2J0IA

Crystal structure of the human p21-activated kinase 4
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
290
structure length
289
Chain Sequence
SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE PAK 4
publication title Crystal Structure of the Human P21-Activated Kinase 4
rcsb
source organism Homo sapiens
total genus 88
structure length 289
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2j0iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2j0iA01
4LOPA 2XIRA 4C57A 2XEYA 4ZTLA 4L44A 4AG8A 3MJ1A 4EOJA 3DJ7A 2YDJA 3V5TA 1B38A 3VUKA 3KF4A 3F3WA 5D12A 3UNKA 3D0EA 3PIZA 3NUXA 1WBPA 4MQ1A 4RVMA 3LFDA 4EZ7A 2BDJA 3BV2A 4KKGA 4YJUA 4WHZA 4CQGA 4XUFA 5CEPA 5IDPA 1AGWA 1A9UA 4RJ8A 4RQKA 1OL2A 4H58A 2LAVA 3LIJA 3ZONA 4FIJA 3B8RA 4D4SA 2XEZA 4IXPA 4RIYA 3KXMA 3W18A 4FT0A 3R9NA 5IU2A 2QOFA 3L9LA 5KMLA 1RW8A 4FTOA 4U5JA 4BKYA 5CQUA 3NX8A 3OMVA 5EYCA 5ICPA 3PJ2A 3AMYA 4IHPA 3C5IA 3GU7A 3G9LX 4BR3A 4DTAA 5F1ZA 3FWQA 4XV2A 3GU8A 3FJQE 3GNIB 4FKIA 3JPVA 3ORMA 3FMJA 4OBQA 4FV9A 1TQMA 3W8QA 2HXLA 2ONLA 4U7ZA 3N4VA 4DFZE 3BHYA 3UODA 5AV4A 4UBAA 3N4UA 4XJ0A 3UOKA 4FKUA 4NIFB 1AD5A 1FMKA 4Q5EA 5IG1A 5M08A 1HCKA 4FT9A 1E1XA 3BE9A 3P23A 3Q5ZA 5K3YA 3W2OA 5BVDA 4WRGA 1CKJA 4EOQA 1QPJA 2WQNA 1OI9A 3BIZA 1Q61A 2CJMA 3BU3A 3BV3A 3R7GA 1GZ8A 5JGBA 5ANJA 3MTLA 2BHEA 4MXCA 3ZSHA 2VWVA 3Q4UA 3DGKA 3NVMB 3NLBA 2C6OA 1UU8A 1T45A 4E4MA 5I5ZA 4AU8A 4FE2A 2P55A 2ERKA 3AD6A 3QC9A 1PMNA 3QQLA 4J7BA 3RAWA 3KVXA 3S4QA 3T3UA 1UNGA 5G1XA 2GNFA 1Q24A 2R3GA 1MRVA 4TT7A 1PHKA 4BDAA 5DR9A 4K2RA 5E8XA 3EQFA 1U5QA 3I6WA 4IC8A 2CNQA 3R1QA 3DA6A 4O0TA 4EH2A 4TYEA 1PXNA 5EI2A 2X81A 4OTQA 3QTRA 5CSVA 4KAOA 2IW9A 4C4IA 4M97A 2QLUA 5T6KA 3MFRA 3DZQA 4LQMA 5HBHA 2ZV9A 4EL9A 2QONA 2RGPA 2XP2A 4PL4A 5HVJA 5BPYA 5KMNA 5LQFA 2E2BA 2VTMA 2BTRA 3R2BA 2X39A 3ZU7A 4BL1A 4F6UA 3QX4A 2BRBA 4MH7A 4EOKA 5IISA 2WMXA 3LMIA 4FGRA 4ZK5A 4AW1A 4GFGA 3QL8A 2V22A 3ORTA 1TKIA 3PVWA 4EUTA 4JBPA 2VTTA 1H1RA 4GU9A 4JX3A 3F5GA 1G8SA 3ZRMA 1TQIA 3V8SA 4DLIA 3BEGA 3QKKA 4WNMA 2QKWB 4MKCA 3GC0A 4KIQA 2J90A 1HCLA 4Y95A 3BYVA 3TCPA 4A4LA 2W17A 3Q9ZA 4CZYB 4KSQA 2CLXA 2EXCX 3SRVA 3PLAE 1Q3DA 4W4VA 5AX9A 3QFVA 4QP7A 2BFXA 2XM8A 3FDNA 4GRBA 1LP4A 5DT0A 1NT2A 3LLAA 5GJDA 3QYZA 4E5AX 3AXWA 4ZLOA 2R3MA 4MNEB 1Q8YA 2YM3A 4G9CA 1KV1A 4QP3A 3RPYA 3SKCA 4Z16A 1IR3A 2WPAA 1XH4A 4KIKA 3QALE 4E7WA 1ZZ2A 4ZTMA 4FTRA 2B55A 4JL9A 2W96B 4U44A 3UE4A 4EOOA 3PDTA 3D83A 2G1TA 3DBFA 4EH8A 2R4BA 4TKSA 5F94A 4O96A 3DK6A 3MA6A 3A7GA 4IVAA 2B52A 4JBQA 2QOIA 3QCQA 2W1GA 2W1HA 3A60A 3PZEA 2OWBA 4JDKA 5ETCA 4ASZA 5CLPA 5TOZA 2UZOA 5D7VA 1K2PA 1GIHA 3VUDA 4BWPA 3JXWA 3FXXA 1BL7A 4W9WA 2PVHA 4G1WA 5IA2A 2QOKA 5KMMA 2PTKA 4CQEA 2OO8X 3IG7A 5C8KA 5M56A 4YHJA 5CASA 2VZ6A 2RF9A 2YM7A 4NK9A 3SXFA 3M42A 5CEIA 4QQTA 2YLEA 5EHOA 3RZBA 1P5EA 3CLYA 4D0WA 2XVDA 4AGDA 4UV0A 1JVPP 4YO4A 4M3QA 4ONAA 4BCFA 3A8XA 1YOMA 3OXTA 4FL3A 4QNAA 2WOUA 1FVVA 2UW5A 4ORKA 5BUEA 3MA3A 4D5KA 5M4IA 4YZ9A 4Y5HA 3QLGA 1YRPA 5C4LA 3HRBA 4IAZA 3U54A 4JDIA 5BUJA 4EYMA 4RJ6A 2PY3A 3KCKA 4O0WA 4QMNA 5K5XA 4FZFB 2PYWA 4G31A 4C3PA 3FMHA 5A6NA 2VO7A 2IWIA 2J6MA 4FBXA 2OIQA 4FTCA 5AP7A 3I5ZA 2YZAA 2G2FA 4FZ6A 2PMOX 3HP5A 3LPBA 4TNBA 4B9DA 4F7NA 2UW9A 2ITNA 2WTIA 3E8EA 3GOKA 3UVRA 3ZS5A 4C35A 4MD9E 2GNJA 2XIXA 3C0HA 4AOJA 3OHTA 5IEVA 3I6UA 5CVFA 4BTMA 4EYJA 5EM5A 3ZZEA 3L8SA 5J87A 4TNDA 1NVRA 3BE2A 1UA2A 2GS7A 2QO2A 4HNIA 3C0IA 4JG7A 4YURA 3SOAA 3AG9A 5KX8A 4R3RA 2J9MA 2GHMA 3D4QA 3IONA 3KL8A 3FQHA 4P2KA 4R6VA 4ZSEA 5HIEA 4X2JA 3ACJA 1YXTA 4XV9A 3QXOA 2SRCA 3CTHA 4YP8A 1Y8GA 3BELA 3C50A 3GOPA 2HZ0A 4WNPA 4IMYA 4DEDA 4BC6A 3I1AA 4RVLA 5IA0A 4X2KA 4BFMA 3VQHA 4L6QA 5CWZA 5AM6A 4IWQA 4RX8A 2ZMCA 3SC1A 2O5KA 4PMPA 5BYZA 4GT4A 2YN8A 2G15A 4BIBA 2YAKA 1VYWA 2XB7A 2CSNA 4GH2A 5BQ0A 3G51A 3NPCA 5CTPA 4ASDA 5KUPA 3R22A 4ZTHA 3CQUA 2WQOA 4NM0A 3MN3A 3R2YA 1CSNA 2G2IA 4OW8A 3OTUA 3NMUF 1JSUA 1PJKA 5IKWA 4QP6A 2VAGA 3KXNA 3FXZA 1STCE 1P14A 2VTHA 3F2AA 4UXLA 1ATPE 1OL7A 3KULB 4YHFA 4IADA 3POOA 3L8PA 4DE4A 4FZDB 3AT4A 2UVYA 4U40A 4UWCA 4D55A 2BDWA 4V04A 3DK3A 5E7RA 3TNQB 4BZNA 4HVIA 2PVYA 2B9JA 3FXWA 4XG7A 3LXLA 2ZMDA 4X2FA 5D1JA 2HWOA 2RIOA 4DGLC 5C8NA 4DFNA 3O71A 4A7CA 5EDPA 2XJ0A 3MVHA 5HX6A 5ANEA 3HKOA 3HZTA 2ZM4A 1Y91A 4DLJA 4F99A 4PPCA 3PA5A 2OFUA 2QO9A 3V8WA 2W1ZA 4XG4A 4FSMA 2ITPA 2OZAB 2OKRA 4IC7A 2PVJA 2WMUA 3AD5A 3NR9A 4WUNA 3UJGA 4L45A 4N6YA 3PIYA 4G5JA 4PTGA 2XJ2A 4L46A 1VR2A 3PRFA 5AUYA 5ANGA 2Y6OA 2BKZA 4RWLA 3GCSA 5AIRA 5HVKA 5E8SA 1WBWA 4YTFA 3SD0A 3KXXA 4U8ZA 4EHVA 4DT9A 2BRGA 2QO7A 5K0XA 4AOIA 5B2MA 2OXYA 3UP2A 4FTTA 4EZ5A 4HZRA 2FSOX 1W98A 1XWSA 3BKBA 2VNWA 4WKQA 5CY3A 3ZO4A 1UKIA 1OZ1A 3LXKA 4WD5A 5L6OA 4KABA 4MD8E 3UPZA 2ZM3A 5A4LA 5M4UA 4DGMA 1BI7A 2C6LA 3MY1A 3QWJA 3FZTA 4LRKA 3GC8A 3OT3A 1ZAOA 3NGAA 4LL0A 4R8QA 5FBOA 3R9HA 3MH3A 5FQDC 3C51A 4U97A 3V3VA 3IDCA 4G9RA 4WG3A 5DVRA 3ZO1A 4X3FA 5AUUA 3SA0A 3BQCA 3CXWA 1R78A 5DN3A 4YR8A 2GTMA 3WIGA 2XNOA 5DE2A 4TL0A 3ZEWA 3GQIA 4QP2A 1VEBA 3OOMA 3DNDA 4CRLA 5LXMA 4AACA 2C47A 1KV2A 3U6HA 3LJ2A 4ZSAA 4HGEA 3ZH8A 5GINE 2BCJA 4BHZA 4AT5A 2YERA 1YI6A 1CKIA 1JSTA 3V5QA 1H26A 1PKGA 3CTQA 1PXJA 2HOGA 3FYJX 3PY0A 3QZGA 4DF3A 5AP0A 3A62A 2QLQA 4K33A 4QP8A 4ZOGA 4FSUA 5A46A 5LVPA 2X7GA 2C0TA 3HLLA 5EQEA 5IMEA 2WIPA 4ZP5A 3K2LA 4NW5A 4RZWA 5DFPA 4ZJVA 4WBBB 3LM5A 1GY3A 3LFBA 3QX2A 3IGGA 3QCXA 2OXDA 3E88A 3FE3A 2W5BA 2FGIA 2B9HA 3PPKA 4GK4A 4U3ZA 4ZY6A 4ACDA 3EFLA 3DU8A 4Z7HA 5T68A 1ZOGA 2JIUA 4ZJIA 5IF1A 2UZLA 4ZZMA 4IZAA 5KHWA 2E9VA 4RA4A 4ZSLA 1YDTE 3HGKA 5J9ZA 4FMQA 2WTDA 5EW3A 3FEGA 3QKLA 4AN3A 5LMKA 4PNIA 2IO6A 4RQVA 4RIWA 3VF8A 4BN1A 2PVKA 3EQBA 4W4XA 2QHNA 3DBCA 5AV1A 4AZEA 4FV8A 5CEMA 1LR4A 4BCQA 3BWJA 1ZOEA 1OL1A 3THBA 5E8ZA 4ASEA 4GL9A 2XKFA 2YEXA 3VAPA 5HTIA 2W7XA 3UIBA 3FQSA 1H00A 3ORZA 4LUDA 5FWKK 1LEWA 4DG2E 1FVTA 2I0YA 2V7AA 4PDSA 3AC5A 2EXMA 5IZFA 2IVUA 3P86A 3NCGA 4OTIA 2YWPA 4XX9A 5H8GA 3PG1A 2VUWA 4NTTA 5HO8A 5HLNA 4EBVA 4BWXA 2YM8A 4K0YA 1CDKA 2R3JA 3R8UA 3W2QA 3TUBA 2GQGA 3IO7A 2V0DA 4IWOA 3RWPA 5HO7A 5L8KA 4NFNA 2OFVA 4RC4A 3MPTA 4UWBA 5L6PA 3BBTB 3V6RA 3PJ8A 3K5UA 2PPQA 3R21A 4CFVA 3EN5A 4C37A 4EQUA 1Q8UA 1Q62A 3ORNA 3LFSA 4FSQA 4BCIA 4I5PA 5EKOA 3BGPA 4QQ5A 3EHAA 3JVSA 4GJ3A 4RBLA 1ZY5A 3WZDA 4C4JA 3Q2MA 3FAAA 2PMLX 5IH5A 4RRVA 4I23A 1H1QA 2R3LA 4YNOA 2FSTX 2BMCA 2JLDA 3UPXA 3ANQA 3RMFA 4EJ7A 3PVUA 4JOAA 4YZCA 3O96A 4IX4A 4AZVA 5HD4A 4DBNA 4U6RA 1ZOHA 4BDKA 2WMSA 2WMWA 1W82A 1BI8A 3OCSA 1AQ1A 2WMRA 3E7OA 3MY0A 4QOXA 4FL1A 2BPMA 3CR0A 5EM7A 5HNGA 4C3RA 5IDNA 2PUNA 4R7IA 5I9XA 3LCDA 2CLQA 3EL7A 5H8BA 2BILB 5J1WA 3R9RA 3PXFA 4YJTA 2ZAZA 3BHVA 5G6VA 4BCOA 5AV3A 5C27A 3ALOA 2WTJA 1Y6BA 3EZRA 4EK4A 3ZM9A 5BVFA 3QQJA 3FYKX 5AAGA 4AWIA 3FI2A 3U6IA 4FKGA 1DI9A 4GT5A 4JBVA 4R1VA 4ANSA 1W0XC 3PJ3A 4ZTQA 3FQEA 4F0IA 5M07A 2UZNA 3COHA 1B6CB 2FYSA 4HJOA 4E4NA 3FLSA 5EI6A 1YOLA 2CN5A 3K5VA 4AE6A 4GT3A 4D4VA 4GEOA 4AZWA 4C8BA 5M09A 2F2CB 3R83A 3WF9A 4V0GA 4RX5A 4JX7A 2BRHA 4X7QA 4U9AA 1R0EA 4XRLA 4F1MA 3RAIA 1G5SA 5FRIA 4F09A 1IA8A 1SZMA 2BZIB 2CKOA 2GCDA 3E7VA 3OWLA 3FY0A 4BTKA 4EHEA 1VZOA 3G6HA 1Y8YA 4QMQA 4IJ9A 3V51A 3V5LA 2W4OA 4BWKA 5AAEA 3EN7A 4OGRA 3IOKA 2JKOA 3OCTA 3C4ZA 4X2GA 3TIZA 3IDPA 3RM7A 4BRXA 4D9UA 4YUQA 5HBEA 5I9ZA 1LEZA 4JRNA 4BIDA 4MWHA 3IGOA 1IRKA 1KE8A 4CKJA 4ZTRA 3CJGA 3BWFA 3QRJA 4BDGA 1OBGA 4DA5A 4YPSA 4TWCA 1FQ1B 1BMKA 3DFCB 4O0SA 1RQQA 1ZY4A 3FY2A 3G9NA 4EKKA 5CAUA 2O0UA 2C3LA 4CD0A 3NAXA 5I9YA 4JJRA 3F61A 3VIDA 3EN9A 4AP7A 4RWJA 5HIBA 4F7JA 4CV8A 2X8DA 5GZ8A 3W10A 4ID7A 4C62A 4YJNA 1CKPA 4FNWA 4CYIA 3FZRA 3LAUA 4CGAA 4FVRA 4DFXE 3DKCA 2VO0A 5C9CA 3W2CA 4BCMA 1JKTA 5J7BA 3NEWA 2WEVA 3PXKA 1OKVA 3F7ZA 5CSXA 4FSNA 4I0TA 3VO3A 3ROYA 5F20A 1ERKA 5L6WL 3F2NA 1UV5A 3OD6X 5I9WA 3NW5A 4NZWB 3QD2B 3G90X 4DC2A 1KOAA 4F08A 3G33A 4BI1A 4GIIA 4AA0A 5HBJA 3SG9A 1XBBA 5K5NA 3G0EA 4C3FA 4DH8A 2B4SB 2GPHA 4EH9A 4K9YA 3D7TB 5IEYA 4FTUA 4F64A 5TKDA 1XH9A 4RWKA 3PIXA 4GU6A 4NIFA 5H2UA 3Q96A 4XLVA 3NNUA 4CG9A 5AR2A 3R30A 3EWHA 4DGNA 5JQ5A 3VBVA 3ZBFA 1GNGA 1H0VA 4QTBA 4BCNA 5KKRC 3FMEA 3QTQA 5A4CA 4KSPA 5AV0A 4JAIA 2QC6A 2PVMA 2I0VA 3CBLA 5M53A 3TZ8A 4XYFA 5A54A 2OJ9A 4FC0A 3DPKA 2ZB0A 2XUUA 4YGAA 4BDJA 4FK6A 4ANBA 4BVUA 3VWAA 4XS2A 5HGIA 4JR7A 2J5EA 4XOZA 4E6QA 4O91A 3U87A 5HG7A 4B4LA 3OBJA 3IW4A 1WBNA 4M69B 4QMVA 4MYGA 2Y9QA 3OT8A 3AGLA 3BGQA 3NAYA 4BKZA 5A4TA 3I60A 4EOMA 2RSVA 3KY2A 2VWBA 1M14A 3BLQA 3CTJA 5DPVA 1FMOE 2QODA 3NIEA 4RGJA 1CM8A 4FV6A 4YHTA 3DK7A 4PDPA 1MRYA 2W4KA 3F5PA 2C6EA 3HA8A 2BROA 4AT3A 5A14A 2YITA 4GVJA 3R71A 4IM0A 4EOSA 4MF0A 4USEA 3BHHA 1O6YA 2X4FA 4FTIA 4I92A 5DBXA 4YJQA 2J51A 3TZ7A 2B9FA 5E8YA 4BDBA 3MVJA 4D2PA 2B53A 5BVOA 4IB1A 5JKGA 1R39A 4XP0A 3UGCA 1PYEA 4PL5A 3LQ5A 3ZLYA 3VS1A 2LGCA 3MYGA 5IQAA 5HX8A 4XG9A 3ZM4A 2OG8A 3ATTA 3GC9A 4O0RA 1NXKA 4HPUE 5A4EA 5AM7A 1H01A 3RBWA 3UTOA 4AW5A 4QTCA 3RNYA 5EQPA 2X4ZA 3F3UA 1DAYA 1NVSA 2YFXA 2VN9A 4LMUA 4IM3A 4MXXA 4U80A 3K3JA 4ACHA 4EC8A 4O7LA 3E8NA 2PUIA 4J98A 2JDVA 3SW7A 3DFAA 3BEAA 3HX4A 4P7EA 5CQWA 3TDVA 5BX0A 3I5NA 4EH4A 4EORA 5IUHA 4WNOA 5BVWA 3LE6A 5AUTA 2YCRA 3EZVA 4OTGA 4WA9A 3CPBA 4I93A 4UY9A 2H96A 1PXIA 3PSCA 5ANKA 5H8EA 4IACA 4BZDA 5LWMA 1GAGA 2XNPA 4PY1A 3SVVA 3EYHA 4G17A 4M14A 1OIUA 4XV3A 5EK7A 1UVRA 2HYYA 2HK5A 1WFCA 4A06A 5CANA 3NUSA 2YM4A 3P9JA 1OIYA 3EN6A 3DJ6A 4PL3A 4O81A 4P5QA 3OEZA 4FSRA 5ETFA 5IA5A 4HVGA 4PF4A 5CAVA 4DT8A 5DEWA 3Q5IA 1ZYJA 5GJFA 4ANQA 3FSFA 3VN9A 3QQGA 4FSWA 2BKKA 2NNWB 4YU2A 3Q9XA 3RWQA 5IQDA 4L67A 4QMYA 3A61A 3GENA 5CZHA 3MW1A 4C4GA 5M4CA 4P5ZA 1ZYSA 2XNEA 2YLFA 2ITUA 4I5HA 5IQIA 4RIOA 3BGZA 4FTMA 4CG8A 2VTSA 2F2UA 4QMMA 1KSWA 3VS3A 5E8WA 4NYEA 4XNEA 3UDBA 3TNHA 4E73A 3PY3A 3TIYA 1IEPA 2Z7LA 2R3QA 3RK7A 1NVQA 5DHJA 5GJGA 3BYUA 2ITZA 3SAYA 1PMUA 2OF4A 2PWLA 4CFMA 5B2LA 5B2KA 3S1HA 3PXYA 4QT1A 4CTBA 5EM6A 2J4ZA 5J1VA 4Z9LA 2JFLA 4ERWA 1V0PA 4CRSA 4A9UA 3ZHPC 3UOHA 3KCFA 4FKLA 4I6HA 4I4FA 3Q3BA 3ZZWA 4JR3A 4IB0A 2BUJA 3EKNA 4WNKA 3V5JA 4BHNA 1UU7A 5JZJA 4DYMA 1OPLA 2XNBA 3MIYA 4S34A 2XNGA 4AOTA 3DY7A 4D58A 3BBWA 4RX9A 5I4NA 3NYXA 4NEUA 4BZOA 1DAWA 2OJGA 3BX5A 4RC3A 3KREA 2E9UA 2BDFA 2C6DA 4EH7A 2JDOA 3ZC5A 5KE0A 4IVDA 3QZHA 4KB8A 3DQWA 4MCVA 3T8OA 4BYJA 3SG8A 3PUPA 1WVYA 4UEUA 4YZNA 2C6KA 5AR5A 1ZARA 2GHGA 5FEQA 3RI1A 3MV5A 1IAHA 2QOOA 4G5PA 3D5WA 4EH3A 3DKGA 2XF0A 4Q9ZA 1PXPA 4E6CA 1OMWA 5CF5A 1H07A 4I24A 3LZBA 4FUXA 3RAKA 4AZFA 1JKKA 4FA2A 2JKKA 4N57A 3LMHA 4GKIA 4C7TA 5HG9A 3W32A 2VGPA 5CAQA 5AP3A 1ZMWA 4I94A 4U0IA 3OCBA 3TJCA 4BCGA 2EB3A 4O7NA 2WTWA 5K0KA 4HYUA 1U4DA 1YXUA 1TVOA 3FMNA 4BGHA 1FGKA 2HAKA 4L42A 4BCPA 5HEZA 4QNYA 4UZDA 1IA9A 3ENMA 2JDRA 3VRYA 4FYOA 4FYNA 3ZUUA 4UMRA 2XJ1A 4F65A 3DKFA 2VTPA 4GUBA 5AAFA 3F88A 4IX3A 4PMMA 3FMDA 3RVGA 2UZWE 2VTIA 2WFYA 2XIYA 2UW4A 4NTSA 1ZMUA 4IBMA 3GCVA 1JQHA 4GSBA 1UWHA 5L2WA 5J9LA 2NRUA 1DM2A 1W8CA 2GTNA 2GDOA 4PDOA 4APCA 1O9UA 4DFYA 5ACKA 1H4LA 2PUUA 2XBJA 1URWA 2WB8A 2HWPA 3IQ7A 4W8DA 2EVAA 4YJPA 3LMGA 5IH6A 5TO8A 5CT0A 2X2MA 4ZLYA 2XRWA 3OWKA 2C69A 3NNWA 4D28A 3GCQA 3WZJA 3UVQA 5LMBA 3C4EA 5TR6A 3KXHA 4CNHA 3OFMA 2G2HA 2W05A 2X2KA 1WVXA 1SM2A 4A9SA 4DINA 2ZYBA 4S33A 5DNRA 1XJDA 5L2QA 1J91A 2CMWA 2VO6A 3MH0A 4XCUA 4RZVA 3ZUVA 4EONA 4LL5A 3RM6A 3FL5A 4ACGA 4O86A 1JBPE 3VBTA 4R78A 3ODYX 4DG3E 3VS5A 2R3FA 4MHAA 5BUIA 4K8AA 3LCKA 4KBCA 5JMSA 3IW6A 3QD4A 2OZAA 4I0RA 3EYGA 3MH2A 3CIKA 2CGXA 4H3QA 4F4PA 2P0CA 4W4YA 3Q6UA 1BYGA 5A6OA 3M1SA 4DFLA 3LJ0A 1TQPA 2XK4A 1GOLA 4A4OA 5DWRA 2OW3A 5E8UA 1P4OA 3AMBA 3ACKA 3IKAA 4CMTA 2PZYA 4F6SA 5BMSA 2CKQA 2VWXA 2A2AA 4QP4A 4Y8DA 3EQGA 3QTIA 1I09A 3K3IA 5EKNA 1QPEA 5KO1A 2R3OA 1Q8WA 4CLIA 3PE2A 3COIA 1XH6A 2FSMX 4UMTA 2CPKE 3TJDA 4FTQA 2X8IA 4R5YA 1PXKA 4HNFA 5HNBA 5BVEA 4EBWA 4FV7A 5E9EA 2J0LA 3VJNA 1PY5A 3IECA 1ZWSA 4E5BA 4OT5A 5HLPA 2YISA 3GT8A 3HMPA 3GUBA 5C4KA 4IWDA 4R7BA 4ITHA 1YQJA 2WU7A 2BZJA 2HIWA 1OBDA 4YMJA 3CS9A 3ETAA 3PXZA 4M12A 4O0VA 1Q8ZA 3NWWA 3QU0A 4TRLA 5AP6A 3DLZA 3CJFA 3SOCA 4ZMEA 3KRWA 3QTWA 2YJSA 3VW8A 1MQBA 3R1YA 4YC8A 2BRNA 5CVHA 5DLSA 3R9OA 3DLSA 4D5HA 3CD3A 2CGVA 2JBOA 1WMKA 5CSWA 1JNKA 1PYXA 4FNXA 3EN4A 2HW6A 3FHIA 3Q4ZA 2AUHA 4FSTA 4NFMA 5ITAA 3I79A 3CQWA 3H3CA 4J71A 4IAAA 4KINA 5CNOA 1ZYLA 4BDHA 2IPXA 2GS2A 2PK9A 3LXPA 2NPQA 3QRIA 4GG5A 4RIYB 1DI8A 1PMEA 4HW7A 5IH4A 4O2PA 5AUWA 5EW9A 4CXAA 5EYKA 3PE1A 1KWPA 5H3QA 3WF6A 4AN2A 5CNNA 3BYOA 3V5PA 2C5XA 4OAUC 4MK0A 4O7TA 3NYNA 3GP0A 4FODA 4LRMA 2OH0E 3N9XA 4NM7A 1Y6AA 4GFOA 4PP9A 4UZHA 4IDTA 3ELJA 3R7UA 4YLKA 3VBWA 4ERKA 3GQLA 4GK3A 4CKIA 4BTJA 4UXQA 3QA0A 2PUPA 4LGGA 4Z55A 3E8CA 3T9TA 5AUVA 3BPRA 5J79A 2DUVA 4I4EA 4I6QA 2XYNA 4GVAA 3D2KA 5AMNA 4ANMA 5KCVA 2W1DA 4BDFA 5IA4A 1H1WA 3P7CA 2ZB1A 4RJ5A 2JAMA 2XH5A 3FKLA 3DAJA 2QURA 4F63A 3Q04A 3HV3A 1V1KA 3VVHA 4IVBA 3KC3A 2VWZA 4BGQA 4EOIA 5KMIA 3C4XA 3ZRLA 3LFQA 4AA5A 3F3TA 3Q6WA 4MD7E 4QQJA 4CMOA 3IDBA 4AA4A 1KE9A 2J7TA 2WQMA 4FSYA 4E20A 4IW0A 4QYEA 4C61A 1KE6A 3BU6A 2WQEA 4FUYA 3SHEA 5FTQA 3WZUA 2BAJA 4DTBA 4JRVA 5LARA 4LRJA 5EHYA 3G15A 3A4OX 4K11A 4XHKB 4ITIA 4ENYA 2XRUA 3QTSA 4NU1A 2QR7A 4F70A 1YWNA 4EHGA 2P4IA 2XK6A 3UYSA 2VTQA 4NT4A 4L01A 4BDDA 5DRBA 3PY1A 2VO3A 4FKTA 3W2RA 3WF7A 5JFSA 4XBRA 3W8LA 3E5AA 2QCSA 4H05A 5DI1A 4BDIA 1J7LA 1H28A 3R04A 2VTJA 4V01A 2PVFA 4NKAA 3ET7A 3ANRA 5D11A 3MY5A 3D7ZA 3EQRA 2YCQA 2ERZE 4I20A 2QNJA 2WNTA 2O3PA 3CGOA 4IFGA 4CCBA 1FVRA 5HI2A 2WGJA 2YM6A 4D9TA 4OAVB 4O83A 4KWPA 3HAVA 4UMQA 3C5UA 4IANA 2ACXA 2CNUA 3MI9A 4G3EA 2FH9A 2V62A 3KKVA 4UYNA 3ZXZA 1RE8A 4GK2A 3RAHA 4I5MA 3VUGA 3O51A 4BCJA 2YIQA 4D1XA 2X8EA 2IZRA 5AEPA 3OTVA 5IQCA 4U3YA 3O7LD 4IM2A 4HVSA 5F9EA 5IQEA 5LWNA 2WMBA 2Q0BA 2O2UA 4EJNA 3HEGA 5EI8A 4E3CA 4L7FA 3FC1X 3CSVA 3GVUA 5A9UA 3LFEA 4WSQA 5FUTA 1PXLA 3MPAA 4FKOA 4EH5A 3R73A 4LGDA 4Y73A 4F9CA 3BRBA 3LQ3A 4PMTA 3QBNA 5BYYA 2X6DA 4E4LA 3GGFA 4WRSA 3NYVA 3R8ZA 4RJ7A 2F57A 2Y6MA 2VTAA 3E87A 3LW0A 4QYHA 5AUXA 3AGMA 4RA5A 2DS1A 2UZEA 1JKLA 3GU4A 4C2WA 2GNIA 5FTGA 5EDRA 2PMNX 4RJ4A 3VS6A 1M17A 2PZ5A 2W0JA 3TKUA 3UQGA 3WE8A 3G5DA 4EHZA 5DA3A 3V5WA 3TL8A 4KIKB 4AX8A 3W55A 4F0GA 3A7FA 3CY2A 3KRXA 4M13A 1K3AA 2UZBA 2RG6A 4EK8A 4Q2AA 3PVBA 3VHKA 4IVCA 1XBCA 4YO6A 5K4JA 4ENXA 4OTFA 2HELA 2WO6A 5KKRB 4JS8A 4OTPA 4YZBA 5CXHA 3R6XA 4PQNA 2QKRA 3LLTA 4USDA 4S30A 4FF8A 3MWUA 4U79A 5E1EA 5L2IA 4YTHA 1IAJA 1GZKA 1ZRZA 3LFAA 4C4EA 4C59A 5FP6A 4TWNA 4FVQA 3ORLA 3OZ6A 3QZFA 5KZ0A 4YTCA 4QP9A 3FLYA 2OI4X 3R28A 4PRJA 4C0TA 4FTNA 1UU3A 4L9IA 5HG8A 4ZY4A 4BBFA 4O7RA 3CEKA 4MXOA 4FEVA 1OGUA 5HG5A 3ODZX 4QPAA 2Y0AA 3MESA 1GJOA 3EOCA 4FICA 4CT1A 4DGOA 3QHWA 3HVCA 3DKOA 1CMKE 3OF0A 4J95A 2PZRA 4M66A 3BU5A 4YNEA 5HCZA 1Q97A 2F7EE 1YDRE 5C01A 3WYYA 4C4HA 5DMZA 3FUPA 4D2SA 5M44A 2XS0A 1E1VA 5M57A 3P79A 4JLCA 5E4HA 4GFMA 4HZSA 4UWYA 4PPAA 4FV0A 4FVPA 4EWQA 3AT2A 3A99A 5CT7A 5HOAA 3L9NA 1KOBA 4XRJA 1GZOA 3VHEA 1M2PA 3QC4A 4YBJA 3VF9A 2V7OA 2YCSA 4GG7A 3H9RA 4FG8A 5DRDA 5FGKA 3O17A 3ROCA 4X6RA 1OM1A 3R01A 2HENA 2A1AB 4U81A 5FM3A 4XG8A 3B2TA 3R8LA 5I9VA 2CKEA 3AMAA 4FIHA 3KRRA 1I44A 3M2WA 4I6BA 4IEBA 5M51A 4XOYA 1F3MC 4RIXA 3EL8A 3O23A 3VS7A 4U41A 2JC6A 3GC7A 2X9FA 3F7WA 4LM5A 3QTXA 5JSMA 2JITA 4E6DA 2OZOA 1H1SA 2PZPA 3P0MA 4RSSA 3KN5A 3UIUA 3FLZA 1SVEA 2W9ZB 3HMIA 2GNHA 3P4KA 4L3JA 3SQQA 3SXRA 2HZ4A 3OUNB 3EFWA 3PSDA 2OU7A 4I3ZA 4AGCA 4M0ZA 4AUAA 4D2VA 4RMZA 1YDSE 4RVTA 3VW6A 3PYYA 4BDEA 4PTCA 4O27B 1FGIA 4FGBA 2F49A 4KIPA 3U8WA 4RJ3A 2R7BA 4CFNA 4FIEA 3UZTA 3TZ9A 3FV8A 1IG1A 1YI3A 2XCKA 1X8BA 2C30A 2ITQA 4FTKA 1UNLA 4BBEA 5KMJA 4TYHA 3ZO2A 1ZMVA 3GB2A 3U51A 3CKXA 2CKPA 1VYZA 4EKLA 2XK9A 4O84A 3RK9A 2GU8A 3QUEA 5AWMA 4RPVA 3BLRA 2C6MA 3KK9A 3A7JA 1GIJA 3RKBA 4E5WA 1YWVA 4C2VA 3I4BA 5L2SA 3UNZA 4S2ZA 2CGUA 4K77A 3D5XA 3BHTA 3KQ7A 1ND4A 4AQCA 4MTAA 4D4RA 3NUAA 5B7VA 1BLXA 3VNTA 3WZEA 5HICA 3DQXA 3P7AA 3UO4A 3W33A 3H30A 4PMSA 2OJIA 4R77A 3E3BX 2GSFA 2ONLC 2BIKB 4FOCA 3BZ3A 4FX3A 4R5SA 3ZCLA 4EOPA 3GEQA 2H34A 3BI6A 1UU9A 5CI6A 2ITVA 3UYTA 2NO3A 1J7UA 1RDQE 4NUSA 4GW8A 3TNWA 3D9VA 4G2FA 2R3RA 1Y57A 4MWIA 4C58A 2W1EA 4AF3A 4CZUA 4D1ZA 4G16A 2JDTA 3QRKA 4DFBA 5KHXA 2W06A 2ZVAA 5AR7A 4FZAB 5JQ8A 4IZYA 3MFUA 3AC3A 4AN9A 2UUEA 3KK8A 2XA4A 3OW3A 2ZJWA 3UIMA 3FI8A 2ETRA 2XYUA 4G3GA 3HDNA 5B0XA 2P3GX 1LPUA 2IZTA 5HLWA 4C4FA 5JGDA 2YDKA 3UOLA 3OUKA 3W2PA 1M52A 4OT6A 4WO5A 2PVRA 2ZV8A 2P2HA 3HNGA 3OEFX 4I22A 2V5QA 5D10A 3QQFA 3QAME 5FLFA 4A07A 3R7EA 2BAKA 4OLIA 2X1NA 3G2FA 1M2RA 4F9AA 4AT4A 5JT2A 3I0OA 1XQZA 3JVRA 4FKJA 4IAYA 4QD6A 3QCSA 4LV5A 4XMOA 3VULA 3ORPA 3PRIA 4XG2A 4TZRA 4QMZA 1QL6A 4S31A 2H6DA 4AW0A 4AAAA 3ZBXA 4EK3A 5L2TA 3LFNA 2B9IA 5CF8A 1JKSA 3GXLA 4J53A 4J96A 3TACA 2B1PA 2WHBA 4QYYA 2WU6A 5CU3A 4RFZA 1SMHA 2A19B 1R0PA 2BVAA 2XBAA 2F7XE 3P1AA 2WAJA 4F7LA 2YAAA 4JI9A 4J52A 5HVYA 5L4QA 2WD1A 4IZ5A 3DDPA 2WTKB 4M7IA 2UW7A 1Z5MA 3FLQA 4CZTA 5ANOA 3Q32A 4FKRA 5LCKA 4CVAA 1YHSA 3RHXA 3EJ1A 2OK1A 4KRCA 2FSLX 1OITA 3I0QA 3MS9A 3OXIA 1JOWB 5IEXA 5EOBA 4EK5A 3R63A 4QMSA 2NP8A 3OVVA 3QZIA 4FT3A 3CC6A 3HMNA 1OECA 4P90A 4J1RA 2RL5A 2JFMA 3UZRA 3PVGA 1Z57A 3I81A 2QOQA 1PKDA 2PMIA 5I3OA 2GFSA 2R3PA 3FI3A 2PE1A 1IASA 5HNIX 5J5SA 4ALUA 3UO6A 3KXGA 3KMMA 5CF6A 2CHLA 4O0UA 5JRQA 2KULA 3H0ZA 5AFVA 1FBNA 5GIPE 2PZIA 3HUCA 2WMQA 4X0MA 5AP4A 3RHKA 2GHLA 2ZDUA 3KRJA 5KMOA 1QMZA 4ZS4A 5IUIA 4DEIA 2I1MA 3OG7A 2RFSA 3CQEA 3Q9YA 3MIAA 3IW8A 5JFVA 3E62A 3RPRA 3FPMA 2WMAA 4FTAA 4YTIA 2WTVA 3QYWA 4MXAA 4APPA 4JVGA 4ACMA 5IMXA 4IAIA 2BIYA 3WYXA 2BALA 3FHRA 4NWMA 3EIDA 5FTOA 1P2AA 4ZS0A 1PW2A 2Z7RA 5E92A 4JT3A 5AA9A 3DAKA 2CGWA 2R3NA 4CT2A 5JFWA 2Y7JA 3U9CA 4JIKA 4K6ZA 2J0KA 3TDWA 1XKKA 3LCSA 4ASXA 4CFFA 3QTZA 4IJPA 2QOBA 3PTGA 1O6LA 4O7VA 4NCTA 3P78A 3VBYA 3ZLWA 4R3CA 2YABA 1RJBA 5HORA 2JKMA 5IQFA 2Z02A 4WSYA 3C4FA 5C26A 3CE3A 4MBJA 5IPJA 2UW6A 5J9YA 3RCDA 2B54A 3KFAA 4OBPA 4M15A 3PA3A 2QI8A 1P4FA 3VUIA 2QVSE 4QTEA 3ZDUA 4HVDA 4ZAUA 3KU2A 3FC2A 2GFCA 2C3IB 1M2QA 3ATSA 3LJ1A 4CCUA 4L7SA 3BYSA 4G3CA 4AS0A 2HW7A 3F6XA 3II5A 5LVLA 3TKIA 3LCTA 4ZY5A 5CEOA 1Q4LA 4X3JA 4E26A 2IN6A 4L52A 4I41A 2IZSA 3O50A 3F3ZA 3NUPA 2UVXA 1BKXA 4RVKA 1YKRA 1SNUA 4YLJA 3H10A 4PPBA 1OKZA 1W84A 4UYAA 3HL7A 3BYMA 1WZYA 4GMYA 3OS3A 3PP0A 4MNEA 5CSHA 4J99A 2W9FB 2C5NA 3HMMA 3UIXA 3FKNA 1MRUA 2JIVA 3AC1A 4XV1A 5HCXA 4PP7A 4LUEA 1WBSA 2YHVA 1QPCA 5LVOA 4YZMA 1REJA 5KMKA 2IVVA 3O8UA 4XG3A 3A2CA 3VQUA 1U59A 3UMXA 2YM5A 4OTDA 3N4TA 2J2IB 2UZVA 3TT0A 3NNVA 1OL5A 4ZSJA 4E4XA 2W1FA 2V55A 2HZNA 2NRYA 2VTLA 2REIA 4HGTA 4PNKA 1BUHA 3DXNA 1YVJA 4BBMA 4EQCA 5T3QA 2B0QA 3PJ1A 1G8AA 3BCEA 3C0GA 3NIZA 2XK7A 4G6LA 5L8LA 2WEIA 5HE3A 3I7CA 3R1SA 4IB3A 3HDMA 4NM3A 3PFQA 3VBQA 5C8MA 3GCUA 5DT4A 2I0HA 2O65A 4XP2A 2VX3A 3DB8A 5CU2A 2GQRA 3IW5A 4IQ6A 4MX9A 2C3JA 3KXZA 4LOOA 4BB4A 3UQCA 1B39A 3MDYA 3ID6C 4NSTA 2QD9A 1MUOA 2O8YA 3AD4A 2PVNA 3SW4A 1PMVA 4DG0E 3ENHA 2G01A 1XBAA 2QQ7A 1T46A 2IZUA 2C3KA 2W1CA 4TXCA 4O7SA 2C5OA 4Z3VA 3ZFYA 3S3IA 4JBOA 3DXPA 3RINA 3FZPA 2AC3A 2J0JA 3Q4CA 4QMLA 2R0IA 4YZDA 3SDJA 3F82A 3PLSA 5K9IA 4EOLA 5M55A 3GBZA 1S9JA 2JBPA 2Q0NA 2C4GA 5FEEA 4H1JA 2PSQA 4W9XA 3LFCA 5E90A 4KD1A 3ZFXA 2JIIA 4O0XA 4QPSA 2VWWA 3EKKA 2H8HA 4Q9SA 4LI5A 4R1YA 4YJRA 2R0UA 3WARA 4MBIA 4BICA 4TN6A 5HHWA 2ZV2A 5ANDA 3LVPA 5GHVA 5CEQA 3U6JA 5D9HA 3QQKA 1BX6A 2X6EA 5ACBC 4GV1A 4DH1A 3CGFA 5JEBA 5LVMA 3QLFA 5IA1A 2EU9A 2W5HA 3KMWA 3R00A 4AFEA 3R8PA 3F3VA 3KN6A 4HCUA 4X3FC 1KUTA 4ANOA 3L9PA 3DS6A 4U43A 3NNXA 4XG6A 4QRCA 4K1BA 3RPSA 3UOJA 3UC4A 4DEGA 1UNHA 1YI4A 2ETKA 4O38A 3W16A 3W2SA 1S9IA 4MXZA 3LKMA 4IAKA 4IDVA 3H0YA 4FI1A 4R7HA 5C03A 3QRUA 2WMTA 5KNJA 2R5TA 2JAVA 5DEYA 3HV5A 4ZZNA 4FSZA 2UZUE 4GJ2A 5BNJA 3D14A 5E8VA 4F9BA 4KA3A 3COMA 3MJ2A 3UG2A 2JGZA 3N51A 4YBKA 3KULA 5FM2A 3ZC6A 4DH3A 4DN5A 5EFQA 2FO0A 4AFJA 4N70A 2RKUA 4N0SA 5CU4A 2XIZA 3P7BA 4NKSA 3QXPA 5D7AA 2QG7A 2UW8A 4WT6A 4QMWA 5AIKA 1Q8TA 4EQMA 3LHJA 2R2PA 3A8WA 2WTKC 3KB7A 3JS2A 3NCZA 1SNXA 3OWJA 4USFA 3CY3A 4C36A 5HU9A 1KE5A 3DB6A 2UV2A 3L9MA 4KUJA 3EFJA 4O1OA 5E8TA 3QD0A 3DBEA 5J95A 1PF8A 4DH5A 5I9UA 4O82A 3NSZA 2A4LA 4O6LA 4WG5A 2I7QA 5AP2A 5TT7A 4TW9A 4AGWA 5DH3A 1Q5KA 5BMMA 3TKHA 3U4WA 4QMTA 1J3HA 4DITA 5CEKA 4O1PA 1H08A 4I21A 3AC8A 4XH6A 5CX9A 4RFMA 4YJSA 2C1BA 2WTCA 3AQVA 4KS7A 4Y83A 4YPDA 5DR2A 4D2RA 3OY3A 4ALVA 4F7SA 2IG7A 3R1NA 4L3LA 3OP5A 2HCKA 3AC4A 4F9WA 1L8TA 4MNFA 2DYLA 4FKWA 4O0YA 2J0MB 1BL6A 5JN2A 4FZ7A 3FMMA 1J7IA 3AC2A 4BIEA 4MBLA 3R8VA 5FXQA 1XR1A 4PWNA 4GS6A 4D0XA 3VUMA 4O21A 4FEQA 4E93A 3DZOA 4GYIA 3HECA 3TNPC 5JRSA 3NRMA 5AV2A 4EZ3A 4B99A 1Q3WA 2C6TA 3UG1A 3POZA 5DYJA 1U54B 3DDQA 1WBVA 2OGVA 4WOVA 4HYIA 4DAWA 5J5TA 1H24A 4ACCA 4FV3A 4AGUA 3ZTXA 2F7ZE 2VTOA 3Q53A 5LVNA 4P4CA 4M84A 3UQFA 3Q52A 3EB0A 3D94A 5CS6A 2YDIA 5AX3A 1U5RA 5JGAA 3ZO3A 5IQBA 1OPJA 4L43A 3ZMMA 3LOKA 3CPCA 4FKQA 4IWPA 1MQ4A 5AR4A 3RPOA 2XNNA 3COKA 4U45A 3ZSIA 3LCOA 3NUNA 4HVHA 2IW6A 3EMGA 3CCNA 3D2IA 1G3NA 5BVKA 5DR6A 2R3IA 4KS8A 4RWIA 5FDPA 1SVHA 3MB6A 5HIDA 2FB8A 3E64A 4ANLA 3UC3A 4N4SA 2VNYA 3MGYA 3PXRA 3VS0A 5FD2A 2VWYA 4H3BA 3WIKA 2E9NA 4X2NA 4BYIA 1M7QA 4D2WA 4FEXA 4ZMFA 4UB7A 3IOPA 5M4FA 4W4WA 4AZSA 3F66A 3UMWA 1J1BA 4ZSGA 3TWJA 3ZFMA 4OBOA 2Z60A 3S2PA 4DBXA 3FL4A 4EI4A 1Q41A 2OJJA 3NS9A 4O2ZA 4TPTA 2FA2A 3ZSGA 4ALWA 4BI2A 3K54A 5H9BA 4I0SA 4FNYA 3PPJA 4FV1A 4W8EA 3FZ1A 5KBRA 4D1SA 1FOTA 2KTYA 3DCVA 3ERKA 3NYOA 1OUYA 2QG5A 2ZM1A 2OIDA 4BCKA 2QU6A 4F9YA 1R3CA 1PRYA 4OR5A 3AT3A 4MVFA 1APME 5JFXA 3R9DA 3ALNA 4OTWA 5CAOA 3MFTA 1H27A 2OBJA 4DEHA 5I0BA 2P33A 3HMOA 3L1SA 3WZKA 4JQ8A 2HXQA 3LQ8A 1V0BA 3KEXA 2ITOA 2WOTA 4M67A 5ETAA 5FDXA 3L8XA 3TEIA 4FTJA 2VX1A 5C1QB 2VWIA 4BKJA 2VTNA 2OH4A 2CCIA 2Y4IC 4C38A 2ETMA 2ZV7A 2PE2A 3ZEPA 4FL2A 4J97A 3RZFA 2VX0A 3ORKA 3D5UA 3IS5A 3GU6A 1E9HA 3F2RA 5DT3A 4XEYA 3GFEA 4KRDA 5CAPA 5IA3A 3JR1A 2XKCA 4IE9A 3QQHA 4FV2A 4WIHA 3MSSA 3QQUA 4JAJA 4FIFA 1ZYDA 3Q9WA 5HU3A 1V0OA 4B8LA 5LJJA 2CNVA 1YXXA 5KZIA 2BZKB 4QMUA 2OICA 1WAKA 3RALA 1JAMA 2RG5A 3GI3A 5L8JA 4ZJJA 3DNEA 3Q60A 3HV6A 3SRVB 2W1IA 3WOWA 2YWVA 2PE0A 1HOWA 2FVDA 2GMXA 2EUFB 2R7IA 3SLSA 3PP1A 4A4XA 4C02A 3A7IA 2OSCA 4B6LA 2ESMA 2VWUA 3M11A 1A06A 3UP7A 2XK8A 5EYMA 3R02A 5ANIA 3OROA 3DOGA 3UVPA 5GIOE 3JY9A 4FKSA 3S95A 2OIBA 4F6WA 3R7VA 2C5VA 3ZRKA 5IQHA 3ORIA 3F5XA 4LYNA 3QD3A 4KIOA 4PX6A 5HKMA 3R7YA 1OPKA 4ZTNA 3DAEA 4Z7GA 4FV5A 3MBLA 4YLLA 4G34A 2VRXA 5HTCA 1H0WA 3U9NA 4AXAA 5EDQA 4MF1A 3TV7A 3VS2A 2GQSA 5CI7A 3E3PA 3QWKA 3A7HA 1VJYA 4YC6A 2VU3A 5E1SA 5EOLA 5EW8A 5D41A 3ULZA 2XMYA 2WQBA 3WE4A 5LMKC 3JUHA 4NW6A 1ZYCA 4EH6A 2YIRA 1MP8A 5BYLA 4BY9E 4TWPA 3UZPA 4XBUA 2CDZA 5FEDA 2F4JA 2PU8A 2OF2A 3FMKA 4FV4A 2Z7QA 5EM8A 3DTCA 3V01A 4JNWA 2Z8CA 4XLIA 2W5AA 3FSKA 4QQCA 3C4WA 4DTKA 4YC3A 3HA6A 4C33A 3TZMA 4ZEGA 4ZZOA 5HD7A 3RCJA 4IH8A 4NCTC 4CV9A 4FNZA 4O6EA 2CCHA 5JK3A 2RFNA 3UNJA 2UZTA 2VGOA 5HE2A 4JDJA 3ORXA 4IAFA 5HO6A 3WILA 3ZLSA 2BTSA 4J8NA 4X21A 3ZUTA 4FKVA 2ITXA 3TI1A 3O2MA 2PL0A 1JSVA 3LM0A 4L3PA 4OUCA 4EWHA 2DWBA 3VUHA 3F69A 1YOJA 4NM5A 3RTPA 4DH7A 3FKOA 3OXZA 4YJVA 5J8IA 3DXQA 3CP9A 3KGAA 3QF9A 4F1TA 5AR3A 1OKWA 3Q2JA 4QMOA 3MB7A 3ULIA 3PPZA 4L8MA 4UMUA 1H8FA 3OWPA 5DOSA 1REKA 2J5FA 4G3FA 5TE0A 3REPA 5KBQA 2UW0A 4D2TA 4E6AA 4B8MA 4JDHA 2ZDTA 1R1WA 1XO2B 2WIHA 4G6NA 2PVLA 3TNIA 4DEAA 4NL0A 3PZHA 3MFSA 3NUUA 3HAMA 4BCHA 3LFFA 4H1MA 3TV6A 4NJ3A 5HE1A 4TY1A 3TTIA 3B2WA 1XH7A 2C1AA 2J0IA 3LXNA 4GIHA 4H39A 3D7TA 3VUTA 4FT5A 5IQGA 2OXXA 3OW4A 4CKRA 2QHMA 3NVKI 4HPTE 4II5A 4R3PA 2BR1A 4G3DA 1KE7A 1YW2A 3PXQA 5ETIA 5EG3A 5HESA 5GZ9A 4C34A 1ZXEA 3QKMA 4ARKA 5CF4A 3SV0A 1YHVA 3WF5A 4DGGA 4FKPA 2PHKA 2RFDA 4F0FA 5CSPA 5FXRA 4LFIA 2YIXA 3DV3A 1YXVA 4WG4A 5I3RA 4HGSA 5F4NA 1FINA 2W4JA 3PWDA 3FZOA 2YIWA 2C5YA 4QTAA 2IW8A 3ZOSA 2QU5A 4OTHA 3HV4A 3IW7A 2XIKA 1UKHA 3PWYA 3VBXA 3FPQA 3GFWA 4B0GA 2WZJA 3HRCA 4GYGA 3BHUA 2Z2WA 4HGLA 1J1CA 2JD5A 4ZXTA 4M69A 3T9IA 3CKWA 4I1ZA 1XH8A 4CTCA 4Y85A 3GU5A 2R9SA 3FBVA 4H36A 2YCFA 3JY0A 3U55A 2XM9A 3EQDA 4HYSA 5FBNC 3C9WA 2Z7SA 2E9OA 4EEVA 3T3VA 4QYFA 3ZDIA 1NA7A 2HZIA 3QA8A 3V8TA 5EQYA 4EC9A 4I6FA 2Y4PA 3SGCA 1U46A 1K9AA 3RNIA 1PXMA 2G9XA 4RLLA 2VV9A 5AADA 3UBDA 5HZNA 4PDYA 2DQ7X 4L53A 1OIRA 2X0GA 3HRFA 3CD8A 1UWJA 4JQ7A 4LOQA 3A4PA 3QCYA 3U4UA 4WUAA 4RFYA 3VS4A 3QHRA 3OC1A 4BF2A 5E91A 1WBTA 4S32A 1F0QA 2OJFE 2WXVA 1OL6A 4X6QC 3R7OA 4A9TA 4E8AA 3C13A 3DJ5A 1OKYA 1XHAA 3EFKA 2AYPA 5EH0A 4EK6A 3KF7A 4DHFA 4J8MA 2X7FA 4U42A 3TN8A 2GNGA 4CEGA 4DCAA 2YZLA 2RFEA 1YWRA 2BZHB 1SYKA 2CN8A 4CYJA 4K18A 3KMUA 3P5KA 4RX7A 3PJCA 2VD5A 4BTFA 2I40A 2ITWA 3P08A 3V04A 1FPUA 3DTWA 1JLUE 4PTEA 3OBGA 3TTJA 2Q83A 3TG1A 3NZ0A 5LCJA 4JQEA 2BAQA 1OB3A 2UZDA 2XZSA 3VRZA 3EQCA 4X3FB 3G0FA 1F5QA 4N6ZA 2GNLA 3QTUA 3BLHA 4AZTA 2R64A 4FIGA 4FG9A 3HYHA 1EH4A 2QOLA 1O6KA 4AW2A 5CALA 1H25A 4Y5QA 4DCEA 4V05A 1OUKA 5K4IA 2IJMA 5LOHA 5CZIA 2IVSA 5CU0A 1LUFA 3JYAA 3NUYA 5HE0A 4IFCA 5AUZA 1URCA 3OOGA 2I6LA 2O63A 1L3RE 4UX9A 4FG7A 4B7TA 1ZLTA 2UVZA 3ZYAA 3H9FA 3I7BA 4MXYA 4L68A 4EUUA 4F1OA 2ITYA 2J50A 3SXSA 4NJDA 2OLCA 1ZZLA 2HY0A 3MVMA 4ITJA 4KNBA 4UMPA 5AA8A 4CFXA 2BFYA 5J7HA 2WMVA 2O64A 4JG8A 3TUDA 3UO5A 2UW3A 5DG5A 2FUMA 3NW7A 1NW1A 3MH1A 4FEWA 3RP9A 4IX6A 3HV7A 3ZXTA 3IPHA 1M7NA 4FT7A 3OY1A 5AP1A 5A4QA 5HCYA 3TV4A 3G6GA 2XNMA 2QR8A 4TWOA 4DEEA 4XP3A 4MAOA 1WBOA 5GZAA 1WVWA 2X7OA 3NDMA 4QTDA 2XK3A 4DFUA 3F5UA 3PG3A 3O8PA 4TYGA 4HYHA 2ITTA 5CENA 5F95A 4YSJA 4RIWB 3E8DA 3QGYA 3WF8A 4RC2A 4E1ZA 4DEBA 5EHLA 3C1XA 2YJRA 1QCFA 4QMPA 5LMAA 2WKMA 2F9GA 3L8VA 3RK5A 3C7QA 2H9VA 4GUEA 4A9RA 4M0YA 2XCHA 3MVLA 3E92A 4MEDA 1WCCA 3MTFA 4UN0C 4PUZA 3BQRA 2Y8OA 3E93A 3QRTA 4CFUA 1JPAA 2EB2A 5GNKA 3F9NA 3RJCA 4CFWA 3OCGA 4RIXB 3WBLA 4O7YA 4JIAA 3VC4A 2XKDA 2QOCA 5L3AA 3S00A 3EQIA 4O22A 5FP5A 5FXSA 3R7IA 2EXEA 4CMUA 4RT7A 3EQPA 5DIAA 5TF9A 2C0IA 3O8TA 4H3PA 4YSMA 3DBQA 1DS5A 5CXZA 4M68A 2BRMA 1QPDA 4Y72A 4FK3A 1YXSA 3W1FA 2ZOQA 3AOXA 4ZIMA 1H1PA 3NW6A 4TTHB 4QO9A 2YIYA 2C0OA 2BHHA 4LGHA 5M06A 3GCPA 2A0CX 2E9PA 4HCTA 2IVTA 1GIIA 3C4CA 4NH1A 1Q99A 4LMNA 2PULA 3EH9A 3TM0A 4BI0A 4FOBA 4KBKA 4M8TA 3HUBA 5EYDA 5JH6A 1XH5A 3DT1A 4Y46A 2GS6A 4LV8A 2YA9A 4IIRA 5IUGA 1NY3A 2EWAA 4WBOA 4TYHB 3V6SA 4Q5HA 4O7WA 3MPMA 2XKEA 4G6OA 4BGGA 2R3KA 4KKEA 3E63A 3ZLXA 3D15A 3QUPA 4KBAA 3WI6A 3D5VA 3SX9A 3TUCA 2B7AA 3DBDA 2C68A 2P2IA 1A48A 4ZLZA 5JZNA 5AJQA 2X2LA 3Q4TA 4YJOA 4LG4A 5CVGA 1JWHA 1Z9XA 4HCVA 3KA0A 4IB5A 4AE9A 5HQ0A 3EQHA 2C6IA 2VTRA 2I0EA 5FG8A 4QP1A 4A9YA 4I5CA 5CU6A 3PA4A 2JKQA 3FLNC 3O0GA 4TYIA 3RPVA 2W99B 4ZTSA 1YHWA 3O7LB 4MQ2A 3RGFA 3PSBA 2AC5A 4FEUA 3FMLA 3HP2A 3QUDA 1PXOA 2R3HA 4KKHA 3R0TA 4QPMA 1SVGA 4V0GB 3IK3A 3KVWA 3H4JA 4RLKA 3TXOA 3S0OA 4O7ZA 2YACA 4JXFA 1GZNA 2X9EA 2QOHA 4L00A 3H9OA 3ITZA 4PV0A 3FZSA 5AP5A 1OIQA 4OTRA 3VJOA 3FI4A 4FTLA 4HOKA 2HY81 1OVEA 1W83A 4GKHA 5BVNA 4BDCA 4CSVA 5HTBA 2A27A 1W7HA 1CTPE 4GCJA 3B8QA 2WELA 4QMXA 4CLJA 4ANNA 4TYJA 4FR4A 4JG6A 4IZ7A 4QYGA 5AR8A 5A3XA 3R8MA 4IX5A 2Y4IB 3QGWA 3KRLA 4UALA 5DGZA 2JDSA 4D4YA 2JEDA 4FIIA 1U54A 4RG0A 3FLWA 5CYIA
chains in the Genus database with same CATH superfamily
4LOPA 2XIRA 4C57A 2XEYA 4ZTLA 4L44A 4AG8A 3MJ1A 4EOJA 3DJ7A 2YDJA 3V5TA 1B38A 3VUKA 3KF4A 3F3WA 5D12A 3UNKA 3D0EA 3PIZA 3NUXA 1WBPA 4MQ1A 4RVMA 3LFDA 4EZ7A 2BDJA 3BV2A 4KKGA 4YJUA 4WHZA 4CQGA 4XUFA 5CEPA 5IDPA 1AGWA 1A9UA 4RJ8A 4RQKA 1OL2A 4H58A 2LAVA 3LIJA 3ZONA 4FIJA 3B8RA 4D4SA 2XEZA 4IXPA 4RIYA 3KXMA 3W18A 4FT0A 3R9NA 5IU2A 2QOFA 3L9LA 5KMLA 1RW8A 4FTOA 4U5JA 4BKYA 5CQUA 3NX8A 3OMVA 5EYCA 5ICPA 3PJ2A 3AMYA 4IHPA 3C5IA 3GU7A 3G9LX 4BR3A 4DTAA 5F1ZA 3FWQA 4XV2A 3GU8A 3FJQE 3GNIB 4FKIA 3JPVA 3ORMA 3FMJA 4OBQA 3W0MA 4FV9A 1TQMA 3W8QA 2HXLA 2ONLA 4U7ZA 3N4VA 4DFZE 3BHYA 3UODA 5AV4A 4UBAA 3N4UA 4XJ0A 3UOKA 4FKUA 4NIFB 1AD5A 1FMKA 4Q5EA 5IG1A 5M08A 1HCKA 4FT9A 1E1XA 3BE9A 3P23A 3Q5ZA 5K3YA 3W2OA 5BVDA 4WRGA 1CKJA 4EOQA 1QPJA 2WQNA 1OI9A 3BIZA 1Q61A 2CJMA 3BU3A 3BV3A 3R7GA 1GZ8A 5JGBA 5ANJA 3MTLA 2BHEA 4MXCA 3ZSHA 2VWVA 3Q4UA 3DGKA 3NVMB 3NLBA 2C6OA 1UU8A 1T45A 4E4MA 5I5ZA 4AU8A 4FE2A 2P55A 2ERKA 3AD6A 3QC9A 1PMNA 3QQLA 4J7BA 3RAWA 3KVXA 3S4QA 3T3UA 1UNGA 5G1XA 2GNFA 1Q24A 2R3GA 1MRVA 4TT7A 1PHKA 4BDAA 5DR9A 4K2RA 5E8XA 3EQFA 1U5QA 3I6WA 4IC8A 2CNQA 3R1QA 3DA6A 4O0TA 4EH2A 4TYEA 1PXNA 5EI2A 2X81A 4OTQA 3QTRA 5CSVA 4KAOA 2IW9A 4C4IA 4M97A 2QLUA 5T6KA 3MFRA 3DZQA 4LQMA 5HBHA 2ZV9A 4EL9A 2QONA 2RGPA 2XP2A 4PL4A 5HVJA 5BPYA 5KMNA 5LQFA 2E2BA 2VTMA 2BTRA 3R2BA 2X39A 3ZU7A 4BL1A 4F6UA 3QX4A 2BRBA 4MH7A 4EOKA 5IISA 2WMXA 3LMIA 4FGRA 4ZK5A 4AW1A 4GFGA 3QL8A 2V22A 3ORTA 1TKIA 3PVWA 4EUTA 4JBPA 2VTTA 1H1RA 4GU9A 4JX3A 3F5GA 1G8SA 3ZRMA 1TQIA 3V8SA 4DLIA 3BEGA 3QKKA 4WNMA 2QKWB 4MKCA 3GC0A 4KIQA 2J90A 1HCLA 4Y95A 3BYVA 3TCPA 4A4LA 2W17A 3Q9ZA 4CZYB 4KSQA 2CLXA 2EXCX 3SRVA 3PLAE 1Q3DA 4W4VA 5AX9A 3QFVA 2X0OA 4QP7A 2BFXA 2XM8A 3FDNA 4GRBA 1LP4A 5DT0A 1NT2A 3LLAA 5GJDA 3QYZA 4E5AX 3AXWA 4ZLOA 2R3MA 4MNEB 1Q8YA 2YM3A 4G9CA 1KV1A 4QP3A 3RPYA 3SKCA 4Z16A 1IR3A 2WPAA 1XH4A 4KIKA 3QALE 4E7WA 1ZZ2A 4ZTMA 4FTRA 2B55A 4JL9A 2W96B 4U44A 3UE4A 4EOOA 3PDTA 3D83A 2G1TA 3DBFA 4EH8A 2R4BA 4TKSA 5F94A 4O96A 3DK6A 3MA6A 3A7GA 4IVAA 2B52A 4JBQA 2QOIA 3QCQA 2W1GA 2W1HA 3A60A 3PZEA 2OWBA 4JDKA 5ETCA 4ASZA 5CLPA 5TOZA 2UZOA 5D7VA 1K2PA 1GIHA 3VUDA 4BWPA 3JXWA 3FXXA 1BL7A 4W9WA 2PVHA 4G1WA 5IA2A 2QOKA 5KMMA 2PTKA 4CQEA 2OO8X 3IG7A 5C8KA 5M56A 4YHJA 5CASA 2VZ6A 2RF9A 2YM7A 4NK9A 3SXFA 3M42A 5CEIA 4QQTA 2YLEA 5EHOA 3RZBA 1P5EA 3CLYA 4D0WA 2XVDA 4AGDA 4UV0A 1JVPP 4YO4A 4M3QA 4ONAA 4BCFA 3A8XA 1YOMA 3OXTA 4FL3A 4QNAA 2WOUA 1FVVA 2UW5A 4ORKA 5BUEA 3MA3A 4D5KA 5M4IA 4YZ9A 4Y5HA 3QLGA 1YRPA 5C4LA 3HRBA 4IAZA 3U54A 4JDIA 5BUJA 4EYMA 4RJ6A 2PY3A 3KCKA 4O0WA 4QMNA 5K5XA 4FZFB 2PYWA 4G31A 4C3PA 3FMHA 5A6NA 3PUFC 2VO7A 2IWIA 2J6MA 4FBXA 2OIQA 4FTCA 5AP7A 3I5ZA 2YZAA 2G2FA 4FZ6A 2PMOX 3HP5A 3LPBA 4TNBA 4B9DA 4F7NA 2UW9A 2ITNA 2WTIA 3E8EA 3GOKA 3UVRA 3ZS5A 4C35A 4MD9E 2GNJA 2XIXA 3C0HA 4AOJA 3OHTA 5IEVA 3I6UA 5CVFA 4BTMA 4EYJA 5EM5A 3ZZEA 3L8SA 5J87A 4TNDA 1NVRA 3BE2A 1UA2A 2GS7A 2QO2A 4HNIA 3C0IA 4JG7A 4YURA 3SOAA 3AG9A 5KX8A 4R3RA 2J9MA 2GHMA 3D4QA 3IONA 3KL8A 3FQHA 4P2KA 4R6VA 4ZSEA 5HIEA 4X2JA 3ACJA 1YXTA 4XV9A 3QXOA 2SRCA 3CTHA 4YP8A 1Y8GA 3BELA 2X0PA 3C50A 3GOPA 2HZ0A 4WNPA 4IMYA 4DEDA 4BC6A 3I1AA 4RVLA 5IA0A 4X2KA 4BFMA 3VQHA 4L6QA 5CWZA 5AM6A 4IWQA 4RX8A 2ZMCA 3SC1A 2O5KA 4PMPA 5BYZA 4GT4A 2YN8A 2G15A 4BIBA 2YAKA 1VYWA 2XB7A 4O4FA 2CSNA 4GH2A 5BQ0A 3G51A 3NPCA 5CTPA 4ASDA 5KUPA 3R22A 4ZTHA 3CQUA 2WQOA 4NM0A 3MN3A 3R2YA 1CSNA 2G2IA 4OW8A 3OTUA 3NMUF 1JSUA 1PJKA 5IKWA 4QP6A 2VAGA 3KXNA 3FXZA 1STCE 1P14A 2VTHA 3F2AA 4UXLA 1ATPE 1OL7A 3KULB 4YHFA 4IADA 3POOA 3L8PA 4DE4A 4FZDB 3AT4A 2UVYA 4U40A 4UWCA 4D55A 2BDWA 4V04A 3DK3A 5E7RA 3TNQB 4BZNA 4HVIA 2PVYA 2B9JA 3FXWA 4XG7A 3LXLA 2ZMDA 4X2FA 5D1JA 2HWOA 2RIOA 4DGLC 5C8NA 4DFNA 3O71A 4A7CA 5EDPA 2XJ0A 3MVHA 5HX6A 5ANEA 2IEWA 3HKOA 3HZTA 2ZM4A 1Y91A 4DLJA 4F99A 4PPCA 3PA5A 2OFUA 2QO9A 3V8WA 2W1ZA 4XG4A 2ZFYA 4FSMA 2ITPA 2OZAB 2OKRA 4IC7A 2PVJA 2WMUA 3AD5A 3NR9A 4WUNA 3UJGA 4L45A 4N6YA 3PIYA 4G5JA 4PTGA 2XJ2A 4L46A 1VR2A 3PRFA 5AUYA 5ANGA 2Y6OA 2BKZA 4RWLA 3GCSA 5AIRA 5HVKA 5E8SA 1WBWA 4YTFA 3SD0A 3KXXA 4U8ZA 4EHVA 4DT9A 2BRGA 2QO7A 5K0XA 4AOIA 5B2MA 2OXYA 3UP2A 4FTTA 4EZ5A 4HZRA 2FSOX 1W98A 1XWSA 3BKBA 2VNWA 4WKQA 5CY3A 3ZO4A 1UKIA 1OZ1A 3LXKA 4WD5A 5L6OA 4KABA 4MD8E 3UPZA 2ZM3A 5A4LA 5M4UA 4DGMA 1BI7A 2C6LA 3MY1A 3QWJA 3FZTA 4LRKA 3GC8A 3OT3A 1ZAOA 3NGAA 4LL0A 4R8QA 5FBOA 3R9HA 3MH3A 5FQDC 3C51A 4U97A 3V3VA 3IDCA 4G9RA 4WG3A 5DVRA 3ZO1A 4X3FA 5AUUA 3SA0A 3BQCA 3CXWA 1R78A 5DN3A 4YR8A 2GTMA 3WIGA 2XNOA 5DE2A 4TL0A 3ZEWA 3GQIA 4QP2A 1VEBA 3OOMA 3DNDA 4CRLA 5LXMA 4AACA 2C47A 1KV2A 3U6HA 3LJ2A 4ZSAA 4HGEA 3ZH8A 5GINE 2BCJA 4BHZA 4AT5A 2YERA 1YI6A 1CKIA 1JSTA 3V5QA 1H26A 1PKGA 1PXJA 2HOGA 3CTQA 3FYJX 3PY0A 3QZGA 4DF3A 5AP0A 3A62A 2QLQA 4K33A 4QP8A 4ZOGA 4FSUA 5A46A 5LVPA 2X7GA 2C0TA 3HLLA 5EQEA 5IMEA 2WIPA 4ZP5A 3K2LA 4NW5A 4RZWA 5DFPA 4ZJVA 4WBBB 3LM5A 1GY3A 3LFBA 3QX2A 3IGGA 3QCXA 2OXDA 3E88A 3FE3A 2W5BA 2FGIA 2B9HA 3PPKA 4GK4A 4U3ZA 4ZY6A 4ACDA 3EFLA 3DU8A 4Z7HA 5T68A 1ZOGA 2JIUA 4ZJIA 5IF1A 2UZLA 4ZZMA 4IZAA 5KHWA 2E9VA 4RA4A 4ZSLA 1YDTE 3HGKA 5J9ZA 4FMQA 2WTDA 5EW3A 3FEGA 3QKLA 4AN3A 5LMKA 4PNIA 2IO6A 4RQVA 4RIWA 3VF8A 4BN1A 2PVKA 3EQBA 4W4XA 2QHNA 3DBCA 5AV1A 4AZEA 4FV8A 5CEMA 1LR4A 4BCQA 3BWJA 1ZOEA 1OL1A 3THBA 5E8ZA 4ASEA 4GL9A 2XKFA 2YEXA 3VAPA 5HTIA 2W7XA 3UIBA 3FQSA 1H00A 3ORZA 4LUDA 5FWKK 1LEWA 4DG2E 1FVTA 2I0YA 2V7AA 4PDSA 3AC5A 2EXMA 5IZFA 2IVUA 3P86A 3NCGA 4OTIA 2YWPA 4XX9A 5H8GA 3PG1A 2VUWA 4NTTA 5HO8A 5HLNA 4EBVA 4BWXA 2YM8A 4K0YA 1CDKA 2R3JA 3R8UA 3W2QA 3TUBA 2GQGA 3IO7A 2V0DA 4IWOA 3RWPA 5HO7A 5L8KA 4NFNA 2OFVA 4RC4A 3MPTA 4UWBA 5L6PA 3BBTB 3V6RA 3PJ8A 3K5UA 2PPQA 3R21A 4CFVA 3EN5A 4C37A 4EQUA 1Q8UA 1Q62A 3ORNA 3LFSA 4FSQA 4BCIA 4I5PA 5EKOA 3BGPA 4QQ5A 3EHAA 3JVSA 4GJ3A 4RBLA 1ZY5A 3WZDA 4C4JA 3Q2MA 3FAAA 2PMLX 5IH5A 4RRVA 4I23A 1H1QA 2R3LA 4YNOA 2FSTX 3NFGB 2BMCA 2JLDA 3UPXA 3ANQA 3RMFA 4EJ7A 3PVUA 4JOAA 4YZCA 3O96A 4IX4A 4AZVA 5HD4A 4DBNA 4U6RA 1ZOHA 4BDKA 2WMSA 2WMWA 1W82A 1BI8A 3OCSA 1AQ1A 2WMRA 3E7OA 3MY0A 4QOXA 4FL1A 2BPMA 3CR0A 5EM7A 5HNGA 4C3RA 5IDNA 2PUNA 4R7IA 5I9XA 1VLRA 3LCDA 2CLQA 3EL7A 5H8BA 2BILB 5J1WA 3R9RA 3PXFA 4YJTA 2ZAZA 3BHVA 5G6VA 4BCOA 4AQKA 5AV3A 5C27A 3ALOA 2WTJA 1Y6BA 3EZRA 4EK4A 3ZM9A 5BVFA 3QQJA 3FYKX 5AAGA 4AWIA 3FI2A 3U6IA 4FKGA 1DI9A 1ST4A 4GT5A 4JBVA 4R1VA 4ANSA 1W0XC 3PJ3A 4ZTQA 3VONA 3FQEA 4F0IA 5M07A 2UZNA 3COHA 1B6CB 2FYSA 4HJOA 4E4NA 3FLSA 5EI6A 1YOLA 2CN5A 3K5VA 4AE6A 4GT3A 4D4VA 4GEOA 4AZWA 4C8BA 5M09A 2F2CB 3R83A 3WF9A 4V0GA 4RX5A 4JX7A 2BRHA 4X7QA 4U9AA 1R0EA 4XRLA 4AXCA 4F1MA 3RAIA 1G5SA 5FRIA 4F09A 1IA8A 1SZMA 2BZIB 2CKOA 2GCDA 3E7VA 3OWLA 3FY0A 4BTKA 4EHEA 1VZOA 3G6HA 1Y8YA 4QMQA 4IJ9A 3V51A 3ML1A 3V5LA 2W4OA 4BWKA 5AAEA 3EN7A 4OGRA 3IOKA 2JKOA 3OCTA 3C4ZA 4X2GA 3TIZA 3IDPA 3RM7A 4BRXA 4D9UA 4YUQA 5HBEA 5I9ZA 1LEZA 4JRNA 4BIDA 4MWHA 3IGOA 1IRKA 1KE8A 4CKJA 4ZTRA 3CJGA 3BWFA 3QRJA 4BDGA 1OBGA 4DA5A 4YPSA 4TWCA 1FQ1B 1BMKA 3DFCB 4O0SA 1RQQA 1ZY4A 3FY2A 3G9NA 4EKKA 5CAUA 2O0UA 2C3LA 4CD0A 3NAXA 5I9YA 4JJRA 3F61A 3VIDA 3EN9A 4AP7A 4RWJA 5HIBA 4F7JA 4CV8A 2X8DA 5GZ8A 3W10A 4ID7A 4C62A 4YJNA 1CKPA 4FNWA 4CYIA 3FZRA 3LAUA 4CGAA 4FVRA 4DFXE 3DKCA 2VO0A 5C9CA 3W2CA 4BCMA 1JKTA 5J7BA 3NEWA 2WEVA 3PXKA 1OKVA 3F7ZA 5CSXA 4FSNA 4I0TA 3VO3A 3ROYA 5F20A 1ERKA 5L6WL 3F2NA 1UV5A 3OD6X 5I9WA 3NW5A 4NZWB 3QD2B 3G90X 4DC2A 1KOAA 4F08A 3G33A 4BI1A 4GIIA 4AA0A 5HBJA 3SG9A 1XBBA 5K5NA 3G0EA 4C3FA 4DH8A 2B4SB 2GPHA 4EH9A 4K9YA 3D7TB 5IEYA 4FTUA 4F64A 5TKDA 1XH9A 4RWKA 3PIXA 4GU6A 4NIFA 5H2UA 3Q96A 4XLVA 3NNUA 4CG9A 5AR2A 3R30A 3EWHA 4DGNA 5JQ5A 3VBVA 3ZBFA 1GNGA 1H0VA 4QTBA 4BCNA 5KKRC 3FMEA 3QTQA 5A4CA 3UDZA 4KSPA 5AV0A 4JAIA 2QC6A 2PVMA 2I0VA 3CBLA 5M53A 3TZ8A 4XYFA 5A54A 2OJ9A 4FC0A 3DPKA 2ZB0A 2XUUA 4YGAA 4BDJA 4LV7A 4FK6A 4ANBA 4BVUA 3VWAA 4XS2A 5HGIA 4JR7A 2J5EA 4XOZA 4E6QA 4O91A 3U87A 3W0QA 5HG7A 4B4LA 3OBJA 3IW4A 1WBNA 4M69B 4QMVA 4MYGA 2Y9QA 3OT8A 3AGLA 3BGQA 3NAYA 4BKZA 5A4TA 3I60A 2XAOA 4EOMA 2RSVA 3KY2A 2AEGA 2VWBA 1M14A 3BLQA 3CTJA 5DPVA 1FMOE 2QODA 3NIEA 4RGJA 1CM8A 4FV6A 4YHTA 3DK7A 4PDPA 1MRYA 2W4KA 3F5PA 2C6EA 3HA8A 2BROA 4AT3A 5A14A 2YITA 4GVJA 3R71A 4IM0A 4EOSA 4MF0A 4USEA 3BHHA 1O6YA 2X4FA 4FTIA 4I92A 5DBXA 4YJQA 2J51A 3TZ7A 2B9FA 5E8YA 4JMQA 4BDBA 3MVJA 4D2PA 2B53A 5BVOA 4IB1A 5JKGA 1R39A 4XP0A 3UGCA 1PYEA 4PL5A 3LQ5A 3ZLYA 3VS1A 2LGCA 3MYGA 5IQAA 5HX8A 4XG9A 3ZM4A 2OG8A 3ATTA 3GC9A 4O0RA 1NXKA 4HPUE 5A4EA 5AM7A 1H01A 3RBWA 3UTOA 4AW5A 4QTCA 3RNYA 5EQPA 2X4ZA 3F3UA 1DAYA 1NVSA 2YFXA 2VN9A 4LMUA 4IM3A 4MXXA 4U80A 3K3JA 4ACHA 4EC8A 4O7LA 3E8NA 2PUIA 4J98A 2JDVA 3SW7A 3DFAA 3BEAA 3HX4A 4P7EA 5CQWA 3TDVA 5BX0A 3I5NA 4EH4A 4EORA 5IUHA 4WNOA 5BVWA 3LE6A 5AUTA 2YCRA 3EZVA 4OTGA 4WA9A 3CPBA 4I93A 4UY9A 2H96A 1PXIA 3PSCA 5ANKA 5H8EA 4IACA 4BZDA 5LWMA 1GAGA 2XNPA 4PY1A 3SVVA 3EYHA 4G17A 4M14A 1OIUA 4XV3A 5EK7A 1UVRA 2HYYA 2HK5A 1WFCA 4A06A 5CANA 3NUSA 2YM4A 3P9JA 1OIYA 3EN6A 3DJ6A 4PL3A 4O81A 4P5QA 3OEZA 4FSRA 5ETFA 5IA5A 4HVGA 4PF4A 5CAVA 4DT8A 5DEWA 3Q5IA 1ZYJA 5GJFA 4ANQA 3FSFA 3VN9A 3QQGA 4FSWA 2BKKA 2NNWB 4YU2A 3Q9XA 3RWQA 5IQDA 4L67A 4QMYA 3A61A 3GENA 5CZHA 3MW1A 4C4GA 5M4CA 4P5ZA 1ZYSA 3AKKA 2XNEA 2YLFA 2ITUA 4I5HA 5IQIA 4RIOA 3BGZA 4FTMA 4CG8A 2VTSA 2F2UA 4QMMA 1KSWA 3VS3A 5E8WA 4NYEA 4XNEA 3UDBA 3TNHA 4E73A 3PY3A 3TIYA 1IEPA 2Z7LA 2R3QA 3RK7A 1NVQA 5DHJA 5GJGA 3BYUA 2ITZA 3SAYA 1PMUA 2OF4A 2PWLA 4CFMA 5B2LA 5B2KA 3S1HA 3PXYA 4QT1A 4CTBA 5EM6A 2J4ZA 5J1VA 4Z9LA 2JFLA 4ERWA 1V0PA 4CRSA 4A9UA 3ZHPC 3UOHA 3KCFA 4FKLA 4I6HA 4I4FA 3Q3BA 3ZZWA 4JR3A 4IB0A 2BUJA 3EKNA 4WNKA 3V5JA 4BHNA 1UU7A 5JZJA 4DYMA 1OPLA 2XNBA 3MIYA 4S34A 2XNGA 4AOTA 3DY7A 4D58A 3BBWA 4RX9A 5I4NA 3NYXA 4NEUA 4BZOA 1DAWA 2OJGA 3BX5A 4RC3A 3KREA 2E9UA 2BDFA 2C6DA 4EH7A 2JDOA 3ZC5A 5KE0A 4IVDA 3QZHA 4KB8A 4QDEA 3DQWA 4MCVA 3T8OA 4BYJA 3SG8A 3PUPA 1WVYA 4UEUA 4YZNA 2C6KA 5AR5A 1ZARA 2GHGA 5FEQA 3RI1A 3MV5A 1IAHA 2QOOA 4G5PA 3D5WA 4EH3A 3DKGA 2XF0A 4Q9ZA 1PXPA 4E6CA 1OMWA 5CF5A 1H07A 4I24A 3LZBA 4FUXA 3RAKA 4AZFA 1JKKA 4FA2A 2JKKA 4N57A 3LMHA 4GKIA 4C7TA 5HG9A 3W32A 2VGPA 5CAQA 5AP3A 1ZMWA 4I94A 4U0IA 3OCBA 3TJCA 4BCGA 2EB3A 4O7NA 2WTWA 5K0KA 4HYUA 1U4DA 1YXUA 1TVOA 3FMNA 4BGHA 1FGKA 2HAKA 4L42A 4BCPA 5HEZA 4QNYA 4UZDA 1IA9A 3ENMA 2JDRA 3VRYA 4FYOA 4FYNA 3ZUUA 4UMRA 2XJ1A 4F65A 3DKFA 2VTPA 4GUBA 5AAFA 3F88A 4IX3A 4PMMA 3FMDA 3RVGA 2UZWE 2VTIA 2WFYA 2XIYA 2UW4A 4NTSA 1ZMUA 4IBMA 3GCVA 1JQHA 4GSBA 1UWHA 5L2WA 5J9LA 2NRUA 1DM2A 1W8CA 2GTNA 2GDOA 4PDOA 4APCA 1O9UA 4DFYA 1TFFA 5ACKA 1H4LA 2PUUA 2XBJA 1URWA 2WB8A 2HWPA 3IQ7A 4W8DA 2EVAA 4YJPA 3LMGA 5IH6A 3NFFB 5TO8A 5CT0A 2X2MA 4ZLYA 2XRWA 3OWKA 2C69A 3NNWA 4D28A 3GCQA 3WZJA 3UVQA 5LMBA 3C4EA 5TR6A 3KXHA 4CNHA 3OFMA 2G2HA 2W05A 2X2KA 1WVXA 1SM2A 4A9SA 4DINA 2ZYBA 4S33A 5DNRA 1XJDA 5L2QA 1J91A 2CMWA 2VO6A 3MH0A 4XCUA 4RZVA 3ZUVA 4EONA 4LL5A 3RM6A 3FL5A 4ACGA 4O86A 1JBPE 3VBTA 4R78A 3ODYX 4DG3E 3VS5A 2R3FA 4MHAA 5BUIA 4K8AA 3LCKA 4KBCA 5JMSA 3IW6A 3QD4A 2OZAA 4I0RA 3EYGA 3MH2A 3CIKA 2CGXA 4H3QA 4F4PA 2P0CA 4W4YA 3AKLA 3Q6UA 1BYGA 5A6OA 3M1SA 4DFLA 3LJ0A 1TQPA 2XK4A 1GOLA 4A4OA 5DWRA 2OW3A 5E8UA 1P4OA 3AMBA 3ACKA 3IKAA 4CMTA 2PZYA 4F6SA 5BMSA 2CKQA 2VWXA 2A2AA 4QP4A 4Y8DA 3EQGA 3QTIA 1I09A 3K3IA 5EKNA 1QPEA 5KO1A 2R3OA 1Q8WA 4CLIA 3PE2A 3COIA 1XH6A 2FSMX 4UMTA 2CPKE 3TJDA 4FTQA 2X8IA 4R5YA 1PXKA 4HNFA 5HNBA 5BVEA 4EBWA 4FV7A 5E9EA 2J0LA 3VJNA 1PY5A 3IECA 1ZWSA 4E5BA 4OT5A 5HLPA 2YISA 3GT8A 3HMPA 3GUBA 5C4KA 4IWDA 4R7BA 4ITHA 1YQJA 2WU7A 2BZJA 2HIWA 1OBDA 4YMJA 3CS9A 3ETAA 3PXZA 4DDGA 4M12A 4O0VA 1Q8ZA 3NWWA 3QU0A 4TRLA 5AP6A 3DLZA 3CJFA 3SOCA 4ZMEA 3KRWA 3QTWA 2YJSA 3VW8A 3W0OA 1MQBA 3R1YA 4YC8A 2BRNA 5CVHA 5DLSA 3R9OA 3DLSA 4D5HA 3CD3A 2CGVA 2JBOA 1WMKA 5CSWA 1JNKA 1PYXA 1G8JA 4FNXA 3EN4A 2HW6A 3FHIA 3Q4ZA 2AUHA 4FSTA 4NFMA 5ITAA 3I79A 3CQWA 3H3CA 4J71A 4IAAA 4KINA 5CNOA 1ZYLA 4BDHA 2IPXA 2GS2A 2PK9A 3LXPA 2NPQA 3QRIA 4GG5A 4RIYB 1DI8A 1PMEA 4HW7A 5IH4A 4O2PA 5AUWA 5EW9A 4CXAA 5EYKA 3PE1A 1KWPA 5H3QA 3WF6A 4AN2A 5CNNA 3BYOA 3V5PA 2C5XA 4OAUC 4MK0A 4O7TA 3NYNA 3GP0A 4FODA 4LRMA 2OH0E 3N9XA 4NM7A 1Y6AA 4GFOA 4PP9A 4UZHA 4IDTA 3ELJA 3R7UA 4YLKA 3VBWA 4ERKA 3GQLA 2XARA 4GK3A 4CKIA 4BTJA 4UXQA 3QA0A 2PUPA 4LGGA 4Z55A 3E8CA 3T9TA 5AUVA 3BPRA 5J79A 2DUVA 4I4EA 4I6QA 2XYNA 4GVAA 3D2KA 5AMNA 4ANMA 5KCVA 2W1DA 4BDFA 5IA4A 1H1WA 3P7CA 2ZB1A 4RJ5A 2JAMA 2XH5A 3FKLA 2XAMA 3DAJA 2QURA 4F63A 3Q04A 3HV3A 1V1KA 3VVHA 4IVBA 3KC3A 2VWZA 4BGQA 4EOIA 5KMIA 3C4XA 3ZRLA 3LFQA 4AA5A 3F3TA 3Q6WA 4MD7E 4QQJA 4CMOA 3IDBA 4AAYA 4AA4A 1KE9A 2J7TA 2WQMA 4FSYA 4E20A 4IW0A 4QYEA 4C61A 1KE6A 3BU6A 2WQEA 4FUYA 3SHEA 5FTQA 3WZUA 2BAJA 4DTBA 4JRVA 5LARA 4LRJA 5EHYA 3G15A 3A4OX 4K11A 4XHKB 4ITIA 4ENYA 2XRUA 3QTSA 4NU1A 2QR7A 4F70A 1YWNA 4EHGA 2P4IA 2XK6A 3UYSA 4BJJB 2VTQA 4NT4A 4L01A 4BDDA 5DRBA 3PY1A 2VO3A 4FKTA 4FRFA 3W2RA 3WF7A 4XBRA 3W8LA 5JFSA 3E5AA 2QCSA 4H05A 5DI1A 4BDIA 1J7LA 1H28A 3R04A 2VTJA 4V01A 2PVFA 4NKAA 3ET7A 3ANRA 5D11A 3MY5A 3D7ZA 3EQRA 2YCQA 2ERZE 4I20A 2QNJA 2WNTA 2O3PA 3CGOA 4IFGA 4CCBA 1FVRA 5HI2A 2WGJA 2YM6A 4D9TA 4OAVB 4O83A 4KWPA 3HAVA 4UMQA 3C5UA 4IANA 2ACXA 2CNUA 3MI9A 4G3EA 2FH9A 2V62A 3KKVA 4UYNA 3ZXZA 1RE8A 4GK2A 3RAHA 4I5MA 3VUGA 3O51A 4BCJA 2YIQA 4D1XA 2X8EA 2IZRA 5AEPA 3OTVA 5IQCA 4U3YA 3O7LD 4IM2A 4HVSA 5F9EA 5IQEA 5LWNA 2WMBA 2Q0BA 2O2UA 4EJNA 3HEGA 5EI8A 4E3CA 4L7FA 3FC1X 3CSVA 3GVUA 5A9UA 3LFEA 4WSQA 5FUTA 1PXLA 3MPAA 4FKOA 4EH5A 3R73A 4LGDA 4Y73A 4F9CA 3BRBA 3LQ3A 4PMTA 3QBNA 5BYYA 2X6DA 4E4LA 3GGFA 4WRSA 3NYVA 3R8ZA 4RJ7A 2F57A 2Y6MA 2VTAA 3E87A 3LW0A 4QYHA 5AUXA 3AGMA 4RA5A 2DS1A 2UZEA 1JKLA 3GU4A 4AXFA 4C2WA 2GNIA 5FTGA 5EDRA 2PMNX 4RJ4A 3VS6A 1M17A 2PZ5A 2W0JA 3TKUA 3UQGA 3WE8A 3G5DA 4EHZA 5DA3A 3V5WA 3TL8A 4KIKB 4AX8A 3W55A 4F0GA 3A7FA 3CY2A 3KRXA