2J0IA

Crystal structure of the human p21-activated kinase 4
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
290
structure length
289
Chain Sequence
b'SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE/THREONINE-PROTEIN KINASE PAK 4
publication title Crystal Structure of the Human P21-Activated Kinase 4
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 289
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2j0iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2j0iA01
2HY81 4I4EA 4FT0A 2P4IA 3UBDA 2XP2A 5HBJA 4E4MA 3C5IA 4CFFA 3GCVA 3TKIA 4QPSA 4YJTA 3KVWA 5I3OA 5K9IA 4BBMA 5EI6A 4FOBA 3FQEA 3GFEA 3UZTA 3MPMA 3UZRA 1T46A 4N6ZA 4IFGA 4GKHA 3BEAA 3LXPA 3E7OA 4FX3A 1SVEA 4YGAA 4BL1A 4CG8A 2GHMA 3E3PA 4YTIA 5HTBA 3V5LA 5L2WA 4FEVA 1TVOA 2G2HA 2EUFB 2B52A 5DI1A 3KN6A 3IG7A 5EQYA 4BDIA 1A06A 2YACA 1UNLA 3DXNA 3EKKA 2E9NA 2VTQA 3QHWA 3OXIA 5BNJA 4JL9A 2BHEA 4ID7A 4AE6A 1OVEA 1XQZA 3CE3A 3PUPA 4WBBB 4AZTA 2WMXA 2ZB0A 3QCSA 4FTJA 3TACA 5ITAA 5HBEA 3KREA 3D0EA 4IW0A 2R3JA 5KO1A 2BDJA 5KMJA 4NCTC 4BN1A 4V0GB 3EJ1A 2VTAA 4NKAA 5A4LA 4RIXA 3C4EA 4RX9A 4A4XA 4E20A 1IRKA 4MD9E 4NFNA 5ETAA 1PXMA 3AG9A 4I0SA 4YLLA 4G16A 3VQHA 5DHJA 3U8WA 3O17A 5DN3A 1M52A 5HE1A 1T45A 1XH4A 4KRCA 4WNPA 5AWMA 5GZAA 5L3AA 2GFSA 1LEWA 4IJPA 3ZFYA 3R00A 4F4PA 3P7CA 4PDSA 1XKKA 2UZEA 1OL2A 2I0VA 3MB7A 3U6JA 3FLYA 2PVHA 4ZS4A 4O0RA 1WFCA 2CDZA 1M7NA 2EXCX 3ITZA 4YO6A 4BZDA 5CXZA 4FNXA 5IDPA 5CVHA 3AMBA 2WMSA 1YHSA 3MWUA 5E7RA 4OT5A 3ALOA 1JSUA 4DLIA 3ZZEA 4QNYA 1P14A 2HXLA 1QMZA 2ITZA 3QA0A 2PTKA 4CQGA 3RNYA 5AP2A 3RI1A 4U3YA 5AJQA 2UZDA 5F20A 3R9DA 3ZLYA 4DFYA 1H01A 5LQFA 5C4LA 5A3XA 1NVQA 3COKA 3QD4A 5A4EA 5AV3A 2CJMA 4NSTA 3G90X 4O81A 4YNOA 3ENHA 3HA8A 1L8TA 4AOJA 3RALA 3PG1A 1U4DA 4WUNA 3UO5A 3L8VA 3HRFA 3O96A 2XNNA 4JQ8A 4YC6A 5E8UA 3SXSA 3ULIA 4LUEA 1UVRA 3FI8A 3OCSA 4OBQA 4ZJIA 5AX3A 4IAYA 3ZM4A 1QPJA 3B2TA 3R7IA 3FPQA 1X8BA 4J97A 3I81A 4IE9A 1H0VA 3E3BX 1S9JA 2BIKB 2C3KA 2UZUE 2UZVA 3F3UA 5L8LA 2X6DA 3C1XA 2Q0NA 4TL0A 2F4JA 3NSZA 4FIGA 4I92A 4FSWA 3Q5ZA 2QI8A 3P7AA 2J4ZA 2DQ7X 2UW6A 1OUKA 4HW7A 5JMSA 4MTAA 4P7EA 2YAAA 4AXAA 3BEGA 3BYVA 4ZXTA 5J95A 3RHXA 3BYUA 3RK7A 2UW9A 4ENXA 2HOGA 2RFNA 3OY1A 5LVOA 3EFJA 2JD5A 2JKOA 3CTJA 3OFMA 4GEOA 1WBTA 3UNKA 3I0QA 3ATSA 3EYHA 1U59A 3W2OA 4TPTA 1PXLA 3ZO3A 4CFVA 5DR9A 2VTRA 1NVSA 5ANJA 4D4YA 5M07A 1M7QA 1E1VA 3ERKA 5I9VA 4EWQA 1F0QA 2J0LA 3QFVA 5BMMA 1KE7A 3DK6A 5GNKA 3RPOA 3Q2JA 2IN6A 4I23A 4NCTA 4U42A 5CS6A 5DRBA 5LXMA 4C4HA 4O7VA 5EH0A 4O7NA 4UWYA 4FEWA 3D14A 3QTWA 4DEHA 1OGUA 2CGXA 5GZ9A 3NUSA 5EOBA 3EQHA 4LUDA 3LXLA 4C61A 3R02A 4DG3E 3AGMA 2GNIA 2IVTA 4L9IA 4YPSA 2UVZA 3VS1A 3HNGA 1LP4A 2GDOA 4U8ZA 2QG7A 1OKYA 5IISA 1SNUA 4OTPA 5IA0A 4G5PA 5D7VA 4AE9A 3MSSA 5IQAA 1MRUA 3A4OX 5HCXA 5H9BA 5LWNA 2OZAB 4NW6A 4X2JA 1P5EA 2WQNA 3R1YA 4RVKA 2BPMA 5A6NA 5HU9A 3KQ7A 5CU0A 3EKNA 4FR4A 4FZ6A 3FLNC 5KMOA 3F5XA 5BVKA 2CGUA 2R3LA 2VAGA 4RRVA 5M08A 4X6RA 4FKOA 2JKKA 2Y4IC 3GOPA 4JR3A 5FM2A 4BDAA 1LPUA 2XKEA 3DNEA 3GC9A 4PTEA 1VZOA 3F7ZA 3MPTA 2CKEA 2VX3A 1OB3A 3ZMMA 4R7IA 2WMQA 1YXTA 4YBKA 3KGAA 3PJ1A 3WF5A 5L2TA 3SGCA 3PTGA 4QYGA 2X9FA 4L52A 3RPVA 3REPA 1U54A 4RVLA 5J9ZA 2QU5A 2E9UA 2F2UA 5IG1A 4BC6A 1PMUA 5DR2A 4HCTA 4AF3A 4ASXA 5E90A 4NW5A 2W17A 2E9PA 3ZDUA 3JUHA 3KULA 4Z3VA 4ZOGA 2RGPA 4ZY6A 2YFXA 4U97A 2RG6A 4PTCA 3PXZA 2P55A 4E1ZA 3QU0A 3F5UA 3PFQA 5HLNA 3QTZA 2WD1A 5AM6A 3KULB 4RSSA 3O8UA 5FBNC 2BRNA 1YDTE 3N9XA 4CRLA 1OITA 1MRYA 3A7IA 3QTXA 3JS2A 2VWIA 1XH6A 1EH4A 3PIXA 2J0IA 2WKMA 3RM7A 3HV4A 4D5KA 3D7TA 3ZLXA 1F3MC 3E92A 1SNXA 2P3GX 5FRIA 4ARKA 4J95A 4D28A 2WB8A 3GQLA 2QG5A 4EK5A 2YISA 2OGVA 2YLFA 2R3OA 3B8RA 5CI6A 1P4OA 2EB2A 2G1TA 3I6UA 3O8TA 2UV2A 3D7TB 4O0SA 3VBYA 1ZYLA 4UMRA 1I44A 3G0FA 4DN5A 3IPHA 1TQPA 4J71A 4RZWA 5HE2A 3A7GA 4FOCA 1H1SA 3MBLA 4HCVA 3HAMA 2V62A 3HMIA 2J51A 1TQMA 4GJ3A 2J2IB 4PL3A 5CVFA 2OF4A 2GFCA 2ZV2A 3F66A 2B4SB 4MK0A 4XRJA 3G33A 3TV7A 2XRUA 1OZ1A 5TT7A 3ZBXA 4OTHA 5CSWA 1FINA 2VTPA 3FPMA 4DYMA 2RF9A 4S32A 4ZIMA 5AP6A 5CSXA 3RP9A 4FG9A 4IVCA 2BHHA 3G9NA 4MXYA 3I60A 2WIHA 3NNUA 4BTJA 3BLHA 4GYGA 3TNWA 2R4BA 3HLLA 5A9UA 3M11A 3DTCA 1BX6A 4WD5A 2Y6OA 3D2IA 4L45A 4MBLA 2YDKA 2WZJA 3ZXTA 3NYNA 2BDFA 3FMKA 3CY2A 4FKQA 2O3PA 3SHEA 2H96A 5CF4A 3O7LB 3IGGA 5D12A 3A61A 3DDQA 4GCJA 4RJ4A 1GIJA 2H9VA 3KCFA 4OTQA 4UMQA 2R7BA 4CG9A 1V1KA 2XKDA 4FTOA 3TKHA 5HD7A 3WYXA 2H8HA 4YTHA 3VRZA 3QWKA 4BDCA 3BHTA 1NA7A 4YTCA 2Y4IB 4R5YA 3GNIB 3TNQB 3W32A 1SVHA 1OPLA 2BAJA 4BYIA 4OW8A 4HYHA 4M69B 5CENA 4OR5A 2GNJA 5AV1A 5CAQA 5A4CA 4N0SA 3FXZA 1R1WA 4TWPA 3G15A 3IS5A 1PMVA 2C69A 5FTOA 3MN3A 2HW6A 2OKRA 3DGKA 1O9UA 1IASA 1JSTA 4FZDB 2C5VA 1R0PA 1MP8A 3F9NA 3ODZX 3P0MA 4UYNA 4IX4A 5EM6A 2PU8A 3E8DA 4Y5QA 4F0GA 1KV2A 3V5JA 1PXOA 4C59A 4E26A 5L6OA 4PRJA 3NVKI 4I41A 4N4SA 1ZYDA 4BICA 5I4NA 5HVKA 4F6UA 1UKHA 4GW8A 5BX0A 5HI2A 4Z7HA 1H1PA 2VX0A 4RMZA 4R3CA 5I5ZA 3PY0A 3R04A 4GU9A 3LCTA 4QMQA 5JGDA 2C6KA 3QKMA 3Q3BA 4MYGA 2UVXA 4NT4A 2EXEA 4C3PA 2WOUA 3RAWA 2ACXA 3ACKA 4J52A 3CSVA 3I4BA 4X3FC 1VJYA 3KK8A 4BDBA 3OCTA 1B38A 2R7IA 3LFCA 3GCSA 2Y0AA 3K3JA 3PVWA 1W8CA 4IVAA 1PXNA 2WTCA 3Q52A 3QD3A 3AT3A 3PWDA 5J9LA 3BWFA 1J91A 4J7BA 3MH1A 3UOHA 4J53A 5EW3A 3GC0A 4HVHA 3R1NA 3LJ1A 4IDTA 2WMTA 4ZAUA 2CCHA 3LXKA 5EQPA 3A8XA 4I93A 1W7HA 4O2ZA 1J1CA 3FI3A 4RC2A 3U4UA 5GHVA 2GQRA 3RTPA 3H4JA 3FUPA 1CKIA 3QRTA 4IAAA 4JQEA 4EC8A 2CPKE 2R3KA 3FMJA 2QODA 3M1SA 4FVQA 4LFIA 3WBLA 4I6FA 4YC3A 4E5BA 3DCVA 5I9YA 3VF8A 4QYHA 4PUZA 2BILB 4OT6A 2X0GA 3I7CA 4L46A 3BE9A 1OPKA 3ZO1A 3GQIA 4L67A 4AS0A 4BDFA 5I9WA 3KB7A 4HVGA 5FTGA 3P4KA 3TUBA 1ZYJA 3BQCA 5FXSA 1FVRA 2HY0A 3SRVA 4TNBA 5C1QB 3QF9A 1YHVA 4ZY5A 2H6DA 2IZTA 4BCKA 1AGWA 4QTBA 4TYHB 2PSQA 3DK7A 4FTRA 4M15A 5E8XA 5KE0A 4ANSA 4DINA 5D9HA 4ZSAA 2XIRA 4FKWA 4RQVA 3QZFA 3R7VA 3UJGA 3TUDA 3F5PA 4RWJA 4WKQA 3R2YA 2VTJA 2XM8A 4QMYA 5DEWA 2QO2A 4H1MA 4JOAA 3VBXA 2ETMA 3AQVA 3DKGA 3MVLA 4IACA 5C8KA 4F9YA 4AZEA 4FTTA 3KXMA 4K8AA 4Q9ZA 4RVTA 5IQDA 3H10A 3C0IA 2JAMA 2SRCA 1WAKA 4KKGA 4CFWA 3DFAA 4C37A 4Z16A 4OBOA 1Q8YA 4D1ZA 2PPQA 3E7VA 3CEKA 2RFEA 1KOBA 2A1AB 3AC2A 2C30A 3NIEA 4FYOA 4YJPA 2C47A 5DVRA 3QCQA 5EM8A 3PVGA 4I0TA 5HG8A 1J7IA 3AD4A 4UN0C 3UOLA 3ZC5A 3BHVA 3QZHA 5HNGA 4TWCA 5CEMA 4EQUA 5CF8A 3NZ0A 3TL8A 4HOKA 4O0VA 4J99A 4WIHA 3CR0A 4A7CA 2O8YA 2XKCA 2ERKA 2PUUA 2YCRA 3DLSA 4FKIA 4E7WA 3V8TA 4NH1A 3VNTA 3TG1A 4JG7A 4X3FA 2Z7RA 2XIYA 2ERZE 4L3LA 4U80A 2CLXA 3QL8A 1BUHA 4EBVA 4HVIA 5HX6A 4ZMEA 3E88A 5JKGA 3EYGA 4AWIA 4WBOA 1UWHA 2YIXA 3NW5A 4RX8A 5HESA 5LCJA 3PA4A 5BYYA 5JT2A 1V0PA 4GSBA 3MESA 4Y46A 2BZJA 4RLKA 4X3FB 1ZY4A 1RE8A 4QMOA 1CDKA 3DZOA 4JRVA 5L4QA 5J87A 3II5A 4J1RA 3ZEWA 2EVAA 2B0QA 4CMOA 2KULA 3QD2B 3MVJA 4KIPA 3FY0A 3RMFA 4NJDA 3GENA 4JXFA 5E92A 4JR7A 4F0FA 2ESMA 5FWKK 4X7QA 4JS8A 4I21A 4GV1A 5H8EA 2PVLA 4FIJA 5E8ZA 3LMIA 3B8QA 4JDKA 3VS3A 4WSYA 5HHWA 1VEBA 3W55A 4PNKA 4JVGA 2A19B 5HE0A 5KMMA 5KMLA 4C0TA 1J7UA 3LLAA 3QKKA 1XHAA 2I40A 3O7LD 3UVPA 4FTQA 4I6HA 5EFQA 4E5WA 3F5GA 1OL7A 3LFDA 4YZMA 5C26A 4XV3A 3DBCA 3F7WA 4RX7A 3GU6A 2R0UA 3HX4A 4HNFA 3OF0A 4G6LA 5FD2A 3R73A 3ZM9A 4LI5A 1H08A 3MY1A 4DCEA 3OS3A 3IQ7A 3RK9A 4AT3A 5AUWA 2IPXA 3R30A 3HMOA 5FP5A 2X7OA 2YIRA 3ALNA 4UMUA 2NNWB 3C5UA 4F64A 4LYNA 2Z7SA 4FZFB 4FA2A 5AUZA 4H36A 2OZOA 4MXZA 4ZTHA 5JSMA 4I94A 4RQKA 4GUEA 2OW3A 4E4XA 3KEXA 2ZM3A 5KX8A 3UPZA 2C6OA 3C4ZA 3GCQA 3O23A 3DY7A 4KABA 4LOPA 5E9EA 1OBDA 2OK1A 5EI8A 2J0KA 3QHRA 2RL5A 2P0CA 5HTCA 3HMNA 5DR6A 4ALUA 1MQBA 3SD0A 2J90A 2RFSA 3FMMA 4M66A 4U44A 4DTAA 4FSMA 2QLQA 1BI7A 1YWRA 3OBJA 4MBIA 3LMGA 5HCYA 2XK9A 4Y83A 1JPAA 4BB4A 4RJ7A 5CF5A 5HGIA 3G6HA 5AIKA 4MWIA 3PP1A 3BGZA 2CSNA 4CCBA 1BL7A 3DJ6A 2YCSA 3MV5A 2GNHA 2WMUA 4YJRA 4EQMA 5EW9A 4TNDA 5FEDA 3F2NA 1KV1A 1J7LA 4RJ6A 3R22A 4IZAA 1Z9XA 4XV1A 2WMBA 2XZSA 5L2QA 3V01A 3OUNB 4WNMA 4O86A 3S4QA 3WZUA 2JDRA 3R9NA 2WGJA 4XV2A 3R7OA 4NU1A 5BUEA 1ZMWA 4FK3A 2X2LA 4UXLA 3FKNA 5CTPA 1ZY5A 4ANMA 2J9MA 3OXZA 2W9FB 2PE1A 2ZDTA 3JYAA 3OWKA 4KIQA 4TYJA 3BGQA 3ZCLA 2PHKA 4F70A 4MNEA 3IECA 3GT8A 4OTGA 1GIHA 1UU7A 4FF8A 5C9CA 4D4RA 2W7XA 3F3TA 4BBEA 2JAVA 4XG6A 3JPVA 4FMQA 5C8MA 4WOVA 3QYZA 4YBJA 5F4NA 3BQRA 5JFWA 3PPKA 4C8BA 3WZKA 3FQSA 4E3CA 2ITXA 2A0CX 4EH2A 3DJ5A 2WELA 4JG6A 3ZFMA 2R0IA 3A2CA 4QTCA 5IH5A 4FT7A 2W99B 1VYWA 5TOZA 3MJ2A 3PIZA 4MAOA 5M44A 1BMKA 5ANDA 4D9UA 3UGCA 4YZBA 2FGIA 3KFAA 4O27B 3UG1A 4CTBA 2YM8A 5KNJA 2QR7A 2VTNA 2WMAA 3HDMA 4UBAA 1W0XC 3NS9A 3SW4A 3MVMA 1CTPE 3QUEA 4AN2A 3KXZA 4YURA 3NW6A 4U7ZA 3CKWA 1OL6A 2Y8OA 3DB8A 4P4CA 2HWOA 3BU3A 3HMPA 3OMVA 4GVJA 4XG9A 3RVGA 3SV0A 1IR3A 4QP7A 4R5SA 5EKOA 2VTTA 2YWPA 4EYMA 3TM0A 1IAHA 4QMUA 3R8PA 4TYGA 1OPJA 1XH5A 3UP7A 3WILA 3U55A 2JKQA 3ORZA 3QRIA 4QMZA 3KA0A 1UU9A 3GU7A 3Q5IA 4IB5A 5CZIA 5A6OA 2J7TA 4AT5A 3VQUA 4AACA 5FEQA 5F1ZA 3H0ZA 3WF8A 3Q4CA 4AGUA 3R63A 4LOOA 2A27A 2BR1A 4GU6A 4P2KA 5HTIA 4W8EA 4USEA 2W1GA 3U6IA 3FMEA 2Z02A 4TWNA 3QC4A 2BRBA 2QNJA 4KIOA 4X3JA 5TO8A 4QO9A 5B0XA 3QCXA 5T68A 3VJOA 3QQLA 3ZRMA 3UMWA 5I9XA 3QRJA 3FEGA 1OKVA 3QTUA 4IM0A 3QUPA 4F99A 2XNEA 4R6VA 2OH0E 4YHFA 4EH9A 1M2QA 2HZ0A 2OJFE 2W1DA 5J9YA 2R5TA 3DJ7A 3MW1A 3E8EA 2ZOQA 2RG5A 2R3PA 4GVAA 3FY2A 2VTOA 1FBNA 4QYFA 2PZ5A 4FTCA 5CNNA 4FVPA 4HYSA 1B6CB 2V7AA 4DG2E 3EWHA 2J0JA 4XG3A 2VTMA 4LQMA 4E93A 1UU3A 3TEIA 2XRWA 4U0IA 3GOKA 2O5KA 3NW7A 3TTIA 3S3IA 2R3FA 2XNGA 4USFA 5K0XA 5ANEA 3RWPA 4PPAA 5EQEA 1XBBA 4IWQA 1UV5A 3R8LA 4EH4A 3A7FA 3U9CA 3LKMA 1Y6BA 3FKLA 3BYMA 3SQQA 3VO3A 3E63A 4C36A 1OKWA 2ITUA 4LGHA 2VTLA 3FWQA 2GSFA 4QP8A 4FNZA 4IJ9A 3NNVA 3FMLA 3MS9A 4YHTA 4XMOA 2J50A 2WU6A 1KWPA 3WYYA 4DFNA 4O6EA 3D4QA 5AP5A 3T3VA 4HYUA 2IZRA 1ZZ2A 1WBPA 2CKQA 3FLZA 1FMOE 4FSNA 3PLAE 4AN9A 2X8IA 1KOAA 5AP7A 5AA9A 5K4JA 3A60A 3FQHA 5KKRB 1M2PA 3IDCA 4XRLA 4F6WA 2UW7A 1IA8A 3PG3A 4Y72A 1SZMA 4YU2A 2F49A 4C4FA 2F57A 3KXNA 4JAJA 3VWAA 3W10A 4BI2A 2YDIA 3QXPA 3NGAA 2NPQA 3ORKA 3ZH8A 2XK3A 3L8PA 4E73A 3C9WA 4UXQA 3VS2A 5EYDA 2BAKA 2C1BA 2YWVA 5BVWA 5KHWA 3H0YA 3KCKA 4RIXB 4U5JA 5HOAA 3Q53A 3FC2A 4BCMA 4C4GA 2VD5A 4BVUA 3FI2A 4FI1A 4IANA 3ZSIA 5JGBA 2CNUA 4B4LA 3UE4A 2WTWA 3U51A 3ULZA 3VUKA 4NTTA 3VBQA 4ANLA 3HV3A 2ZM4A 4XOZA 3OT8A 3JR1A 2X8DA 2HZIA 3DNDA 4K6ZA 4LRKA 3VS4A 5IEXA 4BCJA 4RFZA 3I5ZA 4TZRA 3TNHA 3TXOA 4EOOA 2J6MA 4RIOA 1GAGA 1K3AA 3BWJA 5HIDA 3LQ5A 4B0GA 4BRXA 3CY3A 4O22A 2QHNA 4F7LA 3ZDIA 3AOXA 1Q61A 2HCKA 4O0YA 1O6YA 4QPMA 3OOMA 4AZSA 2BRGA 2XBAA 4QMXA 2WFYA 1WMKA 4D0XA 5M57A 5CF6A 4O7SA 5BQ0A 4J8MA 4PL5A 3RKBA 1PY5A 4WNOA 1AQ1A 1GOLA 5EOLA 4ZTMA 1W82A 2JITA 2QONA 4D55A 4QP4A 3AT4A 4ANQA 4UZHA 2UZWE 2YM3A 2OG8A 4KBAA 3L9PA 3PE1A 3RCJA 5GIOE 2WTVA 3QX4A 4FUXA 1ZLTA 4AZVA 4G9RA 5LMBA 4NM5A 3VBTA 3PDTA 4F1TA 2W1IA 2FYSA 1LR4A 5AFVA 2IG7A 2BTSA 2Z2WA 1JLUE 1ZMUA 3KRXA 4LMUA 1H1WA 2UZTA 3SC1A 5JGAA 4MHAA 2PK9A 2XF0A 4L00A 5IKWA 4H1JA 1E1XA 2ONLC 1H27A 1K9AA 1JBPE 1Q62A 3A4PA 3QQJA 4YJQA 5F95A 4DFBA 3NPCA 5DPVA 3ORLA 2I0YA 4FGRA 2XJ2A 2IVSA 3ROCA 4U9AA 4X2NA 2PVMA 3UNJA 4L3JA 1DM2A 4AQCA 5LARA 5EDPA 4GFMA 4AFEA 1UU8A 5AV0A 3R1SA 5A46A 4G6OA 4OBPA 3JVSA 3TT0A 1Q4LA 4CXAA 2J5FA 4IX5A 3POZA 2UW3A 3LW0A 2BROA 3MY0A 2W4OA 5ACKA 3BKBA 3QTSA 4ZSLA 5M55A 4DLJA 2HENA 2PE0A 2WQMA 4V04A 4XV9A 2J0MB 3SG9A 3TIYA 2Y9QA 3QQHA 3HRCA 3BIZA 5JFSA 4CYIA 4KBKA 3KRJA 1W84A 2ZV9A 5BVNA 2RKUA 2AC3A 2JFMA 3FKOA 3DBFA 3PE2A 4WT6A 3RAIA 5E8WA 3GGFA 3B2WA 5HX8A 4IMYA 3DBQA 4DT8A 3FL5A 4GJ2A 3BU6A 2CGWA 3VUHA 5FUTA 4FV0A 2O65A 2ITNA 2VWUA 4QMWA 2VGOA 2FVDA 4AP7A 4EL9A 4F9BA 5BVDA 4QTEA 1OECA 3MFRA 3V5QA 2C5YA 3DK3A 4YZDA 4EOPA 3LFAA 3SA0A 2X9EA 4GUBA 4FV1A 3KC3A 2B1PA 3QX2A 4DTKA 2R3HA 2Z7QA 4NKSA 3VUTA 4M84A 3E5AA 4TWOA 3W16A 5IQFA 2WO6A 3CKXA 2YHVA 5EDRA 2R3QA 3PZHA 1GZ8A 5AR3A 3DB6A 5ANIA 3NUXA 3OWPA 4IB0A 3IW8A 4ANOA 4FKLA 4D1XA 4TRLA 2XJ0A 4L01A 2BKZA 4QT1A 2W5AA 1LUFA 4K11A 4C35A 1WBSA 2OWBA 5E8SA 3F6XA 2VWXA 1BI8A 3Q9YA 5HBHA 3TI1A 2VTHA 1OL1A 1U54B 3CS9A 3RNIA 4FNYA 1R0EA 4QMPA 4DGNA 4BY9E 1Z5MA 2UZOA 3FSFA 1RJBA 2QR8A 5AIRA 2X39A 1Q8WA 4AW0A 4EQCA 4OTRA 4A9TA 4ZY4A 5H8GA 4ZSEA 4UV0A 3ZRLA 2E2BA 4H05A 2XNMA 4NEUA 2C0OA 3OD6X 3EQGA 3AC8A 4ZLOA 3GUBA 2OU7A 1ZAOA 1BKXA 2XA4A 3ZLWA 1KE9A 4FIHA 4EOLA 5DMZA 3VF9A 2ITWA 3FYJX 4DGGA 5B2KA 1JKKA 4L43A 2ITVA 2XK4A 3PJ8A 3VS6A 2QVSE 3OOGA 4LV5A 4M97A 5EHOA 5LVMA 2V5QA 3IOPA 3R0TA 5DOSA 2YIWA 2ONLA 3FMDA 5KCVA 2WMRA 4I5CA 5HVJA 5J7HA 5AAEA 2QQ7A 3HZTA 1Q8TA 4R7HA 1OIUA 4WRGA 1Y57A 5L6PA 4H3BA 2C5XA 3OUKA 3NAXA 2DWBA 4HCUA 4BCQA 4EORA 5IH6A 2FA2A 4A9YA 3NRMA 5AR2A 3RPSA 5K0KA 4E6DA 1WBNA 1FPUA 4BBFA 3QALE 4KBCA 3UVQA 5M09A 4AW2A 3F2RA 2NRUA 4ACMA 4EH3A 2CHLA 4ERWA 5H2UA 2YN8A 3WARA 4E4NA 3VW8A 3AMYA 4FSTA 5DBXA 2HZNA 2PVRA 4IXPA 3BX5A 4O6LA 3ZUVA 2W9ZB 1IA9A 1OMWA 4JDHA 3U87A 3FZPA 4A9RA 3VC4A 2JDOA 3HV5A 1YDSE 5HQ0A 3AD5A 3EN6A 3LLTA 4K33A 4ACCA 4S33A 3UC4A 4GFOA 2VO0A 4BDKA 4FSZA 5KBRA 3POOA 3CBLA 4FEUA 4XS2A 3ORPA 3ZSHA 2XCKA 3Q96A 2O64A 3K5VA 4HGLA 3PXFA 2DUVA 4MH7A 4ORKA 2W05A 4NK9A 2G01A 2GPHA 1R3CA 5JH6A 3OVVA 2FO0A 2WEIA 3I7BA 4GK3A 4CZTA 3COMA 4FTLA 4BI1A 3NLBA 3MH2A 5TF9A 4DAWA 2GQSA 3BV2A 4QTDA 5DIAA 3UTOA 4C57A 3VBVA 1PF8A 4QPAA 4HGSA 1YOJA 1DAYA 3NUNA 3NWWA 5EHLA 5HU3A 3TJDA 4JBQA 2PULA 5CXHA 1FOTA 2YITA 4MNFA 2W4JA 4FSUA 5LOHA 2B53A 2XCHA 3G2FA 4FEXA 3LVPA 4DH3A 4ZP5A 2W5HA 3DKCA 2KTYA 1KE6A 4MEDA 1GY3A 5IZFA 3PZEA 1U5RA 3KMMA 3RZBA 4F1MA 3DBDA 4JDJA 4Y5HA 1AD5A 2RIOA 1XJDA 2QO7A 4FKRA 4AOTA 1CM8A 1ZOHA 2W06A 3Q32A 4EKKA 4DEEA 4AU8A 2C4GA 5CSHA 2XIZA 4F9AA 3VAPA 1KUTA 4XBUA 4IADA 4AA5A 2IO6A 4R3PA 1REJA 4FV3A 4CVAA 2WEVA 5K5NA 3D94A 4RBLA 4FL2A 4RFMA 4FG8A 4CYJA 4D4VA 3LHJA 5IUHA 2C6LA 3PVUA 1I09A 2C6MA 4LRMA 4FKTA 3MFUA 4ZSGA 3HV6A 4TW9A 4WHZA 2W4KA 3D5UA 4R77A 4CKJA 3HDNA 1VYZA 4J98A 1QPCA 3D5WA 1JWHA 3R1QA 3DAEA 5I0BA 1YI4A 5AP3A 2WQOA 2JEDA 2C6TA 4RIWA 2GS7A 2X4ZA 3SKCA 4AW5A 5HVYA 3MA6A 1OBGA 4ZSJA 5I3RA 4A9UA 1ZRZA 5CALA 5CEQA 3ZU7A 4Y95A 2IZSA 1QPEA 5JQ5A 4RPVA 5BYZA 2B54A 2YIYA 4RIYA 2JIUA 3V6RA 3WF7A 4ZZOA 5BUJA 4IWOA 4RJ5A 3CLYA 1DAWA 4RJ3A 1URWA 3C0HA 4XBRA 4WG5A 2R9SA 5FGKA 4ZJJA 4X2FA 3KKVA 1YOLA 1RDQE 3IDBA 5CAOA 4S34A 3F3ZA 4XLVA 3OCBA 4RIYB 2BVAA 2Q83A 3QRUA 4DF3A 2WTKC 3SRVB 5CQUA 4KUJA 3U54A 4DFLA 4WG3A 4ONAA 2I7QA 4O7ZA 2W5BA 3W18A 3G0EA 5M06A 2F2CB 4D58A 3CCNA 1XBCA 3BHHA 4EOQA 3R9HA 2WOTA 3UG2A 4BTMA 4FNWA 4DEBA 4P90A 3SLSA 3W8QA 2A2AA 4IWDA 5IEVA 4BKYA 4GL9A 3BI6A 4BCIA 3F82A 3HEGA 1PJKA 3LFEA 1ZWSA 3HGKA 3BRBA 1APME 4BGHA 4JQ7A 3D7ZA 4JDIA 4YMJA 4BKJA 4FKJA 3RZFA 5EI2A 4FTMA 4TN6A 4BGGA 4MF1A 5HO8A 2R64A 5D11A 1W83A 4IH8A 4C7TA 3NNXA 3UYTA 3VULA 5M4FA 3BBTB 3MJ1A 3PXRA 2QOOA 3UC3A 3E87A 1CKPA 3DT1A 3F69A 3HUCA 4ZTQA 3R9OA 1YW2A 2X7FA 2J5EA 4MWHA 4CFXA 2JKMA 2PE2A 2QOIA 2VWVA 3CP9A 4YJVA 3PPJA 3H9FA 4FL3A 2XH5A 2VTSA 4BIBA 2FH9A 5E8YA 4CEGA 2PZRA 3Q9ZA 4WG4A 5H8BA 2PVFA 3COHA 4C62A 3OROA 5IQCA 3O2MA 4W8DA 2VGPA 3T3UA 4YNEA 1YHWA 3W33A 4IAFA 2GNGA 4EZ3A 1Y8GA 3R71A 4FTNA 1ERKA 5KZ0A 4YR8A 3E8CA 3MB6A 3GCUA 4QMTA 4BI0A 2CNVA 2G2IA 4XP2A 3CC6A 3GFWA 4QP3A 2C0IA 3VIDA 4DH5A 1MUOA 1Q41A 4FV2A 4G3CA 2HIWA 4RC3A 4E5AX 4BWXA 4J96A 2VNYA 3DLZA 5FDXA 3UQGA 4JBVA 4D1SA 2NRYA 2ITTA 3LAUA 3GI3A 3Q4ZA 5AAFA 5EKNA 4LV8A 1CMKE 1CKJA 2AUHA 3P7BA 4U45A 4U40A 5DG5A 2JIVA 4BIDA 4M68A 3ORTA 5JZNA 3D2KA 5AUVA 3TZ9A 4NIFA 3I6WA 5IQBA 3C0GA 2EU9A 3MTLA 1KSWA 4ZTNA 3HP2A 1G8AA 3R21A 4O91A 4DFZE 3TDVA 3DOGA 3TZ7A 4EK3A 2VO6A 5LWMA 1WBOA 4FIEA 4MXAA 4O2PA 3VS5A 3UPXA 4KS7A 5EG3A 3FMHA 5KZIA 2B7AA 3T9IA 4EWHA 5IA4A 4IHPA 2YABA 3EN9A 4D2WA 5CY3A 3UVRA 3VHKA 3BU5A 5I9ZA 4QMMA 5HD4A 5K5XA 4UY9A 4LRJA 1XH7A 4X2KA 5JRQA 2FB8A 4NYEA 3I0OA 2V22A 1NW1A 1XBAA 3EQFA 4MF0A 2JC6A 4G9CA 2Z7LA 1YKRA 3HL7A 1Q24A 1OIQA 5T6KA 3ET7A 3MIAA 3Q9XA 5CYIA 2C6DA 3IW6A 4MXCA 2W1EA 4MX9A 1FGIA 1CSNA 3SX9A 5AR5A 2WHBA 1YOMA 4G3DA 3UIXA 2WMWA 5E1EA 3VVHA 3PSCA 4ZMFA 4ALVA 3P1AA 4EOSA 4XX9A 2E9VA 5CVGA 5HCZA 2GCDA 4E6QA 4CLJA 4O7YA 4GRBA 4KB8A 3ZTXA 3EOCA 2CGVA 5LCKA 5AUXA 3ORMA 2C68A 4PMSA 4UMTA 2IW8A 4WRSA 4O82A 1BYGA 4O0TA 3L9LA 4I22A 5F94A 3I79A 3ACJA 4G6NA 3EN7A 3CQWA 5CLPA 2P2HA 4I4FA 4YHJA 4QRCA 5AR7A 3UYSA 3HUBA 3NX8A 4O1OA 1DS5A 2PMNX 3P5KA 3WIKA 3CGFA 5L8KA 3KXXA 3I1AA 1M17A 4CKIA 5M56A 3AC1A 1F5QA 3FXXA 3KN5A 4ZK5A 2YZAA 4MXOA 1REKA 1H24A 3ZEPA 4ACDA 4E6CA 3PP0A 3W2CA 5FTQA 3AC3A 4O0WA 4OTFA 2Y7JA 4HPUE 3UMXA 2PZYA 2XUUA 4FKGA 3JXWA 5DGZA 5AP1A 4EHEA 3CJGA 3D5XA 4AGCA 3LCDA 2BFXA 4PTGA 4XH6A 4AGDA 5H3QA 4XG7A 3OEZA 3OT3A 4BCOA 4ZLYA 4NTSA 3UOJA 2IVUA 4FTIA 1JAMA 3F61A 4IB1A 5HE3A 3I5NA 3ATTA 1DI9A 1FQ1B 3PJ2A 2BZHB 3KF7A 2BDWA 4JNWA 4ACHA 4KINA 3E8NA 4B6LA 5C4KA 5L6WL 2W96B 4EK4A 1E9HA 1XH8A 4DBNA 4AN3A 4UB7A 4ZLZA 5HEZA 4ANNA 3R8UA 5IQIA 4QMVA 3ELJA 1SMHA 1JQHA 2QD9A 2OSCA 5DT0A 4FODA 3QCYA 4QP1A 3FI4A 4FYNA 3FZ1A 3R83A 3BBWA 5BUIA 3QKLA 4G2FA 3PRFA 4HVSA 4BFMA 3O8PA 4FV7A 5AEPA 5ANKA 4EK8A 3G51A 3EQPA 4MNEB 4HJOA 2B9IA 3BLQA 4XCUA 4U79A 3MI9A 4XP3A 5A4QA 2OJJA 4Y85A 2WTJA 4DITA 1H28A 1H8FA 3WZJA 2CKPA 4U41A 3RAHA 1JKTA 4I6QA 5EHYA 5HIBA 3EQBA 1PXKA 2XNPA 1JVPP 4FKSA 3U9NA 3BCEA 1U46A 3EQIA 4GT5A 4BZNA 4F7NA 3Q4TA 3UIMA 2I0EA 2OFUA 3PYYA 4OUCA 3FZOA 3RHKA 2YLEA 1ZXEA 3P79A 2R2PA 5M53A 2C1AA 3DZQA 3G5DA 3DXQA 3BZ3A 3LIJA 3DAKA 4BCFA 4FL1A 3NCZA 3JY9A 5FDPA 3VBWA 5AA8A 4BKZA 4PDYA 4G34A 3K54A 2AC5A 4G3FA 4FTUA 4D4SA 3FE3A 3FZTA 4Z55A 3QQFA 1GJOA 2F7ZE 4JT3A 4UEUA 4Z7GA 5I9UA 1R39A 2EWAA 4QMLA 3ZC6A 4EC9A 2HW7A 2ZMDA 2HK5A 1QPDA 1YXVA 3PJ3A 4I0RA 4K18A 4QD6A 3BE2A 3BLRA 3HECA 4YC8A 4AZFA 2ETRA 5IUIA 4K77A 2UUEA 3EMGA 1UNHA 2FSMX 3F3WA 4O1PA 3L1SA 3BPRA 4RZVA 4ITHA 3ZLSA 4AW1A 4CFUA 3ORNA 2VO3A 4M3QA 4CV8A 4FC0A 5IF1A 5LJJA 3HAVA 4OGRA 3MVHA 4PF4A 3RPYA 1JOWB 1UA2A 2BMCA 5CANA 4FBXA 5CQWA 4M13A 1Q5KA 3UO6A 3MFSA 2PUIA 3ORIA 5HLWA 5ETFA 3A7JA 4APPA 2X2KA 1H0WA 3ENMA 2VUWA 3QLFA 3TNPC 4E4LA 4EYJA 3U4WA 4O84A 1SYKA 1YDRE 3OY3A 4JX7A 4KNBA 3QRKA 2QKRA 4IVDA 4L7FA 1V0BA 2Y4PA 4CTCA 1XO2B 4AG8A 4E6AA 3QQKA 2JIIA 3HV7A 4AA0A 3WIGA 4RLLA 3IOKA 4XEYA 5CSVA 4L44A 2GMXA 4IX6A 1KE5A 4BDDA 4YZCA 2R3IA 4JLCA 2O2UA 2ZAZA 3G9LX 3FYKX 2OIDA 4Q2AA 5TE0A 5EM7A 1NVRA 5IUGA 2I0HA 3IO7A 2XVDA 3QYWA 4HYIA 4N57A 3PY3A 4A9SA 4APCA 1RW8A 3DDPA 5BVOA 5AV4A 4YJUA 2HELA 2JGZA 4S30A 4XP0A 2UZNA 4I5MA 4I5HA 2GU8A 3G6GA 4GIHA 4AFJA 5DT4A 3VN9A 5IMEA 3VW6A 3GC8A 4FZ7A 3C4CA 2VRXA 5C03A 4XUFA 4F08A 3OXTA 4EH8A 1H00A 4I6BA 2XEYA 4N6YA 3LOKA 3LQ3A 5JFVA 2BIYA 5HNIX 2PVNA 2QU6A 3R01A 3KRLA 3EB0A 4IEBA 3VS7A 1M2RA 3ODYX 3MH3A 1SVGA 1OIYA 5E91A 5CAVA 4ZTRA 2BRMA 3PLSA 2OXDA 1PMEA 4O0XA 3W2QA 4OAVB 2YAKA 5AR4A 4EHGA 1ZYCA 5IQEA 4DE4A 1J3HA 1GZOA 2OIQA 3L9NA 4V0GA 4B8LA 2ZVAA 3D5VA 2I6LA 3LE6A 1ATPE 4QYYA 2OXYA 3DXPA 3C7QA 3FHRA 4PMPA 2ITQA 5HLPA 1H07A 3V04A 4EZ7A 4GH2A 1IEPA 3A7HA 4UWCA 5CSPA 3CJFA 2UW0A 1FVVA 4AUAA 4PV0A 4QTAA 1GZKA 1WBWA 3A99A 5LVNA 3QBNA 2BRHA 4FTKA 4C58A 3IDPA 3HA6A 3PXYA 2WNTA 5DT3A 4DC2A 3OTVA 3TNIA 5JN2A 2C5OA 3QTQA 1Q8ZA 4DEAA 2F7XE 4EOJA 2ZMCA 3OBGA 4W4VA 2WQEA 3L8SA 3UOKA 4KKEA 3NEWA 3DTWA 4AAAA 3FV8A 4EKLA 5ANOA 3NDMA 3OZ6A 2OO8X 3ANRA 3CTHA 1Q3WA 1WVWA 4R8QA 4GYIA 4F9WA 3GP0A 1PKGA 3A8WA 4CQEA 2ZM1A 4BCPA 1PRYA 4BR3A 4DH8A 4IAIA 2I1MA 3FJQE 4FIIA 4O21A 3KY2A 4RWKA 5HZNA 3L8XA 2QOCA 4FV6A 2X4FA 3GU8A 4U81A 3VUDA 3R6XA 4IBMA 4PQNA 3FMNA 3MPAA 5HICA 3V3VA 4PP7A 1OL5A 4RA5A 5B2MA 4MD7E 3R28A 3QQGA 4IM2A 4I3ZA 3K2LA 5CAUA 4MQ2A 2PVJA 5LVLA 4QMSA 3RAKA 1U5QA 4FKUA 4FV9A 3FXWA 5DRDA 4CLIA 3N4UA 3P23A 5ACBC 2YEXA 2NP8A 4IM3A 5M4UA 4L7SA 4C02A 4DG0E 3VS0A 1ZOGA 4YPDA 4RWLA 4CMTA 4HVDA 5J5TA 4GK2A 4XYFA 4XLIA 3QTRA 4N70A 1R78A 2PUPA 3P78A 4PP9A 4D5HA 4Q9SA 4XHKB 2PUNA 3V8SA 2UW4A 3E62A 3OP5A 2X1NA 1Y6AA 5CT7A 3PRIA 5A14A 3LFFA 1YRPA 4FT9A 5M4IA 3FZRA 3AXWA 3AT2A 3TV6A 4B8MA 2VWBA 4FE2A 3OC1A 3DQXA 2QOQA 2WQBA 4MKCA 4FKVA 4EEVA 3N4TA 2XYUA 2XBJA 4ASEA 5T3QA 4A4LA 5LVPA 5DWRA 4TY1A 2AYPA 4M0ZA 4YLKA 1OM1A 4KRDA 2A4LA 4DEDA 5AX9A 3C4WA 4QQJA 3KL8A 3P86A 2PY3A 1OUYA 4FG7A 4AA4A 4GS6A 1GNGA 3IW5A 3DU8A 1YXXA 4MQ1A 5CEIA 4AGWA 2W0JA 2GQGA 1V0OA 2BZKB 4WSQA 4UX9A 1W98A 3EZVA 2RSVA 2Z8CA 3LJ2A 1FGKA 3OEFX 3GC7A 3SXRA 2OZAA 1L3RE 3KF4A 3LCOA 4MCVA 2WAJA 4PDPA 5HO6A 4ALWA 2CNQA 1HCKA 3QLGA 2IZUA 3R9RA 1Z57A 1M14A 3MGYA 3H9RA 4O7RA 2WXVA 2Z60A 3NAYA 1OKZA 3PSDA 4GT4A 4IVBA 4QP2A 2WIPA 3O71A 4O38A 4QQCA 2B55A 4PDOA 3BHYA 4EOKA 4FIFA 3V8WA 3CD8A 5CEPA 3ZXZA 5AV2A 3IGOA 5GJDA 5AUYA 4F63A 2OI4X 3LM5A 4DFUA 3DQWA 1Q8UA 4XG8A 5DLSA 5G1XA 3WOWA 1S9IA 4KAOA 3ZOSA 2ETKA 3L9MA 3D83A 4YSJA 3C13A 3PSBA 3S1HA 2GTNA 3GEQA 2UZLA 3R8ZA 3KRRA 4JJRA 3EN5A 3V5PA 3ZBFA 1Q99A 4ACGA 4D2TA 5L2IA 3R8VA 2VO7A 4DGOA 3EL7A 5B2LA 5IMXA 2JDTA 3S00A 5GZ8A 2R3GA 1ND4A 3AMAA 4G1WA 4C3FA 5HG9A 2Y6MA 2ZV8A 3V5WA 3KU2A 4HGEA 4DBXA 1DI8A 4G17A 4PL4A 3NUAA 4DEIA 4H3QA 3DAJA 3OW3A 5LMAA 3VUIA 3BELA 3UNZA 3IW4A 4IDVA 3PXQA 4NZWB 4ANBA 5E8TA 3C50A 4J8NA 4PWNA 3TIZA 4E8AA 4QMNA 3SDJA 1URCA 4IIRA 3FLQA 4C4EA 3A62A 5J1WA 3FAAA 1JKLA 3WZDA 4C2VA 4DGLC 2C3IB 3RJCA 4GK4A 5EDQA 4RFYA 4EBWA 3ZSGA 4DA5A 4H39A 4YSMA 3S0OA 4DH1A 3OWJA 4U43A 5IA3A 1IG1A 2FSOX 3DFCB 4QNAA 4I5PA 3FC1X 2GTMA 4FUYA 4BZOA 2OXXA 3LQ8A 5J7BA 4B9DA 4YJOA 5KMIA 5JFXA 4O83A 4II5A 4CCUA 3GXLA 5JK3A 4M12A 3DBEA 4FT5A 4F9CA 1PKDA 1JSVA 4CMUA 4GG7A 3OCGA 2IWIA 2YJRA 3RCDA 3AC5A 4CGAA 3THBA 3LZBA 4OTIA 3PY1A 3W8LA 1P4FA 4XNEA 3K5UA 2XB7A 3WF6A 4FSQA 2XK8A 2YA9A 3N51A 2W1CA 5JRSA 4EJNA 4F65A 4EJ7A 5CWZA 2IW6A 4L68A 3K3IA 4R7BA 1JNKA 3EZRA 3IONA 5ANGA 4ZJVA 4MD8E 4BTKA 4MVFA 3QWJA 4HNIA 3AGLA 4MBJA 2EB3A 3PPZA 3HKOA 2WPAA 4FV8A 2O0UA 3F3VA 1ZOEA 3F2AA 1QCFA 2ZJWA 2CN8A 4IB3A 4IQ6A 4FSYA 4KIKA 5FXQA 4UMPA 5IQHA 4USDA 3LXNA 4RGJA 4BDGA 3S95A 4FV4A 4RG0A 4CV9A 4X6QC 3CGOA 3UIBA 3WZEA 1YXSA 3FL4A 3KMWA 3GB2A 2W1ZA 3ZUUA 5AUUA 1LEZA 2V7OA 1VR2A 3T9TA 5FEEA 4TT7A 2GHLA 5CT0A 4C38A 2O63A 4KIKB 3VJNA 4GFGA 2CLQA 2F7EE 2XKFA 5E1SA 1GIIA 4TKSA 3NVMB 4CT2A 1WZYA 2OJIA 4W9XA 2GNFA 5GINE 2QOBA 4BCHA 3KRWA 3ZFXA 4CZYB 1RQQA 4YZ9A 4Y8DA 3EQCA 2UZBA 4LOQA 4R3RA 4YUQA 4ASZA 4CFMA 4M8TA 4RT7A 3UQCA 5ETIA 3FDNA 4M69A 2BCJA 3SXFA 4PX6A 2XEZA 5D10A 3WI6A 4IZ7A 2BAQA 5J79A 4JRNA 2HAKA 5K4IA 2XJ1A 2GS2A 4G3EA 4IC8A 2JBPA 4U6RA 3C4XA 4KWPA 2CKOA 4U3ZA 5IA1A 4OTDA 2C6EA 5BYLA 4YP8A 1B39A 3LMHA 2WU7A 5IEYA 4PPCA 3QZIA 4R1YA 3CTQA 2XK7A 4XG2A 3KK9A 4ZTLA 4JAIA 2BALA 3KXGA 4FKPA 4OTWA 4QQTA 3IK3A 4RA4A 3R2BA 5A4TA 5AP4A 3MY5A 4F7SA 2REIA 4QYEA 3Q4UA 4FTAA 3WE4A 1H4LA 3H9OA 4BIEA 3QZGA 4YO4A 5C27A 2ZB1A 3RINA 4FK6A 3TZMA 3Q6UA 3DPKA 4CRSA 4L3PA 2FUMA 5HORA 2PZPA 3OHTA 3QGYA 2JLDA 4ZTSA 1JKSA 4ZEGA 4NM0A 3U6HA 2F9GA 4LGGA 4V05A 1H26A 4AZWA 5KBQA 3SW7A 4CZUA 5BVFA 3NUPA 1WBVA 4PY1A 3UQFA 3FBVA 2PZIA 4M14A 4ZZMA 4EUTA 3IW7A 4WA9A 4JI9A 3UP2A 2PMLX 4CNHA 4BHNA 3JY0A 4W4YA 2XYNA 5IPJA 2XK6A 3ANQA 4BWPA 1MRVA 4KSQA 2R3NA 5GJFA 4Q5EA 2WMVA 3GVUA 3EFWA 4FV5A 4H58A 3VUMA 2C3JA 2JBOA 1YI3A 3AD6A 5D7AA 4ZS0A 2YM6A 1YVJA 4X2GA 5FM3A 4ASDA 5G6VA 1OI9A 5KHXA 2YDJA 4X0MA 5IH4A 3TUCA 4QP9A 2P33A 4Q5HA 3GU5A 3QGWA 3QC9A 3OTUA 3QUDA 4RIWB 1PMNA 3C4FA 3ETAA 2YCQA 1O6KA 3ORXA 2V55A 4YTFA 5F9EA 5IQGA 4A4OA 3EFKA 3PA5A 4HZRA 2PMIA 4IC7A 2BFYA 3FHIA 3ZZWA 2GS6A 5FQDC 3MYGA 4O7TA 4KSPA 3LJ0A 1HOWA 2DS1A 3QAME 3VHEA 5EK7A 1WVXA 5JZJA 3O0GA 5M51A 3DKOA 5GJGA 3DV3A 2OF2A 2ITYA 4S31A 4TYHA 3LFQA 2PYWA 2E9OA 3LM0A 4ZZNA 4R1VA 2PWLA 2XNOA 2QOKA 3MA3A 1WVYA 4H3PA 4F1OA 5CI7A 2C6IA 2OH4A 3RWQA 3FLSA 3P08A 3QA8A 4LM5A 4YLJA 1ZARA 3ZYAA 5JQ8A 1NT2A 1FMKA 3ZHPC 4JX3A 2XMYA 4DGMA 5ETCA 5HO7A 4HGTA 3CD3A 3BV3A 3EIDA 3COIA 4B99A 2X6EA 2YM5A 5E4HA 3PA3A 3MFTA 3FLWA 3O51A 4LGDA 5HIEA 2G9XA 4FSRA 4KD1A 4EK6A 2XNBA 2BZIB 2JDSA 4ENYA 4GG5A 5BPYA 2QLUA 5AM7A 3ZS5A 3V6SA 1BL6A 4PMMA 2QO9A 4WUAA 3DKFA 4UWBA 4D2PA 1UKIA 4UZDA 2FSLX 4BDJA 4WNKA 2PVYA 1IAJA 3FZSA 4IFCA 2VV9A 3CQUA 2QCSA 2YCFA 4O7LA 4F7JA 2WTIA 3UO4A 4O96A 2DYLA 4D9TA 1YI6A 3LFSA 1K2PA 1NXKA 4I24A 3HVCA 5CZHA 4TXCA 4XG4A 4DHFA 3ROYA 1TKIA 1YQJA 3GBZA 2HXQA 2OIBA 3MH0A 4K2RA 1G3NA 5FBOA 3PVBA 5DH3A 2GHGA 5J8IA 4QQ5A 5BVEA 5EW8A 4TTHB 4EZ5A 3TN8A 4LMNA 3V51A 1Q3DA 3NR9A 4KS8A 3HP5A 3HMMA 4DTBA 4FT3A 3NNWA 3Q9WA 1OIRA 1G8SA 3W2SA 2OLCA 3M42A 4KA3A 1H1RA 2QHMA 4JIKA 1YWNA 3AC4A 3C51A 4G5JA 3RPRA 4CKRA 3NYOA 3RM6A 4EOMA 4IWPA 5TKDA 3W2RA 5FXRA 5L2SA 1WCCA 5C01A 3RBWA 2OJ9A 1QL6A 2R3RA 4EHZA 2X2MA 1PXJA 3IKAA 4NIFB 4DFXE 3UODA 5CAPA 4L6QA 4YZNA 3LPBA 1A48A 3WE8A 3KXHA 1G5SA 5EYKA 1ZZLA 2CCIA 2C3LA 5EYMA 3R7UA 2PVKA 4CFNA 2YERA 4K9YA 5EYCA 4C3RA 4EI4A 4ITJA 4L53A 5HNBA 3N4VA 2H34A 4AX8A 2BKKA 4LL5A 2YZLA 3EHAA 5DE2A 4PNIA 2X81A 3TCPA 4NM7A 2WTKB 4D2RA 5AUTA 3EH9A 3BYOA 2OJGA 3T8OA 4YJSA 5LMKC 5J5SA 2IVVA 2PL0A 3Q60A 4W4XA 2VZ6A 4JBPA 5E8VA 5FLFA 4NFMA 3SAYA 3TWJA 5KUPA 1PYEA 4FZAB 5DFPA 4C4IA 2P2IA 4FVRA 2G15A 2UW8A 2OICA 2XIKA 5D1JA 3R7YA 4TYEA 3LFBA 5A54A 3RGFA 1ZYSA 5CNOA 3D15A 4ITIA 5HG7A 2VTIA 3S2PA 4V01A 3V5TA 4EH5A 3SOCA 4X21A 2VNWA 4JIAA 4K0YA 4XJ0A 4EOIA 4NL0A 2CN5A 3OW4A 3SG8A 2IW9A 1H25A 1STCE 3H3CA 3BHUA 4FICA 4TYIA 4Y73A 5CX9A 3Q2MA 4XOYA 5DNRA 3KVXA 5HG5A 3UIUA 3W2PA 3NUUA 1UNGA 4LL0A 4RJ8A 4OLIA 3TV4A 4I20A 5K3YA 2Q0BA 4EH7A 1BLXA 3TJCA 5AAGA 3Q04A 4OAUC 2CMWA 3MDYA 4PPBA 5J1VA 4HZSA 2UW5A 5CEOA 5DYJA 2JFLA 4JG8A 2B9JA 4AT4A 3CIKA 4F0IA 1Q97A 4UYAA 3R7EA 2JDVA 3ZO2A 5AADA 2QOLA 5IDNA 4KKHA 1GZNA 3PJCA 3EL8A 2X8EA 3ZO4A 4MXXA 2QC6A 4BGQA 3EQRA 3LFNA 4GT3A 3E93A 5EM5A 1PXIA 3QTIA 3TKUA 4BWKA 4M0YA 2YJSA 5D41A 3QD0A 4QOXA 4BYJA 4C34A 1PHKA 2ITPA 2VWZA 1PXPA 4NWMA 1TQIA 4DT9A 4O0UA 4NJ3A 2XIXA 4W9WA 4RC4A 5AMNA 4EUUA 4Z9LA 5AP0A 4HPTE 2VWWA 5M4CA 3NIZA 4GMYA 1XR1A 2W1FA 4YJNA 4F09A 4R78A 4DCAA 3E64A 4BF2A 2LGCA 2YM4A 2QOFA 3F88A 4C33A 1J1BA 4GIIA 2HZ4A 3PXKA 4F6SA 3ZUTA 3UZPA 4IZ5A 2VU3A 4A07A 4QP6A 2EXMA 4A06A 2WTDA 3DS6A 3H30A 3QXOA 3GU4A 2LAVA 3VRYA 2GNLA 2YM7A 4BCNA 1HCLA 2V0DA 2BUJA 3ID6C 3R8MA 3NYXA 3OWLA 3EFLA 4LG4A 3P9JA 2XS0A 4M67A 5IA5A 2IJMA 2OBJA 3O50A 5DEYA 3WF9A 4BDHA 1Y8YA 5KKRC 4WO5A 5HKMA 3ZRKA 3MTFA 4CT1A 2R3MA 4G3GA 1ZMVA 1YWVA 4IX3A 3BYSA 3ZONA 3TTJA 4BDEA 5KMKA 5LMKA 3KMUA 3EN4A 2QURA 2UVYA 1UWJA 3JVRA 5CU3A 3TZ8A 4ERKA 3LCSA 3Q6WA 3R7GA 4D2SA 2ZYBA 3HYHA 2OFVA 4GKIA 2QOHA 2FSTX 3DA6A 4BHZA 3OG7A 4UALA 3PWYA 5IA2A 5CASA 5TR6A 2YIQA 3GCPA 5IU2A 1PYXA 1NY3A 3CPCA 4W4WA 4RWIA 5FP6A 3HRBA 4FEQA 3SOAA 3UDBA 3VUGA 4C2WA 3CPBA 4CD0A 1O6LA 4RX5A 3NYVA 4JBOA 1Y91A 2HYYA 4DEGA 4I1ZA 4K1BA 3BGPA 5B7VA 1P2AA 2ZV7A 2XM9A 5KMNA 2VX1A 5BMSA 2HWPA 3EQDA 4RVMA 1A9UA 5ICPA 5JEBA 4M7IA 5C8NA 4BCGA 3TDWA 5CU4A 2B9HA 4NM3A 2PMOX 4EHVA 4EONA 4D2VA 4S2ZA 5CEKA 2VN9A 3LCKA 5CU6A 5L8JA 5AR8A 3SVVA 3CXWA 5CU2A 4IZYA 4L42A 3FSKA 4DH7A 3MIYA 4O7WA 2QKWB 1PW2A 2B9FA 3D9VA 3W1FA 3NCGA 1XH9A 4NUSA 5DA3A 2G2FA 4IAKA 3RK5A 5GIPE 4L8MA 2W1HA 3NMUF 1MQ4A 4BTFA 1XWSA 2ZDUA 4EH6A 1KE8A 5FG8A 3NUYA 2C0TA 3CQEA 4B7TA 2BTRA 1FVTA 4P5ZA 1YXUA 2ITOA 4FGBA 1H1QA 2VWYA 4CSVA 4IAZA 4G31A 2X7GA 1SM2A 4PMTA 3PIYA 4C4JA 2C5NA 2RFDA 4P5QA 4AOIA 4D0WA 2NO3A 3QQUA 3M2WA
chains in the Genus database with same CATH superfamily
2HY81 4I4EA 1OGYA 4FT0A 2P4IA 3UBDA 2XP2A 5HBJA 4E4MA 3C5IA 4CFFA 3GCVA 3TKIA 4QPSA 4YJTA 3KVWA 5I3OA 5K9IA 4BBMA 5EI6A 4FOBA 3FQEA 3GFEA 3UZTA 3MPMA 3UZRA 1T46A 4N6ZA 4IFGA 4GKHA 3BEAA 3LXPA 3E7OA 4FX3A 1SVEA 4YGAA 4BL1A 4CG8A 2GHMA 3E3PA 4YTIA 5HTBA 3V5LA 5L2WA 4FEVA 1TVOA 2G2HA 2EUFB 2B52A 5DI1A 3KN6A 3IG7A 5EQYA 4BDIA 1A06A 2YACA 1UNLA 3DXNA 3EKKA 2E9NA 2VTQA 3QHWA 3OXIA 5BNJA 4JL9A 2BHEA 4ID7A 4AE6A 1OVEA 1XQZA 3CE3A 3PUPA 4WBBB 4AZTA 2WMXA 2ZB0A 3QCSA 4FTJA 3TACA 5ITAA 5HBEA 3KREA 3D0EA 4AXEA 4BJJA 4IW0A 2R3JA 5KO1A 2BDJA 5KMJA 4NCTC 4BN1A 4V0GB 3EJ1A 2VTAA 4NKAA 5A4LA 4RIXA 3C4EA 4RX9A 4A4XA 4E20A 1IRKA 4MD9E 4NFNA 4QDEA 5ETAA 1PXMA 3AG9A 2X0PA 4I0SA 4YLLA 4G16A 3VQHA 5DHJA 3U8WA 3O17A 5DN3A 1M52A 5HE1A 1T45A 1XH4A 4KRCA 4WNPA 5AWMA 5GZAA 5L3AA 2GFSA 1LEWA 4IJPA 3ZFYA 3R00A 4F4PA 3P7CA 4PDSA 1XKKA 2UZEA 1OL2A 2I0VA 3MB7A 3U6JA 3FLYA 2PVHA 4ZS4A 4O0RA 1WFCA 2CDZA 1M7NA 2EXCX 3ITZA 4YO6A 4BZDA 5CXZA 4FNXA 5IDPA 5CVHA 3AMBA 4AQKA 2WMSA 1YHSA 3MWUA 5E7RA 4OT5A 3ALOA 1JSUA 4DLIA 3ZZEA 4QNYA 1P14A 2HXLA 1QMZA 2ITZA 3QA0A 2PTKA 4CQGA 3RNYA 5AP2A 3RI1A 4U3YA 5AJQA 2UZDA 5F20A 3R9DA 3ZLYA 4DFYA 1H01A 5LQFA 3O5AA 5C4LA 5A3XA 1NVQA 3COKA 3QD4A 5A4EA 5AV3A 2CJMA 4NSTA 3G90X 4O81A 4YNOA 3ENHA 3HA8A 1L8TA 4AOJA 3RALA 3PG1A 1U4DA 4WUNA 3UO5A 3L8VA 3HRFA 3O96A 2XNNA 4JQ8A 4YC6A 5E8UA 3SXSA 3ULIA 4LUEA 1UVRA 3FI8A 3OCSA 4OBQA 4ZJIA 5AX3A 4IAYA 3ZM4A 1QPJA 3B2TA 3R7IA 3FPQA 1X8BA 4J97A 3I81A 4IE9A 1H0VA 3E3BX 1S9JA 2BIKB 2C3KA 2UZUE 2UZVA 3F3UA 5L8LA 2X6DA 3C1XA 2Q0NA 4TL0A 2F4JA 3NSZA 4FIGA 4I92A 4FSWA 3Q5ZA 2QI8A 3P7AA 2J4ZA 2DQ7X 2UW6A 1OUKA 4HW7A 5JMSA 4MTAA 4P7EA 2YAAA 4AXAA 3BEGA 3BYVA 4ZXTA 5J95A 3RHXA 3BYUA 3RK7A 2UW9A 4ENXA 2HOGA 2RFNA 3OY1A 5LVOA 3EFJA 2JD5A 2JKOA 3CTJA 3OFMA 4GEOA 1WBTA 3UNKA 3I0QA 3ATSA 3EYHA 1U59A 3W2OA 4TPTA 1PXLA 3ZO3A 4CFVA 5DR9A 2VTRA 1NVSA 5ANJA 4D4YA 5M07A 1M7QA 1E1VA 3ERKA 5I9VA 4EWQA 1F0QA 2J0LA 3QFVA 5BMMA 1KE7A 3DK6A 5GNKA 3RPOA 3Q2JA 2IN6A 4I23A 4NCTA 4U42A 5CS6A 5DRBA 5LXMA 4C4HA 4O7VA 3W0QA 5EH0A 4O7NA 4UWYA 4FEWA 3D14A 3QTWA 4DEHA 1OGUA 2CGXA 5GZ9A 3NUSA 5EOBA 3EQHA 4LUDA 3LXLA 4C61A 3R02A 4DG3E 3AGMA 2GNIA 2IVTA 4L9IA 4YPSA 2UVZA 3VS1A 3HNGA 1LP4A 2GDOA 4U8ZA 2QG7A 1OKYA 5IISA 1SNUA 4OTPA 5IA0A 4G5PA 5D7VA 4AE9A 3MSSA 5IQAA 1MRUA 3A4OX 5HCXA 5H9BA 5LWNA 2OZAB 4NW6A 4X2JA 1P5EA 2WQNA 3R1YA 4RVKA 2BPMA 5A6NA 5HU9A 3KQ7A 5CU0A 3EKNA 4FR4A 4FZ6A 3FLNC 5KMOA 3UDTA 3F5XA 5BVKA 2CGUA 2R3LA 2VAGA 4RRVA 5M08A 4X6RA 4FKOA 2JKKA 2Y4IC 3GOPA 4JR3A 5FM2A 4BDAA 1LPUA 2XKEA 3DNEA 3GC9A 4PTEA 1VZOA 3F7ZA 2XANA 3MPTA 2CKEA 2VX3A 1OB3A 3ZMMA 4R7IA 2WMQA 1YXTA 4YBKA 3KGAA 3PJ1A 3WF5A 5L2TA 3SGCA 3PTGA 4QYGA 2X9FA 4L52A 3RPVA 3REPA 1U54A 4RVLA 5J9ZA 2QU5A 2E9UA 2F2UA 5IG1A 4BC6A 1PMUA 5DR2A 4HCTA 4AF3A 4ASXA 5E90A 4NW5A 4DDIA 2W17A 2E9PA 3ZDUA 3JUHA 3KULA 4Z3VA 4ZOGA 2RGPA 4ZY6A 2YFXA 4U97A 2RG6A 4FRFA 4PTCA 3PXZA 2P55A 4E1ZA 3QU0A 3F5UA 3PFQA 5HLNA 3QTZA 2WD1A 5AM6A 3KULB 4RSSA 3O8UA 5FBNC 2BRNA 1YDTE 3N9XA 4CRLA 1OITA 1MRYA 3A7IA 3QTXA 3JS2A 2VWIA 1XH6A 1EH4A 3PIXA 2J0IA 2WKMA 3RM7A 3HV4A 4D5KA 3D7TA 3ZLXA 1F3MC 3E92A 1SNXA 2P3GX 5FRIA 4ARKA 4J95A 4D28A 2WB8A 3GQLA 2QG5A 4EK5A 2YISA 2OGVA 2YLFA 2R3OA 3B8RA 5CI6A 1P4OA 2EB2A 2G1TA 3I6UA 3O8TA 2UV2A 3D7TB 4O0SA 3VBYA 1ZYLA 4UMRA 1I44A 3G0FA 4DN5A 3IPHA 1TQPA 4J71A 4RZWA 5HE2A 3A7GA 4FOCA 1H1SA 3MBLA 4HCVA 3HAMA 2V62A 3HMIA 2J51A 1TQMA 4GJ3A 2J2IB 4PL3A 5CVFA 2OF4A 2GFCA 2ZV2A 3F66A 2B4SB 4MK0A 4XRJA 3G33A 3TV7A 2XRUA 1OZ1A 5TT7A 3ZBXA 4OTHA 5CSWA 1FINA 2VTPA 3FPMA 4DYMA 2RF9A 4S32A 4ZIMA 5AP6A 5CSXA 3RP9A 4FG9A 4IVCA 2BHHA 3G9NA 4MXYA 3I60A 2WIHA 3NNUA 4BTJA 3BLHA 4GYGA 3TNWA 2R4BA 3HLLA 5A9UA 3M11A 3DTCA 1BX6A 4WD5A 2Y6OA 3D2IA 4L45A 4MBLA 2YDKA 2WZJA 3ZXTA 3NYNA 2BDFA 3FMKA 3CY2A 4FKQA 2O3PA 3SHEA 2H96A 5CF4A 3O7LB 2X0OA 3IGGA 5D12A 3A61A 3DDQA 4GCJA 4RJ4A 1GIJA 2H9VA 3KCFA 4OTQA 4UMQA 2R7BA 4CG9A 1V1KA 2XKDA 4FTOA 3TKHA 5HD7A 3WYXA 2H8HA 4YTHA 3VRZA 3QWKA 4BDCA 3BHTA 1NA7A 4YTCA 2Y4IB 4R5YA 3GNIB 3TNQB 3W32A 1SVHA 1OPLA 2BAJA 4BYIA 3UDSA 4OW8A 4HYHA 4M69B 5CENA 4OR5A 2GNJA 5AV1A 5CAQA 5A4CA 4N0SA 3FXZA 1R1WA 4TWPA 3G15A 3IS5A 1PMVA 2C69A 5FTOA 3MN3A 2HW6A 2OKRA 3DGKA 1O9UA 1IASA 1JSTA 4FZDB 2C5VA 1R0PA 1MP8A 3F9NA 3ODZX 3P0MA 4UYNA 4IX4A 5EM6A 2PU8A 3E8DA 4Y5QA 2XARA 4F0GA 1KV2A 3V5JA 1PXOA 4C59A 4E26A 5L6OA 4PRJA 3NVKI 4I41A 4N4SA 1ZYDA 4BICA 5I4NA 5HVKA 4F6UA 1UKHA 4GW8A 5BX0A 5HI2A 4Z7HA 1H1PA 2VX0A 4RMZA 4R3CA 2XAMA 5I5ZA 3PY0A 3R04A 4GU9A 3LCTA 4QMQA 5JGDA 2C6KA 3QKMA 3Q3BA 4MYGA 2UVXA 4NT4A 2EXEA 4C3PA 2WOUA 3RAWA 2ACXA 3ACKA 4J52A 2X0QA 3CSVA 3I4BA 4X3FC 1VJYA 3KK8A 4BDBA 3OCTA 1B38A 2R7IA 3LFCA 3GCSA 2Y0AA 4O4DA 3K3JA 3PVWA 1W8CA 4IVAA 1PXNA 2WTCA 3Q52A 3QD3A 3AT3A 3PWDA 5J9LA 3BWFA 1J91A 4J7BA 3MH1A 3UOHA 4J53A 5EW3A 3ML1A 3GC0A 4HVHA 3R1NA 3LJ1A 4IDTA 2WMTA 4ZAUA 2CCHA 3LXKA 5EQPA 3A8XA 3TYKA 4I93A 1W7HA 4O2ZA 1J1CA 3FI3A 4RC2A 3U4UA 5GHVA 2GQRA 3RTPA 3BL9A 3H4JA 3FUPA 1CKIA 3QRTA 4IAAA 4JQEA 4EC8A 2CPKE 2R3KA 3FMJA 2QODA 3M1SA 4FVQA 4LFIA 3WBLA 4I6FA 4YC3A 4E5BA 3DCVA 5I9YA 3VF8A 4QYHA 4PUZA 2BILB 4OT6A 2X0GA 3I7CA 4L46A 3BE9A 4AAYA 3BLAA 1OPKA 3ZO1A 3GQIA 4L67A 4AS0A 4BDFA 5I9WA 3KB7A 4HVGA 5FTGA 3P4KA 3TUBA 1ZYJA 3BQCA 5FXSA 1FVRA 2HY0A 3SRVA 4TNBA 5C1QB 3QF9A 1YHVA 4ZY5A 2H6DA 2IZTA 4BCKA 1AGWA 4QTBA 4TYHB 2PSQA 3DK7A 4FTRA 4M15A 5E8XA 5KE0A 4ANSA 4DINA 5D9HA 4ZSAA 2XIRA 4FKWA 4RQVA 4DHJA 3QZFA 3R7VA 3UJGA 3TUDA 3F5PA 4RWJA 4WKQA 3R2YA 2VTJA 2XM8A 4QMYA 5DEWA 2QO2A 4H1MA 4JOAA 3VBXA 2ETMA 3AQVA 3DKGA 3MVLA 4IACA 5C8KA 4F9YA 4AZEA 4FTTA 3KXMA 4K8AA 4Q9ZA 4RVTA 5IQDA 3H10A 3C0IA 2JAMA 2SRCA 1WAKA 4KKGA 4CFWA 3DFAA 4C37A 4Z16A 4OBOA 1Q8YA 4D1ZA 3TMOA 2PPQA 3E7VA 3CEKA 2RFEA 1KOBA 2A1AB 3AC2A 2C30A 3NIEA 4FYOA 4YJPA 2C47A 5DVRA 3QCQA 5EM8A 3PVGA 4I0TA 5HG8A 1J7IA 3AD4A 4UN0C 3UOLA 3ZC5A 3BHVA 3QZHA 5HNGA 4TWCA 5CEMA 4EQUA 5CF8A 3NZ0A 3TL8A 4HOKA 4O0VA 4J99A 4WIHA 3CR0A 4A7CA 2O8YA 2XKCA 3W0SA 2ERKA 2PUUA 2YCRA 3DLSA 4FKIA 4E7WA 3P5JC 3V8TA 4NH1A 3VNTA 3TG1A 4JG7A 4X3FA 2Z7RA 2XIYA 2ERZE 4L3LA 4U80A 2CLXA 3QL8A 1BUHA 4EBVA 4HVIA 5HX6A 4ZMEA 3E88A 5JKGA 3EYGA 3PFYA 4AWIA 3AKKA 4WBOA 1UWHA 2YIXA 3NW5A 4RX8A 5HESA 5LCJA 3PA4A 5BYYA 5JT2A 1V0PA 4GSBA 3MESA 4Y46A 2BZJA 4RLKA 4X3FB 1ZY4A 1RE8A 4QMOA 1CDKA 3DZOA 4JRVA 5L4QA 5J87A 3II5A 4J1RA 3ZEWA 2EVAA 2B0QA 4CMOA 2KULA 3QD2B 3MVJA 4KIPA 3FY0A 3RMFA 4NJDA 3GENA 4JXFA 5E92A 4JR7A 4F0FA 2ESMA 5FWKK 4X7QA 4JS8A 4I21A 4GV1A 5H8EA 2PVLA 4FIJA 5E8ZA 3LMIA 3B8QA 4JDKA 3VS3A 4WSYA 5HHWA 1VEBA 3W55A 4PNKA 4JVGA 2A19B 5HE0A 5KMMA 5KMLA 4C0TA 1J7UA 3LLAA 3QKKA 1XHAA 2I40A 3O7LD 3UVPA 4FTQA 4I6HA 5EFQA 4E5WA 3F5GA 1OL7A 3LFDA 4YZMA 5C26A 4XV3A 3DBCA 3F7WA 4RX7A 3GU6A 2R0UA 3HX4A 4HNFA 3OF0A 4G6LA 5FD2A 3R73A 3ZM9A 4LI5A 1H08A 3MY1A 4DCEA 3OS3A 3IQ7A 3RK9A 4AT3A 5AUWA 2IPXA 3R30A 3HMOA 5FP5A 2X7OA 2YIRA 3ALNA 4UMUA 2NNWB 4DHIB 3C5UA 4F64A 4LYNA 2Z7SA 4FZFB 4FA2A 5AUZA 4H36A 2OZOA 4MXZA 4ZTHA 5JSMA 4I94A 4RQKA 4GUEA 2OW3A 4E4XA 3KEXA 2ZM3A 5KX8A 3UPZA 2C6OA 3C4ZA 3GCQA 3O23A 3DY7A 4KABA 4LOPA 5E9EA 1OBDA 2OK1A 5EI8A 2J0KA 3QHRA 2RL5A 2P0CA 4O7SA 5HTCA 3HMNA 5DR6A 4ALUA 1MQBA 3SD0A 2J90A 2RFSA 3FMMA 4M66A 4U44A 2XALA 4DTAA 4FSMA 2QLQA 1BI7A 1YWRA 3OBJA 4MBIA 3LMGA 5HCYA 2XK9A 4Y83A 1JPAA 4BB4A 4AXCA 4RJ7A 5CF5A 5HGIA 3G6HA 5AIKA 4MWIA 3PP1A 3BGZA 2CSNA 4CCBA 1BL7A 3DJ6A 2YCSA 3MV5A 2GNHA 2WMUA 4I6LA 4YJRA 4EQMA 5EW9A 4TNDA 5FEDA 3F2NA 1KV1A 1J7LA 4RJ6A 3R22A 4IZAA 1Z9XA 4XV1A 2WMBA 2XZSA 5L2QA 3V01A 3OUNB 3AKJA 4WNMA 4O86A 3S4QA 3WZUA 2JDRA 4F78A 3R9NA 2WGJA 4XV2A 3R7OA 4NU1A 5BUEA 1ZMWA 4FK3A 2X2LA 4UXLA 3FKNA 5CTPA 1ZY5A 4ANMA 2J9MA 3OXZA 2W9FB 2PE1A 2ZDTA 3JYAA 3OWKA 4KIQA 4TYJA 3BGQA 3ZCLA 2PHKA 4F70A 4MNEA 3IECA 3GT8A 4OTGA 1GIHA 1UU7A 4FF8A 5C9CA 4D4RA 2W7XA 3F3TA 4BBEA 1W2CA 2JAVA 4XG6A 3JPVA 4FMQA 5C8MA 4WOVA 3QYZA 4YBJA 5F4NA 3BQRA 5JFWA 3PPKA 4C8BA 3WZKA 3FQSA 4E3CA 2ITXA 2A0CX 4EH2A 3DJ5A 2WELA 4JG6A 3ZFMA 2R0IA 3A2CA 4QTCA 5IH5A 4FT7A 2W99B 1VYWA 5TOZA 3MJ2A 3PIZA 4MAOA 5M44A 1BMKA 5ANDA 4D9UA 3UGCA 4YZBA 2FGIA 3KFAA 4O27B 3UG1A 4CTBA 2YM8A 5KNJA 2QR7A 2VTNA 2WMAA 3HDMA 4UBAA 1W0XC 3NS9A 3SW4A 3MVMA 1CTPE 3QUEA 4AN2A 3KXZA 4YURA 3NW6A 4U7ZA 3CKWA 1OL6A 2Y8OA 3DB8A 4P4CA 2HWOA 3BU3A 3HMPA 3OMVA 4GVJA 4XG9A 3RVGA 3SV0A 1IR3A 4QP7A 4R5SA 5EKOA 2VTTA 2YWPA 4EYMA 3TM0A 1IAHA 4QMUA 3R8PA 4TYGA 1OPJA 1XH5A 3UP7A 3WILA 3U55A 2JKQA 3ORZA 3QRIA 4QMZA 3KA0A 1UU9A 3GU7A 3Q5IA 4IB5A 5CZIA 5A6OA 2J7TA 4AT5A 3VQUA 4AACA 5FEQA 5F1ZA 3H0ZA 3WF8A 3Q4CA 4AGUA 3R63A 4LOOA 2A27A 2BR1A 4GU6A 4P2KA 5HTIA 4W8EA 4USEA 2W1GA 3U6IA 3FMEA 2Z02A 4TWNA 3QC4A 2BRBA 2QNJA 4KIOA 4X3JA 5TO8A 4QO9A 5B0XA 3QCXA 5T68A 3VJOA 3QQLA 3ZRMA 3UMWA 5I9XA 1W2DA 3QRJA 3FEGA 1OKVA 3QTUA 4LV7A 4IM0A 3QUPA 4F99A 2XNEA 4R6VA 2OH0E 4YHFA 4EH9A 1M2QA 2HZ0A 2OJFE 2W1DA 5J9YA 2R5TA 3DJ7A 3MW1A 3E8EA 2ZOQA 2RG5A 2R3PA 4GVAA 3FY2A 2VTOA 1FBNA 4QYFA 2PZ5A 4FTCA 5CNNA 1TFFA 4FVPA 4HYSA 1B6CB 2V7AA 4DG2E 3EWHA 2J0JA 4XG3A 2VTMA 4LQMA 4E93A 1UU3A 3TEIA 2XRWA 4U0IA 3GOKA 2O5KA 3NW7A 3TTIA 3S3IA 2R3FA 2XNGA 4USFA 5K0XA 5ANEA 3RWPA 4PPAA 5EQEA 1XBBA 4IWQA 1UV5A 3R8LA 4EH4A 3A7FA 3U9CA 3LKMA 1Y6BA 3FKLA 3BYMA 3SQQA 3VO3A 3E63A 4C36A 1OKWA 2ITUA 4LGHA 2VTLA 3FWQA 2GSFA 4QP8A 4FNZA 4IJ9A 3NNVA 3FMLA 3MS9A 4YHTA 4XMOA 2J50A 2WU6A 1KWPA 3WYYA 4DFNA 4O6EA 3D4QA 5AP5A 3T3VA 4HYUA 2IZRA 1ZZ2A 1WBPA 2CKQA 3FLZA 1FMOE 4FSNA 3VONA 3PLAE 4AN9A 2X8IA 1KOAA 5AP7A 5AA9A 5K4JA 3A60A 3FQHA 5KKRB 1M2PA 3IDCA 4XRLA 4F6WA 2UW7A 1IA8A 3PG3A 4Y72A 1SZMA 4YU2A 2F49A 4C4FA 2F57A 3KXNA 4JAJA 3VWAA 3W10A 4BI2A 2YDIA 3QXPA 3NGAA 4BJJB 2NPQA 3ORKA 3ZH8A 2XK3A 3L8PA 4E73A 3C9WA 4UXQA 3VS2A 5EYDA 2BAKA 2C1BA 2YWVA 5BVWA 5KHWA 4DDGA 3H0YA 3KCKA 4RIXB 4U5JA 5HOAA 3Q53A 3FC2A 4BCMA 4C4GA 2VD5A 4BVUA 3FI2A 4FI1A 4IANA 3ZSIA 5JGBA 2CNUA 4B4LA 1TZDA 3UE4A 2WTWA 3U51A 3ULZA 3VUKA 4NTTA 3VBQA 4ANLA 3HV3A 2ZM4A 4O4CA 4XOZA 3OT8A 3JR1A 5BV3A 2X8DA 2HZIA 3DNDA 4K6ZA 4LRKA 3VS4A 5IEXA 4BCJA 4RFZA 3I5ZA 4TZRA 3TNHA 3TXOA 4EOOA 2J6MA 4RIOA 1GAGA 1K3AA 3UDZA 3BWJA 5HIDA 3LQ5A 4B0GA 4BRXA 3CY3A 3AKLA 4O22A 2QHNA 4F7LA 3ZDIA 3AOXA 1Q61A 2HCKA 4O0YA 1O6YA 4QPMA 3OOMA 4AZSA 2BRGA 2XBAA 4QMXA 2WFYA 1WMKA 4D0XA 5M57A 5CF6A 3PUFC 5BQ0A 4J8MA 4PL5A 3RKBA 1PY5A 4WNOA 1AQ1A 1GOLA 5EOLA 4ZTMA 1W82A 2JITA 2QONA 4D55A 4QP4A 3AT4A 4ANQA 4UZHA 2UZWE 2YM3A 2OG8A 4KBAA 3L9PA 3PE1A 3RCJA 5GIOE 2WTVA 3QX4A 4FUXA 1ZLTA 4AZVA 4G9RA 5LMBA 4NM5A 3VBTA 3PDTA 4F1TA 2W1IA 2FYSA 1LR4A 5AFVA 2IG7A 2BTSA 2Z2WA 1JLUE 1ZMUA 3KRXA 4LMUA 1H1WA 2UZTA 3SC1A 5JGAA 4MHAA 4MUQA 2PK9A 2XF0A 4L00A 5IKWA 4H1JA 1E1XA 2ONLC 1H27A 1K9AA 1JBPE 1Q62A 3A4PA 3QQJA 4YJQA 5F95A 4DFBA 3NPCA 5DPVA 3ORLA 2I0YA 4FGRA 3W0PA 2XJ2A 2IVSA 3ROCA 4U9AA 4X2NA 2PVMA 3UNJA 4L3JA 1DM2A 4AQCA 5LARA 5EDPA 4GFMA 4AFEA 1UU8A 5AV0A 3R1SA 5A46A 4G6OA 4OBPA 3JVSA 3TT0A 1Q4LA 4CXAA 2J5FA 4IX5A 3POZA 2UW3A 3LW0A 2BROA 3MY0A 2W4OA 5ACKA 3BKBA 3QTSA 4ZSLA 5M55A 4DLJA 2HENA 2PE0A 2WQMA 4V04A 4XV9A 2J0MB 3SG9A 3TIYA 2Y9QA 3QQHA 3HRCA 3BIZA 5JFSA 4CYIA 4KBKA 3KRJA 1W84A 2ZV9A 5BVNA 2RKUA 2AC3A 2JFMA 3FKOA 3DBFA 3PE2A 4WT6A 3RAIA 5E8WA 3GGFA 3B2WA 5HX8A 4IMYA 3DBQA 4DT8A 3FL5A 4GJ2A 3BU6A 2CGWA 3VUHA 5FUTA 4FV0A 2O65A 2ITNA 2VWUA 4QMWA 2VGOA 2FVDA 4AP7A 4EL9A 4F9BA 5BVDA 3BL7A 4QTEA 1OECA 3MFRA 3V5QA 4DHZA 2C5YA 3DK3A 4YZDA 4EOPA 3LFAA 3SA0A 2X9EA 4GUBA 4AXFA 4FV1A 3KC3A 2B1PA 3QX2A 4DTKA 2R3HA 2Z7QA 4NKSA 3VUTA 4M84A 3E5AA 4TWOA 3W16A 5IQFA 2WO6A 3CKXA 2YHVA 5EDRA 2R3QA 3PZHA 1GZ8A 5AR3A 3DB6A 5ANIA 3NUXA 3OWPA 4IB0A 3IW8A 4ANOA 4FKLA 4D1XA 4TRLA 2XJ0A 4L01A 2BKZA 4QT1A 2W5AA 1LUFA 4K11A 4C35A 1WBSA 2OWBA 5E8SA 3F6XA 2VWXA 1BI8A 3Q9YA 5HBHA 3TI1A 2VTHA 1OL1A 1U54B 3CS9A 3RNIA 4FNYA 1R0EA 4QMPA 4DGNA 4BY9E 1Z5MA 2UZOA 3FSFA 1RJBA 2QR8A 5AIRA 2X39A 1Q8WA 4AW0A 4EQCA 4OTRA 4A9TA 4ZY4A 5H8GA 4ZSEA 4UV0A 3ZRLA 2E2BA 4H05A 2XNMA 4NEUA 2C0OA 3OD6X 3EQGA 3AC8A 4ZLOA 3GUBA 2OU7A 1ZAOA 1BKXA 2XA4A 3ZLWA 1KE9A 4FIHA 4EOLA 5DMZA 3VF9A 2ITWA 3FYJX 4DGGA 5B2KA 1JKKA 4L43A 2ITVA 2XK4A 3PJ8A 3VS6A 2QVSE 3OOGA 4LV5A 4M97A 5EHOA 5LVMA 2V5QA 3IOPA 3R0TA 5DOSA 2YIWA 2ONLA 3FMDA 5KCVA 2WMRA 4I5CA 5HVJA 5J7HA 5AAEA 2QQ7A 3HZTA 1Q8TA 4R7HA 1OIUA 4WRGA 1Y57A 5L6PA 4LDTA 4H3BA 2C5XA 3OUKA 3NAXA 2DWBA 4HCUA 4BCQA 4EORA 5IH6A 2FA2A 4A9YA 3NRMA 5AR2A 3RPSA 5K0KA 4E6DA 1WBNA 1FPUA 4BBFA 3QALE 4KBCA 3UVQA 5M09A 4AW2A 3F2RA 2NRUA 4ACMA 4EH3A 2CHLA 4ERWA 5H2UA 2YN8A 3WARA 4E4NA 3VW8A 3AMYA 4FSTA 5DBXA 2HZNA 2PVRA 4IXPA 3BX5A 4O6LA 3ZUVA 2W9ZB 1IA9A 1OMWA 4JDHA 3U87A 3FZPA 4A9RA 3VC4A 2JDOA 3HV5A 1YDSE 5HQ0A 3AD5A 3EN6A 3LLTA 4K33A 4ACCA 4S33A 3UC4A 4GFOA 2VO0A 4BDKA 4FSZA 5KBRA 3POOA 3CBLA 4FEUA 4XS2A 3ORPA 3ZSHA 1VLRA 2XCKA 3Q96A 2O64A 3K5VA 4HGLA 3PXFA 2DUVA 4MH7A 4ORKA 2W05A 4NK9A 2G01A 2GPHA 1R3CA 5JH6A 3OVVA 1XMLA 2FO0A 2WEIA 3I7BA 4GK3A 4CZTA 3COMA 4FTLA 4BI1A 3NLBA 3MH2A 5TF9A 4DAWA 2GQSA 3BV2A 4QTDA 5DIAA 3UTOA 4C57A 3VBVA 1PF8A 4QPAA 4HGSA 1YOJA 1DAYA 3NUNA 3NWWA 5EHLA 5HU3A 3TJDA 4JBQA 1XMMA 2PULA 5CXHA 1FOTA 2YITA 4MNFA 2W4JA 4FSUA 5LOHA 2B53A 2XCHA 3G2FA 4FEXA 3LVPA 4DH3A 4ZP5A 2W5HA 3DKCA 2KTYA 1KE6A 4MEDA 1GY3A 5IZFA 2IEWA 3PZEA 1U5RA 3KMMA 3RZBA 4F1MA 3DBDA 4JDJA 4Y5HA 1AD5A 2RIOA 1XJDA 2QO7A 4FKRA 4AOTA 1CM8A 1ZOHA 2W06A 3Q32A 4EKKA 4DEEA 4AU8A 2C4GA 5CSHA 2XIZA 4F9AA 3VAPA 1KUTA 4XBUA 4IADA 4AA5A 2IO6A 4R3PA 1REJA 4FV3A 4CVAA 2WEVA 5K5NA 3D94A 4RBLA 4FL2A 4RFMA 4FG8A 4CYJA 4D4VA 3LHJA 5IUHA 2C6LA 3PVUA 1I09A 2C6MA 4LRMA 4FKTA 3MFUA 4ZSGA 3HV6A 4TW9A 4WHZA 2W4KA 3D5UA 4R77A 4CKJA 3HDNA 1VYZA 4J98A 1QPCA 3D5WA 1JWHA 3R1QA 3DAEA 5I0BA 1YI4A 5AP3A 2WQOA 2JEDA 2C6TA 4RIWA 2GS7A 2X4ZA 3SKCA 4AW5A 5HVYA 3MA6A 1OBGA 4ZSJA 5I3RA 4A9UA 1ZRZA 5CALA 5CEQA 3ZU7A 4Y95A 2IZSA 1QPEA 5JQ5A 4RPVA 5BYZA