4EWQA

Human p38 alpha mapk in complex with a pyridazine based inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
349
structure length
346
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFARHTDDEMGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
publication title Human p38 alpha MAP Kinase in complex with a pyridazine based inhibitor
rcsb
source organism Homo sapiens
total genus 107
structure length 346
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ewqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ewqA01
4LV8A 2PWLA 1KOBA 2JDRA 2PVJA 3RINA 3S3IA 4R7IA 1VEBA 2CKPA 3OTVA 3W33A 4WG4A 4UY9A 4C4EA 4EK4A 3NEWA 2G2IA 4UMPA 1WBNA 1FGKA 4YZNA 4DINA 4E5BA 4NM7A 3PUPA 4QMWA 1W7HA 3O51A 4QMXA 4XG3A 3NUAA 3F61A 4UMUA 4QQTA 2EXEA 2BPMA 1KE6A 4OBQA 3CTQA 4NJDA 5T68A 4E7WA 4O7SA 3FY2A 1BX6A 4FTMA 3F3VA 2WMXA 4YJQA 4HOKA 4OLIA 4EHZA 3E3BX 3OWPA 4BYIA 5LQFA 2IG7A 3IW6A 3H0YA 4IXPA 4ANBA 4AOTA 1Q3WA 1H0WA 2PMIA 3C7QA 4R5YA 5AUXA 1Y6AA 3R01A 1Q41A 5HVYA 2GNGA 4C33A 4BWKA 3FMKA 3EHAA 3VS3A 4YO4A 4XG9A 2GU8A 1V0BA 1ZYLA 4KKEA 2P3GX 5EW8A 3CPBA 5LJJA 2CNUA 2ITTA 3IOKA 1PYXA 2XK9A 3REPA 3ZS5A 4FSRA 2X7GA 4EWHA 3NUUA 5TF9A 1KSWA 3I81A 3IQ7A 4DFYA 3F88A 2HWPA 3FKOA 1P2AA 1SM2A 2R5TA 2J0MB 2Y6OA 4LV5A 3ULZA 4FV8A 2Q83A 1J7UA 2JBOA 3KMMA 3DLSA 4F6WA 5D12A 4F1OA 4FEVA 4C2VA 1Q97A 2UZLA 3H3CA 1REJA 4EH8A 3FLZA 5IKWA 3UIXA 3MA6A 4FIIA 1CKPA 4QP2A 5HO7A 4L00A 1J1CA 1RJBA 2CLXA 4C62A 2UZVA 3RHKA 3NNXA 1NVQA 3DXNA 1PYEA 2VWBA 4I1ZA 3VUHA 4F9CA 2PK9A 5I9UA 5ANEA 2ZM1A 3LCOA 3FYKX 1OITA 2W1HA 3KXGA 3MVHA 3OXIA 1ZYJA 3TNIA 2YACA 3BYUA 4F09A 1UU9A 1OB3A 2CGVA 4IZYA 5DYJA 3M42A 2BZJA 4FX3A 3W2SA 4DHFA 3JY0A 5ETFA 5J95A 4AQCA 1KE7A 5CI7A 3ZUUA 4Q5EA 4FG9A 4FGRA 2ZYBA 1HCLA 5IQBA 2YLFA 1XH6A 3CQWA 4W4YA 4ERWA 5FXSA 1CTPE 4DLJA 2PZYA 2GS6A 2YZAA 2C30A 4HW7A 2XNBA 3BWJA 3MDYA 3OWKA 4FVQA 1H01A 4YHFA 3FXZA 4O0UA 5EKNA 4D28A 2P55A 3BGQA 1FINA 3R7YA 3T9TA 4HCUA 3H10A 1PF8A 2NP8A 3BU6A 4GG7A 3OC1A 3TUBA 2UZUE 3QC4A 3UQGA 1YOJA 3E8NA 4J99A 5FM3A 4R77A 3CJFA 5IMEA 3HP2A 5HIBA 2WTCA 1BKXA 5HLWA 4M0YA 2XK7A 1HCKA 3HMPA 4EOQA 3QTIA 4NCTA 3LMHA 3CY2A 4UB7A 1UA2A 3OCGA 4L43A 4YTIA 3VIDA 4ZSJA 3KFAA 4EH6A 4FKRA 3RCJA 5IQDA 1YXTA 4BZOA 5J8IA 3ORNA 1Y6BA 4K33A 1FVVA 4O7RA 4IE9A 4CMTA 4DGGA 4WA9A 5BVEA 4D1XA 2AC5A 5KKRC 2VZ6A 5E4HA 4YZCA 5IG1A 4GRBA 3R9OA 4ANNA 5EW3A 4PTGA 3HV4A 3CGOA 2G15A 4RWIA 2RG5A 1H1PA 3QTWA 4IC8A 3LFDA 3MPTA 4YPSA 5AM7A 5K5XA 2B55A 2I40A 1IASA 3NVKI 2GS2A 3EQGA 3RBWA 3NIEA 4TT7A 5EFQA 4D58A 3FMNA 4RX8A 4WBBB 2C6TA 5KBRA 5CQWA 1ZOGA 4DBNA 2XYNA 3QCSA 5C01A 3O96A 2YN8A 3RAWA 3MA3A 3UYSA 3FL5A 3QRJA 2F7ZE 3LOKA 5AUVA 1STCE 2RG6A 5IA5A 5IH4A 3F66A 3T9IA 3A60A 5D41A 4L7FA 2PTKA 4YSMA 5EM7A 4AX8A 2XNNA 3FLNC 4BCFA 3CQUA 4JI9A 5CU2A 3NPCA 4FKQA 3AT3A 2WGJA 5H8GA 3O17A 1CSNA 1J3HA 3COMA 3DKFA 4FTJA 3K2LA 1M7QA 2QCSA 3VAPA 3WIGA 3GC8A 4C3FA 4RFMA 4PPBA 2R0UA 5BVNA 5HHWA 4O7TA 2VGPA 4IM2A 3R9RA 5AV4A 4TRLA 4DH5A 1PXOA 3L8VA 4O2ZA 2J2IB 4FTUA 1GZOA 5TKDA 2QO7A 4Y5HA 4P2KA 4CTBA 4CRLA 3UOKA 1ZZ2A 4ENXA 4DEIA 2PE2A 4EH2A 3GOKA 5JZNA 2OWBA 3K3IA 2UW4A 4R6VA 4JR7A 4EBVA 5CXZA 3PXQA 5C4KA 5DGZA 1U54A 4FF8A 4PQNA 2FA2A 4C36A 3HGKA 5AAGA 5AR8A 3AT2A 3LFNA 1UNLA 2C0OA 3PY0A 2JFLA 3BPRA 4C02A 2QR8A 2QURA 2A19B 3W2PA 5BUIA 4X3FC 3LCSA 3LJ0A 4FC0A 4RJ7A 1B6CB 2G1TA 3MWUA 4UWYA 3A2CA 2GHGA 4FSQA 2J6MA 4JOAA 1U54B 5IDNA 3ORKA 1TVOA 4C7TA 1KUTA 3DZOA 2BALA 3MYGA 3NW7A 4M66A 3SXSA 2PZRA 4BDDA 3DNDA 3I7BA 4XV1A 1YRPA 3HVCA 4HNFA 3BZ3A 3QD3A 3JVSA 2VTNA 2IZSA 3RZFA 5BVWA 2B1PA 3PSBA 1H0VA 4O84A 3EKNA 4KBAA 3LCTA 2WO6A 3FZ1A 4DFUA 3F69A 3P79A 3F82A 2EXMA 5D7AA 3DXQA 3HA8A 5DI1A 3F5GA 4I93A 2EU9A 3A62A 2VX3A 3MFUA 1Q3DA 2IVTA 2QOFA 3NDMA 4QOXA 4EBWA 1MQBA 3KU2A 4AZWA 5A4LA 1XO2B 2WELA 3GNIB 3BEAA 3QC9A 2P2IA 4BCQA 5BYYA 5EM5A 3HRCA 3FYJX 4EOJA 3R8LA 1Z57A 4A9YA 4A9RA 3AG9A 4F08A 2BAJA 2C3JA 5FP5A 4F99A 3E8CA 5AUUA 4DFBA 4B99A 3RJCA 3S00A 5EQPA 4HJOA 5AP7A 5IU2A 5CNOA 2UVXA 3R2YA 4TWOA 5JFSA 4RJ8A 1P5EA 2SRCA 4FSZA 4DAWA 4FVPA 1H08A 4JR3A 3O8TA 3FL4A 4ANOA 4CKJA 2X6EA 2OJIA 4M3QA 3ROYA 4QP4A 1M7NA 3QTZA 2PHKA 3D5WA 4NW6A 4O96A 4BDFA 4BFMA 5D10A 4U97A 4WOVA 3KB7A 3U4UA 3D4QA 4RFYA 1H1QA 3IGGA 4JIAA 1UNGA 5FWKK 4GFOA 3ORXA 4G9RA 4IVDA 2OK1A 3U9NA 2VRXA 2VTLA 3EH9A 2XVDA 1H28A 4EK5A 3BEGA 3NUNA 5HZNA 3TKUA 3BBTB 4HPTE 2ZM3A 4MH7A 3UO4A 5I9VA 3HEGA 3MH0A 4GS6A 5LMBA 2BUJA 3ELJA 4JQ8A 4XOZA 4DH3A 2X4FA 3MFTA 4CQGA 4ZTNA 5M4UA 1JWHA 4BCGA 5KBQA 3TXOA 2FYSA 3UZTA 3R7OA 5JGBA 2WTWA 1R1WA 5F9EA 4PNKA 2Y4IC 4MNEA 3V6RA 4CEGA 3DKOA 3MGYA 2VTTA 3GC0A 4WUAA 2ETKA 4NWMA 2ZV2A 3Q4CA 3R9NA 4G16A 4AOIA 4CLJA 4RJ6A 4CV9A 1WBSA 4D4RA 2OU7A 3JUHA 3P08A 3TZ8A 3QTXA 1Q8WA 3IW8A 4UWBA 1ND4A 3KRRA 3P78A 4JDHA 2WEVA 4NW5A 1F3MC 5E9EA 4JX7A 3RAKA 4P7EA 4NEUA 5B2LA 1R0EA 5DWRA 1WCCA 5EYKA 2R3IA 1ZYCA 4DYMA 4Z7GA 4ERKA 3DBDA 5A54A 1O6KA 2W0JA 1YHVA 3D15A 5AX3A 4BCPA 4CFUA 3HAMA 2DWBA 3PWYA 4DF3A 4EQUA 2ZM4A 5FRIA 3TZ9A 2PMNX 5L6OA 3ORTA 2F57A 3QQUA 3I79A 2W96B 3EKKA 3W32A 2XKCA 5AV3A 3RM7A 3CD8A 3DV3A 3QF9A 1JSVA 4KRDA 3R63A 5M4CA 2VTQA 2X7FA 3AC1A 1YW2A 4Y95A 1BYGA 3CXWA 2CNVA 3KA0A 3KC3A 5CVGA 3ZONA 3HMOA 5EDQA 5EI6A 5GZ9A 5E1EA 2VTAA 2FUMA 1H1SA 2VTIA 2W17A 3OEFX 3R9HA 4AN2A 5EKOA 3WIKA 3ZUTA 4F7LA 3LLTA 1SNXA 3V5PA 4C4IA 5I5ZA 4O0SA 3UTOA 3A61A 1OM1A 2A27A 4K6ZA 3IDCA 5DLSA 3FMJA 4MEDA 1OUYA 2R2PA 1PMNA 2CDZA 2C3LA 3R0TA 3AQVA 4UZHA 3GI3A 3OVVA 5JFXA 3ZDIA 3QQGA 4KIKA 5BYZA 4J71A 3JVRA 2BIKB 4FNZA 3BYVA 3MSSA 4ACMA 3AMBA 2XNPA 1UU8A 3FMMA 5KUPA 2J0IA 3NRMA 4FTKA 3QTUA 5M09A 3DOGA 4KA3A 4EOSA 3F2RA 3PLSA 5IZFA 3QUDA 5H2UA 1OL1A 2WMWA 3PIYA 1Q8ZA 4W8DA 2IW8A 3ZRMA 4EC8A 4UBAA 3HMMA 1OL5A 3NZ0A 4N70A 5GZ8A 2H6DA 2VTMA 4KIKB 1DAWA 1QMZA 2CGXA 2ITVA 3P1AA 2XJ2A 4XS2A 3DJ5A 4QO9A 4RX5A 4D5HA 4WG5A 4FZ6A 2OLCA 2HWOA 2XNOA 5EW9A 4IH8A 4X2FA 2BAKA 2XKEA 5CF8A 1QPDA 4MXZA 4WG3A 3FI3A 3Q5ZA 2XKDA 2GQSA 4GKHA 4PX6A 3LQ3A 4M13A 2JAMA 4RLLA 4IVAA 4FV0A 4BDHA 3VW8A 3Q9YA 1IRKA 4RVTA 4D9UA 4DGNA 1GIJA 4WT6A 4Q9SA 3PA4A 2ZMDA 2Z7SA 4PV0A 5DNRA 1RW8A 4DN5A 2YIRA 5ANGA 5CEIA 5J7HA 3N9XA 5HD4A 4KIOA 3GP0A 5LMKA 4CKIA 4YZBA 4PL3A 3TL8A 4RWKA 1FVTA 2AUHA 4FSMA 4PTCA 5IQIA 3MIYA 3EN7A 2B4SB 3IO7A 4FK3A 4B8LA 1SVGA 4XG6A 4I23A 4TYGA 2GDOA 4YTCA 3EN5A 3FUPA 1M17A 2WPAA 4DE4A 1ZARA 4PDOA 3ROCA 2ITNA 2YJRA 3EL7A 4I4FA 3WZEA 1H1RA 3UOLA 1PRYA 4NKAA 5AP4A 2YM3A 2GHMA 3I4BA 4GT5A 4X2NA 2GHLA 3RM6A 2QLQA 3B8QA 3QX2A 4CKRA 3PY1A 4YP8A 4BR3A 4ZMEA 1KV2A 3LE6A 4P5QA 1XBBA 3FKNA 3OOMA 2G2FA 4Y46A 4ZY5A 4AS0A 1YVJA 5HLPA 2NRUA 5T3QA 4BZNA 3C4FA 3MI9A 5IEXA 1VR2A 3PP1A 4GV1A 4K1BA 4BDJA 5F94A 4IEBA 2HY81 5CQUA 1UU7A 3O0GA 2CGWA 2JDOA 4V05A 4X6RA 3TNHA 5FP6A 2ZV8A 5J9LA 1L3RE 4O86A 3TACA 4O81A 5E91A 4CRSA 3R04A 3BRBA 1FVRA 5AUYA 3RALA 3NUPA 3MS9A 2P0CA 3KXXA 4ZTRA 4I0SA 3WE8A 4ANSA 4FL1A 4EH3A 3BYOA 3GCVA 5BVKA 3PZEA 4FSYA 4U0IA 2IZUA 4RZWA 5HI2A 2PU8A 1AQ1A 1UKIA 4S30A 3PG3A 4LGDA 4DTAA 2VAGA 3EFJA 4EHVA 3N4UA 3O7LB 3PVWA 1ZMUA 3DQWA 5F20A 3TTIA 2ITQA 3W10A 3ZC5A 3E8DA 2RKUA 4U3YA 5LVOA 4ITHA 3TZMA 3NW6A 4QP9A 4L3LA 3BGPA 3KXNA 4S33A 5M55A 2PVNA 2Z7LA 3LIJA 5LARA 3UQCA 5HU9A 4FT7A 4ZY6A 4IAKA 3LFAA 4FL2A 3LVPA 3TWJA 4Z16A 4A07A 2OZAA 5AR3A 4M7IA 5CZIA 3QA8A 4RSSA 4O91A 4BF2A 2OG8A 2W1FA 1OL7A 3R1QA 2OI4X 2FO0A 4RC4A 4EH9A 4OW8A 4DCAA 3GOPA 2QOQA 3V3VA 2A4LA 3CY3A 4NM0A 3VS6A 2F2CB 3ZOSA 4V04A 3KULB 2H34A 3QCQA 2HXLA 4RZVA 4HCVA 5FEQA 3ZM4A 4EOIA 5KKRB 4D5KA 4DG3E 4AA4A 2OZAB 4KSPA 2HENA 1PXIA 4W9XA 3MESA 4D2SA 4IMYA 4KB8A 5KNJA 3QRUA 4EKLA 2ITXA 2WQEA 3ATTA 5EM8A 3G15A 1QPEA 4DA5A 4LMNA 1RQQA 4AACA 4YHJA 4AW2A 2R4BA 4HGTA 1PXNA 5AIRA 4QYGA 5IA4A 4MVFA 5C8KA 3QRKA 3EIDA 3CTJA 1OKYA 3UC3A 3TUDA 1WMKA 3OXZA 3WZJA 4ZS4A 3RK5A 2QD9A 2DQ7X 3IONA 1WVXA 2WQNA 3DB8A 3E3PA 3UIUA 4EYMA 3O8PA 4CQEA 2OF2A 4FNXA 3ZU7A 5IA2A 4BTFA 3QYWA 4JX3A 4KS7A 3RAIA 3OS3A 3Q5IA 4WIHA 1JOWB 3BELA 5EDRA 3V5JA 4AW0A 2ZMCA 3VUMA 4IJPA 1F0QA 3I5NA 4DGOA 3ORZA 2PL0A 3DDPA 4FT3A 4L3JA 4CTCA 4UWCA 4G1WA 3UVPA 3R71A 4MBIA 2JFMA 2RSVA 1Q8UA 4RBLA 1Z9XA 3NW5A 3FZSA 4BTMA 3QHRA 4BRXA 4DFXE 3UMXA 5DFPA 2UW5A 2O2UA 1SNUA 2YABA 2XIZA 3G0FA 3VQHA 4X2GA 5I4NA 5J79A 2PUPA 3QUPA 4X3FA 3DJ6A 2B7AA 5EM6A 1ZOHA 3UODA 3BU5A 3TV6A 2ITUA 3UYTA 2UW0A 3GU5A 5D7VA 4I24A 4Z3VA 4O0VA 2YDKA 4RX9A 1YDRE 4U8ZA 2C6OA 4OGRA 3LCDA 2V62A 2J0JA 4Y5QA 3TNPC 4A4OA 4EOPA 4IBMA 4KIPA 2XBJA 3IW5A 3GFEA 4O6LA 3F5PA 4X3FB 4JS8A 3ALOA 3VUTA 3FQEA 4EC9A 2YISA 4GIHA 2PVYA 3F3WA 3DK3A 3RGFA 4FZAB 2V5QA 3C0HA 4WNKA 4AOJA 2O5KA 3F7ZA 2XNGA 1YKRA 2UZOA 3ACKA 3GQLA 4IAIA 4JBQA 3QRIA 4RWLA 4YPDA 4CT1A 4DH7A 4TL0A 3VBTA 5GIPE 4MF1A 2CGUA 2JLDA 4JDKA 3QBNA 3R7UA 1E1VA 1I44A 5L2QA 3SOCA 1M52A 2WOTA 2XUUA 4OBOA 3ZXZA 2BIYA 3FZPA 2UUEA 2JDSA 3HV6A 4IB1A 2UZDA 2C4GA 3F9NA 4NFNA 3UG2A 4KRCA 4D1ZA 3KN5A 3Q4UA 1DS5A 4OTFA 3OWJA 5CAVA 4M8TA 5A4QA 3UO6A 3WYXA 2FSMX 5M07A 1DI9A 5ICPA 1IA8A 4EQMA 5CEMA 5M51A 2QONA 3C4XA 4QRCA 3QZIA 4H39A 2WTKC 5AV2A 4NK9A 3P7BA 5KE0A 3UP2A 3ZH8A 4FOCA 5AUZA 4YTFA 2QOIA 3D9VA 4QYYA 1PJKA 2C69A 5CSWA 4E6AA 1LP4A 4KNBA 1ZYDA 4QMYA 2H9VA 4F65A 1XWSA 4YNEA 3S2PA 3VHEA 4EWQA 3KL8A 4F9BA 3CC6A 3DU8A 3R22A 3R7IA 1U59A 2UZWE 5M56A 4QPMA 4MF0A 3EWHA 4GK4A 4M14A 3W16A 3W2RA 4PDSA 2J4ZA 3PYYA 3LFQA 2R7IA 3M11A 3KQ7A 3NVMB 4B6LA 2FVDA 3DBEA 2YDIA 2I6LA 1W98A 3Q2MA 2PMLX 4GJ3A 4AWIA 2O63A 4IAFA 4N0SA 5CYIA 2BFYA 4K11A 4KBKA 5LWNA 1G5SA 4A4XA 4F70A 5HTIA 4G5JA 2VTSA 3KCFA 2Y4IB 5LVLA 3OWLA 4GK2A 4LYNA 4B9DA 1LEWA 3P7AA 4FIFA 4H3BA 4JBVA 5DRDA 3UIMA 1NT2A 3SD0A 1JQHA 2GSFA 5HNIX 4JG6A 5TR6A 2NNWB 2QLUA 4ZOGA 4EJNA 4X7QA 2C3KA 4EQCA 3ZTXA 3RNIA 2HZIA 2HIWA 3C4WA 4JDIA 4XP0A 3MY0A 3PDTA 3G2FA 3SXRA 2I1MA 4S34A 1H26A 2ZV7A 2YHVA 3ORMA 1W0XC 5EOLA 5HGIA 3FKLA 3RHXA 3TNQB 4A4LA 2R3NA 4U81A 3PPKA 5A14A 2CNQA 1BL6A 4RPVA 3DPKA 2ONLA 3OY1A 3MPMA 3PP0A 4W8EA 3QZHA 4QMZA 3B2TA 4YC6A 4E20A 4FT9A 4XJ0A 5LMKC 1GNGA 3RPSA 4U80A 3SA0A 4FICA 1UV5A 4YJSA 2X2MA 5CF6A 4YLKA 4TW9A 4USFA 2WMTA 4RWJA 4FEUA 1OKWA 4G9CA 3QKMA 1YWRA 2VTOA 2W5AA 4Z55A 5CLPA 3QA0A 4C38A 3WE4A 4AFEA 4FIHA 4YJPA 5HIDA 3EL8A 4IVCA 4HZRA 2QG5A 2A1AB 4LG4A 3D83A 4FR4A 4UMRA 5KMKA 4YUQA 2X4ZA 3PG1A 1SMHA 4YBKA 4MCVA 2BAQA 1P4OA 3CGFA 4GIIA 3PRIA 3TJDA 4BY9E 5J7BA 2PZIA 5AR7A 3ZLSA 5M53A 2OO8X 3R21A 4BGGA 3OOGA 4AG8A 1OIUA 1ZAOA 4QMQA 2KTYA 3QAME 2QO2A 2X2KA 3IW4A 4U45A 4HVDA 3N51A 2PVKA 3O7LD 4YJTA 4R8QA 3LFEA 3ZFXA 4BCIA 1YXUA 2V7AA 3OCSA 4FV1A 4IAYA 4UX9A 3EYHA 4KABA 2ZVAA 3FEGA 2R3JA 4DTBA 3VO3A 3E8EA 4FOBA 3SC1A 3P7CA 3UG1A 3GENA 4O0YA 4DBXA 4WKQA 2BRGA 4MWHA 1GZNA 3KXMA 3OT8A 5ITAA 4G6LA 2HZ4A 1P4FA 2HCKA 2XNMA 3DDQA 4DEAA 4EOLA 2Y8OA 4FIJA 1Q8TA 5AA8A 3DGKA 3MN3A 1H1WA 3I6UA 3NIZA 2YCQA 4L46A 4M0ZA 2C6LA 4O1OA 3S0OA 3PXKA 4XX9A 4QQCA 3CPCA 4ARKA 4CZUA 3W8QA 3VBVA 4F9YA 4MQ2A 2BZIB 2O8YA 1U46A 3TIYA 3TKHA 4EH5A 3HRFA 3TM0A 1PMEA 3UE4A 5AV1A 5CT7A 3HDMA 4OTGA 3TZ7A 5IEYA 5FQDC 5E8UA 5G6VA 2REIA 3OCTA 4ASEA 4PRJA 2PY3A 3HL7A 5JT2A 5I3OA 4JQ7A 3UDBA 3BBWA 5KX8A 5L3AA 4CG9A 1BLXA 3F6XA 3TTJA 2BDFA 2YCRA 3BGZA 2YIWA 2C3IB 2YDJA 5BNJA 3PFQA 4S2ZA 5BPYA 2F7EE 3UP7A 2C6EA 3QTQA 4Q5HA 5LMAA 4QNYA 5JFWA 1L8TA 3IS5A 4LOPA 4FTIA 2XP2A 1ZWSA 4J97A 4NFMA 3VBYA 5L2IA 5IQAA 4QQ5A 4K2RA 2W4JA 4JG8A 5FBOA 3QD4A 4Y85A 4BGQA 4LRKA 3PJ2A 2C1AA 2QOCA 2YERA 4L3PA 5AUWA 5AADA 5JK3A 5KMJA 4WRGA 5H9BA 4AP7A 4CFNA 5BVDA 2PVFA 4GW8A 3L1SA 3EFLA 1SYKA 1J91A 3BYSA 3FMLA 3JS2A 4ZAUA 5AAFA 4IFCA 5D1JA 3VVHA 3PLAE 3FWQA 3KVWA 2ZDTA 2EB2A 5C1QB 2B0QA 3RWQA 2O65A 2XYUA 4QYHA 3KVXA 1U5RA 2PZ5A 4X21A 5KCVA 4ZTMA 4G34A 4X6QC 4DH8A 2PE1A 4N6ZA 5DRBA 2C1BA 4MAOA 4PMSA 3VUDA 3NUSA 3OUKA 3OT3A 1NW1A 2EXCX 4LGGA 3Q96A 4FKGA 4WRSA 2VUWA 4FKIA 2WOUA 3ULIA 4O7YA 4MK0A 4Z7HA 4FV6A 4IX3A 5HLNA 2C6KA 3PXZA 2GNHA 4O38A 4D9TA 4QMNA 1LR4A 4ANMA 4IDVA 3HDNA 5DR2A 4GKIA 5A46A 5L2WA 3G9LX 4NYEA 3PJ8A 1ZYSA 4XG8A 5B2KA 3R8UA 3O8UA 4KS8A 4C58A 2YEXA 2XK3A 3NCGA 1JVPP 2EUFB 1ZXEA 3DS6A 4OTIA 4IX5A 4DCEA 4YMJA 1YDTE 3BE9A 5FD2A 2NO3A 3ZLXA 3NNWA 3EQDA 4ITIA 3LQ8A 3P9JA 4BCMA 5GIOE 4LFIA 3DLZA 4O7WA 2W4OA 2GS7A 2Y7JA 2IJMA 3NCZA 3NLBA 4IM3A 4TYEA 3TN8A 3G0EA 3E92A 5AIKA 5HVJA 4IWDA 3WILA 4OT5A 1OBGA 5BVOA 4G5PA 2VO0A 1TKIA 3AMYA 3U55A 4FV2A 4B8MA 1WVWA 3NX8A 4CLIA 4EUTA 4G17A 5DBXA 3C4EA 3H9RA 2HY0A 3LFBA 3DK6A 3ITZA 1GZ8A 4CFXA 4QPSA 1FOTA 2I0VA 3EOCA 4KBCA 5EHLA 2QVSE 3G5DA 5C27A 5IA3A 3I5ZA 4E4LA 4G3EA 2ERKA 3VBXA 4APCA 3FMEA 4Q2AA 1Q24A 4AZTA 5IF1A 5ANIA 5C8MA 4O0XA 4IJ9A 5F95A 3C4CA 2YIXA 3QXPA 4L67A 3RNYA 5M44A 3TV7A 4BC6A 4XOYA 2WMQA 3W2OA 4BI1A 2IZRA 4E3CA 3E93A 5CEPA 3HECA 5CALA 5DT4A 1K2PA 3F3UA 4EI4A 2JKOA 5E8TA 2ACXA 3NGAA 2I0HA 3KKVA 4NU1A 5HE2A 4F9WA 4IQ6A 1R3CA 5CEKA 3A4PA 3DB6A 3U8WA 3EQFA 2PSQA 4O2PA 1XBCA 2J0LA 4M68A 2XRWA 2Z02A 3DTWA 3P0MA 5JZJA 2ESMA 1ZLTA 5C03A 4BHNA 4S32A 5AX9A 4TYJA 4OR5A 2X0GA 4ANLA 5CSPA 2QODA 5HEZA 4JXFA 3AD4A 4J95A 2JDTA 4PDPA 5KMLA 1DM2A 2V0DA 3DY7A 3Q9XA 3QGWA 4WUNA 3KN6A 3PPZA 4YSJA 4BBEA 4CFVA 2VO3A 1Q61A 1JPAA 4FT5A 4GK3A 5AM6A 1T46A 3ENHA 5ETCA 3OUNB 4X3JA 1GIHA 4B0GA 2QR7A 1V0PA 1ZY5A 1Y8YA 4ASXA 4IANA 4OUCA 2EVAA 4PMTA 1LUFA 3GU6A 3VJOA 3LJ2A 3ATSA 2IVSA 1EH4A 4O6EA 4BDAA 2GQRA 3DZQA 3SX9A 3VS2A 3FI2A 2R0IA 3D5VA 3VS1A 3EQPA 3HV3A 3HYHA 3NWWA 3R2BA 1H8FA 4ZTQA 5JMSA 3QZGA 5HNGA 5DE2A 3ZLYA 4MD9E 5A4CA 5FXRA 2X2LA 3KREA 3Q9ZA 1H25A 5HG9A 3SRVA 3H30A 1KE9A 4MNEB 4XEYA 5JRSA 3PE2A 3C1XA 4F9AA 4QP7A 4XV9A 2QI8A 1PKGA 5FXQA 2QOLA 2JKQA 2GNLA 3Q52A 3R1SA 4BDIA 4ACDA 4HYHA 2CCIA 3UPXA 4PF4A 3HA6A 4CZYB 5DR9A 4J8MA 5CY3A 2WIHA 4AFJA 2DYLA 2R3LA 1T45A 4BCKA 4ZZMA 4YJOA 5A4EA 2WHBA 3I6WA 2XEZA 3SRVB 4LOOA 4PTEA 1J7IA 4ZJIA 4XP2A 3PJ3A 3DCVA 4K8AA 4D55A 5HO6A 4KKHA 2ONLC 3CBLA 3M2WA 3QQHA 5HG5A 4QTDA 3C0GA 4D2WA 3SW4A 3VNTA 2FB8A 3R6XA 2VWIA 4ASZA 5BMSA 3E63A 3D2KA 1S9JA 4II5A 2W1IA 3BYMA 2R3RA 4TWNA 3EFKA 2UVYA 2HZ0A 3IDBA 5C9CA 4USDA 5DEYA 4EONA 2PUNA 2C0TA 3OCBA 4E6CA 2WTDA 4QTBA 3QGYA 4H1MA 4MD8E 3CJGA 2IVVA 1YI6A 2VTPA 5IMXA 4FSNA 3L9MA 4FZ7A 3RI1A 3LW0A 2YM6A 2YWPA 3LQ5A 3A4OX 3LXKA 3A7FA 3PJ1A 1OIYA 4F7SA 3OY3A 5T6KA 2WMRA 4UXLA 2UW7A 5E8XA 1ZY4A 4K77A 3UQFA 4QTAA 4TKSA 2BROA 1CKIA 3ANRA 2WTKB 3FZRA 4DGLC 3BLHA 3T3VA 2XMYA 3FC1X 4FSUA 3BLQA 4QP8A 4XV3A 3GGFA 4TNDA 4YJRA 3IOPA 3AC8A 3LKMA 2PE0A 2YM5A 3LFCA 3QQFA 4E1ZA 4ZTHA 1PXKA 2GMXA 4ZZNA 5KHXA 4ZTLA 4R5SA 1MQ4A 4O0TA 3LJ1A 3FLYA 3VF8A 3E64A 4BCOA 2BZHB 2RFNA 4QMUA 3R8ZA 2ITYA 3U51A 4GUEA 4OAUC 2W1GA 2XIRA 4P90A 4CFFA 2HW6A 4XNEA 5FTGA 3JPVA 3OW3A 4FKSA 4ZP5A 3A7JA 4WBOA 3Q4TA 4MXAA 2JD5A 3PJCA 3U6JA 2XKFA 1PMUA 2ZAZA 3PIZA 4O7NA 1Q62A 2WIPA 3WI6A 2H96A 4F0FA 4I22A 3ZSIA 2PVMA 4MWIA 1KWPA 3NSZA 5HNBA 5BUEA 4HCTA 5BMMA 2BRHA 3H9OA 3N4VA 5FGKA 4JVGA 4C57A 2XJ0A 2W4KA 4YZ9A 4QP6A 3W2QA 4R78A 1I09A 4XP3A 4O21A 3NUYA 4YJUA 1BL7A 3R8MA 3ET7A 4UYAA 3RPOA 4BTJA 5ANOA 5LOHA 4I5MA 4BBFA 2XNEA 4R1YA 3TKIA 4QD6A 1YQJA 1JSTA 4GEOA 4YC8A 5AV0A 5H8EA 2JDVA 5LCKA 4IAAA 2NRYA 4EJ7A 5LXMA 3D0EA 3IECA 2W05A 2B9FA 4PUZA 1O9UA 5ETIA 1WAKA 4L45A 4E6QA 3WOWA 3TCPA 2RGPA 4B4LA 1BMKA 1PW2A 1OUKA 3Q6UA 1BUHA 4C4HA 2JIUA 3FJQE 3Q6WA 4FZDB 5AEPA 3RKBA 1OL6A 4CMUA 3K5UA 4C0TA 4IWQA 3II5A 1R39A 5TE0A 3WZDA 5HVKA 5HCYA 4BZDA 1ZZLA 5KMIA 4GUBA 3ZFMA 5I9YA 4D4SA 4BWXA 3ZBFA 3GU8A 5M06A 4X2JA 4I5CA 5TOZA 2OH0E 3A7GA 3UO5A 3PRFA 4AN3A 5CU6A 5EYDA 4WNPA 4MYGA 3OZ6A 5E8YA 3SXFA 3MH2A 4I4EA 5CWZA 1CDKA 2B52A 1WBPA 4FTLA 3EYGA 4FNWA 4IHPA 2Q0BA 2QU6A 5DOSA 1YDSE 3FE3A 3MVJA 2B54A 4HVIA 1H07A 2VU3A 5B2MA 5J9YA 4ZSGA 2GTNA 5BUJA 1UKHA 4M69A 5IH6A 1V0OA 3C13A 4A7CA 5HO8A 4MXOA 2QO9A 2VWXA 5JGAA 3LLAA 4FTAA 5DA3A 2GPHA 4MTAA 1XR1A 2Y9QA 1YWVA 1JKSA 3DQXA 1B38A 3O71A 4IACA 4U79A 4YJVA 4EORA 5FBNC 4FKTA 3Q53A 4BKJA 3D2IA 2YAAA 4JJRA 4YLLA 5IQFA 2GCDA 2OF4A 3Q60A 3VS0A 2W06A 4OTQA 3V5TA 5AMNA 4I6HA 3FMDA 4BDGA 1E1XA 3BU3A 2AYPA 2VTHA 1JKTA 2CLQA 3QX4A 5CX9A 1NVRA 2OSCA 4AA5A 4ZLOA 2VWZA 4BGHA 4ZJVA 5KMMA 3DK7A 4J53A 4MBLA 3A99A 2BZKB 3ACJA 2PYWA 2Z7QA 4HYUA 4USEA 4E4MA 2GNFA 5CEOA 5IA1A 2RL5A 3GCUA 3R28A 4ZLYA 3UZRA 2G9XA 4ALVA 4XRJA 5L2SA 3FHIA 3AGMA 4U42A 3VHKA 4E26A 2W9FB 2ETRA 4M97A 2ZJWA 1OPLA 4NT4A 4NUSA 4PMMA 3DKGA 3OROA 4I0TA 3LFSA 4ZJJA 5CAPA 4H36A 3WYYA 2UV2A 2IW6A 2QNJA 4TYIA 2CN5A 4FBXA 4G3FA 3DT1A 4XG2A 4XRLA 3KK9A 4ACHA 3GT8A 3TDWA 4R7HA 3QFVA 3VS5A 3N4TA 3A8WA 5EYCA 4QQJA 3ORLA 5F1ZA 5AR4A 4RQVA 3BX5A 5H3QA 2R3MA 2F49A 4D2PA 4TWCA 2J51A 4UYNA 2PZPA 4YLJA 4YJNA 3LZBA 1UVRA 3DJ7A 4FIEA 1XHAA 3F2NA 4ASDA 3LMIA 4C8BA 1PMVA 3MJ2A 4Y83A 4FK6A 3KEXA 4QMTA 4EL9A 3ALNA 4E5WA 1OECA 5M4FA 4CV8A 4QT1A 2IN6A 2YCSA 4BIDA 4ALUA 5IUHA 1PKDA 3PXRA 2Y0AA 3ODZX 4JLCA 3COIA 2Z60A 3WZKA 3NNVA 4I0RA 3C0IA 2XM9A 2WMBA 3KCKA 4F0GA 2IZTA 3MB6A 3KXZA 3RVGA 4RRVA 2BDWA 4E73A 4EOKA 4QYFA 4FV3A 4QMSA 4F1MA 1GJOA 1XBAA 3EQHA 3IGOA 4QMOA 4XG4A 2I7QA 2GQGA 4PL4A 1YXSA 4ZXTA 4ZY4A 2QQ7A 4NTTA 4YZMA 4FTNA 5AP2A 3V51A 1OBDA 5I9XA 4AN9A 3R8VA 3OFMA 2V22A 1OMWA 3RWPA 3CTHA 4FV5A 4J7BA 4EKKA 3ORPA 3BWFA 3I7CA 3UC4A 3SLSA 1Y91A 2OJ9A 3H4JA 3TNWA 5BQ0A 4YURA 4FV7A 4FYNA 1OZ1A 4AGCA 4L6QA 5HBJA 3A7HA 4RFZA 1JAMA 2BVAA 2UW8A 5K4IA 4QTEA 3HUBA 2WB8A 5J1VA 5M08A 2R9SA 5E7RA 4GT4A 4FIGA 5EHOA 3VS4A 5K3YA 4GFMA 3F3ZA 4EUUA 4BICA 4Q9ZA 3DXPA 4JQEA 1G3NA 5AP5A 3KK8A 2C5OA 4QMPA 5EG3A 4OT6A 3MBLA 4EK8A 2F4JA 4WNOA 2IW9A 4M12A 4KWPA 1URWA 4C3PA 3DFAA 4ONAA 1YXVA 1JKKA 1JNKA 1Y8GA 4Y8DA 2CJMA 3V8SA 5J87A 5L4QA 3OW4A 3FC2A 3ZHPC 3FI8A 3MFSA 2NPQA 2ITZA 2WMSA 3DAEA 4A06A 4BN1A 5GZAA 4TNBA 4D2VA 1M2PA 4DEHA 4OTPA 4QMVA 2XK6A 4FL3A 1XQZA 2B9IA 2OW3A 2Q0NA 4XLVA 4C4FA 4FVRA 4IVBA 5D9HA 4BYJA 5CANA 2LAVA 3AD5A 4BIEA 3DTCA 3VN9A 1APME 3EN4A 4C35A 3ZEWA 3GC7A 3NYVA 3WZUA 4ID7A 2IVUA 5L8KA 4FI1A 3LPBA 5J5TA 3BCEA 4OTRA 3UNJA 3EJ1A 4N4SA 5HE0A 3ENMA 1BI8A 2FSTX 3FQSA 5CI6A 3ZM9A 2W1ZA 2XIYA 4LRJA 4O22A 2E9UA 4HVHA 2VX1A 3OXTA 2OJJA 4L8MA 1OPKA 4QYEA 3VWAA 3UOJA 4NL0A 2X81A 3EQBA 5FEEA 5JQ8A 1H24A 1O6LA 1OIQA 3QQLA 3R9DA 2X8IA 1YWNA 2Z8CA 3RTPA 4FODA 2XIXA 5B0XA 3NNUA 3KF7A 3LMGA 3W55A 1IEPA 3GU7A 4GSBA 5I9WA 3QKLA 2HXQA 4E5AX 3K3JA 4ZS0A 1Q4LA 2VGOA 3DBFA 1FMKA 3SG8A 2UW6A 3LCKA 3QTSA 4MXYA 3FSKA 4HVGA 3UZPA 2J7TA 2WU6A 2P33A 4GH2A 1QL6A 3GXLA 5HCXA 3QZFA 1PXLA 4I6FA 2JC6A 4PNIA 4R1VA 4FKOA 3FXXA 4BI2A 1WZYA 3VULA 3U6IA 4U3ZA 2OH4A 1YXXA 4M84A 1FBNA 3O2MA 3KMUA 3FAAA 1WBTA 3FHRA 3KF4A 5JKGA 2C0IA 4UEUA 4WD5A 5K5NA 2WKMA 2KULA 2Z7RA 3WF8A 4O7ZA 3D7TA 4TY1A 2W1DA 3G6GA 2E9NA 4R3PA 2P4IA 4NTSA 1SZMA 4BKZA 2HYYA 3SKCA 4CYIA 1PHKA 4UMTA 2C6DA 3QRTA 3AC5A 3L9PA 4KINA 3W8LA 5AFVA 3LHJA 4BDEA 3JY9A 2YLEA 2XF0A 2XH5A 5TT7A 4FTTA 4FEXA 5L6WL 3ZO1A 2LGCA 4RA5A 2HOGA 3BHHA 5BVFA 3D7TB 3ETAA 3IG7A 4YGAA 4FSTA 3QLGA 3BLRA 1U4DA 4HGLA 4L9IA 5AP6A 3B2WA 4V0GA 5HKMA 4C37A 2J50A 4EH4A 1MRVA 3R7VA 2QC6A 4GFGA 5FEDA 3F3TA 4C59A 3V04A 3CIKA 4J96A 1J1BA 4I5PA 3RCDA 5F4NA 4AW1A 4CD0A 5J1WA 5HX8A 2UVZA 4OTWA 1IA9A 5AR5A 4XUFA 3OP5A 4FT0A 4KAOA 5E90A 4DG2E 3SOAA 1QPJA 3VUGA 4FKUA 4V0GB 3UNKA 3E88A 3GVUA 3GQIA 4G3CA 5I9ZA 3PVGA 4AZSA 5A6OA 2BTRA 5CNNA 4FMQA 3Q3BA 3HMNA 1CM8A 3MFRA 4TTHB 4EYJA 3MY5A 3MY1A 3SV0A 1OKZA 4AW5A 3H0ZA 3HRBA 4F0IA 4ZZOA 4U9AA 2BRNA 3QQJA 4PP7A 3MVMA 1U5QA 4W4VA 2UZEA 3OBGA 4CCBA 1JKLA 3U4WA 2OFVA 3OHTA 5A6NA 2BMCA 3E7VA 3S4QA 3DFCB 4GG5A 2F9GA 4U43A 3LXNA 4FUXA 4ZEGA 3HKOA 3C5IA 2J90A 4CCUA 2OIQA 3DAKA 3LXPA 3W2CA 3FDNA 3CS9A 4LQMA 4F6SA 2WQBA 5L8LA 5CXHA 3RAHA 3VQUA 5EHYA 2VTJA 2JBPA 2ZB1A 4YO6A 3RK9A 3QQKA 1WVYA 1NVSA 3CSVA 3V5WA 4UXQA 3AC3A 1ZMWA 4I5HA 4PWNA 4AT4A 3RK7A 4F7JA 5K9IA 4RJ4A 2YM4A 3BI6A 3L8SA 2XM8A 4JBPA 1AGWA 3KGAA 4F63A 3S1HA 4D4VA 3R02A 3SG9A 2Y4PA 3A7IA 1ZOEA 3CEKA 3QLFA 4PPCA 3D5XA 3ZO4A 4IWOA 3OBJA 2B9HA 4DG0E 4J98A 4U7ZA 3FY0A 5ACBC 1DI8A 4IZ5A 4AU8A 1NXKA 5CENA 5EOBA 5GNKA 2HK5A 1F5QA 2QG7A 4D2RA 2C5NA 5CF4A 1UNHA 3M1SA 3F7WA 3PVBA 5ANDA 5EQEA 3MVLA 4GU9A 4C4GA 3NS9A 4RVMA 5DVRA 1GIIA 2WU7A 3NR9A 2CPKE 5IH5A 3CR0A 4O83A 4NSTA 4RIWA 3PVUA 5FTQA 5A9UA 5B7VA 4HZSA 3I0OA 3ZRKA 4TPTA 4CYJA 3DNEA 3MTFA 5E8WA 2VNYA 3EZVA 5CS6A 4IWPA 4O7LA 4EHEA 3R1YA 4ORKA 5CSHA 4RVLA 5CZHA 3NYOA 2GTMA 3MIAA 2YITA 3QTRA 4BCNA 4QMMA 2XBAA 4RIWB 3MH3A 4XMOA 4RG0A 5DMZA 4DFZE 4AZFA 1DAYA 3HNGA 3MH1A 4BDBA 3ODYX 4ZMFA 2WQMA 5H8BA 2VO6A 4ALWA 4FKJA 2WD1A 3AMAA 4HVSA 2FSLX 3PXFA 1MUOA 3QXOA 1GY3A 1RE8A 2CMWA 3FPMA 3ORIA 4MQ1A 4AZEA 4JAJA 1H27A 3KXHA 4IW0A 4WO5A 5CTPA 5EK7A 3L8XA 5CAQA 5C4LA 4CNHA 3SVVA 4L68A 3U9CA 3NAXA 4L01A 1BI7A 1K3AA 1PXJA 3DA6A 3H9FA 5KZ0A 3MJ1A 2JITA 2R3HA 3PPJA 3PTGA 3PXYA 4ITJA 5EYMA 4AGWA 4YR8A 5BX0A 4OTDA 2PMOX 1XH9A 2DS1A 3AC4A 3F2AA 3FMHA 4LL5A 4EZ3A 4M15A 1OIRA 2R3QA 4YC3A 4FTOA 3DBCA 3GC9A 4U5JA 4CSVA 3QWKA 3FI4A 4H1JA 3RP9A 2XK4A 4LMUA 2Z2WA 4G31A 4IFGA 5CSVA 5JSMA 5ANKA 1ZRZA 4GL9A 4XBUA 4AXAA 4E4XA 3AC2A 3TJCA 2CKEA 3NMUF 4R3CA 3P5KA 3PE1A 2O64A 3V5QA 2BDJA 3VUIA 4FTQA 3F5XA 4G6NA 3ZSHA 2UW3A 2EWAA 4ACCA 3SW7A 1XH5A 3U54A 2R3GA 4XLIA 2J5EA 1CKJA 4UV0A 1UWJA 3CLYA 3MPAA 4DEDA 2W5HA 3CE3A 3I0QA 3PA3A 3GCQA 4ZK5A 4EOOA 2OIDA 4JAIA 4C2WA 5HQ0A 5CVHA 4AGUA 2YZLA 3AXWA 4QP1A 3UMWA 3I1AA 3EQRA 3TT0A 3QHWA 1V1KA 3L9LA 3LXLA 5L6PA 5CASA 2CSNA 3C50A 3BIZA 5KHWA 4AF3A 2ZOQA 2PUUA 2BHEA 4XYFA 1W82A 3PIXA 4L44A 3SHEA 3DAJA 3GB2A 3KRLA 4PDYA 4JG7A 1TQPA 1VJYA 4BTKA 4WSYA 3B8RA 2VWYA 3ID6C 4DT9A 3ZCLA 2BRMA 3FZTA 1KV1A 1Q5KA 4HYIA 3TIZA 1KE5A 1Q8YA 2VWWA 3HP5A 1JLUE 3ZEPA 4AT3A 4MBJA 5L8JA 4I94A 1WBWA 4HNIA 4FKVA 5CF5A 3EQCA 1KOAA 4I3ZA 2X1NA 3A8XA 2YM7A 4JL9A 4P5ZA 4UMQA 1FGIA 5CT0A 3UOHA 1RDQE 4O7VA 1B39A 5DHJA 5IDPA 3AGLA 2J0KA 2X8DA 2X8EA 3KRXA 4M67A 3AD6A 5JN2A 1VZOA 4G3GA 4RA4A 3CKXA 5FG8A 4E8AA 3FPQA 4BCHA 4Z9LA 4KUJA 4FG8A 4BB4A 2ZDUA 2QKWB 3GEQA 3G90X 4C61A 1URCA 2RF9A 5HCZA 4F4PA 5HG7A 3QCXA 3K54A 3POOA 4X2KA 1K9AA 5DG5A 4DEBA 3UNZA 2CN8A 3BE2A 3VJNA 3Q2JA 4U6RA 2RIOA 3WF7A 4DT8A 1UU3A 3F5UA 3U6HA 3R8PA 4QNAA 2WMAA 2R3OA 4FSWA 2XRUA 5HE1A 1OI9A 3C9WA 3QU0A 4Y72A 4BDKA 5IEVA 2ETMA 2PVLA 3TI1A 2G2HA 4HPUE 3POZA 3V8TA 4RJ5A 5AP1A 4CVAA 5HX6A 2IPXA 5DT3A 2J9MA 5FLFA 3PY3A 4DTKA 4CGAA 3JXWA 3OG7A 3QYZA 4JDJA 4L53A 3SQQA 2HW7A 2XB7A 3RMFA 3WF9A 4JRVA 1MRUA 4UZDA 5GINE 3ANQA 2XEYA 4JIKA 2VWVA 3G51A 4TN6A 3E5AA 2PPQA 4FEQA 3ZBXA 5J9ZA 4IZ7A 5JFVA 2WMVA 2YIQA 3IK3A 2VWUA 2X6DA 3DKCA 3R00A 4IB5A 5HBEA 3AOXA 1WFCA 2R3FA 2OBJA 1IR3A 3CD3A 1REKA 3GBZA 1VYWA 4RVKA 4EEVA 4IIRA 1PXMA 4GU6A 3RZBA 5I0BA 3GFWA 4JBOA 5DN3A 5KMOA 1YOMA 1ZMVA 4P4CA 4BKYA 4FE2A 3UBDA 2Y6MA 3AT4A 1G8AA 5IPJA 1KE8A 3TUCA 4AGDA 3FZOA 2ITOA 3PSDA 4B7TA 4FA2A 4IADA 4IX6A 4LOQA 5HIEA 4FEWA 4K0YA 2VV9A 3MV5A 4UN0C 5M57A 2PVHA 4MNFA 2F2UA 2X39A 3Q32A 3QKKA 1TQMA 1ERKA 3U87A 4K9YA 3D94A 3SAYA 4A9SA 5AP3A 4KIQA 4GYGA 2OICA 2B53A 4QTCA 2XCKA 2PULA 2UW9A 4W4XA 1G8SA 3Q9WA 2JGZA 3MTLA 2PVRA 2GNJA 4C34A 3WF6A 5J5SA 3RPVA 4KSQA 2YJSA 2JAVA 2EB3A 3KRJA 4U44A 4RIXA 4A9UA 5LVNA 2BRBA 2YA9A 3MW1A 4F7NA 1GZKA 1Z5MA 4MX9A 4F1TA 2XJ1A 5G1XA 4FTCA 2YIYA 2W5BA 1QCFA 3EQIA 2C6MA 3FBVA 2I0YA 3FXWA 4Y73A 1H00A 1WBOA 4J1RA 2XA4A 3UJGA 3TDVA 1JSUA 2CKOA 3EB0A 5GHVA 4I92A 1A9UA 1PXPA 2O0UA 1OL2A 4QMLA 4RIXB 4X0MA 5DEWA 4EZ7A 3NYNA 4EOMA 2WTVA 4FV9A 1W8CA 4MHAA 4W9WA 2OXDA 4NM3A 4HYSA 2QHNA 5LCJA 2R64A 2WNTA 2RFEA 1ATPE 3HAVA 4ZSEA 3L9NA 3ZYAA 2OZOA 4DLIA 2VX0A 3ZO2A 4D2TA 4IC7A 1FMOE 3HUCA 2X9EA 2H8HA 2YCFA 1S9IA 5CVFA 1J7LA 4IB3A 5HICA 2I0EA 3WBLA 5CU4A 5HTCA 2UZBA 4C3RA 3ZSGA 1SVEA 3C51A 4CMOA 4LL0A 1O6YA 1TQIA 3BQRA 5EDPA 4QPAA 4TXCA 4S31A 4N57A 3PA5A 4FNYA 5ANJA 2VNWA 4E4NA 4PL5A 4HGSA 4I21A 4AZVA 4BCJA 2WQOA 4R7BA 2PUIA 2IO6A 2XIKA 4GJ2A 4XCUA 4GT3A 2WFYA 2YM8A 5CEQA 4TWPA 2ITWA 5IQHA 1IG1A 5L2TA 3I60A 5KMNA 1UWHA 2C47A 2UZTA 3R7GA 3ZUVA 2BFXA 3GUBA 4R3RA 1QPCA 4O27B 1JBPE 5GJDA 3VW6A 4NCTC 3FV8A 3PSCA 2BCJA 4OAVB 2XZSA 3OF0A 4FV4A 2C5YA 2ERZE 4GYIA 4K18A 5M4IA 3KRWA 4IX4A 1CMKE 2JIIA 3P86A 4G6OA 3WF5A 1X8BA 4EZ5A 3UVRA 2VN9A 1HOWA 4AUAA 5IUGA 4LRMA 5E8ZA 2ZV9A 4PPAA 1OGUA 4QP3A 2O3PA 3V5LA 4BWPA 4U41A 4C4JA 3SDJA 5E8VA 4MXCA 5FM2A 3JR1A 3BHVA 3HV5A 3QALE 4WSQA 2UZNA 2FGIA 2G01A 3V6SA 1AD5A 4O82A 2A0CX 2HELA 4FZFB 4E93A 5GJGA 4GMYA 5TO8A 3IW7A 4AE6A 5AUTA 1R78A 3BV2A 4I6BA 3MB7A 5IQCA 2FSOX 2OXYA 4BL1A 2GFSA 5JGDA 4F6UA 2CKQA 4AE9A 2W7XA 3HV7A 3W1FA 3UVQA 3EZRA 3O50A 2X9FA 1A06A 4IDTA 4IM0A 1FQ1B 3EN9A 3EFWA 2OKRA 4I20A 4ZIMA 5C8NA 3UPZA 3KY2A 2OJGA 2YFXA 4WNMA 3ERKA 4J52A 4M69B 3LM5A 4TYHA 2JIVA 3DBQA 5DPVA 2C6IA 3Q4ZA 3PZHA 1YHWA 2AC3A 2IWIA 5E8SA 4DC2A 2HAKA 5K0XA 3D7ZA 3QD2B 4XG7A 4YZDA 1M2RA 3VRZA 4ZTSA 2ITPA 4PMPA 4A9TA 1WBVA 5CU0A 4NKSA 4NJ3A 4ZSLA 2BR1A 2C68A 4OBPA 3QL8A 3E62A 2QOBA 3FLWA 4O0RA 4DITA 3C5UA 4TYHB 4PY1A 4U40A 1LPUA 1OKVA 4XBRA 3K5VA 3OD6X 2YAKA 5FDXA 4ZSAA 5IQGA 4L52A 3TEIA 4RC3A 1LEZA 1GAGA 2WZJA 3R7EA 4PP9A 3EMGA 4LUEA 4O0WA 4RJ3A 4DFLA 5C26A 2HZNA 2WEIA 4NZWB 2W9ZB 4GVJA 1M2QA 3SGCA 5EI2A 3IDPA 5EH0A 3BQCA 5HG8A 4BHZA 3NAYA 2A2AA 5HBHA 5ACKA 3BHTA 3BHYA 4YNOA 3KULA 3NYXA 4FKLA 3ZC6A 3IKAA 3HMIA 3PWDA 4RIOA 3BHUA 3ZO3A 3GU4A 5JRQA 2C5XA 5JQ5A 4D0XA 3BKBA 4YBJA 3ZXTA 2WTIA 4EK6A 4O1PA 5KZIA 1YHSA 4DEEA 2XK8A 4N6YA 4RIYA 5IA0A 4XHKB 5FUTA 3ZZWA 3VS7A 2WMUA 3EN6A 5JH6A 2R3PA 2W1EA 4RQKA 5LVMA 4F64A 2CHLA 3HX4A 1SVHA 2WTJA 2WXVA 2E2BA 2QOKA 4MXXA 5IUIA 5A4TA 4BI0A 3R73A 4AAAA 1NY3A 1Q99A 4NM5A 4IAZA 2OXXA 5AR2A 3HLLA 2VTRA 4RIYB 1OPJA 3OMVA 4ENYA 2E9VA 5JEBA 2BKKA 2OFUA 1P14A 5HORA 3VBQA 1W84A 3FSFA 4YU2A 4KD1A 4IZAA 4FKWA 2W99B 4FG7A 4L7SA 5DH3A 3LFFA 3O23A 1NA7A 4ZLZA 3V01A 1H4LA 3D5UA 5AAEA 3L8PA 5LVPA 3OEZA 5GJFA 4GVAA 3UIBA 3ZLWA 2QOOA 3E7OA 3Q04A 4DH1A 3FLSA 1Y57A 4JT3A 4CFWA 4J8NA 2B9JA 2P2HA 3QWJA 1XH8A 2GFCA 4MD7E 3TV4A 5HU3A 5ETAA 1E9HA 3ZFYA 4I6QA 3R30A 5EQYA 5I3RA 4TZRA 2RFDA 1OVEA 5E92A 2C5VA 3CKWA 3VUKA 1XH4A 3C4ZA 1W83A 1IAHA 1M14A 2JEDA 3IPHA 1XKKA 4D4YA 4CFMA 1PY5A 2BILB 5HD7A 2XCHA 3WARA 3BV3A 4RX7A 2R7BA 4BBMA 4JRNA 5IQEA 4CT2A 2XS0A 3ZZEA 5K4JA 2J5FA 5AWMA 3OTUA 5EI8A 5HE3A 2E9OA 2JKMA 3LM0A 4AT5A 1XJDA 3V8WA 4DGMA 3VRYA 3RPRA 3G6HA 4IB0A 3COKA 3KMWA 4RGJA 2QOHA 4NIFA 5E1SA 2QHMA 1FPUA 2E9PA 4RMZA 4ANQA 4DFNA 4JNWA 2FH9A 2BHHA 4OTHA 3T8OA 4I41A 3ZDUA 4D1SA 4FYOA 4XH6A 4NH1A 5LWMA 4HGEA 3CCNA 3QCYA 3P23A 3RPYA 2DUVA 3THBA 2QU5A 3ZRLA 1R0PA 5BYLA 2V7OA 2WAJA 5AP0A 4RLKA 3QD0A 4APPA 1MRYA 4CG8A 4NIFB 4XV2A 5CU3A 4RC2A 2ZB0A 3FQHA 3D14A 2F7XE 3NUXA 4CXAA 4WHZA 5CAOA 1A48A 2YWVA 4EH7A 2QKRA 4LUDA 3G33A 5FDPA 5CSXA 5AA9A 4W4WA 5KO1A 3GCPA 4H05A 3P4KA 4E6DA 1VYZA 2BKZA 4FKPA 5DT0A 4AA0A 3G9NA 5D11A 1IAJA 4BVUA 3S95A 3FLQA 3JYAA 5K0KA 3HZTA 4BDCA 5DR6A 3CQEA 4FTRA 2OIBA 3LAUA 4FUYA 3W18A 3T3UA 1YI3A 2BTSA 5HESA 1GOLA 4H58A 3QUEA 4LGHA 4H3PA 3R1NA 4FGBA 4GCJA 4LI5A 3VC4A 2VO7A 4DEGA 2JKKA 4BIBA 2V55A 2CCHA 5DIAA 1YI4A 3R83A 3UGCA 4LM5A 4G2FA 3TG1A 3VBWA 5CAUA 3CP9A 3E87A 5HTBA 4YTHA 3GCSA 4YHTA 2R3KA 4MKCA 2GNIA 5FTOA 4EK3A 4KKGA 4G3DA 1YOLA 5A3XA 2W1CA 4L42A 2VD5A 4UALA 4ACGA 2X7OA 1XH7A 5HOAA 4D0WA 2OJFE 2RFSA 4EHGA 5IISA 4V01A 3COHA 4RT7A 3VF9A 2OGVA 3ZMMA 5AJQA 4CZTA 1MP8A 4H3QA
chains in the Genus database with same CATH superfamily
4LV8A 2PWLA 1KOBA 2JDRA 2PVJA 3RINA 3S3IA 3NFFB 4R7IA 1VEBA 2CKPA 3OTVA 4BJJA 3W33A 4WG4A 4UY9A 4C4EA 2X0OA 4EK4A 3NEWA 2G2IA 4UMPA 1WBNA 1FGKA 4YZNA 4DINA 4E5BA 4NM7A 3PUPA 4QMWA 1W7HA 3O51A 4QMXA 4XG3A 3NUAA 2XALA 3F61A 4UMUA 4QQTA 2EXEA 2BPMA 1KE6A 4OBQA 3AKKA 3CTQA 4NJDA 5T68A 4BJJB 4E7WA 4O7SA 3FY2A 1BX6A 4FTMA 3F3VA 2WMXA 4YJQA 4HOKA 4OLIA 4EHZA 3E3BX 3OWPA 4BYIA 5LQFA 2IG7A 3IW6A 3H0YA 4IXPA 4ANBA 4AOTA 1Q3WA 1H0WA 2PMIA 3C7QA 4R5YA 5AUXA 1Y6AA 3R01A 1Q41A 5HVYA 2GNGA 4C33A 4BWKA 3FMKA 3EHAA 3VS3A 4YO4A 4XG9A 2GU8A 1V0BA 1ZYLA 4KKEA 2P3GX 5EW8A 3CPBA 5LJJA 1G8KA 2CNUA 2ITTA 3IOKA 1PYXA 2XK9A 3REPA 3ZS5A 4FSRA 2X7GA 4EWHA 3NUUA 5TF9A 1KSWA 3I81A 3IQ7A 4DFYA 3F88A 2HWPA 3FKOA 1P2AA 1SM2A 2R5TA 2J0MB 2Y6OA 4LV5A 3ULZA 4FV8A 2Q83A 1J7UA 2JBOA 3KMMA 3DLSA 4F6WA 5D12A 4F1OA 4FEVA 4C2VA 1Q97A 2UZLA 3H3CA 1REJA 4EH8A 3FLZA 5IKWA 3UIXA 3MA6A 4FIIA 1CKPA 4QP2A 5HO7A 4L00A 1J1CA 1RJBA 2CLXA 4C62A 2UZVA 3RHKA 3NNXA 1NVQA 3DXNA 1PYEA 2VWBA 4I1ZA 3VUHA 4F9CA 2PK9A 5I9UA 5ANEA 2ZM1A 3LCOA 3FYKX 1OITA 2W1HA 3KXGA 3MVHA 3OXIA 1ZYJA 3TNIA 2YACA 3BYUA 4F09A 1UU9A 1OB3A 2CGVA 4IZYA 2A98A 3M42A 2BZJA 4FX3A 3W2SA 4DHFA 3JY0A 5ETFA 5J95A 4AQCA 1KE7A 5CI7A 3ZUUA 4Q5EA 4FG9A 4FGRA 2ZYBA 1HCLA 5IQBA 2YLFA 1XH6A 3CQWA 4W4YA 4ERWA 5FXSA 1CTPE 4DLJA 2PZYA 2GS6A 2YZAA 2C30A 4HW7A 2XNBA 3BWJA 3MDYA 3OWKA 4FVQA 1H01A 4YHFA 3FXZA 4O0UA 5EKNA 4D28A 2P55A 3BGQA 1FINA 3R7YA 3T9TA 4HCUA 3H10A 1PF8A 2NP8A 3BU6A 4GG7A 3W0NA 3OC1A 3TUBA 2UZUE 3QC4A 3UQGA 1YOJA 3E8NA 4J99A 5FM3A 4R77A 3VONA 3CJFA 5IMEA 3HP2A 5HIBA 2WTCA 1BKXA 5HLWA 1TFFA 4M0YA 2XK7A 1HCKA 3HMPA 4EOQA 3QTIA 4NCTA 3LMHA 3CY2A 4UB7A 1UA2A 3OCGA 4L43A 4YTIA 3VIDA 4ZSJA 3KFAA 4EH6A 4FKRA 3RCJA 5IQDA 1YXTA 4BZOA 5J8IA 3ORNA 1Y6BA 4K33A 1FVVA 4O7RA 4IE9A 4CMTA 4DGGA 4WA9A 5BVEA 4D1XA 2AC5A 5KKRC 2VZ6A 5E4HA 4YZCA 5IG1A 4GRBA 3R9OA 4ANNA 5EW3A 4PTGA 3HV4A 3CGOA 2G15A 4RWIA 2RG5A 1H1PA 3QTWA 4IC8A 3LFDA 3MPTA 4YPSA 5AM7A 5K5XA 2B55A 2I40A 1IASA 3NVKI 2GS2A 3EQGA 3RBWA 3NIEA 4TT7A 5EFQA 4D58A 3FMNA 4RX8A 4WBBB 2C6TA 5KBRA 5CQWA 1ZOGA 4DBNA 2XYNA 3QCSA 5C01A 3O96A 2YN8A 3RAWA 3MA3A 3UYSA 3FL5A 3QRJA 2F7ZE 3LOKA 5AUVA 1STCE 2RG6A 5IA5A 5IH4A 3F66A 3T9IA 3A60A 5D41A 4L7FA 2PTKA 4YSMA 5EM7A 4AX8A 2XNNA 3FLNC 4BCFA 3CQUA 4JI9A 5CU2A 3NPCA 4FKQA 3AT3A 2WGJA 5H8GA 3O17A 1CSNA 1J3HA 3COMA 3DKFA 4FTJA 3K2LA 1M7QA 2QCSA 3VAPA 3WIGA 3GC8A 4C3FA 4RFMA 4PPBA 2R0UA 5BVNA 5HHWA 4O7TA 2VGPA 4IM2A 3R9RA 5AV4A 4TRLA 4DH5A 1PXOA 3L8VA 4O2ZA 2J2IB 4FTUA 1GZOA 5TKDA 2QO7A 4Y5HA 4P2KA 4CTBA 4CRLA 3UOKA 1ZZ2A 4ENXA 4DEIA 2PE2A 4EH2A 3GOKA 5JZNA 2OWBA 3K3IA 2UW4A 4R6VA 4JR7A 4EBVA 5CXZA 3PXQA 5C4KA 5DGZA 1U54A 4FF8A 4PQNA 2FA2A 4C36A 3HGKA 5AAGA 5AR8A 3AT2A 3LFNA 1UNLA 2C0OA 3PY0A 2JFLA 3BPRA 4O4BB 3W0QA 4C02A 2QR8A 2QURA 2A19B 3W2PA 5BUIA 4X3FC 3LCSA 3LJ0A 4FC0A 4RJ7A 1B6CB 2G1TA 3MWUA 4UWYA 3A2CA 2GHGA 4FSQA 2J6MA 4JOAA 1U54B 5IDNA 3ORKA 4DHIB 1TVOA 4C7TA 1KUTA 3DZOA 2BALA 3MYGA 3NW7A 4M66A 3SXSA 2PZRA 4BDDA 3DNDA 3I7BA 4XV1A 1YRPA 3HVCA 4HNFA 3BZ3A 3QD3A 3JVSA 2VTNA 2IZSA 3RZFA 5BVWA 2B1PA 3PSBA 1H0VA 4O84A 3EKNA 4KBAA 3LCTA 2WO6A 3FZ1A 4DFUA 3F69A 3P79A 3F82A 2EXMA 5D7AA 3DXQA 3HA8A 5DI1A 3F5GA 4I93A 2EU9A 3A62A 2VX3A 3MFUA 1Q3DA 2IVTA 2QOFA 3NDMA 4QOXA 4EBWA 1MQBA 3KU2A 4AZWA 5A4LA 1XO2B 2WELA 3GNIB 3BEAA 3QC9A 2P2IA 4BCQA 5BYYA 5EM5A 3HRCA 3FYJX 4EOJA 3R8LA 1Z57A 4A9YA 4A9RA 3AG9A 4F08A 2BAJA 2C3JA 5FP5A 4F99A 3E8CA 5AUUA 4DFBA 4B99A 3RJCA 3S00A 5EQPA 4HJOA 5AP7A 5IU2A 5CNOA 2UVXA 3R2YA 4TWOA 5JFSA 4RJ8A 1P5EA 2SRCA 4FSZA 4DAWA 4FVPA 1H08A 4JR3A 3O8TA 3FL4A 4ANOA 4CKJA 2X6EA 2OJIA 4M3QA 3ROYA 4QP4A 1M7NA 3QTZA 2PHKA 3D5WA 4NW6A 4O96A 4BDFA 4BFMA 5D10A 4U97A 4WOVA 3KB7A 3U4UA 3D4QA 4RFYA 1H1QA 3IGGA 4AXEA 4JIAA 1UNGA 5FWKK 4GFOA 3ORXA 4G9RA 4IVDA 2OK1A 3U9NA 2VRXA 2VTLA 3EH9A 2XVDA 1H28A 4EK5A 3BEGA 3NUNA 5HZNA 3TKUA 3BBTB 4HPTE 2ZM3A 4MH7A 3UO4A 5I9VA 2AQXA 3HEGA 3MH0A 4GS6A 5LMBA 2BUJA 3ELJA 4JQ8A 4XOZA 4DH3A 2X4FA 3MFTA 4CQGA 4ZTNA 5M4UA 1JWHA 4BCGA 5KBQA 3TXOA 2FYSA 3UZTA 3R7OA 5JGBA 2WTWA 1R1WA 5F9EA 4PNKA 2Y4IC 4MNEA 3V6RA 4CEGA 3DKOA 3MGYA 2VTTA 3GC0A 4WUAA 2ETKA 4NWMA 2ZV2A 3Q4CA 3R9NA 4G16A 4AOIA 4CLJA 4RJ6A 4CV9A 1WBSA 4D4RA 2OU7A 3JUHA 3P08A 3TZ8A 3QTXA 1Q8WA 3IW8A 4UWBA 1ND4A 3KRRA 3P78A 4JDHA 2WEVA 4NW5A 1F3MC 5E9EA 4JX7A 3RAKA 4P7EA 4NEUA 5B2LA 1R0EA 5DWRA 1WCCA 5EYKA 2R3IA 1ZYCA 4DYMA 4Z7GA 4ERKA 3DBDA 5A54A 1O6KA 2W0JA 1YHVA 3D15A 5AX3A 4BCPA 4CFUA 3HAMA 2DWBA 3PWYA 4DF3A 4EQUA 2ZM4A 5FRIA 3TZ9A 2PMNX 5L6OA 3ORTA 2F57A 3QQUA 3I79A 2W96B 3EKKA 3W32A 2XKCA 5AV3A 3RM7A 3CD8A 3DV3A 3QF9A 1JSVA 4KRDA 3R63A 5M4CA 2VTQA 2X7FA 3AC1A 1YW2A 4Y95A 1BYGA 3CXWA 2CNVA 3KA0A 3KC3A 5CVGA 3ZONA 3HMOA 5EDQA 5EI6A 5GZ9A 5E1EA 2VTAA 2FUMA 1H1SA 2VTIA 2W17A 3OEFX 3R9HA 4AN2A 5EKOA 3WIKA 3ZUTA 4F7LA 3LLTA 1SNXA 3V5PA 4C4IA 5I5ZA 4O0SA 3UTOA 3A61A 1OM1A 2A27A 4K6ZA 3IDCA 5DLSA 3FMJA 3BL9A 4MEDA 1OUYA 2R2PA 1PMNA 2CDZA 2C3LA 3R0TA 3AQVA 4UZHA 3GI3A 3OVVA 5JFXA 3ZDIA 3QQGA 4KIKA 5BYZA 4J71A 3JVRA 2BIKB 4FNZA 3BYVA 3MSSA 3W0MA 4ACMA 3AMBA 2XNPA 1UU8A 3FMMA 5KUPA 3PFYA 2J0IA 3NRMA 4FTKA 3QTUA 5M09A 3DOGA 4KA3A 4EOSA 3F2RA 3PLSA 5IZFA 3QUDA 5H2UA 1OL1A 2WMWA 3PIYA 1Q8ZA 4W8DA 2IW8A 3ZRMA 4EC8A 4UBAA 3HMMA 1OL5A 3NZ0A 4N70A 5GZ8A 2H6DA 2VTMA 4KIKB 1DAWA 1QMZA 2CGXA 2ITVA 3P1AA 2XJ2A 4XS2A 3DJ5A 4QO9A 3TMOA 4RX5A 4D5HA 4WG5A 4FZ6A 2OLCA 2HWOA 2XNOA 5EW9A 4IH8A 4X2FA 2BAKA 2XKEA 5CF8A 1QPDA 4MXZA 4WG3A 3FI3A 3Q5ZA 2XKDA 2GQSA 4GKHA 4PX6A 3LQ3A 4M13A 2JAMA 4RLLA 4IVAA 4FV0A 4BDHA 3VW8A 3Q9YA 1IRKA 4RVTA 4D9UA 4DGNA 1GIJA 4WT6A 4Q9SA 2XARA 3PA4A 2ZMDA 2Z7SA 4PV0A 5DNRA 1RW8A 4DN5A 2YIRA 5ANGA 5CEIA 5J7HA 3N9XA 5HD4A 4KIOA 3GP0A 5LMKA 4CKIA 4YZBA 4PL3A 3TL8A 4RWKA 1FVTA 2AUHA 4FSMA 4PTCA 5IQIA 3MIYA 3EN7A 2B4SB 3IO7A 4FK3A 4B8LA 1SVGA 4XG6A 1ST0A 4I23A 2XANA 4TYGA 2GDOA 4YTCA 3EN5A 3FUPA 1M17A 2WPAA 4DE4A 1ZARA 4PDOA 3ROCA 2ITNA 2YJRA 3EL7A 4I4FA 3WZEA 1H1RA 3UOLA 1PRYA 4NKAA 5AP4A 2YM3A 2GHMA 3I4BA 4GT5A 4X2NA 2GHLA 3RM6A 2QLQA 3B8QA 3QX2A 4CKRA 3PY1A 4YP8A 4BR3A 4ZMEA 1KV2A 3LE6A 4P5QA 1XBBA 3FKNA 3OOMA 2G2FA 4Y46A 4ZY5A 4AS0A 1YVJA 5HLPA 2NRUA 5T3QA 4BZNA 3C4FA 3MI9A 5IEXA 1VR2A 3PP1A 4GV1A 4K1BA 4BDJA 5F94A 4IEBA 2HY81 5CQUA 1UU7A 3O0GA 2CGWA 2JDOA 4V05A 4X6RA 3TNHA 5FP6A 2ZV8A 5J9LA 1L3RE 4O86A 3TACA 4O81A 5E91A 4CRSA 3R04A 3BRBA 1FVRA 5AUYA 3RALA 3NUPA 3MS9A 2P0CA 3KXXA 4ZTRA 4I0SA 3WE8A 4ANSA 4FL1A 4EH3A 3BYOA 3GCVA 5BVKA 3PZEA 4FSYA 4U0IA 4O4FA 2IZUA 4RZWA 5HI2A 2PU8A 1AQ1A 1UKIA 4S30A 3PG3A 4LGDA 4DTAA 2VAGA 3EFJA 4EHVA 3N4UA 3O7LB 3PVWA 1ZMUA 3DQWA 5F20A 3TTIA 2ITQA 3W10A 3ZC5A 3E8DA 2RKUA 4U3YA 5LVOA 4ITHA 3TZMA 3NW6A 4QP9A 4L3LA 3BGPA 3KXNA 4S33A 5M55A 2PVNA 2Z7LA 3LIJA 5LARA 3UQCA 5HU9A 4FT7A 4ZY6A 4IAKA 3LFAA 4FL2A 3LVPA 3TWJA 4Z16A 4A07A 2OZAA 5AR3A 4M7IA 5CZIA 3QA8A 4RSSA 4O91A 4BF2A 2OG8A 2W1FA 1OL7A 3R1QA 2OI4X 2FO0A 4RC4A 4EH9A 4OW8A 4DCAA 3GOPA 2QOQA 3V3VA 2A4LA 3CY3A 4NM0A 3VS6A 2F2CB 3ZOSA 4V04A 3KULB 2H34A 3QCQA 2HXLA 4RZVA 4HCVA 5FEQA 3ZM4A 4EOIA 5KKRB 4D5KA 4DG3E 4AA4A 2OZAB 4KSPA 2HENA 1PXIA 4W9XA 3MESA 4D2SA 4IMYA 4KB8A 5KNJA 3QRUA 4EKLA 2ITXA 2WQEA 3ATTA 5EM8A 3G15A 1QPEA 4DA5A 4LMNA 1RQQA 4AACA 4YHJA 4AW2A 2R4BA 4HGTA 1PXNA 5AIRA 4QYGA 5IA4A 4MVFA 5C8KA 3QRKA 3EIDA 3CTJA 1OKYA 3UC3A 3TUDA 1WMKA 3OXZA 3WZJA 4ZS4A 3RK5A 2QD9A 2DQ7X 3IONA 1WVXA 2WQNA 3DB8A 3E3PA 3UIUA 4EYMA 3O8PA 4CQEA 2OF2A 4FNXA 3ZU7A 5IA2A 4BTFA 3QYWA 4JX3A 4KS7A 3RAIA 3OS3A 3Q5IA 4WIHA 1JOWB 3BELA 5EDRA 3V5JA 4AW0A 2ZMCA 3VUMA 4IJPA 1F0QA 3I5NA 4DGOA 3ORZA 2PL0A 3DDPA 4FT3A 4L3JA 4CTCA 4UWCA 4G1WA 3UVPA 3R71A 4MBIA 2JFMA 2RSVA 1Q8UA 4RBLA 1Z9XA 3NW5A 3FZSA 4BTMA 3QHRA 4BRXA 4DFXE 3UMXA 5DFPA 2UW5A 2O2UA 1SNUA 2YABA 2XIZA 3G0FA 3VQHA 4X2GA 5I4NA 5J79A 2PUPA 3QUPA 4X3FA 3DJ6A 2B7AA 5EM6A 1ZOHA 3UODA 3BU5A 3TV6A 2ITUA 3UYTA 2UW0A 3GU5A 5D7VA 4I24A 4O4DA 4Z3VA 4O0VA 2YDKA 4RX9A 1YDRE 4U8ZA 1G8JA 1VLRA 2C6OA 4OGRA 3LCDA 2V62A 2J0JA 4Y5QA 3TNPC 4A4OA 4EOPA 4IBMA 4KIPA 4DDGA 4QDVA 2XBJA 3IW5A 3GFEA 4O6LA 3F5PA 4X3FB 4JS8A 3ALOA 3VUTA 3FQEA 4EC9A 2YISA 4GIHA 2PVYA 3F3WA 3DK3A 3RGFA 4FZAB 2V5QA 3C0HA 4WNKA 4AOJA 2O5KA 3F7ZA 2XNGA 1YKRA 2UZOA 3ACKA 3GQLA 4IAIA 4JBQA 3QRIA 4RWLA 4YPDA 4CT1A 4DH7A 4TL0A 3VBTA 5GIPE 4MF1A 2CGUA 2JLDA 4JDKA 4MUQA 3QBNA 3R7UA 1E1VA 1I44A 5L2QA 3SOCA 1M52A 2WOTA 2XUUA 4OBOA 3ZXZA 2BIYA 3FZPA 2UUEA 2JDSA 3HV6A 4IB1A 2UZDA 2C4GA 3F9NA 4NFNA 3UG2A 4KRCA 4D1ZA 3KN5A 3Q4UA 1DS5A 4OTFA 3OWJA 5CAVA 4M8TA 5A4QA 3UO6A 3WYXA 2FSMX 5M07A 1DI9A 5ICPA 1IA8A 4EQMA 5CEMA 5M51A 2QONA 3C4XA 4QRCA 3QZIA 4H39A 2WTKC 5AV2A 4NK9A 3P7BA 5KE0A 3UP2A 3ZH8A 4FOCA 5AUZA 4YTFA 2QOIA 3D9VA 4QYYA 1PJKA 2C69A 5CSWA 4E6AA 1LP4A 4KNBA 1ZYDA 4QMYA 2H9VA 4F65A 1XWSA 4YNEA 3S2PA 3VHEA 4EWQA 3KL8A 4F9BA 3CC6A 3DU8A 3R22A 3R7IA 1U59A 2UZWE 5M56A 4QPMA 4MF0A 3EWHA 4GK4A 4M14A 3W16A 3W2RA 4PDSA 2J4ZA 2AEGA 3PYYA 3LFQA 2R7IA 3M11A 3KQ7A 3NVMB 4B6LA 2FVDA 3DBEA 2YDIA 2I6LA 1W98A 3Q2MA 2PMLX 4GJ3A 4AWIA 2O63A 4LV7A 4IAFA 4N0SA 5CYIA 2BFYA 4K11A 4KBKA 5LWNA 1G5SA 4A4XA 4F70A 5HTIA 4G5JA 2VTSA 3KCFA 2Y4IB 5LVLA 3OWLA 4GK2A 4LYNA 4B9DA 1LEWA 3P7AA 4FIFA 4H3BA 4JBVA 5DRDA 3UIMA 1NT2A 3SD0A 1JQHA 2GSFA 5HNIX 4JG6A 5TR6A 2NNWB 2QLUA 4ZOGA 4EJNA 4X7QA 2C3KA 4EQCA 3ZTXA 3RNIA 2HZIA 2HIWA 3C4WA 4JDIA 4XP0A 3MY0A 3PDTA 3G2FA 3SXRA 2I1MA 4S34A 1H26A 2ZV7A 2YHVA 3ORMA 1W0XC 5EOLA 5HGIA 3FKLA 3RHXA 3TNQB 4A4LA 2R3NA 4U81A 3PPKA 5A14A 2CNQA 1BL6A 4RPVA 3DPKA 2ONLA 3OY1A 3MPMA 3PP0A 4W8EA 3QZHA 4QMZA 3B2TA 4YC6A 4E20A 4FT9A 4XJ0A 5LMKC 1GNGA 3RPSA 4U80A 3SA0A 4FICA 1UV5A 4YJSA 2X2MA 5CF6A 4YLKA 4TW9A 4USFA 2WMTA 4RWJA 4FEUA 1OKWA 4G9CA 3QKMA 1YWRA 2VTOA 2W5AA 4Z55A 5CLPA 3QA0A 4C38A 3WE4A 4AFEA 4QDEA 4FIHA 4YJPA 5HIDA 3EL8A 4IVCA 4HZRA 2QG5A 2A1AB 4LG4A 3D83A 4FR4A 4UMRA 5KMKA 4YUQA 2X4ZA 3PG1A 1SMHA 4YBKA 4MCVA 2BAQA 1P4OA 3CGFA 4GIIA 4AQKA 3PRIA 3TJDA 4BY9E 5J7BA 2PZIA 5AR7A 3ZLSA 5M53A 2OO8X 3R21A 4BGGA 3OOGA 4AG8A 1OIUA 1ZAOA 4QMQA 2KTYA 3QAME 2QO2A 2X2KA 3IW4A 4U45A 4HVDA 3N51A 2PVKA 3O7LD 4YJTA 4R8QA 3LFEA 3ZFXA 4BCIA 1YXUA 2V7AA 3OCSA 4FV1A 4IAYA 4UX9A 3EYHA 4KABA 2ZVAA 3FEGA 2R3JA 4DTBA 3VO3A 3E8EA 4FOBA 3SC1A 3P7CA 3UG1A 3GENA 4O0YA 4DBXA 4WKQA 2BRGA 4MWHA 1GZNA 3KXMA 3OT8A 5ITAA 4G6LA 2HZ4A 1P4FA 2HCKA 2XNMA 3DDQA 4DEAA 4EOLA 2Y8OA 4FIJA 1Q8TA 5AA8A 3DGKA 3MN3A 1H1WA 3I6UA 3NIZA 2YCQA 4L46A 4M0ZA 2C6LA 4O1OA 3S0OA 3PXKA 4XX9A 4QQCA 3CPCA 4ARKA 4CZUA 3W8QA 3VBVA 4F9YA 4MQ2A 2BZIB 2O8YA 1U46A 3TIYA 3TKHA 4EH5A 3HRFA 3TM0A 1PMEA 3UE4A 5AV1A 5CT7A 3HDMA 4OTGA 3TZ7A 5IEYA 5FQDC 5E8UA 5G6VA 2REIA 3OCTA 4ASEA 4PRJA 2PY3A 3HL7A 5JT2A 5I3OA 4JQ7A 3UDBA 3BBWA 5KX8A 5L3AA 4CG9A 1BLXA 3F6XA 2XAMA 3TTJA 2BDFA 2YCRA 3BGZA 2YIWA 2C3IB 2YDJA 5BNJA 3PFQA 4S2ZA 5BPYA 2F7EE 3UP7A 2C6EA 3QTQA 4Q5HA 5LMAA 4QNYA 5JFWA 1L8TA 3IS5A 4LOPA 4FTIA 2XP2A 1ZWSA 4J97A 4NFMA 3VBYA 5L2IA 5IQAA 4QQ5A 4K2RA 2W4JA 4JG8A 5FBOA 3QD4A 4Y85A 4BGQA 4LRKA 3PJ2A 2C1AA 2QOCA 2YERA 4L3PA 5AUWA 5AADA 5JK3A 5KMJA 4WRGA 5H9BA 4AP7A 4CFNA 5BVDA 2PVFA 4GW8A 3L1SA 3EFLA 1SYKA 1J91A 3BYSA 3FMLA 3JS2A 4ZAUA 5AAFA 4IFCA 5D1JA 3VVHA 3PLAE 3FWQA 3KVWA 3ML1A 2ZDTA 2EB2A 5C1QB 2B0QA 3RWQA 2O65A 2XYUA 4QYHA 3KVXA 1U5RA 2PZ5A 4X21A 5KCVA 4ZTMA 4G34A 4X6QC 4DH8A 2PE1A 4N6ZA 5DRBA 2C1BA 4MAOA 4PMSA 3VUDA 3NUSA 3OUKA 3OT3A 1NW1A 2EXCX 4LGGA 3Q96A 4FKGA 4WRSA 2VUWA 4FKIA 2WOUA 3ULIA 4O7YA 4MK0A 4Z7HA 4FV6A 4IX3A 5HLNA 2C6KA 3PXZA 2GNHA 4O38A 4D9TA 4QMNA 1LR4A 4ANMA 4IDVA 3HDNA 5DR2A 4GKIA 5A46A 5L2WA 3G9LX 4NYEA 3PJ8A 1ZYSA 4XG8A 5B2KA 3R8UA 3O8UA 4KS8A 4C58A 2YEXA 2XK3A 3NCGA 1JVPP 2EUFB 1ZXEA 3DS6A 4OTIA 4IX5A 4DCEA 4YMJA 1YDTE 3BE9A 5FD2A 2NO3A 3ZLXA 3NNWA 3EQDA 4ITIA 3LQ8A 3P9JA 4BCMA 5GIOE 4LFIA 3DLZA 4O7WA 2W4OA 2GS7A 2Y7JA 2IJMA 3NCZA 3NLBA 4IM3A 4TYEA 3TN8A 3G0EA 3E92A 5AIKA 5HVJA 4IWDA 3WILA 4OT5A 1OBGA 5BVOA 4G5PA 2VO0A 1TKIA 3AMYA 3U55A 4FV2A 4B8MA 1WVWA 3NX8A 4CLIA 1XMLA 4EUTA 4G17A 5DBXA 3C4EA 3H9RA 2HY0A 3LFBA 3DK6A 3ITZA 3AKJA 1GZ8A 4CFXA 4QPSA 1FOTA 2I0VA 3EOCA 4KBCA 5EHLA 2QVSE 3G5DA 5C27A 5IA3A 3I5ZA 4E4LA 4G3EA 2ERKA 3VBXA 4APCA 3FMEA 4Q2AA 1Q24A 4AZTA 5IF1A 5ANIA 5C8MA 4O0XA 4IJ9A 5F95A 3C4CA 2YIXA 3QXPA 4L67A 3RNYA 5M44A 3TV7A 4BC6A 4XOYA 2WMQA 3W2OA 4BI1A 2IZRA 4E3CA 3E93A 5CEPA 3HECA 5CALA 5DT4A 1K2PA 3F3UA 4EI4A 2JKOA 5E8TA 2ACXA 3NGAA 2I0HA 3KKVA 4NU1A 5HE2A 4F9WA 4IQ6A 1R3CA 5CEKA 3A4PA 3DB6A 3U8WA 3EQFA 2PSQA 4O2PA 1XBCA 2J0LA 4M68A 2XRWA 2Z02A 3DTWA 3P0MA 5JZJA 2ESMA 1ZLTA 5C03A 4BHNA 4QEBA 4S32A 5AX9A 4TYJA 4OR5A 2X0GA 4ANLA 5CSPA 2QODA 5HEZA 4JXFA 3AD4A 4J95A 2JDTA 4PDPA 5KMLA 1DM2A 2V0DA 3DY7A 3Q9XA 3QGWA 4WUNA 3KN6A 3PPZA 4YSJA 4BBEA 4CFVA 2VO3A 1Q61A 1JPAA 4FT5A 4GK3A 5AM6A 1T46A 3ENHA 5ETCA 3OUNB 4X3JA 1GIHA 4B0GA 2QR7A 1V0PA 1ZY5A 1Y8YA 4ASXA 4IANA 4OUCA 2EVAA 4PMTA 1LUFA 3GU6A 3VJOA 3LJ2A 3ATSA 2IVSA 1EH4A 4O6EA 4BDAA 2NYAA 2GQRA 3DZQA 3SX9A 3VS2A 3FI2A 2R0IA 3D5VA 3VS1A 3EQPA 3HV3A 3HYHA 3NWWA 3R2BA 1H8FA 4ZTQA 5JMSA 3QZGA 5HNGA 5DE2A 3ZLYA 4MD9E 5A4CA 5FXRA 2X2LA 3KREA 3Q9ZA 1H25A 5HG9A 3SRVA 3H30A 1KE9A 4MNEB 4XEYA 5JRSA 3PE2A 3C1XA 4F9AA 4QP7A 4XV9A 2QI8A 1PKGA 5FXQA 2QOLA 2JKQA 2GNLA 3Q52A 3R1SA 4BDIA 4ACDA 4HYHA 2CCIA 3UPXA 3NFGB 4PF4A 3HA6A 4CZYB 5DR9A 4J8MA 5CY3A 2WIHA 4AFJA 4AAYA 2DYLA 2R3LA 1T45A 4BCKA 4ZZMA 4YJOA 5A4EA 2WHBA 3I6WA 2XEZA 3SRVB 4LOOA 4PTEA 1J7IA 4ZJIA 4XP2A 3PJ3A 3DCVA 4K8AA 4D55A 5HO6A 4KKHA 2ONLC 3CBLA 3M2WA 3QQHA 5HG5A 4QTDA 3C0GA 4D2WA 3SW4A 3VNTA 2FB8A 3R6XA 2VWIA 4ASZA 5BMSA 3E63A 3D2KA 1S9JA 4II5A 2W1IA 3BYMA 2R3RA 4TWNA 3EFKA 2UVYA 2HZ0A 3IDBA 5C9CA 4USDA 5DEYA 4EONA 2PUNA 2C0TA 3OCBA 4E6CA 3BLAA 2WTDA 4QTBA 3QGYA 4H1MA 4MD8E 3CJGA 1ST4A 2IVVA 1YI6A 2VTPA 5IMXA