2J0IA

Crystal structure of the human p21-activated kinase 4
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
290
structure length
289
Chain Sequence
SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE/THREONINE-PROTEIN KINASE PAK 4
publication title Crystal Structure of the Human P21-Activated Kinase 4
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 289
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2j0iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2j0iA01
4QMYA 1PF8A 1K2PA 4EK5A 2RGPA 2XJ2A 3B2WA 3QLFA 4F0IA 4O7TA 2VO6A 4RWJA 1VR2A 1UVRA 5CX9A 5A14A 3ZSHA 4HJOA 2BKZA 2DQ7X 2XNMA 3C13A 4LQMA 2PYWA 3UZRA 3DA6A 4O0YA 3NSZA 4EBVA 5CSXA 3ORIA 3PIZA 4GV1A 1KWPA 3UZTA 4XP0A 5AUWA 4BIDA 4I20A 3ID6C 3NUNA 4J53A 3F66A 4XG4A 3AD6A 4PDPA 4ALVA 2BFYA 1XH7A 3GUBA 4MXAA 4IWOA 4DH5A 4M7IA 2VTOA 5AIKA 4GUEA 4KIOA 3BGPA 4BDJA 4JR7A 2R3RA 3F82A 3R8UA 4PNKA 4RX8A 3LCTA 3VWAA 3F2RA 2GQGA 4NWMA 3IQ7A 4CYIA 4IX3A 4OR5A 4OT6A 4DG3E 4YSJA 3EN4A 4WUNA 5KMKA 5L2WA 3LCKA 3LFFA 4X3FA 4V0GB 3I6UA 5H9BA 3H0ZA 3S3IA 3NYXA 4F08A 2OIDA 1B39A 2NP8A 4W9XA 1OBGA 1F5QA 1WBNA 3LLTA 2VWYA 2XM9A 1ZY5A 4U3ZA 3BEGA 2WO6A 4LUEA 3PG1A 4G5PA 4CCUA 4EHZA 2IPXA 5IG1A 4FV5A 2H96A 3UC3A 4QD6A 2Z7SA 3H30A 4FKQA 4YJNA 4G6LA 5CAPA 5EQEA 2XIYA 1YI4A 4IBMA 5HICA 4JRNA 4AUAA 1H27A 4QP1A 3NW6A 3TTIA 4DTKA 2UZLA 3COMA 5CSWA 3LLAA 4BCKA 2PZYA 4CFNA 3H9OA 4OGRA 2WTCA 3GQIA 3LPBA 3LMHA 3R8VA 3RPOA 3DXPA 1KSWA 3T9TA 3EFWA 5AR5A 3IECA 1WBWA 3W18A 5FXRA 1YI3A 1SNXA 2C5NA 3AT3A 4YSMA 3ZH8A 3LM0A 4C4EA 4XBUA 2IVSA 3F7WA 4TWOA 3ULZA 4AG8A 4D2VA 5IA3A 2IN6A 4R7BA 1BKXA 3NNUA 2WQBA 2W5AA 3OD6X 4AW2A 5M44A 3JY0A 3K54A 3QC9A 2WQEA 2QO2A 2XK7A 2V55A 4QNAA 3VULA 5L2TA 3NWWA 3BU6A 4C4JA 3O0GA 1M7QA 4L45A 3KU2A 3QHRA 4QP6A 4PMMA 3MIYA 4G3DA 3LVPA 3UO6A 1H00A 2OI4X 3KXXA 3QALE 3OEZA 4CFXA 3MVHA 4E6QA 3PPKA 3PJ8A 1H08A 3ANQA 5CNOA 3D5VA 5H8BA 2JC6A 2PVJA 3DNEA 4BDBA 5AADA 4K77A 1HOWA 4D1SA 5IUIA 3C0GA 3UOKA 4LM5A 2IVTA 4DH7A 4EUUA 2O2UA 2QOOA 4CXAA 2FO0A 2GTMA 2WFYA 4PY1A 5D7VA 3DBDA 4C37A 4JDJA 3QTUA 4TT7A 1SVHA 3VUKA 2QU5A 2PWLA 4MEDA 1XH8A 1VEBA 5EW3A 3D5WA 5IPJA 3Q4UA 3EWHA 5E9EA 2NNWB 4K18A 3L9NA 2X39A 5HNBA 3V3VA 3BYSA 5F94A 3PSDA 1MRYA 4BHZA 4BTJA 3JYAA 1YWNA 2ZYBA 3COKA 3RPVA 2UW0A 3ZBFA 4RIXB 4FEUA 1Q4LA 2YITA 3BPRA 2UVZA 1XH4A 2GHGA 4I6BA 4IMYA 3WARA 3AQVA 2YFXA 4F9BA 1PY5A 4F1OA 1URWA 1YQJA 4IFGA 4K9YA 3LHJA 5HU9A 5L6PA 3EQCA 3G2FA 5JGAA 4KUJA 1VJYA 2GFSA 4MD8E 3R01A 3BLRA 4YLJA 2BPMA 4WG4A 3EQRA 3CQEA 3QZIA 3D4QA 3G33A 4G34A 2UW7A 3QD3A 3KCFA 4JOAA 4PL5A 2ITVA 5HCYA 5T68A 4CG9A 3DKFA 2QONA 3OG7A 4H3PA 4IAFA 3LXLA 1W84A 5HOAA 4O82A 3QWJA 4FKGA 2VTQA 3UPXA 2I0YA 2RIOA 2EUFB 3Q3BA 3QXOA 3RVGA 4CMTA 5EOLA 3MV5A 1YHWA 5IA1A 2ZB0A 2UUEA 3Q2JA 4J52A 2BROA 3MVLA 2ZM3A 4ITJA 4YTHA 2RFNA 5GJDA 5L8LA 3KN5A 3QXPA 1BYGA 3Q6UA 3N4VA 2PY3A 3OY1A 4MHAA 4TYHB 2J0MB 3TZ8A 3IS5A 3SV0A 2V62A 4GFGA 4GRBA 4ZTLA 1JBPE 4F7LA 4XCUA 3NMUF 5KMJA 5A3XA 2ITQA 1J1CA 4J8NA 2PVLA 4MBJA 1Q3WA 2GCDA 3F9NA 3PIXA 3RKBA 4Z16A 4UMRA 3I60A 3N9XA 5CXZA 2W7XA 2G2HA 3EQBA 1WMKA 4FVRA 3MSSA 4RVMA 4GVJA 3R9DA 1K9AA 3FSFA 2KTYA 1ATPE 4PPCA 3L9MA 3VIDA 3QFVA 4QMUA 3MA6A 1MUOA 4GSBA 5DR9A 3H4JA 3FE3A 2EU9A 2JDSA 4E6DA 2I7QA 4L46A 3SG9A 2X7OA 3JVRA 3M42A 4XOZA 1H28A 2C6IA 3ALNA 4OAVB 1NT2A 2YJSA 4WNMA 1G8AA 4YLKA 4IB1A 5EKOA 4Z3VA 2QHMA 2RKUA 3OBGA 3HNGA 4J7BA 4J96A 5HIDA 3DDPA 3E87A 4JJRA 4FV9A 4EWHA 4U9AA 1YVJA 3O51A 3HRFA 4EKKA 4F65A 4ZLZA 2B0QA 2F7EE 4UALA 5EM8A 5HBEA 4YTCA 3P7AA 2A2AA 1JKKA 3K2LA 3D5XA 3TJDA 4W8EA 4ZLYA 5LMAA 2JFMA 2VTNA 4ASEA 3LXPA 2IWIA 3EN9A 5LQFA 3P9JA 1QMZA 4IQ6A 4HGEA 2UV2A 3F5UA 3SAYA 4C3PA 4CT2A 3MIAA 4AF3A 3DTWA 1GIIA 4PNIA 5HG8A 2YACA 3OXZA 5IMXA 4FG8A 3VUHA 2PMNX 3DOGA 2XF0A 3NRMA 3O8TA 3WYYA 3DXQA 4C4GA 2J4ZA 1YWVA 3MDYA 3RAHA 3R21A 3PRIA 1H1SA 3P23A 4IVAA 2RG6A 1YOMA 3QUDA 4XG9A 3FSKA 3DKGA 5DFPA 2GQSA 4HPUE 3P4KA 3ENHA 2XJ1A 4FL3A 5KMLA 3POZA 4RZWA 4B7TA 3UIMA 4K8AA 1QPEA 4ZZNA 3L9LA 1OPLA 3P0MA 2XNPA 5DR2A 4BYJA 1PMVA 1UU9A 3WYXA 4WT6A 5DLSA 2R3QA 2B55A 2OICA 2YM7A 3U6IA 4O7RA 3L9PA 3HZTA 4JAJA 2OW3A 4YHJA 3KRRA 4CVAA 4BDGA 3VS6A 3KXNA 5HTCA 1OL6A 4UZDA 3TXOA 2QHNA 5HVKA 4G9CA 4MAOA 4FT3A 2B4SB 2VGPA 2QKWB 1LP4A 3RGFA 4D55A 3NX8A 4UY9A 4GJ2A 3IONA 5B2LA 5JZJA 4P7EA 5FDPA 4RJ4A 3R1SA 2UW5A 4LL5A 2I0EA 4MD7E 4BDCA 4JQEA 5I3RA 4E93A 4YC8A 3W33A 3R7IA 3UOLA 3BBWA 2BDWA 3DJ6A 3L8PA 4KRDA 3U8WA 3VC4A 4AX8A 3PY0A 2PZ5A 3HLLA 5CNNA 4WSYA 4IEBA 3CE3A 4J98A 4S34A 4RJ7A 4M0YA 3QQHA 3MI9A 5FP6A 3CC6A 5E4HA 3HVCA 1BX6A 3PUPA 5AFVA 4BN1A 5AV0A 1P4FA 4UXLA 5AUTA 3WZEA 4FTIA 4ASZA 4HYHA 3UYSA 1SVEA 5DH3A 4LV8A 3DK7A 4U40A 2VX0A 3OCSA 5CZIA 5AP3A 5HX8A 4ERWA 5F9EA 3VBYA 4ZMEA 3BYVA 1LR4A 1PKGA 1UU7A 2EB3A 2IZUA 3FMKA 2HXQA 3NAXA 4QQ5A 4XLVA 4C7TA 3V5TA 3PE2A 4I92A 1H1PA 4B8LA 5BYLA 3ZRMA 3HMPA 5M55A 1W82A 5L4QA 2ITWA 2Y4IB 4GH2A 3BHTA 4CV8A 5IQIA 2DWBA 3I5NA 4I5HA 3LAUA 2XEZA 5M57A 3NZ0A 4ZMFA 1JNKA 1L3RE 4IAYA 2YM8A 4ZTMA 4OTGA 3WF7A 2NO3A 4BCFA 5IQCA 4YNEA 4M97A 5T6KA 5J5SA 3DBCA 2B7AA 4FZ6A 5J79A 4FKSA 3UC4A 4K11A 2GDOA 3PVBA 4QMNA 4O7YA 4N0SA 4AGWA 5C03A 5A4LA 4IAZA 5L6WL 2W4JA 2J51A 3KCKA 4TXCA 3VW8A 1T46A 5BMMA 3VS1A 4ASXA 3HV7A 4BR3A 4YNOA 3ZMMA 3A7JA 4ZK5A 2Y8OA 3ZONA 2WTKB 2Z2WA 3G0EA 5FBNC 3QA0A 5CANA 4L6QA 1PYEA 2O5KA 5T3QA 4EHEA 4ZSAA 4YGAA 1ZWSA 5BMSA 5E8TA 3AT4A 2R3MA 2X4ZA 1KOAA 4XMOA 5EW8A 1QPDA 3DQWA 3ZRKA 4NK9A 2PUPA 4FZFB 1XBAA 3UO5A 5KUPA 4CLJA 2X9FA 5AP7A 5J9LA 4XLIA 4NW5A 5L2QA 3FQSA 4XP3A 3O17A 2HXLA 4FEQA 5JK3A 4O84A 5CU6A 3WE4A 4ZLOA 3HMNA 3VRYA 2ZV2A 1UA2A 3TUCA 1H1WA 4KS7A 4X2NA 3UP2A 3F3ZA 2ETRA 2XH5A 2JKOA 4ANNA 5EOBA 1FVVA 3PE1A 3RK7A 4AP7A 3MFSA 2QOQA 4EK8A 1GAGA 3OT8A 3SD0A 4CFVA 3UG1A 4APPA 1YI6A 4GUBA 5I9VA 3MH3A 5E92A 2C3IB 1QPCA 2XNOA 4APCA 2VU3A 5KNJA 2V22A 3R73A 4KD1A 4XG3A 1M17A 1SZMA 1OECA 5D1JA 3QC4A 3RAIA 2FYSA 1W98A 1F0QA 5G6VA 4QMVA 1ZYLA 3O7LB 5C27A 4DEAA 4EEVA 4IX5A 2QU6A 3OMVA 3EFKA 3FHIA 2BAJA 3LJ0A 4JXFA 3MPMA 3QTXA 4ID7A 4TYGA 2PVRA 3NYNA 3MB7A 2PUIA 4HVDA 2OU7A 3M11A 4CEGA 3VQUA 2QODA 2QLQA 4WBOA 5CVFA 3TUDA 3ZDIA 4USEA 4QP4A 5JZNA 4I6HA 5HEZA 2W5BA 5M51A 4F70A 1R78A 3LFCA 2Z7RA 4AGUA 2R3OA 5HQ0A 2WIPA 2WMAA 2UW4A 3ACJA 2V0DA 4BWPA 4LYNA 2PE2A 2W17A 2WTJA 4IDTA 3VUTA 4ACHA 2W0JA 5AA9A 2C0IA 2JLDA 1CKPA 3H9RA 4PL3A 3QQLA 2V7OA 4R78A 4J99A 2FSTX 3E8NA 2NRUA 4FSQA 1WVYA 1JKSA 5C26A 5LARA 3FL4A 3KULA 2G2IA 3DZOA 4JX7A 4EBWA 2FSLX 2VWIA 3KMWA 4BHNA 3ZOSA 2BHHA 4TPTA 3IW7A 3FPQA 4FSRA 3VF9A 4ITHA 2WTDA 4C2VA 3I0OA 2Y4IC 5E90A 4DLIA 5LVOA 3FXXA 3S1HA 1U54A 3BWJA 2HY81 4IJ9A 2YABA 3M1SA 4TWNA 3BQRA 1S9IA 3B8RA 4ERKA 4O27B 2XBJA 2ZVAA 3DJ5A 2H8HA 4C57A 3F2NA 3GCUA 4FKOA 4BF2A 2QOLA 4Z9LA 3PSBA 3PLAE 4TZRA 2CNQA 3R2BA 4XJ0A 3ZYAA 4K33A 5ETCA 3EMGA 4O0SA 4EOKA 3VBXA 1OPKA 4FICA 2WMVA 4FR4A 4ZTQA 4ALUA 5EYCA 4R1VA 2FSMX 4DT9A 4MKCA 2PSQA 2VX3A 2GS7A 5AP0A 3TNPC 1T45A 1W0XC 4FOBA 4OTPA 2PL0A 2VWVA 2WTKC 3PXYA 5EHLA 4BDFA 4MNEA 2XKDA 3QWKA 3QBNA 4QMOA 3ZS5A 4J71A 2B9JA 2JDOA 4O0TA 1SM2A 3ZZEA 4EOSA 3UG2A 3LFSA 3HDNA 5KHXA 4UWYA 2HY0A 4L9IA 5FEDA 4C3FA 3HA8A 1CDKA 3MA3A 4WNKA 3NCGA 4KKEA 4L7SA 3TL8A 4J95A 3VN9A 4CTBA 1ZOHA 2R3GA 5DT4A 3NNXA 4U45A 5AMNA 1OIYA 3DY7A 4O0UA 5AV1A 2WTWA 3RPSA 3E92A 3GXLA 1LPUA 3F3UA 2VTIA 5DA3A 4JIKA 3ACKA 4XUFA 2WMRA 4UN0C 5FGKA 3W2RA 5IF1A 5EQPA 5CSVA 4Q9ZA 4CTCA 5E8XA 5BQ0A 3S00A 4P5ZA 1G5SA 4M69A 4FL2A 3ZEPA 1O6KA 2YZAA 4IH8A 2WEIA 4B9DA 1DAYA 2P2HA 3MY0A 4EOJA 4BZNA 5IQHA 2C5OA 4EH5A 4L68A 3RAKA 2OXDA 2XBAA 3GQLA 5I9UA 3SA0A 4FSNA 4E1ZA 3PLSA 3FDNA 3KFAA 4FZDB 4QTAA 3RK5A 1PXKA 2YISA 3R83A 5LOHA 5EK7A 3KN6A 3DFCB 5BUIA 3D2KA 5A54A 3W2QA 2WTVA 3P5KA 4C8BA 4KB8A 4GT4A 4RC4A 4TWCA 3MGYA 3PA3A 4MBIA 1GJOA 3R8LA 4D9UA 1MQBA 1Q97A 3E64A 3A7IA 3C1XA 4QYYA 4CG8A 1IA8A 2UZTA 3GI3A 3D5UA 3R1QA 4DGNA 2XS0A 4H1MA 3FY2A 2VWZA 3GU4A 2X1NA 4WG3A 3OEFX 4FNZA 5GIOE 2PVHA 3WOWA 3KC3A 1RJBA 3UQCA 1RDQE 5TF9A 4EJNA 4Y72A 4EK4A 4EOLA 3R7GA 4MXZA 5H8GA 3IDCA 5C1QB 2J5FA 3EQHA 4BCQA 3MH1A 4BDEA 4DFLA 2CN5A 5JEBA 3LOKA 1PKDA 4IZYA 4PF4A 4UMTA 3FLZA 2W5HA 1TKIA 2YJRA 2GMXA 4GT3A 3W2PA 4A9RA 3CSVA 3FI8A 3TKUA 3OTUA 4JDKA 1ZYJA 4M12A 5DRBA 4D5HA 4ZSEA 2X81A 4R5SA 4A9SA 5M4UA 4YJTA 3L1SA 3ORKA 4DFZE 4QMWA 3HMMA 4ENYA 5A4QA 3PDTA 4NM3A 3UYTA 4FIJA 2XKCA 3DLSA 3E5AA 3DFAA 3QTIA 3FMDA 5A9UA 4ZS4A 3IW8A 3GGFA 4W4XA 4AACA 3ZO1A 4BL1A 3EZRA 3QL8A 4H58A 4ACMA 2OF4A 4RC3A 2G15A 1UNHA 2G2FA 2BZHB 4CNHA 4RIYB 5GZ9A 2IZTA 3VVHA 2HZ4A 2GTNA 3FEGA 4UV0A 3QZFA 2CLQA 2ONLA 2R3KA 4NZWB 4YP8A 3ZLYA 4F64A 1TQIA 4IDVA 1NY3A 5DT3A 3UNZA 4BCIA 3VF8A 1GZNA 3P1AA 4RRVA 4B4LA 1OI9A 4O7ZA 5B7VA 4AT5A 3AOXA 3U4UA 1BL7A 4RWKA 1GIJA 4F4PA 5AR8A 5CI7A 2QG5A 2UW6A 4Y83A 4FTNA 4Q5HA 1PMUA 3ZC5A 4RJ8A 3S2PA 4L8MA 4R8QA 1NVQA 2ZDUA 4ZOGA 4E4LA 4QP7A 4DBXA 4F9YA 3ROCA 1OL7A 3VHKA 3FQEA 2J0KA 4FSZA 2R3NA 2VTAA 2JAVA 3F3VA 2WQMA 4IWDA 4PDYA 3VUDA 3GCPA 1I44A 4XV3A 5GJFA 1YDSE 2WIHA 4JRVA 4DYMA 2YWVA 5H2UA 2C6OA 2WMQA 3OWKA 1NW1A 4G3CA 1P2AA 2WAJA 4OTDA 4EONA 1FGKA 2UVXA 4MK0A 2FSOX 3LQ8A 5HE1A 2ZJWA 3E8CA 3HV4A 2X2MA 3R00A 4JX3A 2XNBA 3FLYA 4O83A 4BI1A 3BYOA 3KRWA 4CMUA 3HP2A 4KIKA 4U41A 4A9YA 4C58A 2W1HA 4ZY6A 4L42A 1YHVA 3ALOA 5D11A 3ORTA 4FBXA 4WNOA 3TIZA 2HWPA 4QTEA 3QTWA 3BI6A 4AAAA 4JNWA 4HNIA 3QKMA 4QQJA 2XEYA 4C36A 3QQJA 1YXTA 3CGFA 3UDBA 3AGMA 4DGLC 4ZS0A 1FGIA 5JRSA 1PXMA 2ERKA 2OIBA 1H0VA 5FLFA 4NUSA 3WE8A 4BI2A 2E2BA 3AMBA 4IAAA 1U5QA 4BICA 4EZ7A 4OTHA 2YIQA 4U79A 3G90X 5AR7A 3F69A 3HV5A 4KBKA 1M52A 3PXQA 4O91A 3IGOA 2OJJA 1MRUA 4YLLA 3F88A 4LGDA 2QQ7A 3VBQA 1XH6A 3MFUA 2IW8A 4KS8A 3VNTA 3W8QA 1KUTA 3I5ZA 3FQHA 5CU0A 4TNDA 3ODZX 3V51A 5HO8A 2GHMA 2CN8A 3WZJA 3KF7A 3KREA 3PJ1A 4V0GA 1SNUA 4O2ZA 3W16A 5JKGA 2CSNA 4O38A 3C4WA 5EHOA 2UW8A 2G9XA 4NSTA 4FTMA 3DAEA 3ZO3A 3LMIA 3Q4CA 4I0SA 4LOPA 2BAQA 3R1YA 4RQVA 4FV4A 2ONLC 1A06A 1HCLA 5HE3A 3ZTXA 2BR1A 2FB8A 4C62A 2C4GA 3O23A 5H3QA 2PMIA 4X21A 3UIBA 3NUPA 4GK3A 3THBA 4PP9A 3IKAA 1PRYA 3R6XA 2PVFA 4DEHA 4GKIA 4CZYB 1ZRZA 1JKTA 2JDRA 3FWQA 4GYGA 2VO0A 5EI8A 4O7NA 1K3AA 5CSPA 2ZDTA 3QD0A 4HZRA 3PVUA 4LL0A 2BIYA 2HELA 5C8NA 3IOPA 3QKKA 4W4VA 5HX6A 1JQHA 3ZUVA 4AZFA 4F7NA 3OOGA 1IEPA 3VUGA 4HVIA 3IW5A 4G1WA 1MP8A 2JBOA 2Z7QA 5ANDA 3DU8A 3TEIA 2P0CA 2QOCA 4FV2A 2WMTA 3UMWA 4M8TA 1AGWA 2B9FA 1DAWA 2PE1A 2WQOA 5FM2A 5HKMA 5B2KA 5K4JA 4DT8A 1OZ1A 2YAAA 3GU7A 4GFMA 3CEKA 1ZYDA 2HOGA 3RWQA 3ZXTA 3FKNA 5IEXA 1APME 2X6EA 2B53A 2W1EA 3D9VA 3FZTA 2REIA 4MQ1A 5K3YA 3TKIA 5HIEA 2CNUA 3BIZA 4NYEA 4Y85A 1F3MC 1PJKA 3T3UA 4F99A 3OW3A 4EH9A 5IQBA 1OUYA 3SGCA 4QP3A 2BKKA 2VWXA 4DGMA 4AS0A 4F1MA 4LG4A 3BWFA 4BIEA 2CCHA 1Q5KA 1PW2A 1J1BA 3P79A 3UJGA 1FPUA 3EHAA 3G0FA 3JY9A 3P7CA 5HHWA 3V5PA 2X7GA 3GU8A 4WD5A 2BZKB 4M67A 4I4EA 3LMGA 2X8DA 2WU6A 5BUEA 5JN2A 4TYJA 4D4SA 2XIZA 4GG5A 2ZMDA 4D2SA 1BI7A 1OL5A 2W1GA 3S4QA 3ZC6A 2I40A 2GSFA 5FD2A 3N4UA 4DTAA 5HCXA 3LCOA 4IW0A 3RALA 1O6LA 4YR8A 3RINA 2P4IA 2VTTA 4JQ7A 4O96A 3UMXA 2ZOQA 3VS5A 4BVUA 1BI8A 5L2SA 3TZ9A 3LFEA 2YLFA 4O0VA 4CKRA 4XHKB 1WBOA 3I7BA 1V0BA 3EN5A 4EC9A 5AR3A 5HTIA 3KA0A 4DHFA 1OL1A 4E5AX 3DPKA 4C2WA 4O7WA 2PVMA 2DUVA 5GZ8A 1Y57A 4NCTA 4PWNA 2W96B 4KIPA 4DFNA 4TRLA 3QQGA 4RZVA 3CCNA 4IHPA 5D41A 3E8DA 4FK3A 4KKGA 3V5JA 4G3GA 4NIFB 2GS2A 4FKRA 2QR7A 4NW6A 4BDHA 4S30A 3IW4A 4RFYA 3PWDA 2C0OA 3BLHA 3PZEA 2OWBA 3OROA 5FM3A 3V8TA 5HO7A 4BFMA 3R8MA 3C4FA 2WPAA 3FKLA 5BVFA 2YAKA 2R5TA 1OPJA 2AC3A 4U43A 3ZLSA 1GZOA 4GG7A 2ACXA 3EN6A 5DR6A 3OCBA 3BE9A 3F3WA 3QZHA 4FKLA 4FTQA 3BYUA 4ACDA 4D1XA 3WZKA 1V1KA 4D9TA 4EK6A 3MESA 4CGAA 4U42A 4CCBA 4D4VA 3M2WA 3U54A 3MY5A 3QRKA 3QCYA 4R3CA 1OIUA 3EZVA 3HECA 4NFNA 2QD9A 5AAGA 2VTHA 3BHYA 4KIQA 1CM8A 2QLUA 5EQYA 2EVAA 3LM5A 2O65A 4XV2A 3PZHA 1BLXA 5EYKA 3FKOA 2C6EA 1M2QA 5FP5A 2PTKA 2ITZA 2OJ9A 3OF0A 1O9UA 5K0XA 5CAQA 2VTLA 3RHKA 4HCVA 4KSQA 3LW0A 4JG7A 2ITXA 4FIHA 3RPRA 2YCQA 2Y9QA 3MFTA 2IO6A 4C35A 2IW6A 4UB7A 3TACA 3G9LX 4JLCA 4JVGA 2ZV9A 2BZIB 3R28A 5AP6A 3FC2A 2BRBA 3Q4ZA 3WF6A 3AG9A 3R04A 4BCOA 3COIA 4CKIA 5IU2A 2R9SA 3R63A 4C02A 3RI1A 3FLNC 3A62A 2WGJA 4MXOA 2HIWA 3AC5A 4BCNA 3WIGA 3GOKA 4BBFA 2GNHA 2CNVA 3V8WA 2JIVA 4BDKA 4BRXA 5LWNA 3F7ZA 2XB7A 3IO7A 5L8JA 2B9IA 4NJ3A 2XK9A 2E9UA 4NTTA 4B6LA 2GNJA 1YHSA 2OJIA 4E26A 3AXWA 5EM6A 2XYUA 3GT8A 1JOWB 3Q9WA 3QRTA 3Q32A 4EOMA 4F6WA 1RQQA 5I9XA 1H25A 3V5LA 3DZQA 1PXJA 4CFFA 2A0CX 4D2WA 4AOJA 4Z7HA 4QP9A 5CALA 3D7ZA 4DGGA 3HRCA 4RPVA 4H1JA 4BY9E 3HRBA 3TNIA 1DS5A 2BRNA 4UMQA 5J5TA 2YWPA 4AE6A 2R2PA 3TNWA 4C34A 3ULIA 3R22A 4CRSA 4AN3A 1TVOA 3PFQA 2UVYA 5DPVA 1XO2B 3LJ1A 1BL6A 4NCTC 4XV9A 4X2JA 1FMKA 3QTSA 1WZYA 1AQ1A 4L3LA 2HAKA 3Q6WA 5FXQA 1FBNA 2OIQA 2BHEA 3EQIA 2CDZA 2XK8A 3IDBA 5GHVA 3FBVA 4UMUA 5K4IA 5EI6A 2RSVA 3LZBA 4D28A 3ZSGA 4E20A 3NIZA 3W2SA 5L3AA 4FTKA 3I0QA 4BCJA 4PX6A 4CD0A 4YJPA 4BKZA 4W4YA 1Q8YA 5AJQA 4YTFA 5J87A 3K5VA 4AE9A 2WHBA 5HVYA 4FIEA 2J0JA 3WBLA 4CYJA 4DINA 4F09A 4IWQA 5ICPA 1IA9A 3GBZA 3DBFA 3VO3A 5H8EA 4BYIA 4D4YA 4NL0A 2GU8A 5JFSA 2HCKA 4ENXA 2WMWA 2C6DA 5HI2A 4CQEA 4FGBA 3COHA 2XNNA 3ZZWA 2XCHA 2CMWA 2X8EA 4FZAB 3DKOA 3RZFA 2CKEA 2PE0A 4FODA 4O21A 3KMUA 4IACA 3EJ1A 4FT9A 1Z5MA 3REPA 4ZZOA 5JRQA 2IVVA 4F9CA 1JPAA 2V5QA 2YIWA 5D9HA 4USFA 4IFCA 3SX9A 3OUKA 5M06A 3TIYA 2Z60A 3RJCA 1OKZA 2R3HA 4QMPA 2W4OA 3A2CA 5HESA 4EH6A 5BPYA 5EH0A 5M08A 3MYGA 1ZYCA 3NEWA 4IAKA 4WG5A 4TYEA 2GFCA 3LFAA 3W32A 4A7CA 3D94A 2YM6A 5CEQA 5IUGA 5IQEA 3C51A 2WMUA 3UOHA 4M13A 2HENA 3CKXA 4OBQA 4RFMA 2J2IB 1XBCA 4X2KA 2QO7A 3OCTA 3R30A 5E7RA 3RNIA 4FOCA 2C3LA 2YERA 3I4BA 4LV5A 4MBLA 3U9CA 2QR8A 2J9MA 4PMPA 4K1BA 5KHWA 2BRHA 4UZHA 3RNYA 3U4WA 2XIRA 4RJ6A 4TW9A 3V6RA 4N6ZA 4NM7A 2O63A 4GL9A 4I1ZA 3NW7A 3I79A 5DOSA 1Y8YA 2VTPA 5IQDA 3UPZA 3SHEA 1H07A 4C4IA 4BWKA 4J1RA 3CD3A 3NYVA 4EHVA 2I0VA 3FHRA 3GC0A 4FVQA 3N4TA 2ZM4A 5AR4A 3R7EA 3JVSA 2A4LA 4D2TA 3TV6A 3A60A 3QU0A 5HIBA 3CS9A 5LMBA 4MXCA 1P14A 3CY2A 2C68A 4ANLA 1UNGA 4AFEA 5E91A 2CKOA 4Q5EA 4O2PA 4OTRA 3OBJA 5AAFA 1FOTA 1ZY4A 2C5XA 4GKHA 4X6QC 3A7FA 2A1AB 4FTRA 5JFVA 2WOUA 2UZBA 4X7QA 4FTJA 3QTZA 1EH4A 2YEXA 3C9WA 2QOKA 4I5PA 2JDTA 4QYGA 4FKIA 3R8ZA 4BDAA 4FKWA 3NUXA 3MVJA 1OB3A 4RVTA 4HPTE 5CZHA 4AFJA 5M07A 3GFEA 2C6KA 3DT1A 3PPJA 2O0UA 2CKPA 2GNGA 1Q8WA 3QKLA 3GCVA 3O50A 4U97A 3CP9A 3AC2A 4D4RA 4FYNA 2JBPA 3BV2A 2WEVA 3MFRA 2JITA 5I9ZA 5CF6A 3ITZA 5BVEA 4NTSA 4GYIA 3II5A 3DB6A 4Q2AA 5CI6A 5E1EA 5CEMA 4ZP5A 4KA3A 3DXNA 2OZAB 4S32A 5IA2A 3C0HA 4DE4A 3KK8A 2R3LA 4AQCA 3OWPA 4L7FA 4W8DA 3C5UA 3VS3A 1LEZA 5LXMA 3GCQA 3QLGA 4ANSA 4L53A 1DI9A 2WU7A 2XVDA 4NH1A 5IH4A 2RFSA 4YC3A 3FZRA 5C8MA 4USDA 3RBWA 5AP2A 4YC6A 3MW1A 4ANMA 4EK3A 4ANQA 3OFMA 3BELA 3PXZA 3BHVA 3U87A 1A48A 3E62A 4FNYA 4YJQA 4JBOA 3SC1A 4EH4A 4RVLA 3EQPA 3H3CA 3D0EA 2XM8A 4DH8A 4UXQA 5BUJA 3B8QA 5ANKA 3U6JA 4QMMA 3R9RA 3FXWA 4UWCA 3W1FA 2YHVA 1OGUA 1ZLTA 4XBRA 3TDWA 2UZVA 4FG9A 5AUUA 3E3PA 3ZUUA 4WNPA 4AW1A 5KKRB 3GOPA 3CPBA 4I6FA 4II5A 4QMLA 4B0GA 4V01A 4BZOA 3IG7A 1OVEA 1UWJA 3BEAA 4MF0A 4BDDA 2G01A 4G6NA 2WELA 4TNBA 4BWXA 5M53A 4BBEA 3FI4A 4DN5A 2F49A 3O2MA 2ITTA 2XCKA 2XNGA 5DN3A 1E9HA 1JSTA 4N4SA 2Y6MA 3F5XA 2OO8X 3TCPA 5I0BA 4OAUC 5HG5A 3MH2A 3IPHA 3O8UA 1H26A 5D12A 3I81A 4JL9A 4QTBA 1UU3A 1OIRA 3TJCA 3TWJA 3UIUA 2YLEA 4A4LA 4HW7A 5CAVA 3G15A 1H0WA 5DEWA 4D2RA 3DDQA 3R1NA 4DG0E 4L3JA 3DTCA 5EW9A 3KVXA 4I41A 2WMBA 1IR3A 1J3HA 2XIKA 3EL8A 3LFDA 2RFEA 1GOLA 3R7OA 4AGDA 4CKJA 2W9ZB 3KMMA 4IM2A 4XP2A 4RWLA 4DFBA 3CD8A 2E9PA 2WMSA 4JG8A 2XK4A 2UZEA 2C1AA 2YA9A 2YM5A 4FF8A 3WZDA 2UW9A 4HYUA 3OT3A 1OKYA 5CS6A 3JS2A 5E8VA 3NVMB 1UV5A 4YZNA 3V6SA 4I5MA 2ITNA 4P2KA 4RG0A 4YURA 4HVGA 1JKLA 4HNFA 2I0HA 4LOOA 3TZ7A 5IMEA 3DCVA 2QOHA 2W1ZA 1UWHA 2CGUA 3PA5A 5DNRA 4UYNA 1GIHA 3VBTA 2JKQA 4IAIA 4NKSA 4QRCA 5C01A 2VN9A 4ZJJA 1H8FA 1CSNA 3FV8A 4MWHA 5JGDA 2G1TA 3FMLA 5HE2A 4MNFA 1Y6AA 1R0PA 5CSHA 5F4NA 4ZIMA 4BBMA 3NIEA 2Q0BA 3FZSA 1PXPA 4K0YA 2GNIA 4FTOA 4KAOA 5EI2A 4QYFA 2H34A 1ERKA 4MYGA 1KE5A 4U80A 1IAJA 3FMMA 4IB0A 5AUZA 1JAMA 1OUKA 1Z57A 3ZLXA 4CFWA 1G3NA 2LAVA 3QYZA 2B52A 1OKVA 1R0EA 2CLXA 5J7HA 4AGCA 5HLPA 5HORA 4HGTA 3IDPA 3Q4TA 3AC4A 5JSMA 2ITUA 1J91A 5E8UA 3NPCA 5F95A 3GVUA 2OFUA 4RFZA 4ZTNA 5BVNA 5KMOA 5FUTA 2RL5A 4X2GA 4RIOA 4Y5QA 4O0XA 5AP1A 5EFQA 2IW9A 3RM7A 5IEYA 5LVPA 5A4TA 1Q99A 4AT3A 1VYZA 4G31A 2HW7A 3PXRA 3OS3A 4YJRA 2YIXA 5ACBC 3TI1A 4DLJA 4IANA 4YHTA 4RSSA 2YZLA 2OXYA 4MQ2A 2QC6A 3Q2MA 3VS0A 4YJVA 3HV6A 4QOXA 1J7LA 3HAVA 2VTJA 3D2IA 2XNEA 4WIHA 4Y5HA 2WZJA 4AZEA 2ZV7A 1J7UA 3VS4A 2Y4PA 3UP7A 5HTBA 5KZ0A 5AP5A 3SRVB 5AV2A 2XK6A 1KE8A 4IVDA 5IA5A 4C61A 4FG7A 4DA5A 4J8MA 3TNQB 4FE2A 1KE6A 2JFLA 3FZPA 3NGAA 2BFXA 3P08A 4HOKA 4JR3A 3PTGA 4OTIA 4YZBA 3LIJA 4RA5A 5E8YA 2WOTA 2XP2A 3UVPA 1B38A 4S2ZA 4XS2A 1SMHA 2R3PA 2HW6A 1ZARA 4JT3A 5EDPA 3ZDUA 2HYYA 3Q53A 4ALWA 3O8PA 2C6TA 1GZKA 2YM4A 5B0XA 2OF2A 4XNEA 4BGGA 2RG5A 5ACKA 2QCSA 4QNYA 3PWYA 1U4DA 4FT0A 4UBAA 3K5UA 3PA4A 4E5BA 1AD5A 3BCEA 3CPCA 2YDJA 4EYJA 5HBJA 4G9RA 4GIIA 4E8AA 3WF8A 4QMQA 4KABA 3ET7A 2BTSA 1KOBA 2P3GX 3EN7A 3TN8A 3O7LD 3ZRLA 4YJSA 4IVCA 4RIWB 3UTOA 3BU3A 3ROYA 3VRZA 3WI6A 5KE0A 4FEXA 2X8IA 3R2YA 3FY0A 5GJGA 5EHYA 4DEDA 4DGOA 3D7TA 3BKBA 3BGZA 3KB7A 4FMQA 4GMYA 3C5IA 2PMLX 4GW8A 4FSUA 4DF3A 2BIKB 4ACGA 3BHHA 2HWOA 4M15A 2GNFA 2EXCX 4RQKA 4KSPA 4C33A 1ZXEA 4JQ8A 4UWBA 3EFJA 2Y6OA 4FV1A 4AZWA 4MH7A 3KXHA 3H0YA 4EQMA 1Q3DA 2C1BA 4EOPA 3HAMA 3OC1A 4I22A 4N6YA 2OKRA 4AWIA 1Z9XA 3ORZA 4FEWA 3CXWA 1FVTA 4G2FA 2J7TA 1ZZ2A 3F61A 5LJJA 3FUPA 5LCKA 2IZSA 4RLKA 3PP0A 1ZOGA 3OUNB 3NUYA 5CF8A 4LGHA 3TNHA 4PDOA 5HZNA 5LMKA 4IE9A 4YJUA 1JSUA 1KE7A 4BGHA 4YMJA 4N57A 4EORA 1FQ1B 4NT4A 3P78A 3A99A 3LE6A 1RE8A 5TR6A 3PVGA 3GP0A 4G5JA 2C30A 5HG9A 4ARKA 4QPSA 3MJ1A 3F5GA 5IA0A 4PL4A 4PUZA 4XOYA 5G1XA 4QMTA 3G6HA 5TOZA 3QA8A 1YXUA 1ZOEA 4GEOA 3NUAA 1M2RA 4L43A 4RX5A 4XRLA 4CFMA 2VX1A 3U55A 4NM0A 4AZSA 5AAEA 4LGGA 4HYIA 2ZM1A 5DE2A 3G5DA 3O71A 5FTOA 3NW5A 2JDVA 5IH6A 5EDQA 2KULA 4JIAA 4U3YA 3R7UA 1H24A 2X9EA 2J90A 3DAKA 1JLUE 3KKVA 4ZY4A 3VUMA 2R3IA 2XA4A 3QRJA 2QKRA 3C4CA 3FZOA 3LFQA 3QD4A 3KGAA 4IB3A 4DCAA 3GU6A 4PQNA 3MPAA 1WBVA 3OW4A 4FNXA 5JT2A 3NUSA 5CXHA 4X3JA 5ANIA 3OP5A 1YXXA 2YCSA 3BHUA 4FL1A 3E3BX 2J5EA 4GIHA 4WA9A 1IAHA 4KIKB 5E8WA 2FVDA 5C8KA 4L67A 3EKNA 3PYYA 3QF9A 1WVWA 2ETKA 2X2LA 4FKPA 4TTHB 5CAOA 1CKJA 3BZ3A 4BKYA 4EH3A 3ZFXA 2DYLA 3UODA 1E1XA 3MTFA 5BVOA 1DM2A 2XRWA 3R02A 4QPAA 4X2FA 5D10A 3ELJA 4GK2A 5DI1A 2X2KA 2OK1A 5FG8A 2VO3A 2YIYA 4TN6A 4UX9A 3Q9ZA 3KRJA 4O22A 3UIXA 4EOOA 1UKIA 3ORMA 4YO6A 1YOLA 1YRPA 5IKWA 3UO4A 4BZDA 3QGYA 4X3FB 3PPZA 2PULA 3OZ6A 2BALA 4NKAA 4RA4A 3ZO2A 4DEGA 4U44A 1U5RA 4YJOA 4ZSGA 3LQ5A 2WXVA 4RMZA 1DI8A 1YKRA 5CQUA 3SW4A 4YZDA 4DG2E 3EFLA 2O8YA 3NDMA 5CF5A 1X8BA 4FIFA 1VYWA 3H9FA 3MWUA 4DC2A 5IDNA 2A19B 2UZWE 3HX4A 3UQFA 1CMKE 3TZMA 3ANRA 4WBBB 1WBTA 4H3QA 4YBJA 1BUHA 3ZU7A 3HYHA 3KRXA 5AA8A 5CLPA 3OHTA 4LOQA 4ZJIA 5LMKC 2CGXA 2OFVA 3R8PA 5BYYA 3RCDA 3VBWA 5CEKA 3FYKX 2IG7A 3RMFA 4ACCA 4UYAA 2BRMA 3OOMA 4IB5A 4XH6A 3ORNA 4EC8A 3VBVA 3ZFYA 3FMHA 4WUAA 4H3BA 2C6MA 4TY1A 5E8ZA 5KO1A 4E73A 1M14A 2R7BA 4ZY5A 5M09A 1H1RA 4RT7A 1OL2A 1REKA 2HK5A 4I5CA 4OTFA 5JQ8A 5IQFA 1XWSA 2JIUA 4P5QA 3CBLA 3ZO4A 2J0LA 4F7SA 2IJMA 3VJOA 4F6UA 3DNDA 3EYGA 4HCTA 3OVVA 4I6QA 4LRKA 3HKOA 4NFMA 5AP4A 5BYZA 4L52A 4BCPA 3HA6A 4E6CA 4RX7A 4EZ3A 3JXWA 3U6HA 4E4MA 3HUBA 2O3PA 4DEBA 4C3RA 5M4CA 5KMIA 3C4EA 4J97A 3FPMA 4OBPA 3AD4A 3VUIA 4BIBA 4EHGA 5AM7A 4EQUA 2XKEA 2F9GA 4EWQA 4R3PA 2OH4A 4FTUA 3U51A 3ODYX 3K3IA 3PY3A 3RK9A 5IQGA 1XBBA 2QOBA 4QQTA 3FMEA 2W05A 3CIKA 2PVYA 4LFIA 3ZM9A 3H10A 4CSVA 3ZSIA 3C0IA 4L00A 3GEQA 4N70A 3PP1A 2DS1A 5AM6A 5F1ZA 5GINE 4DEIA 1V0PA 3HV3A 2VNYA 4XV1A 3KL8A 3LCDA 3NAYA 4FSYA 3C4ZA 2OSCA 3LCSA 3CLYA 4BTKA 2C3KA 2E9VA 3RPYA 1QCFA 2R0IA 3ZM4A 4BGQA 3CTHA 5AV3A 5HU3A 3ZXZA 3GFWA 3U9NA 3SQQA 2XKFA 4GT5A 3ZEWA 3GU5A 4XYFA 5TE0A 2W99B 2QO9A 4KINA 4QYEA 5DHJA 1ZAOA 3ZBXA 2X7FA 2WNTA 2C69A 1IASA 3BV3A 4RIXA 5M4FA 3GENA 3FJQE 5EM7A 5IDPA 3D14A 2YN8A 2OG8A 3DV3A 5J95A 4AN9A 3NVKI 2QG7A 3HMIA 3Q04A 4DH1A 5CENA 4JBVA 3ZHPC 4CLIA 4X3FC 4KBAA 4EL9A 3CJGA 4G17A 3R9HA 3RM6A 1GZ8A 3POOA 4HGSA 3QCQA 3TUBA 4JDIA 4FI1A 1LEWA 2W1DA 4XRJA 4KWPA 4AW5A 1Q61A 3LXKA 3AMYA 3FYJX 4IZ5A 4B8MA 2WB8A 4OLIA 4CRLA 5HD4A 4QPMA 4PPAA 5HCZA 3VJNA 5J7BA 4E7WA 4L3PA 4Y73A 4NIFA 1OKWA 4ANOA 5DRDA 3ORPA 4WHZA 4IC7A 3TKHA 1YOJA 4MX9A 5BVDA 4FKVA 5L8KA 3PIYA 3DKCA 4FZ7A 3O96A 5CVGA 4AXAA 4QMZA 4BI0A 4EOQA 1ZYSA 3SVVA 4FNWA 1NVRA 5CU2A 3FLQA 1Y91A 1TQPA 5CVHA 5I3OA 3W2OA 4A9TA 4CV9A 5I9WA 4JDHA 1STCE 1YXSA 3OWLA 3N51A 4AA5A 4IX4A 3OXTA 4MCVA 4TYHA 5DWRA 3S95A 4BDIA 2ITYA 2JIIA 1YXVA 3W10A 2VD5A 2CKQA 3DGKA 5KMMA 2WQNA 1YW2A 3CQWA 4YPSA 4S33A 2IZRA 3SKCA 3RCJA 2VZ6A 1XR1A 4NEUA 1KE9A 4X6RA 3PJCA 5A4CA 2ERZE 5KBRA 2VWWA 2QOFA 2PK9A 1JSVA 3DB8A 1OIQA 1SVGA 3ETAA 4W4WA 5DIAA 5FWKK 4E4NA 4DTBA 1WAKA 3AC3A 4IJPA 3BE2A 4FSMA 4QTCA 4RBLA 2HZ0A 3AT2A 5LVNA 1OM1A 1UNLA 4C0TA 5HGIA 1PXLA 1Q8TA 4TYIA 5CT0A 2HZIA 2P55A 3KRLA 1PMEA 2F4JA 2JKMA 4QO9A 3ZUTA 4AZTA 4BCMA 2BUJA 3MB6A 4WSQA 5HVJA 4AA0A 4AOIA 4BCGA 4JG6A 4I24A 4EQCA 1VZOA 3L8VA 4FK6A 2QI8A 4HZSA 4DFYA 2F2UA 3C7QA 4FSTA 5ITAA 4A9UA 3E88A 5C4LA 3ORLA 3P7BA 3HDMA 4XEYA 4DEEA 2CGWA 2E9OA 3NYOA 4FX3A 4PPBA 4R6VA 2B1PA 5ETIA 5EYMA 5IISA 5DT0A 3GC7A 3ATSA 2VTMA 4E3CA 1IG1A 5KMNA 2OBJA 5TKDA 4QP2A 4U8ZA 1ZMUA 1NA7A 1PMNA 4BKJA 3UZPA 4DFUA 1KV1A 3VAPA 2QNJA 4W9WA 4A06A 5BX0A 5KBQA 2W06A 2C47A 3G6GA 2RFDA 2EWAA 3GC8A 3GCSA 1SYKA 2FGIA 5D7AA 2ITOA 4ANBA 4EKLA 2BAKA 3BLQA 4OUCA 5J9ZA 2X6DA 4F6SA 1I09A 2CHLA 4G16A 4A4OA 4C4HA 1U59A 3W2CA 4U81A 3NR9A 1P5EA 3MS9A 3TT0A 4FIIA 4R3RA 5HO6A 2P33A 4CZTA 3CTJA 5A46A 3QD2B 2B9HA 3VW6A 4IXPA 2PZPA 1HCKA 2YDKA 3MJ2A 5HLWA 1U46A 3R71A 2VWBA 4M3QA 4U5JA 3A61A 1WCCA 4PV0A 5BNJA 3FMNA 4MWIA 1TQMA 4UMPA 2ZAZA 3L8SA 5K9IA 5A6OA 4K2RA 5FXSA 3Q60A 3FXZA 3DJ7A 4U6RA 2ETMA 4AT4A 1W83A 4RC2A 5FEEA 4IZAA 3BBTB 4WOVA 5HBHA 2YCFA 4ITIA 2PVNA 2B54A 4EZ5A 4FEVA 4FTAA 2J50A 4XG2A 3KF4A 4EOIA 1ND4A 4YBKA 4ZTRA 4F0GA 4LMUA 3SOCA 4F9WA 3EKKA 3MH0A 3HUCA 5IEVA 4O1PA 3QTRA 4I4FA 4MTAA 3HL7A 1G8SA 3F6XA 3QQFA 5A4EA 1GNGA 3QAME 5TT7A 4G3EA 5HG7A 4UEUA 4JBQA 4FVPA 3AC1A 3F5PA 5AUVA 2YDIA 1A9UA 5LVMA 2ZB1A 3QQUA 5KZIA 3ZCLA 3Q52A 4LUDA 4FGRA 2XZSA 2BCJA 4CQGA 4K6ZA 2QURA 4OT5A 2W9FB 5JQ5A 2PHKA 1WFCA 2J0IA 1RW8A 3BYMA 3QZGA 5K0KA 5EKNA 5K5NA 4NJDA 3QQKA 1H4LA 5HNGA 3RWPA 4O0WA 4RVKA 3SXSA 4M68A 3A8XA 5CASA 4FTLA 2CPKE 5CU3A 3WF5A 2VAGA 2PVKA 4O1OA 2AC5A 3Q5ZA 4I23A 5B2MA 5GZAA 4I21A 4R7IA 4ZTSA 3MBLA 4AW0A 1PYXA 3HP5A 5ANOA 4C38A 1OBDA 5CT7A 5CYIA 2PZIA 3AGLA 4H39A 1XKKA 4BTFA 4FSWA 3S0OA 5BVKA 2Y7JA 4WRSA 3PXFA 1E1VA 1UKHA 3QCXA 4M0ZA 4D1ZA 2Q0NA 4EYMA 5IUHA 1XHAA 4Q9SA 2X0GA 1H1QA 3ERKA 4FKUA 4I0RA 3FLWA 4O6LA 2JEDA 4FIGA 4NM5A 4D0XA 1L8TA 4M84A 5TO8A 4FYOA 1Q62A 4FV6A 4L01A 4OBOA 4CT1A 3MPTA 3I7CA 4WRGA 3DBQA 1LUFA 2AUHA 3E8EA 4M14A 2H6DA 5DBXA 3GNIB 3BQCA 1ZMVA 2PMOX 3FLSA 4RLLA 5ANJA 4XG8A 5AEPA 4O7VA 5IQAA 4R1YA 4HVSA 5AX3A 5FRIA 2R7IA 1MRVA 4RGJA 3SG8A 2YIRA 4G3FA 5K5XA 5CY3A 4ZXTA 3C50A 5HNIX 3KXGA 4D58A 4RX9A 3KXZA 2PPQA 3FAAA 5FTQA 3BGQA 5CEIA 5CF4A 4H05A 3GB2A 2XUUA 1QL6A 4ORKA 3IK3A 4TKSA 4CZUA 4QT1A 2W4KA 3PSCA 3HGKA 4O7LA 4RJ3A 4TL0A 2UZDA 2VWUA 4PDSA 3UBDA 4AA4A 5AV4A 5L6OA 4OTQA 1UU8A 4ONAA 2GQRA 3KQ7A 4PP7A 2BDFA 1JWHA 4HCUA 4HGLA 2I1MA 2I6LA 4ZSJA 5FTGA 3BU5A 4FUYA 4R7HA 2C6LA 4ZJVA 1QPJA 3EOCA 1Q8ZA 3KVWA 3EL7A 3QRUA 4GK4A 2JKKA 4RWIA 4FV3A 5AIRA 5I4NA 3V5WA 1ZZLA 4NU1A 4YHFA 3WIKA 4GJ3A 4Y95A 2FUMA 4XX9A 3TV7A 4O0RA 2C0TA 5I5ZA 2OZAA 4I94A 2VV9A 3QCSA 3K3JA 5KCVA 4BTMA 2XRUA 4MXYA 4DITA 5KX8A 5BVWA 4YZCA 2OJGA 1XQZA 4LRJA 2YM3A 4MF1A 3NNWA 4O81A 1URCA 3R0TA 1WBSA 4P4CA 5DEYA 2NRYA 3Q9XA 4DBNA 4AN2A 4LMNA 3PY1A 5GIPE 4O86A 5A6NA 2ITPA 1O6YA 4R5YA 4C59A 2O64A 3IW6A 5CWZA 2BVAA 2W1FA 4PTGA 3F3TA 3UQGA 5M56A 4Z7GA 3SW7A 5C4KA 3V01A 3LQ3A 4O7SA 4F9AA 3W8LA 2R0UA 2XYNA 3AMAA 5ANGA 3C4XA 3D15A 2WMXA 4ZEGA 2QOIA 5IH5A 1W7HA 3EYHA 2GS6A 2ZV8A 1R3CA 1KV2A 3A4PA 3OWJA 3KY2A 3DAJA 2NPQA 4MXXA 2F2CB 4ZTHA 5AWMA 3SLSA 3TTJA 3ZLWA 2C5YA 3NCZA 1M2PA 4FT5A 4F63A 3AC8A 4C4FA 3ENMA 3Q5IA 4RJ5A 5JFXA 2QVSE 3T9IA 3KULB 2OZOA 4A4XA 2CGVA 2Z7LA 4ZSLA 4XG7A 4DH3A 1Q41A 3V04A 1FINA 5C9CA 5HLNA 2ZMCA 1ZMWA 4I0TA 3QX4A 2OLCA 4PMTA 3MTLA 5FDXA 1U54B 3R9NA 3P86A 3RTPA 3FZ1A 4FKTA 3IOKA 3TDVA 1OITA 3FMJA 3SOAA 2VTRA 2XK3A 3FC1X 4Y46A 5F20A 3UE4A 2PUNA 3DK6A 1PXNA 4GU6A 5CEOA 2YCRA 2JGZA 2EXMA 3FL5A 4E5WA 2F7ZE 3EB0A 3CR0A 4JBPA 5EM5A 3BX5A 1P4OA 3CY3A 4DAWA 3CTQA 1S9JA 3MY1A 2BILB 2JD5A 3DK3A 2R64A 5EG3A 4DFXE 4EH2A 1PHKA 3V8SA 4IWPA 1PXOA 3VS2A 1XJDA 3WILA 2E9NA 2X4FA 4GS6A 4MNEB 4CMOA 3NS9A 1Q8UA 4R77A 4YUQA 5JFWA 2SRCA 3T8OA 3TM0A 3CQUA 2C5VA 5DG5A 4FTCA 2R3FA 2GNLA 1YWRA 3GC9A 4AU8A 1NVSA 5DMZA 1Y8GA 2VNWA 4JS8A 4KKHA 4CFUA 3EH9A 3E63A 3PJ3A 4LRMA 3QGWA 4IADA 5JGBA 4YPDA 4HYSA 2WKMA 3PRFA 5M4IA 3DS6A 2VGOA 5DYJA 4Z55A 4KRCA 4IM3A 4PRJA 5LVLA 3A8WA 2HZNA 4YTIA 4BCHA 3QRIA 1GY3A 3WZUA 2Q83A 3JR1A 1XH5A 4FTTA 4YU2A 1IRKA 2F7XE 3VQHA 1Q24A 4X0MA 4F0FA 3UGCA 2BZJA 5EDRA 2A27A 4D0WA 3B2TA 3OY3A 4OW8A 5CU4A 1B6CB 5ETFA 3D83A 4M69B 4LI5A 1FMOE 3QUPA 5ANEA 5HD7A 4FT7A 4GCJA 1H01A 4PMSA 3G9NA 4D5KA 3OCGA 4GFOA 1WVXA 4IZ7A 4I3ZA 3EQGA 3JPVA 4OTWA 3LFBA 4FA2A 4PTEA 1M7NA 3A7GA 2PUUA 5KKRC 1MQ4A 4YZ9A 5JMSA 1Y6BA 4S31A 3ORXA 3MN3A 5LWMA 4FV7A 4JI9A 5CQWA 5E1SA 2GPHA 2VUWA 2Z8CA 3LFNA 3ATTA 5J8IA 2V7AA 3I6WA 4V05A 3E7OA 2Z02A 2JAMA 5ETAA 3BRBA 3LJ2A 3CKWA 4DCEA 3SRVA 5JH6A 5IA4A 4QTDA 2EXEA 3ZFMA 2EB2A 4GU9A 1REJA 3UOJA 3DLZA 3KEXA 4QP8A 5EYDA 4FV0A 2VTSA 1JVPP 2H9VA 3MVMA 3QUEA 4L44A 3UNJA 2UZOA 4B99A 3A7HA 4MVFA 3SDJA 2Y0AA 4HVHA 5L2IA 3UNKA 4QYHA 3W55A 3E7VA 5DVRA 4EH7A 2PU8A 4I93A 3TG1A 3T3VA 2CCIA 5IZFA 3RP9A 4KBCA 3QX2A 5J1WA 5CTPA 3VS7A 2AYPA 4F7JA 3AD5A 2BTRA 2IVUA 4A07A 3WF9A 5AUYA 4IC8A 4ASDA 3DBEA 4WKQA 5FBOA 1V0OA 2XIXA 4G6OA 4IIRA 5FEQA 1WBPA 3UVRA 4EJ7A 3D7TB 5J9YA 4FKJA 4RIWA 2PZRA 5I9YA 4PTCA 3CGOA 3HEGA 3LXNA 1PXIA 4O6EA 2WTIA 3HMOA 2F57A 2RF9A 3PG3A 3EIDA 4QQCA 3SXRA 4E6AA 5E8SA 5CEPA 5LCJA 3A4OX 2ESMA 2BDJA 5AUXA 1R1WA 3G51A 4EH8A 1CKIA 4JAIA 3RZBA 2BRGA 4EI4A 2OJFE 3VHEA 4ZZMA 3Q96A 2R4BA 2VRXA 2UW3A 4BB4A 2UZUE 4FUXA 4E4XA 3DQXA 3OXIA 1XH9A 1OMWA 2UZNA 4V04A 3L8XA 3TV4A 4IM0A 4GVAA 4H36A 5GNKA 4U0IA 2CJMA 4Y8DA 2OGVA 4RIYA 3LKMA 2FH9A 4QMXA 3EQDA 2XJ0A 2P2IA 4F1TA 3QHWA 2GHLA 4MD9E 5HE0A 1J7IA 4YZMA 3E93A 3UVQA 4KNBA 2J6MA 5FQDC 1BMKA 2LGCA 3R7VA 4IX6A 2OXXA 3PVWA 3KXMA 2VO7A 3R9OA 2FA2A 5DGZA 4M66A 4AZVA 3NLBA 1W8CA 2W1CA 4U7ZA 5J1VA 2XMYA 3R7YA 4AOTA 3RAWA 3NUUA 4IVBA 4XG6A 1NXKA 3IGGA 2BMCA 3JUHA 3KK9A 3F2AA 3QYWA 3FI2A 3EQFA 3QTQA 4D2PA 3FI3A 3RHXA 2OH0E 3OTVA 4FV8A 3SXFA 4P90A 1R39A 4BC6A 3PJ2A 4EUTA 5AX9A 3V5QA 3I1AA 4QMSA 2R3JA 4TWPA 5AR2A 4WO5A 1YDRE 5CAUA 2C3JA 1FVRA 3PXKA 4ZAUA 3CJFA 2W1IA 1CTPE 4YO4A 3Q9YA 4FC0A 3NNVA 1YDTE 2WD1A
chains in the Genus database with same CATH superfamily
4QMYA 1PF8A 1K2PA 4EK5A 2RGPA 2XJ2A 3B2WA 3QLFA 4F0IA 4O7TA 2VO6A 4RWJA 1VR2A 1UVRA 5CX9A 5A14A 3ZSHA 4HJOA 2BKZA 2DQ7X 2XNMA 3C13A 4LQMA 2PYWA 3UZRA 3DA6A 4O0YA 3NSZA 4EBVA 5CSXA 3ORIA 3PIZA 4GV1A 1KWPA 3UZTA 4XP0A 5AUWA 4BIDA 3G15A 4I20A 3ID6C 3NUNA 4J53A 3F66A 4XG4A 3AD6A 4PDPA 4ALVA 2BFYA 1XH7A 3GUBA 4MXAA 4IWOA 4DH5A 4M7IA 2VTOA 5AIKA 4GUEA 4KIOA 3BGPA 4BDJA 4JR7A 2R3RA 3F82A 3R8UA 4PNKA 4RX8A 3LCTA 3VWAA 3F2RA 2GQGA 4NWMA 3IQ7A 4CYIA 4IX3A 4OR5A 4OT6A 4DG3E 4YSJA 3EN4A 4WUNA 5KMKA 5L2WA 3LCKA 3LFFA 4X3FA 4V0GB 3I6UA 2XAOA 5H9BA 2ZFYA 3H0ZA 3S3IA 3NYXA 4F08A 2OIDA 1B39A 2NP8A 4W9XA 1OBGA 1F5QA 1WBNA 3LLTA 2VWYA 2XM9A 1ZY5A 4U3ZA 3BEGA 2WO6A 4LUEA 3PG1A 4G5PA 4CCUA 4EHZA 2IPXA 5IG1A 4FV5A 2H96A 3UC3A 4QD6A 2Z7SA 3H30A 4FKQA 4YJNA 4G6LA 5CAPA 5EQEA 2XIYA 1YI4A 4IBMA 5HICA 4JRNA 4AUAA 1H27A 4QP1A 3NW6A 3TTIA 4DTKA 2UZLA 3COMA 5CSWA 3LLAA 4BCKA 2PZYA 4CFNA 3H9OA 4OGRA 2WTCA 3GQIA 3LPBA 3LMHA 3R8VA 3RPOA 3DXPA 1KSWA 3T9TA 3EFWA 5AR5A 3IECA 1WBWA 3W18A 5FXRA 1YI3A 1SNXA 2C5NA 3AT3A 4YSMA 3ZH8A 3LM0A 4C4EA 4XBUA 2IVSA 3F7WA 4TWOA 3ULZA 4AG8A 4D2VA 5IA3A 2IN6A 4R7BA 3UDTA 1BKXA 3NNUA 2WQBA 2W5AA 3OD6X 4AW2A 5M44A 3JY0A 3K54A 3QC9A 2WQEA 2QO2A 2XK7A 2V55A 4QNAA 3VULA 5L2TA 3NWWA 3BU6A 4C4JA 3O0GA 1M7QA 4L45A 3KU2A 3QHRA 4QP6A 4PMMA 3MIYA 4G3DA 3LVPA 3UO6A 1H00A 2OI4X 3KXXA 3QALE 3OEZA 4CFXA 3MVHA 4E6QA 3PPKA 3PJ8A 1H08A 3ANQA 5CNOA 3D5VA 5H8BA 2JC6A 2PVJA 3DNEA 4BDBA 5AADA 4K77A 1HOWA 4D1SA 5IUIA 3C0GA 3UOKA 4LM5A 2IVTA 4DH7A 4EUUA 2O2UA 2QOOA 4CXAA 2FO0A 2GTMA 2WFYA 4PY1A 5D7VA 3DBDA 4C37A 4JDJA 3QTUA 4TT7A 1SVHA 3VUKA 2QU5A 2PWLA 4MEDA 1XH8A 1VEBA 5EW3A 3D5WA 4FRFA 5IPJA 3Q4UA 3EWHA 5E9EA 2NNWB 4K18A 3L9NA 2X39A 5HNBA 3V3VA 3BYSA 5F94A 3PSDA 1MRYA 4BHZA 4BTJA 3JYAA 1YWNA 2ZYBA 3COKA 3RPVA 2UW0A 3ZBFA 3TMOA 4RIXB 4FEUA 1Q4LA 2YITA 3BPRA 2UVZA 1XH4A 2GHGA 4I6BA 4IMYA 3WARA 3AQVA 2YFXA 4F9BA 1PY5A 4F1OA 1URWA 1YQJA 4IFGA 4K9YA 3LHJA 5HU9A 5L6PA 3EQCA 3G2FA 5JGAA 4KUJA 1VJYA 2GFSA 4MD8E 3R01A 3BLRA 4YLJA 2BPMA 4WG4A 3EQRA 3CQEA 3QZIA 3D4QA 3G33A 4G34A 2UW7A 3QD3A 3KCFA 4JOAA 4PL5A 2ITVA 5HCYA 5T68A 4CG9A 3DKFA 2QONA 3OG7A 4H3PA 4IAFA 3LXLA 1W84A 5HOAA 4O82A 4DHIB 3QWJA 4FKGA 2VTQA 3UPXA 2I0YA 2RIOA 2EUFB 3Q3BA 3QXOA 3RVGA 4CMTA 5EOLA 3MV5A 1YHWA 5IA1A 2ZB0A 2UUEA 3Q2JA 4J52A 2BROA 3MVLA 2ZM3A 4ITJA 4YTHA 2RFNA 5GJDA 5L8LA 2IEWA 3KN5A 3QXPA 1BYGA 3Q6UA 3N4VA 2PY3A 3OY1A 4MHAA 4TYHB 2J0MB 3TZ8A 3IS5A 3SV0A 2V62A 4GFGA 4GRBA 4ZTLA 1JBPE 4F7LA 4XCUA 3NMUF 5KMJA 5A3XA 2ITQA 1J1CA 4J8NA 2PVLA 4MBJA 1Q3WA 2GCDA 3F9NA 3PIXA 3RKBA 4Z16A 4UMRA 3I60A 3N9XA 5CXZA 2W7XA 2G2HA 3EQBA 1WMKA 4FVRA 3MSSA 4RVMA 4GVJA 3R9DA 1K9AA 3FSFA 2KTYA 1ATPE 4PPCA 3L9MA 3VIDA 3QFVA 4QMUA 3MA6A 1MUOA 4GSBA 5DR9A 3H4JA 3FE3A 2EU9A 2JDSA 4E6DA 2I7QA 3W0QA 4L46A 3SG9A 2X7OA 3JVRA 3M42A 4XOZA 3UDSA 1H28A 2C6IA 3ALNA 1W2DA 4OAVB 1NT2A 2YJSA 4WNMA 1G8AA 4YLKA 4IB1A 5EKOA 4Z3VA 2QHMA 2RKUA 3OBGA 3HNGA 4J7BA 4J96A 5HIDA 3DDPA 3E87A 4JJRA 4FV9A 4EWHA 4U9AA 1YVJA 3O51A 3HRFA 4EKKA 4F65A 4ZLZA 2B0QA 2F7EE 4UALA 5EM8A 5HBEA 3P5JC 4YTCA 3P7AA 2A2AA 1JKKA 3K2LA 3D5XA 3TJDA 4W8EA 4ZLYA 5LMAA 2JFMA 2VTNA 4ASEA 3LXPA 2IWIA 3EN9A 5LQFA 3P9JA 1QMZA 4IQ6A 4HGEA 2UV2A 3F5UA 3SAYA 4C3PA 4CT2A 3MIAA 4AF3A 3DTWA 1GIIA 4PNIA 5HG8A 2YACA 3OXZA 5IMXA 4FG8A 3VUHA 2PMNX 3DOGA 2XF0A 3NRMA 3O8TA 3WYYA 3DXQA 4C4GA 2J4ZA 1YWVA 3MDYA 3RAHA 3R21A 3PRIA 1H1SA 3P23A 4IVAA 2RG6A 1YOMA 3QUDA 4XG9A 3FSKA 3DKGA 5DFPA 2GQSA 4HPUE 3P4KA 3ENHA 2XJ1A 4FL3A 5KMLA 3POZA 4RZWA 4B7TA 3UIMA 4K8AA 1QPEA 4ZZNA 3L9LA 1OPLA 3P0MA 2XNPA 5DR2A 4BYJA 1PMVA 1UU9A 3WYXA 4WT6A 3AKJA 5DLSA 2R3QA 2B55A 2OICA 2YM7A 3U6IA 4O7RA 3L9PA 4FJVA 3HZTA 4JAJA 2OW3A 4YHJA 3KRRA 4CVAA 4BDGA 3VS6A 3KXNA 5HTCA 3VONA 1OL6A 4UZDA 3TXOA 2QHNA 5HVKA 4G9CA 4MAOA 4FT3A 2B4SB 2VGPA 2QKWB 1LP4A 3RGFA 4D55A 3NX8A 4UY9A 4GJ2A 3IONA 5B2LA 5JZJA 4P7EA 5FDPA 2XARA 4RJ4A 3R1SA 2UW5A 4LL5A 2I0EA 4MD7E 4BDCA 4JQEA 5I3RA 4E93A 4YC8A 3W33A 3R7IA 3UOLA 3BBWA 2BDWA 3DJ6A 3L8PA 4KRDA 3U8WA 3VC4A 4AX8A 3PY0A 2PZ5A 3HLLA 5CNNA 4WSYA 4IEBA 3CE3A 4J98A 4S34A 4RJ7A 4M0YA 3QQHA 3MI9A 5FP6A 3CC6A 5E4HA 3HVCA 1BX6A 3PUPA 5AFVA 4BN1A 5AV0A 1P4FA 4UXLA 5AUTA 3WZEA 4FTIA 4ASZA 4HYHA 3UYSA 1SVEA 5DH3A 4LV8A 3DK7A 4U40A 2VX0A 3OCSA 5CZIA 5AP3A 5HX8A 4ERWA 5F9EA 3VBYA 4ZMEA 3BYVA 1LR4A 1PKGA 1UU7A 2EB3A 2IZUA 3FMKA 2HXQA 3NAXA 4QQ5A 4XLVA 4C7TA 3V5TA 3PE2A 4I92A 1H1PA 4B8LA 5BYLA 3ZRMA 3HMPA 5M55A 1W82A 5L4QA 2ITWA 2Y4IB 4GH2A 3BHTA 4CV8A 5IQIA 2DWBA 3I5NA 4I5HA 3LAUA 2XEZA 5M57A 3NZ0A 4ZMFA 1JNKA 1L3RE 4IAYA 2YM8A 4ZTMA 4OTGA 3WF7A 2NO3A 4BCFA 5IQCA 4YNEA 4M97A 5T6KA 5J5SA 3DBCA 2B7AA 4FZ6A 5J79A 4FKSA 3UC4A 4K11A 2GDOA 3PVBA 4QMNA 4O7YA 4N0SA 2X0PA 4AGWA 5C03A 5A4LA 4IAZA 5L6WL 2W4JA 2J51A 3KCKA 4TXCA 3VW8A 1T46A 5BMMA 3VS1A 4ASXA 3HV7A 4BR3A 4YNOA 3ZMMA 3A7JA 4ZK5A 2Y8OA 3ZONA 2WTKB 2Z2WA 3G0EA 5FBNC 3QA0A 5CANA 4L6QA 1PYEA 2O5KA 5T3QA 4EHEA 4ZSAA 4YGAA 1ZWSA 5BMSA 5E8TA 3AT4A 2R3MA 2X4ZA 1KOAA 4XMOA 5EW8A 1QPDA 3DQWA 3ZRKA 4NK9A 2PUPA 4FZFB 1XBAA 3UO5A 5KUPA 4CLJA 2X9FA 5AP7A 5J9LA 4XLIA 4O4CA 4NW5A 5L2QA 3FQSA 4XP3A 3O17A 2HXLA 4FEQA 5JK3A 4O84A 5CU6A 3WE4A 4ZLOA 3HMNA 3VRYA 2ZV2A 1UA2A 3TUCA 1H1WA 4KS7A 4X2NA 3UP2A 3F3ZA 2ETRA 2XH5A 2JKOA 4ANNA 5EOBA 1FVVA 3PE1A 3RK7A 4AP7A 3MFSA 2QOQA 4EK8A 1GAGA 3OT8A 3SD0A 4CFVA 3UG1A 4APPA 3BL7A 1YI6A 4GUBA 5I9VA 3MH3A 5E92A 2C3IB 1QPCA 2XNOA 4APCA 2VU3A 5KNJA 2V22A 3R73A 4KD1A 4XG3A 1M17A 1SZMA 1OECA 5D1JA 3QC4A 3RAIA 2FYSA 1W98A 1F0QA 5G6VA 4QMVA 1ZYLA 3O7LB 5C27A 4DEAA 4EEVA 4IX5A 2QU6A 3OMVA 3EFKA 3FHIA 2BAJA 3LJ0A 4JXFA 3MPMA 3QTXA 4ID7A 4TYGA 2PVRA 3W0NA 3NYNA 3MB7A 2PUIA 4HVDA 2OU7A 3M11A 4CEGA 3VQUA 2QODA 2QLQA 4WBOA 5CVFA 3TUDA 3ZDIA 4USEA 4QP4A 5JZNA 4I6HA 5HEZA 2W5BA 5M51A 4F70A 1R78A 3LFCA 2Z7RA 4AGUA 2R3OA 5HQ0A 2WIPA 2WMAA 2UW4A 3ACJA 2V0DA 4BWPA 4LYNA 2PE2A 2W17A 2WTJA 4IDTA 3VUTA 4ACHA 2W0JA 5AA9A 2C0IA 2JLDA 1CKPA 3H9RA 4PL3A 3QQLA 2V7OA 4R78A 4J99A 2FSTX 3E8NA 2NRUA 4FSQA 1WVYA 1JKSA 5C26A 5LARA 3FL4A 3KULA 2G2IA 3DZOA 4JX7A 4EBWA 2FSLX 2VWIA 3KMWA 4BHNA 3ZOSA 2BHHA 4TPTA 3IW7A 3FPQA 4FSRA 3VF9A 4ITHA 2WTDA 4C2VA 3I0OA 2Y4IC 5E90A 4DLIA 5LVOA 3FXXA 3S1HA 1U54A 3BWJA 2HY81 4IJ9A 2YABA 3M1SA 4TWNA 3BQRA 1S9IA 3B8RA 4ERKA 4O27B 2XBJA 2ZVAA 3DJ5A 2H8HA 4C57A 3F2NA 3GCUA 4FKOA 4BF2A 2QOLA 4Z9LA 3PSBA 3PLAE 4TZRA 2CNQA 3R2BA 4XJ0A 3ZYAA 4K33A 5ETCA 3EMGA 4O0SA 4EOKA 3VBXA 1OPKA 4FICA 2WMVA 4FR4A 4ZTQA 4ALUA 5EYCA 4R1VA 2FSMX 4DT9A 4MKCA 2PSQA 2VX3A 2GS7A 5AP0A 3TNPC 1T45A 1W0XC 4FOBA 4OTPA 2PL0A 2VWVA 2WTKC 3PXYA 5EHLA 4BDFA 4MNEA 2XKDA 3QWKA 3QBNA 4QMOA 3ZS5A 4J71A 2B9JA 2JDOA 4O0TA 1SM2A 3ZZEA 4EOSA 3UG2A 3LFSA 3HDNA 5KHXA 4UWYA 2HY0A 4L9IA 5FEDA 4C3FA 3HA8A 1CDKA 3MA3A 4WNKA 3NCGA 4KKEA 4L7SA 3TL8A 4J95A 3VN9A 4CTBA 1ZOHA 2R3GA 5DT4A 3NNXA 4U45A 5AMNA 1OIYA 3DY7A 4O0UA 5AV1A 2WTWA 3RPSA 3E92A 3GXLA 1LPUA 3F3UA 2VTIA 5DA3A 4JIKA 3ACKA 4XUFA 2WMRA 4UN0C 5FGKA 2A98A 3W2RA 5IF1A 5EQPA 5CSVA 4Q9ZA 4CTCA 5E8XA 5BQ0A 3S00A 4P5ZA 1G5SA 4M69A 4FL2A 3ZEPA 1O6KA 2YZAA 4IH8A 2WEIA 4B9DA 1DAYA 2P2HA 3MY0A 4EOJA 4BZNA 5IQHA 2C5OA 4EH5A 4L68A 3RAKA 2OXDA 2XBAA 3GQLA 5I9UA 3SA0A 4FSNA 4E1ZA 3PLSA 3FDNA 3KFAA 4FZDB 4QTAA 3RK5A 1PXKA 2YISA 3R83A 5LOHA 5EK7A 3KN6A 3DFCB 5BUIA 3D2KA 5A54A 3W2QA 2WTVA 3P5KA 4C8BA 4KB8A 4GT4A 4RC4A 4TWCA 3MGYA 3PA3A 4MBIA 1GJOA 3R8LA 4D9UA 1MQBA 1Q97A 3E64A 3A7IA 3C1XA 4QYYA 4CG8A 1IA8A 2UZTA 3GI3A 3D5UA 3R1QA 4DGNA 2XS0A 4H1MA 3FY2A 2VWZA 3GU4A 2X1NA 4WG3A 3OEFX 4FNZA 5GIOE 2PVHA 3WOWA 3KC3A 1RJBA 3UQCA 1RDQE 5TF9A 4EJNA 4Y72A 4EK4A 4EOLA 3R7GA 4MXZA 5H8GA 3IDCA 5C1QB 2J5FA 3EQHA 4BCQA 3MH1A 4BDEA 4DFLA 2CN5A 5JEBA 3LOKA 1PKDA 4IZYA 4PF4A 4UMTA 3FLZA 2W5HA 1TKIA 2YJRA 2GMXA 4GT3A 3W2PA 4A9RA 3CSVA 3FI8A 3TKUA 3OTUA 4JDKA 1ZYJA 4M12A 5DRBA 4D5HA 4ZSEA 3O5AA 2X81A 4R5SA 4A9SA 5M4UA 4YJTA 3L1SA 3ORKA 4DFZE 4QMWA 3HMMA 4ENYA 5A4QA 3PDTA 1XMMA 4NM3A 3UYTA 4FIJA 2XKCA 3DLSA 3E5AA 3DFAA 3QTIA 3FMDA 5A9UA 4ZS4A 3IW8A 3GGFA 4W4XA 4AACA 3ZO1A 4BL1A 3EZRA 3QL8A 4H58A 4ACMA 2OF4A 4RC3A 2G15A 1UNHA 2G2FA 2BZHB 4CNHA 4RIYB 5GZ9A 2IZTA 3VVHA 2HZ4A 2GTNA 3FEGA 4UV0A 3QZFA 2CLQA 2ONLA 2R3KA 4NZWB 4YP8A 3ZLYA 4F64A 1TQIA 4IDVA 1NY3A 5DT3A 3UNZA 4BCIA 3VF8A 1GZNA 3P1AA 4RRVA 4B4LA 1OI9A 4O7ZA 5B7VA 4AT5A 3AOXA 3U4UA 4O4FA 1BL7A 4RWKA 1GIJA 4F4PA 5AR8A 5CI7A 2QG5A 2UW6A 4Y83A 4FTNA 4Q5HA 1PMUA 3ZC5A 4AAYA 4RJ8A 3S2PA 4L8MA 4R8QA 1NVQA 2ZDUA 4ZOGA 4E4LA 4QP7A 3BLAA 4DBXA 4F9YA 3ROCA 1OL7A 3VHKA 3FQEA 2J0KA 4FSZA 2R3NA 2VTAA 2JAVA 3F3VA 2WQMA 4IWDA 4PDYA 3VUDA 3GCPA 1I44A 4XV3A 5GJFA 1YDSE 2WIHA 4JRVA 4DYMA 2YWVA 5H2UA 2C6OA 2WMQA 3OWKA 1NW1A 4G3CA 1ST4A 1P2AA 2WAJA 4OTDA 4EONA 1FGKA 2UVXA 4MK0A 2FSOX 3LQ8A 5HE1A 2ZJWA 3E8CA 3HV4A 2X2MA 3R00A 4JX3A 2XNBA 3FLYA 4O83A 4BI1A 3BYOA 3KRWA 4CMUA 3HP2A 4KIKA 4U41A 4O4EA 4A9YA 2W1HA 4C58A 4ZY6A 4L42A 1YHVA 3ALOA 5D11A 3ORTA 4FBXA 4WNOA 3TIZA 2HWPA 4QTEA 3QTWA 3BI6A 4AAAA 4JNWA 4HNIA 3QKMA 4QQJA 2XEYA 4C36A 3QQJA 1YXTA 3CGFA 3UDBA 3AGMA 4DGLC 4ZS0A 1FGIA 5JRSA 1PXMA 2ERKA 2OIBA 1H0VA 5FLFA 4NUSA 3WE8A 4BI2A 2E2BA 3AMBA 4IAAA 1U5QA 4BICA 4EZ7A 4OTHA 2YIQA 4U79A 3G90X 5AR7A 3F69A 3HV5A 4KBKA 1M52A 3PXQA 4O91A 3IGOA 2OJJA 1MRUA 4YLLA 3F88A 4LGDA 2QQ7A 3VBQA 1XH6A 3MFUA 2IW8A 4KS8A 3VNTA 3W8QA 1KUTA 3I5ZA 3FQHA 5CU0A 4TNDA 3ODZX 3V51A 5HO8A 2GHMA 2CN8A 3WZJA 3KF7A 3KREA 3PJ1A 4V0GA 1SNUA 4O2ZA 3W16A 5JKGA 2CSNA 4O38A 3C4WA 5EHOA 2UW8A 2G9XA 4NSTA 4FTMA 3DAEA 3ZO3A 3LMIA 3Q4CA 4I0SA 4LOPA 2BAQA 3R1YA 4RQVA 4FV4A 2ONLC 1A06A 1HCLA 5HE3A 3ZTXA 2BR1A 2FB8A 4C62A 2C4GA 3O23A 4QEBA 5H3QA 2PMIA 4X21A 3UIBA 3NUPA 4GK3A 3THBA 4PP9A 3IKAA 1PRYA 3R6XA 2PVFA 4DEHA 4GKIA 4CZYB 1ZRZA 1JKTA 2JDRA 3FWQA 4GYGA 2VO0A 5EI8A 4O7NA 1K3AA 5CSPA 2ZDTA 3QD0A 4HZRA 3PVUA 4LL0A 2BIYA 2HELA 5C8NA 3IOPA 3QKKA 4W4VA 5HX6A 1JQHA 3ZUVA 4AZFA 4F7NA 3OOGA 1IEPA 3VUGA 4HVIA 4F78A 3IW5A 4G1WA 1MP8A 2JBOA 2Z7QA 5ANDA 3DU8A 3TEIA 2P0CA 2QOCA 4FV2A 2WMTA 3UMWA 4M8TA 1AGWA 2B9FA 1DAWA 2PE1A 2WQOA 5FM2A 5HKMA 5B2KA 5K4JA 4DT8A 4LDTA 1OZ1A 2YAAA 3GU7A 4GFMA 3CEKA 1ZYDA 2HOGA 3RWQA 3ZXTA 3FKNA 5IEXA 1APME 2X6EA 2B53A 2W1EA 3D9VA 3FZTA 2REIA 4MQ1A 5K3YA 3TKIA 5HIEA 2CNUA 3BIZA 4NYEA 4Y85A 1F3MC 1PJKA 3T3UA 4F99A 3OW3A 4EH9A 5IQBA 1OUYA 3SGCA 4QP3A 2BKKA 2VWXA 4DGMA 4AS0A 4F1MA 4LG4A 3BWFA 4BIEA 2CCHA 1Q5KA 1PW2A 1J1BA 3P79A 3UJGA 1FPUA 3EHAA 3G0FA 3JY9A 3P7CA 5HHWA 3V5PA 2X7GA 3GU8A 4WD5A 2BZKB 4M67A 4I4EA 3LMGA 2X8DA 2WU6A 5BUEA 5JN2A 4TYJA 4D4SA 2XIZA 4GG5A 2ZMDA 4D2SA 1BI7A 1OL5A 2W1GA 3S4QA 3ZC6A 2I40A 2GSFA 5FD2A 3N4UA 4DTAA 5HCXA 3LCOA 4IW0A 3RALA 1O6LA 4YR8A 3AKLA 3RINA 2P4IA 2VTTA 4JQ7A 4O96A 3UMXA 2ZOQA 3VS5A 4BVUA 1BI8A 5L2SA 3TZ9A 3LFEA 2YLFA 4O0VA 4CKRA 4XHKB 1WBOA 3I7BA 1V0BA 3EN5A 4EC9A 5AR3A 5HTIA 3ML1A 3KA0A 4DHFA 1OL1A 4E5AX 3DPKA 4C2WA 4O7WA 2PVMA 2DUVA 5GZ8A 1Y57A 4NCTA 4PWNA 2W96B 4KIPA 4AXEA 4DFNA 4TRLA 3QQGA 4RZVA 3CCNA 4IHPA 5D41A 3E8DA 4FK3A 4KKGA 3V5JA 4G3GA 4NIFB 2GS2A 4FKRA 2QR7A 4NW6A 4BDHA 4S30A 3IW4A 4RFYA 3PWDA 2C0OA 3BLHA 3PZEA 2OWBA 3OROA 5FM3A 3V8TA 5HO7A 4BFMA 3R8MA 3C4FA 2WPAA 3FKLA 5BVFA 2YAKA 2R5TA 1OPJA 2AC3A 4U43A 3ZLSA 1GZOA 4GG7A 2ACXA 3EN6A 5DR6A 1W2CA 3BE9A 3F3WA 3OCBA 3QZHA 4FKLA 3BYUA 4FTQA 4ACDA 3WZKA 1V1KA 4D1XA 4D9TA 4EK6A 3MESA 4CGAA 4U42A 4CCBA 4D4VA 3M2WA 3U54A 3MY5A 3QRKA 3QCYA 4R3CA 2XALA 1OIUA 3EZVA 3HECA 4NFNA 2QD9A 5AAGA 2VTHA 3BHYA 4KIQA 1CM8A 2QLUA 5EQYA 2EVAA 3LM5A 2O65A 4XV2A 3PZHA 1BLXA 5EYKA 3FKOA 4O4DA 2C6EA 1M2QA 5FP5A 2PTKA 2ITZA 2OJ9A 3OF0A 1O9UA 5K0XA 5CAQA 2VTLA 3RHKA 4HCVA 4KSQA 3LW0A 4JG7A 2ITXA 4FIHA 3RPRA 2YCQA 2Y9QA 3MFTA 2IO6A 4C35A 2IW6A 4UB7A 3TACA 3G9LX 4JLCA 4JVGA 2ZV9A 2BZIB 3R28A 5AP6A 3FC2A 2BRBA 3Q4ZA 3WF6A 3AG9A 3R04A 4BCOA 3COIA 4CKIA 5IU2A 2R9SA 3R63A 4C02A 3RI1A 3FLNC 3A62A 2WGJA 4MXOA 2HIWA 3AC5A 4BCNA 3WIGA 3GOKA 4BBFA 2GNHA 2CNVA 3V8WA 2JIVA 4BDKA 4BRXA 5LWNA 3F7ZA 2XB7A 3IO7A 5L8JA 2B9IA 4NJ3A 2XK9A 2E9UA 4NTTA 4B6LA 2GNJA 1TFFA 1YHSA 2OJIA 4E26A 3AXWA 5EM6A 3W0PA 2XYUA 3GT8A 1JOWB 3Q9WA 3QRTA 3Q32A 4EOMA 4F6WA 1RQQA 5I9XA 1H25A 3V5LA 3DZQA 1PXJA 4CFFA 2A0CX 4D2WA 4AOJA 4Z7HA 4QP9A 5CALA 3D7ZA 4DGGA 3HRCA 4RPVA 4H1JA 4BY9E 3HRBA 3TNIA 1DS5A 4AQKA 2BRNA 4UMQA 5J5TA 1VLRA 2YWPA 4AE6A 2R2PA 3TNWA 4C34A 3ULIA 3R22A 4CRSA 4AN3A 1TVOA 3PFQA 2UVYA 5DPVA 1XO2B 3LJ1A 1BL6A 4NCTC 4XV9A 4X2JA 1FMKA 3QTSA 1WZYA 1AQ1A 4L3LA 2HAKA 3Q6WA 5FXQA 1FBNA 1W2FA 2OIQA 2BHEA 3EQIA 2CDZA 2XK8A 3IDBA 5GHVA 3FBVA 4UMUA 5K4IA 5EI6A 2RSVA 3LZBA 4D28A 3ZSGA 4E20A 3NIZA 3W2SA 5L3AA 4FTKA 3I0QA 4BCJA 4PX6A 4CD0A 4YJPA 4BKZA 4W4YA 1Q8YA 5AJQA 4YTFA 5J87A 3K5VA 4AE9A 2WHBA 5HVYA 4FIEA 2J0JA 3WBLA 4CYJA 4DINA 4F09A 4IWQA 5ICPA 1IA9A 3GBZA 3DBFA 3VO3A 5H8EA 4BYIA 4D4YA 4NL0A 2GU8A 5JFSA 2HCKA 4ENXA 2WMWA 2C6DA 5HI2A 4CQEA 4FGBA 3COHA 2XNNA 3ZZWA 2XCHA 2CMWA 2X8EA 4FZAB 3DKOA 3RZFA 2CKEA 2PE0A 4FODA 4O21A 3KMUA 4IACA 3EJ1A 4FT9A 1Z5MA 3REPA 4ZZOA 5JRQA 2IVVA 4F9CA 1JPAA 2V5QA 2YIWA 5D9HA 4USFA 4IFCA 3NFGB 3SX9A 3OUKA 5M06A 3TIYA 2Z60A 3RJCA 1OKZA 2R3HA 4QMPA 2W4OA 3A2CA 5HESA 4EH6A 5BPYA 5EH0A 5M08A 3MYGA 1ZYCA 3NEWA 4IAKA 4WG5A 4TYEA 2GFCA 3LFAA 3W32A 4A7CA 3D94A 2YM6A 5CEQA 5IUGA 5IQEA 3C51A 2WMUA 3UOHA 4M13A 2HENA 3CKXA 4OBQA 4RFMA 4BJJB 2J2IB 1XBCA 4X2KA 2QO7A 3OCTA 3R30A 5E7RA 3RNIA 4FOCA 2C3LA 2YERA 3I4BA 4LV5A 4MBLA 3U9CA 2QR8A 2J9MA 4PMPA 4K1BA 5KHWA 2BRHA 4UZHA 3RNYA 3U4WA 2XIRA 4RJ6A 4TW9A 3V6RA 4N6ZA 4NM7A 2O63A 4GL9A 4I1ZA 3NW7A 3I79A 5DOSA 1Y8YA 2VTPA 5IQDA 3UPZA 3SHEA 1H07A 4C4IA 4BWKA 4J1RA 3CD3A 3NYVA 4EHVA 2I0VA 3FHRA 3GC0A 4FVQA 3N4TA 2ZM4A 5AR4A 3R7EA 3JVSA 2A4LA 4D2TA 3TV6A 3A60A 3QU0A 5HIBA 3CS9A 5LMBA 4MXCA 1P14A 3CY2A 2C68A 4ANLA 1UNGA 4AFEA 5E91A 2CKOA 4Q5EA 4O2PA 4OTRA 3OBJA 5AAFA 1FOTA 1ZY4A 2C5XA 4GKHA 4X6QC 3A7FA 2A1AB 4FTRA