA 2Q0NA 3EB0A 4P4CA 2QOHA 4IC7A 3PJ3A 2A27A 4J99A 2ONLA 4O4EA 4XS2A 4W9XA 3NUSA 5JK3A 3C4XA 3H4JA 4O91A 3D94A 2BDWA 1PMNA 2X7FA 4JNWA 3GNIB 2IVVA 2PWLA 1OPLA 3O5AA 3LJ1A 1GIIA 3KQ7A 4RJ8A 1F5QA 3T3UA 4CTBA 1YVJA 2ZDTA 4IADA 1KUTA 2OLCA 4I6BA 4BYIA 4D0XA 2XJ1A 5CVHA 4E6AA 3DKFA 2YCSA 2IZUA 2BAJA 2XK8A 2UZLA 3CPBA 4LOQA 3ELJA 4TRLA 4JAIA 4IVCA 5LCJA 1YXXA 2ITYA 2OXDA 3MI9A 4AGUA 4ALUA 5J9ZA 3ROCA 5EDRA 4ZAUA 1CSNA 3H3CA 4NJDA 2B0QA 2CN5A 4RRVA 2GNFA 2HXLA 3HAVA 4ZS4A 1PXLA 3W2CA 4DINA 4FKVA 1Z57A 3R21A 4FV9A 3FKNA 4QO9A 3PY3A 4HNFA 4QP1A 1E1XA 5AUXA 4F63A 4YJUA 4AOIA 1WVWA 3DKGA 2W06A 4O7SA 5JGAA 3E62A 3R2BA 2C69A 3F7ZA 4RQKA 3R01A 5I9YA 5L2IA 2CGUA 5M55A 4BDBA 4BGHA 2V5QA 3GU8A 4X2GA 5HBJA 3IKAA 3BL7A 4JDJA 1KOAA 1KE9A 3KF7A 2UV2A 3ACKA 1W84A 5I3OA 4EBWA 3NVMB 1PMVA 3DZOA 4TW9A 2HW6A 1BLXA 1Q8WA 4CD0A 1PKDA 3G2FA 3FY2A 2UVXA 2GQGA 3P0MA 4AE6A 4FZFB 4OBQA 1JKTA 3ALNA 4CFNA 2F49A 5HD7A 4D1XA 3SV0A 3ZC5A 3BKBA 1ZOHA 3P7CA 1ZMVA 2GQSA 3DK6A 1J7UA 2R3HA 4J97A 3ZSIA 3UZRA 5CF4A 3SW4A 5AP7A 2X7GA 3RCDA 1P4FA 2WOUA 4J53A 3F2AA 4IVAA 4WIHA 3WZJA 3LQ5A 1G3NA 1SNUA 3QTXA 5FEDA 4IZAA 4S33A 4Y46A 4EOLA 4C58A 4EEVA 2F9GA 4TKSA 2XK6A 4F4PA 4X2NA 5K9IA 3O17A 5CAUA 4UBAA 2QOKA 2VV9A 1PMUA 2B54A 2XRUA 3FC2A 3JVSA 3NIZA 1H0VA 3Q53A 1G8AA 2UZUE 2JKQA 1CTPE 3AOXA 3BGZA 2WU6A 5JT2A 2XANA 4NM3A 3BI6A 4HVHA 5IEXA 4O0YA 3UO5A 4XG7A 3FJQE 3OCGA 3R1QA 2ACXA 4YSMA 1MUOA 2UVZA 3FBVA 3KCFA 2QHNA 3AT3A 4O38A 3Q6UA 3F5UA 4G3GA 4PY1A 4KAOA 1I44A 2VRXA 4ACGA 5BX0A 2RFSA 2PMLX 3V01A 4BTFA 2C6DA 5I9VA 5IQFA 2C5OA 3FLSA 1YOMA 3KRJA 3EN9A 3UQCA 2XYNA 3KEXA 4BKYA 3COIA 4L52A 4OTIA 3C4EA 2VTTA 3D2KA 3MB7A 4I5CA 3VS7A 4FZ7A 4Y95A 2VWYA 4M7IA 2XNOA 4R3PA 1IASA 1Q8TA 1ST4A 3F5GA 4NM7A 3VS1A 1B6CB 1WCCA 3TZ9A 4ZY6A 4ZTMA 3BLHA 5ETCA 4E1ZA 4D4YA 2PVFA 4WRGA 2RFDA 3I4BA 4F0FA 5JFSA 3W2SA 1JLUE 4Y85A 2X9FA 1WBWA 4C4FA 4DFNA 4YR8A 2HWPA 3NZ0A 3QTWA 1JSVA 4FNXA 4KSPA 5DPVA 5A6NA 2Z02A 2YEXA 4RWKA 3AC2A 2GS6A 3TNHA 4CKRA 4NH1A 4ANNA 3O8UA 2ZV2A 2IF8A 3O50A 3E5AA 3FHRA 3PA4A 4WA9A 3V5JA 4BCIA 2JLDA 5H8BA 4YUQA 4NYEA 4AAYA 4BIDA 2QVSE 1H1WA 4JG7A 1R3CA 3IGGA 3D5UA 3BE2A 3PUFC 3UIMA 2VUWA 5CNNA 4CLIA 4XBRA 2OIQA 2B1PA 3JXWA 2C30A 4E6QA 1H8FA 1WBPA 1YHWA 5HG7A 4RVTA 3R9HA 5FBNC 2WTJA 3UIBA 3CKXA 4YTIA 4BJJA 5KE0A 1NW1A 3NW6A 1LP4A 2JKOA 3CE3A 4YJOA 5CLPA 4WRSA 2PVKA 5AEPA 1VYZA 3QGWA 2OJFE 3MS9A 4RIXA 4YLKA 3PXYA 4ACCA 4D28A 5DNRA 4UMRA 3UMWA 3M11A 2UW8A 4C38A 2JDTA 2PVMA 2QR8A 1XO2B 4H3PA 3R1YA 2H9VA 2R0IA 3F3UA 1ZOEA 3HV5A 5HI2A 4O82A 3DK3A 3ZFXA 4FKJA 2VX3A 2YZLA 4RVLA 4GYIA 3SW7A 4L01A 4PTCA 3TNQB 2XS0A 4RBLA 5M4IA 4FT0A 4DF3A 3DA6A 3GCPA 1IR3A 4QDEA 4AXEA 5B7VA 4IVBA 3EMGA 3Q60A 4C2WA 2X7OA 4DHJA 3MN3A 3H9FA 4PF4A 4RFMA 3PY0A 2ITZA 4AW2A 5IPJA 4DH5A 3F7WA 3PPJA 3AMAA 3FLWA 3OROA 5L4QA 3FMMA 3W0OA 1ATPE 5LMKA 2J6MA 4CGAA 5A6OA 4QMZA 2FUMA 3MH1A 1OPJA 4E5BA 3LCTA 1OI9A 3BGQA 4CT2A 4YZDA 4LRKA 4R8QA 2HZNA 3G90X 2FVDA 4D2RA 2EB2A 2R7BA 3EYGA 3C9WA 3KB7A 3RKBA 3L9LA 3AKKA 3PFYA 4ASXA 5KMIA 3QX2A 3BGPA 4YJQA 3OZ6A 5HG9A 5AUWA 3ZFYA 2JKKA 4BDGA 3QD2B 4AN3A 3MY0A 5IUIA 4WD5A 4USFA 4DT8A 5FLFA 4XYFA 5C01A 4EC8A 3ZM9A 2R3PA 2CCHA 5F4NA 1KV2A 3GFWA 1PXKA 2UZWE 2B7AA 1OL2A 4OW8A 2PK9A 3ORZA 1W2FA 2XK7A 5AV3A 5C27A 4MF0A 4H3BA 3UQGA 5E8SA 3AC4A 3QQHA 3QTQA 2Z7LA 3AD5A 1YXUA 4ZJJA 3SG9A 3HVCA 1REKA 3R7UA 5I4NA 1S9JA 2J4ZA 3I1AA 3SOAA 2Y8OA 3VUKA 1H27A 1V0PA 4BDCA 3DJ5A 3HV4A 4V01A 2F4JA 4X3FC 4AG8A 2PE1A 4DEGA 2VO0A 4BCNA 2WMXA 2YERA 1OIUA 5DIAA 3D9VA 4OTDA 3OD6X 4F7NA 3FMDA 3ZSGA 3VC4A 1H24A 4QQ5A 4QYYA 4KKGA 3OXTA 4X0MA 4MXYA 4CRLA 2OH4A 4CV9A 3D7TA 3QTIA 4CT1A 1OKYA 1WBVA 4G34A 5G6VA 4FYNA 4CRSA 3BHYA 5GNKA 5EI8A 4CKIA 2V7AA 3AGMA 1BKXA 4IB5A 4RQVA 2XARA 1OKZA 3KXXA 4E26A 3QF9A 3UIXA 5HO7A 5L6OA 2UW6A 4R77A 4XV3A 2C5NA 1UU8A 1K2PA 3QQUA 4XJ0A 3R9DA 4CXAA 2XKCA 2ITNA 2OJ9A 5AV1A 5GJFA 4YZCA 3DQWA 5L3AA 3RPVA 3V8TA 4C3FA 4EQCA 3FMLA 3IONA 4D2TA 5IQCA 3P08A 4IB0A 4TXCA 4BHZA 1X8BA 5CNOA 1K9AA 3QRTA 5EDPA 1L8TA 4I6FA 2OZAB 4I20A 2O0UA 3UJGA 3OUKA 4FV3A 4PPBA 2YM5A 3R22A 3ZHPC 5EYDA 5E8ZA 4W4WA 4H3QA 5DOSA 3VHKA 3BLRA 4YNOA 1GZOA 3BEAA 2CNVA 4S30A 2BTSA 3TN8A 4IFCA 4XV2A 4AS0A 2RGPA 3MVLA 2HXQA 3WI6A 4AAAA 4BCHA 4IX4A 1PXPA 3RK7A 2JC6A 4FIGA 4L9IA 4O86A 3C0HA 2NNWB 4F0IA 3SGCA 1OL7A 2ITXA 5DLSA 5FRIA 1UNLA 3ORNA 3VRZA 4JBQA 4NM5A 4HVGA 5CT0A 4RLKA 3OF0A 3CC6A 2AEGA 2BROA 4BI0A 4GVAA 2O3PA 1VYWA 4QTDA 3R83A 3OW4A 4L3LA 4KB8A 2OWBA 3M42A 3R7OA 1BUHA 4C0TA 2CMWA 5CSXA 4RSSA 3AC1A 4A9TA 4FK6A 4EOPA 1NT2A 3I5NA 3MW1A 3FI2A 3FXWA 3FZOA 5D12A 4ANBA 5IMXA 2IVUA 4FYOA 4RWIA 1YDSE 3S95A 1FVTA 3QFVA 4LMUA 3RM7A 4F78A 2C3LA 2GPHA 2W0JA 3P7AA 4IIRA 5DE2A 4EOMA 1BL7A 5J9LA 3LFNA 4O81A 3GU5A 5CU3A 3UPXA 4O1PA 4F9CA 3EQRA 4KKHA 3QZIA 2X6EA 5IU2A 5KX8A 1UKHA 3FL5A 2WU7A 4NCTC 2VTQA 2XIKA 3MESA 4HZSA 3BX5A 4PMMA 3EN4A 1OIRA 3AMBA 1YHSA 5J79A 3CD8A 2I6LA 3T9TA 2XK4A 4B8LA 1MQBA 4F7SA 1QPCA 3OS3A 2HYYA 3BU5A 2P2IA 3EQPA 2QURA 3LCDA 3D5VA 3FYJX 3ZCLA