3IONA

Pdk1 in complex with compound 8h
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
285
structure length
274
Chain Sequence
RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title The identification of 8,9-dimethoxy-5-(2-aminoalkoxy-pyridin-3-yl)-benzo[c][2,7]naphthyridin-4-ylamines as potent inhibitors of 3-phosphoinositide-dependent kinase-1 (PDK-1).
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 274
sequence length 285
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ionA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ionA01
4FSZA 3RKBA 2HY0A 3NNXA 4KS7A 3LLAA 4EHGA 3MWUA 5DR6A 1LPUA 4EKKA 5A9UA 1KE8A 2WMUA 4GS6A 4AN9A 4DFYA 3MVLA 4GIHA 4IAFA 4XP3A 2YIRA 3RK5A 3ZLXA 2W0JA 3N4VA 3PJ3A 4XV1A 1R78A 3Q96A 3ZDUA 5EQYA 4GCJA 4C58A 1OKYA 3FMJA 2B9JA 1JBPE 2C3KA 3NW5A 5J95A 4M15A 3RI1A 3GI3A 1KOAA 2GQSA 5ITAA 2B9IA 3ATSA 3EFKA 4BWXA 3IDPA 3Q60A 3QTZA 4OLIA 3SA0A 4OAUC 3ZSHA 2O2UA 2VWXA 2JDTA 2QO7A 3LXNA 3EN7A 4BIEA 2WD1A 3QLGA 5FD2A 1R39A 4JX3A 3SDJA 2YA9A 4CV8A 3R1NA 3R6XA 2W17A 2AC5A 3F9NA 5BVWA 2ITXA 3S2PA 4E8AA 2X81A 1YXTA 3QHWA 5DR2A 4HYHA 4QYFA 3FLWA 3CKXA 3CR0A 4IQ6A 2WU7A 4CRSA 2HXLA 3ODYX 4J97A 5D12A 3FI2A 4F08A 4ZS0A 5JRSA 3QKKA 2J2IB 1OGUA 3DAJA 3MTFA 3PZEA 4YTIA 5DG5A 3MB7A 5CALA 4FSQA 4BCQA 1OPKA 3A61A 4MXOA 2XS0A 5EYDA 1Y8YA 1ZYSA 4OR5A 3LMIA 3WARA 4CLIA 5JMSA 5K5XA 3QL8A 2X6EA 4JDHA 1OB3A 2BRGA 2WEVA 3C4EA 3JY9A 1JSTA 3NRMA 4WUNA 2ITQA 4CFFA 3WIKA 2QR8A 5DR9A 2C5XA 2JKMA 2QR7A 4I4FA 2PMLX 3RK9A 4CYJA 4QT1A 2IZSA 2QODA 2XYUA 2CKEA 1DS5A 3ZHPC 2OWBA 4C3FA 5A4CA 4XP0A 3VUMA 4E4XA 1PXPA 2YJRA 3C5IA 5FBOA 4WG4A 3ZUUA 4Z9LA 3LFAA 3C4FA 4KBCA 3W32A 3AC4A 2XNMA 3P78A 1KE9A 5HO6A 3BHTA 3S00A 4NTTA 4FT7A 4ITIA 3R1SA 4GRBA 4BBFA 1H25A 5M4FA 4IX4A 4DFXE 1UU9A 3QXPA 3E93A 2BMCA 1FQ1B 4MK0A 3DLZA 1BKXA 4UX9A 5KMOA 1W7HA 3PXYA 3ZBFA 4RFMA 3SQQA 4ZMEA 4AACA 3DBFA 4IVAA 3V01A 1OIRA 2YAAA 2XYNA 5FLFA 3WZEA 4YP8A 1ZYJA 4IZ7A 4FG8A 4O7RA 5AAEA 2R3GA 2XVDA 4B4LA 4YSJA 2RF9A 3FZRA 3VF9A 4BZNA 3F5XA 2WOTA 4WHZA 4FV3A 3AC3A 3DA6A 5HG7A 4F0GA 2GNGA 2QLUA 3DTWA 5IH5A 5M4CA 4R6VA 4R7IA 2ONLC 4G3FA 4FEVA 2WTKB 4FEQA 5JEBA 2F2UA 4MF0A 2C1AA 2PZIA 2O8YA 4EK5A 4X2NA 4Q5EA 3DK7A 3AD6A 3EH9A 2CNQA 4EQUA 5AUWA 2ETRA 4FA2A 4EBVA 1K3AA 2I40A 3LAUA 1OECA 3FHRA 3Q4UA 4ZIMA 3GCVA 2I0VA 2YAKA 3E8NA 4O1PA 5EG3A 3JR1A 3DBEA 4L44A 2UZUE 4PWNA 1FPUA 1OM1A 3AT4A 3FYKX 3R8VA 3ULZA 4GKIA 5TT7A 3KXXA 3ALOA 4NK9A 3LFBA 4L42A 4RIXA 5FDPA 3SOCA 4XG9A 4BZDA 4FV5A 1U54B 3QA8A 3BPRA 1YOJA 3WYYA 3OFMA 4AAAA 2W99B 1W83A 1PXJA 4YLJA 1OBGA 4L9IA 4C33A 5DYJA 5EM5A 4E3CA 3E3PA 2XIXA 3GQIA 3JVSA 3PA5A 3PLSA 2BZJA 5ETIA 2VGPA 3WYXA 4BGHA 5JKGA 1DAYA 1WBOA 3JS2A 3QWJA 3EKKA 4FVRA 4IX3A 4J95A 2I0YA 4QPMA 5LMAA 2OI4X 3LQ5A 4A4LA 4EK8A 5CEPA 2Z2WA 4CXAA 2CKPA 2VTRA 4K9YA 3ZRKA 2XP2A 3QBNA 2GNIA 4FTOA 2W9FB 4KKGA 5CF4A 4F7NA 3IDBA 2R3HA 3E63A 2XJ2A 4LOPA 2VTHA 3CJGA 3SC1A 2OJJA 1PKGA 4JDJA 3NW6A 3LCOA 3TXOA 1URWA 4CZYB 2YDJA 2HENA 4FZFB 2C5YA 5EYCA 3LM5A 4U45A 5CNNA 3WF8A 3V5JA 2XRUA 1A06A 2CNVA 1YQJA 4GG5A 4O96A 2IZRA 2ZM1A 3COMA 4I41A 4IJ9A 2SRCA 3SAYA 3VS7A 3G9LX 1JSUA 2EB3A 2JKQA 3OWKA 4QMLA 3UMXA 4FICA 4M14A 4RX7A 2B9FA 3WZKA 3DKOA 4O83A 3L9NA 3BRBA 5BPYA 3PIYA 4C57A 2GPHA 3Q9WA 3BYMA 4XRJA 3IQ7A 4OTGA 2UZOA 3UVQA 4AGCA 1SZMA 4F9YA 3AT3A 4WNKA 3CY2A 4QP2A 4EI4A 3HAVA 1H1PA 4IXPA 3GC9A 3MA6A 3GT8A 3ZLYA 3ZZEA 4L53A 1RW8A 5DWRA 5EDPA 5ANIA 5HZNA 3MV5A 3ZUTA 4LV5A 2WFYA 3Q4CA 4AW2A 2QOCA 1Q8UA 4TXCA 2X2MA 2HK5A 3LFQA 2XK3A 4MNFA 5I3OA 3MFTA 3QC4A 5FUTA 3TDWA 1J3HA 3HUBA 1NA7A 4FOCA 2XMYA 3EQRA 3FWQA 5DIAA 4RZWA 3DQWA 4FKQA 1Q62A 5C8NA 3DY7A 5DNRA 5DFPA 2XM9A 1REKA 4XP2A 3PP0A 2X4FA 4BCJA 2C6EA 2Y6OA 4D28A 4RBLA 3LHJA 4DGGA 4D2PA 1SNUA 3MY0A 5AIRA 5AP7A 4ZTRA 2EB2A 4F7LA 2RKUA 2VRXA 2ITOA 1OZ1A 2HELA 1CDKA 3IGOA 4K2RA 4UYNA 5DBXA 5HNIX 3FPMA 5G6VA 4XH6A 2I0EA 3MH3A 4I23A 3V5QA 2XKDA 4L45A 2O63A 3RPSA 4BCOA 4FTQA 3JY0A 4DFZE 5HQ0A 2RFEA 2QI8A 3TT0A 2CGVA 4XYFA 2CHLA 3O2MA 3TV6A 1OBDA 4A9RA 5CU4A 5A3XA 4EH8A 3TEIA 5EM8A 4D0WA 3RJCA 2NRUA 4ID7A 3OMVA 5KKRB 4ITJA 5A6NA 4H1MA 1OL7A 4NT4A 4X2FA 1UWHA 3PFQA 3FI3A 1OI9A 3C4WA 3QXOA 3G6GA 2X2KA 4M67A 4D58A 2RFSA 3KKVA 3VC4A 5JGBA 4L3JA 4HGLA 4O0RA 3TACA 1H1SA 3T3UA 4BI1A 4BY9E 3N4TA 2OXDA 3TNWA 3F66A 5DN3A 4X0MA 4ZY4A 3GBZA 4JBQA 5KBRA 4F9BA 2HOGA 4I6FA 4HCUA 1CMKE 3R04A 4UMTA 5AP2A 4APPA 2F2CB 4O7SA 3O51A 2OF2A 5M53A 4FTLA 3HLLA 5HVJA 1QPEA 3NEWA 2WMXA 3AD5A 3IONA 3QQGA 4R8QA 3NUXA 4FF8A 4KNBA 2OXYA 3GQLA 4BKZA 5DT0A 2R3IA 4ZY5A 2YABA 5CWZA 3G33A 3QD2B 4QYGA 2G2IA 2C3JA 4XOYA 3UNZA 2Y0AA 3QD4A 5J1WA 1GOLA 5HD7A 4KRDA 2WGJA 1Y57A 4NCTC 4EJ7A 3FKLA 4L8MA 4EK3A 4BYJA 4IFGA 4BCNA 3P5KA 1JSVA 2UZTA 2Z7LA 4MBJA 3F2RA 4AW1A 3WZJA 2XNGA 5LCKA 4GKHA 3QKLA 4AOTA 1GZ8A 4AZFA 4JDKA 1SM2A 3R7OA 1MUOA 5BMMA 5KX8A 2E9PA 4O84A 3MB6A 4JBOA 4RLLA 4MF1A 4ERKA 4FEWA 3DK6A 2F7XE 4H3BA 2I7QA 4FTMA 3FY0A 2YZLA 3BGPA 1O6KA 4Z7HA 1XHAA 1H08A 3R63A 2WTVA 3OG7A 3TZ7A 2ERKA 4FV1A 3C50A 4V04A 4X21A 3O17A 4F99A 3IECA 1GNGA 5HIEA 3VWAA 2JGZA 5A4TA 2GNJA 2WMWA 3VQHA 1M17A 2YITA 1PXKA 3C1XA 5IQIA 3LVPA 3AC8A 3VS6A 3I1AA 5AR2A 3TKIA 4KIPA 1Q5KA 2F7EE 4QMYA 3F3UA 4Q5HA 3TNHA 3R00A 4EHEA 4EH7A 5D7VA 1TQMA 2VO3A 4LFIA 4NCTA 4C02A 5BUIA 5GIOE 4YPDA 3BYVA 3I79A 4BDAA 2VWYA 1ZWSA 1G5SA 4UMUA 4LQMA 3DFAA 5L6WL 3LFFA 1YI4A 4DLIA 1FMKA 4P5ZA 5A14A 5BUEA 3PG1A 4B8MA 4MX9A 3M2WA 4UEUA 4C0TA 3V04A 3OY3A 4ENXA 2XUUA 2W1HA 4IVBA 2VTJA 3QQHA 4MD7E 3IW6A 3NNVA 4BKYA 4FODA 4U42A 5L8LA 5CENA 1ZY5A 3HAMA 4BR3A 2IG7A 5F9EA 2IJMA 1PRYA 1BMKA 3CPCA 3EJ1A 5M57A 4DH3A 1U5RA 2VTSA 3HKOA 2J5EA 5DRDA 2JITA 3UZTA 4MVFA 4EH9A 4QQJA 1FVVA 2ITVA 3FLYA 4G6LA 1Y91A 3N4UA 5D41A 2R3MA 4FKTA 3IS5A 4FTUA 3R9HA 2XCHA 3OS3A 4YZMA 1V0BA 3V8TA 5AR5A 5IISA 5KMMA 5GJFA 3FC1X 2E2BA 1DI8A 3BYUA 3NYXA 5IEYA 3EQHA 4FZ6A 4F9WA 5B2MA 4D5KA 3WILA 1ZLTA 3FYJX 4FTNA 4F7JA 4RIXB 3TUCA 2PVMA 1WBWA 1PXMA 2CSNA 2GMXA 2EWAA 3BZ3A 2J0IA 3I6WA 1IAJA 4ZOGA 4ANOA 2QVSE 5L2QA 4MNEB 3PY1A 3Q3BA 3FQHA 5FXRA 3MPMA 1A48A 4EOPA 4Z55A 4FIHA 3UO6A 1CKIA 3EMGA 3MY1A 3VBVA 4YZCA 3QGYA 3UGCA 2C68A 3EL7A 3EQIA 4AZWA 4KIKB 1T45A 2X39A 4J8MA 4BKJA 4UZDA 1IG1A 5DE2A 5C4KA 4AU8A 3V51A 2ZAZA 4C4FA 4FKWA 1YWVA 2Z8CA 2Z7RA 4OW8A 1HOWA 3FMHA 4GV1A 2WPAA 4XG2A 3BU3A 4YJRA 5J9YA 3I0QA 3IW5A 3AMYA 4NTSA 4XCUA 4RRVA 2GQRA 4DCAA 3TN8A 1WCCA 2YCSA 1DAWA 3JUHA 3LFEA 4MHAA 5AIKA 3U51A 1PXIA 3TV4A 2WMBA 3DT1A 3OY1A 3R1YA 3ZSIA 5DT4A 3ZUVA 5I9XA 4RX8A 3A60A 5B2LA 1JKLA 4ACCA 2GU8A 5L2WA 4AOJA 4FSWA 4IB3A 2XRWA 5CXHA 4EH3A 4QMSA 2WTKC 2ZV9A 3P7CA 3PJ8A 5C9CA 3RK7A 4RJ6A 2WQMA 1GZKA 4G1WA 4O27B 4EHVA 5CYIA 4USFA 3K5UA 3D4QA 4BDGA 3CBLA 1YWRA 2W1DA 4JI9A 4IACA 4X2GA 1OPLA 2QNJA 3NW7A 3ORXA 4KS8A 2RG6A 4CGAA 1R3CA 4OBPA 4BCFA 4NFMA 4ZTLA 3UPZA 3GGFA 4DT8A 4BDDA 4Z16A 1Q8YA 4G9RA 3RCJA 3PXKA 4DE4A 4RWJA 1ZOGA 2W5AA 3OHTA 2C5OA 3ZFYA 4CFNA 3SVVA 4M84A 3LKMA 3BQRA 2AYPA 1W8CA 3VW8A 3LM0A 1OMWA 3Q52A 1OIQA 4EH2A 3QZIA 3OOMA 4E5AX 3PWDA 1MQBA 4M0ZA 2XK8A 2GCDA 3OBJA 2ETKA 2YJSA 4TYJA 3R0TA 4BTJA 3DB8A 3WIGA 3L1SA 4GK2A 3DB6A 3BHUA 1QCFA 2WTDA 4IEBA 4IFCA 5K0KA 3E64A 1URCA 3TUBA 2B7AA 4DYMA 3EN9A 5HTCA 1KE7A 3WZDA 2PMNX 4RJ4A 2F49A 4RJ7A 4U9AA 5GHVA 2X6DA 4EOMA 2XJ0A 2ZB0A 4EZ7A 3C4CA 4A7CA 4CFXA 1HCLA 4O0WA 3H0YA 2PSQA 4GK3A 4UWYA 4DC2A 4R3PA 3ZM4A 4R3CA 5IEXA 5AP3A 5GIPE 4A07A 4WNMA 3F7WA 3NDMA 2B0QA 3LMHA 3E7OA 2H6DA 3FC2A 3O8PA 3ZTXA 5H3QA 5KMNA 4C37A 1YXVA 1FVRA 4DGOA 4ZXTA 3A99A 4BDJA 3WF9A 4YLKA 4A06A 3DXQA 3OCSA 3KXZA 1JVPP 1U54A 4KBAA 1WAKA 4ANMA 4U44A 4E6AA 2WTCA 1KV2A 2VAGA 4ZZOA 3VUHA 3FL5A 4XNEA 1AGWA 2XZSA 1XWSA 3DBCA 2J7TA 3GUBA 3IGGA 4TZRA 4R78A 5H8EA 4NZWB 4AZVA 3UZPA 3T9IA 3EB0A 3D2IA 2OXXA 3KF4A 3FZOA 3COIA 5AA9A 5HBEA 2F57A 4RC4A 1H01A 2C6KA 5H8BA 3FLZA 3KRJA 4TPTA 4MXCA 1SVHA 4GFMA 4RJ5A 3QAME 4O0XA 3EOCA 3UTOA 5T6KA 4K33A 5KE0A 1KE6A 3KQ7A 3QA0A 4CCUA 1QPJA 5CAUA 3C13A 4HCVA 5CVFA 4FT5A 3RPYA 4RA4A 3R9OA 4C2WA 3E8EA 5IZFA 3NZ0A 4A9TA 5LQFA 2R3NA 5KHXA 4HGEA 4FIGA 4GFGA 3HYHA 4O6LA 4JG6A 5CY3A 3R7UA 4PTEA 4IADA 1FGIA 2ZV8A 5ANKA 3LFCA 4EYMA 3IW4A 4LGHA 1WBVA 1ZYLA 3POZA 4QMVA 4RVTA 5LJJA 2BILB 5IMEA 5CVHA 4F1OA 3R1QA 3OXTA 3QTSA 1M2RA 2JDVA 5AJQA 5EOLA 1MP8A 5CI7A 4I6QA 3PY3A 5EI8A 1UNLA 3VUIA 3P4KA 5ANDA 4CV9A 1F3MC 1H24A 5EW8A 3KXHA 4ONAA 3CQUA 5LVPA 1QPCA 4CQEA 2VNYA 2C0TA 3KK9A 1ZMVA 3WE8A 3RPRA 1P5EA 3RAIA 5JFSA 4YBKA 4YHJA 5E90A 4ZJJA 1ZRZA 5M56A 2YCFA 3ORLA 4E4NA 5KKRC 4CTBA 2WXVA 3EIDA 5E4HA 3FJQE 3KVXA 1H26A 4S2ZA 1UU7A 2O3PA 3HDMA 4QNYA 2NO3A 4F0FA 1JAMA 2WMSA 4FKUA 2XNBA 4JRVA 5J9LA 2BFXA 2JIVA 1OIUA 4W4VA 3DK3A 3QUPA 4FV2A 2XIYA 1Z9XA 3CKWA 4ZSLA 4BCIA 1M14A 2WTJA 5CQUA 4ZZNA 5JZJA 1PKDA 2VD5A 4J71A 2UVYA 2IW9A 1U46A 4JLCA 5EM6A 1GIJA 3VJNA 2VTQA 3RNIA 4DH1A 1UA2A 2XKCA 4LUEA 3I4BA 1GY3A 3Q9XA 3JVRA 3ORIA 4X7QA 5AWMA 4OTWA 4BTMA 4DEAA 1NY3A 1R0EA 4EC9A 5IF1A 4BDEA 4E26A 4YLLA 4EJNA 4C59A 3VBTA 3KREA 1KOBA 1Q8WA 4NM7A 4OUCA 2C6DA 3T8OA 4BTFA 2FSMX 4LOQA 3OD6X 3BQCA 3D7ZA 1WVWA 3OW4A 4DTKA 4HVIA 5CASA 3LCTA 3LOKA 3HDNA 4N57A 4TWNA 4DG2E 2CLQA 3PVGA 4NFNA 3SGCA 2YEXA 5J7BA 4FKVA 3A8WA 3RWPA 5A4EA 3PY0A 1WVXA 1XQZA 1Q3WA 4AUAA 3QCQA 2ITPA 5IQAA 1SYKA 3D94A 3TNIA 2O65A 4FTCA 1TVOA 3GU5A 3POOA 5IA1A 1WFCA 3FMKA 4AZEA 3TZMA 2WKMA 1R1WA 3L9LA 3GVUA 3WF7A 4DF3A 2HZ0A 4D2TA 3DJ7A 3G9NA 4XV9A 4U43A 4Y46A 2HWOA 3VS2A 4O7NA 5JT2A 4O2PA 3LJ1A 4QNAA 5DRBA 3H4JA 3UNJA 4RG0A 3D2KA 1ZOEA 2ZB1A 1TQIA 1VZOA 2HIWA 3OWLA 4FGBA 4BIDA 5BYYA 4DH8A 4XBUA 4K1BA 4BN1A 3LXLA 4EK4A 2ESMA 3EHAA 1YWNA 4R7HA 2W7XA 4RVMA 4L68A 4YNEA 2VGOA 4EH4A 3F69A 2JKKA 4TKSA 4ZSJA 5JQ8A 5BNJA 4WIHA 1F0QA 2QOIA 4HNIA 4LOOA 5HCYA 4DTBA 1VYWA 4U3ZA 3K2LA 3GEQA 3W8QA 4HGSA 3VS1A 4AGWA 2HAKA 2VTTA 3VO3A 3UP2A 3V5PA 1PYEA 3W2CA 5EHLA 1K9AA 2A2AA 3EL8A 3R7GA 2VWWA 4ASDA 4PDSA 3R02A 1TQPA 3DXPA 2FSOX 2GS7A 4QPSA 5A4QA 5BYLA 2V62A 2C6MA 4AN3A 1PXOA 1B6CB 4JJRA 4AGDA 4U97A 3FXXA 1Q8TA 4XOZA 2IW6A 2VZ6A 3AC5A 3KULB 5A46A 4FOBA 4FTTA 4G9CA 4ASEA 5HO8A 3SRVB 3KU2A 4J52A 1APME 4UYAA 3MYGA 5AM6A 2CNUA 3WOWA 2CGXA 3EQCA 5D11A 3FAAA 4BBMA 3QLFA 4FL1A 3CSVA 2JKOA 1BUHA 4L3PA 5J5TA 2GSFA 4RWKA 4UN0C 4NW6A 2VN9A 3DJ5A 3AQVA 2BFYA 5BVEA 4EQMA 2Z7SA 3GENA 4AQCA 3BWFA 2WIHA 3SD0A 3VIDA 3IW8A 3VUTA 1SNXA 2XNEA 3V6RA 3M11A 3DOGA 3AGMA 3BYOA 3QU0A 4E93A 2R3KA 3ORTA 2P55A 2JC6A 3G15A 3KB7A 2X4ZA 1H07A 3PJCA 2BTSA 3HMMA 3A7IA 5J87A 3KMWA 2VX1A 3AG9A 3FKNA 4QTAA 4DITA 3BLHA 3HRFA 1ZZ2A 4QYEA 3UO5A 2E9UA 4DA5A 3EQFA 4JG7A 3QGWA 1O6YA 4GSBA 3PXFA 3E87A 4FNXA 4FI1A 4HYIA 3G5DA 5L8KA 4YHTA 1PMEA 5GZ9A 1UVRA 2PE1A 5CF8A 2P2HA 2VX3A 4IX5A 4JG8A 3C0HA 4CFWA 4FL3A 4N4SA 4FX3A 4DEGA 4KSPA 5LVLA 4DGLC 4EKLA 3CGFA 3FXZA 4A9SA 1JOWB 4YTHA 3WE4A 3ORZA 2XA4A 4DBNA 3ACKA 3TKUA 3E5AA 3GFEA 3S0OA 5FEEA 5FP5A 4ZLZA 3GCQA 4FZAB 4KKEA 4I5PA 4MBIA 3I0OA 3ZRMA 5EFQA 5HE1A 3CE3A 2KTYA 3NUYA 4HZRA 3RAKA 3E3BX 3WF6A 3IPHA 3OZ6A 4XG6A 4D4YA 4BWPA 3EFJA 4ACDA 4MXAA 2CDZA 3BE9A 2W06A 1QPDA 3I5NA 4BDHA 3DGKA 3QUEA 3M1SA 5DLSA 1L8TA 3GB2A 4I5CA 4UWCA 3U6JA 4MH7A 5L2TA 2J90A 2YZAA 2YLEA 2RG5A 1GZOA 1ZYDA 4CRLA 1BX6A 1Z5MA 4JNWA 3SXFA 3AT2A 5KMIA 5GINE 5A4LA 3HV7A 2XNPA 1X8BA 3OEFX 2W96B 3ORNA 4I22A 3UO4A 4MNEA 4U80A 3P0MA 4IWDA 4AA5A 2V7AA 2FVDA 5EKNA 1KV1A 1WMKA 4W4XA 3UC4A 3C5UA 3HA6A 4OT6A 3BYSA 3R2BA 2BDWA 4QMUA 4C2VA 5HLWA 4B9DA 3OF0A 5C8KA 4G17A 3H9OA 1LEWA 4KIKA 2ONLA 5AV3A 4OAVB 4TNDA 4Y5HA 2PVFA 3MVJA 1PYXA 4PTGA 4U5JA 5FM2A 3UYSA 4MQ1A 2OIBA 3CCNA 4QMQA 2FB8A 2C47A 4H36A 3P7AA 4XHKB 1NXKA 3ROYA 2P3GX 2PK9A 2W4KA 4QD6A 4FNYA 4G3CA 4LRKA 3W1FA 4C4EA 4W8EA 2GFSA 4ZTQA 5L6OA 4QOXA 2OZOA 3SW4A 4TTHB 3UIUA 3A7GA 5B7VA 4GEOA 1Q3DA 1XH5A 3PPKA 4R1YA 3TDVA 3AC2A 5EHYA 4PX6A 2B55A 3ZH8A 4IDTA 4O0TA 2PUUA 3OWPA 3OT8A 4MQ2A 3F5GA 4Q9SA 5IQHA 4KA3A 2P2IA 2H96A 5AP0A 4XUFA 3UG1A 2JDSA 4EOKA 4WO5A 4YMJA 3UOJA 4IMYA 4G16A 3TCPA 4W8DA 4D9UA 1SVEA 2Y4IC 4O81A 4IVCA 3ETAA 3KXNA 4XEYA 4K6ZA 5CZIA 3IK3A 3Q9YA 5HI2A 4BYIA 4XBRA 2W5BA 3LLTA 3MBLA 4Q9ZA 2QOFA 4LL5A 3QRUA 2X7FA 3R9DA 1FMOE 2JDRA 3D9VA 1ZYCA 4OTRA 2ZM3A 4BI0A 2ACXA 4Z3VA 4EOSA 4EOJA 4PP9A 4K77A 3ANQA 4NKSA 2PUPA 1OITA 5I0BA 1RE8A 4WSYA 4Y83A 5CVGA 2V22A 4ZTHA 4WBOA 4F1MA 1H1WA 3R7EA 1OKZA 2XK6A 4X3FB 3TJDA 4ZLOA 4O86A 2UZDA 1SMHA 3SV0A 5JZNA 1VYZA 4MD8E 3GU6A 5HU9A 5AFVA 3BBTB 3RGFA 3QD0A 3ROCA 4DFNA 2O0UA 2WU6A 2X7OA 1OKWA 3HNGA 2DQ7X 1NVSA 3D5UA 1PW2A 3L9PA 4R5YA 1M7QA 1ERKA 4BB4A 1H0WA 4FT3A 3RCDA 1H0VA 5I9ZA 3A4PA 3COKA 2CJMA 2X0GA 2F4JA 3BEAA 3UE4A 3VS5A 4CG9A 4V0GB 3PSBA 4G2FA 3ZYAA 3P1AA 1FGKA 2QO9A 2WB8A 4IZ5A 4KAOA 4EOQA 4USDA 4EZ5A 3ID6C 4GYIA 5FP6A 1P4FA 3MGYA 3VBYA 1OL2A 3C51A 3R8MA 4I4EA 2GNFA 4NL0A 4ORKA 4R7BA 1PMVA 2H8HA 4FSRA 3HV4A 4D55A 3ZO2A 4AN2A 4DGNA 4RPVA 1G3NA 4AA4A 3SG8A 3QQLA 4HPTE 3FZPA 1ZMUA 3BGQA 4FT0A 4I0SA 4IANA 4O0UA 4AA0A 4FTAA 4A4OA 4KKHA 4EH6A 2QHNA 1YI3A 4OTIA 3UIMA 1PMUA 4F9CA 3BU5A 2E9VA 3DS6A 4J53A 2R0IA 2PVJA 3REPA 2QONA 5LVOA 1L3RE 2P0CA 3O96A 3PXQA 3DFCB 3DDQA 4C7TA 4F0IA 4ERWA 3QCSA 2QHMA 3PIXA 5DMZA 4QMNA 2HWPA 2XBJA 4L7FA 4NYEA 5AUZA 4QQTA 2NRYA 3NCGA 4GUEA 4BFMA 3IOKA 4BCMA 3ZMMA 3FL4A 1JWHA 4BDCA 1CKJA 3R8PA 3LW0A 3KEXA 4MXZA 5FDXA 3UBDA 4FUXA 1NW1A 1LR4A 4W9WA 3HP2A 3UP7A 3Q9ZA 4ZZMA 4BHZA 4M66A 2UW9A 5K4IA 5IQDA 4RFZA 3OROA 5DHJA 2OO8X 5E92A 5J9ZA 4HOKA 4C4HA 5M09A 4C34A 3JPVA 5GJGA 2YDIA 1IRKA 1CM8A 1KSWA 4M13A 3KRWA 4PL4A 2BAQA 2VTPA 3LFDA 2W1EA 4IHPA 4D4VA 1Z57A 4CKJA 3NVMB 2WAJA 5J5SA 2QD9A 3R71A 5HNGA 3NYNA 5FWKK 4OGRA 2Q0BA 3VRZA 3LMGA 4BDKA 4HVSA 3R21A 3W10A 3FMMA 2V5QA 2I6LA 4GL9A 4FTJA 4OBQA 4E6CA 3DKCA 4IM0A 1A9UA 2OZAA 3BV2A 5T68A 4YO4A 3TG1A 3IO7A 2IZTA 3VNTA 2QOOA 2J4ZA 3DLSA 3A7HA 1WBTA 3ZBXA 2PYWA 4I1ZA 3OBGA 3G51A 5CX9A 5CEQA 2VTOA 5I3RA 1MQ4A 4M8TA 4Y95A 4ALVA 3PPZA 3F7ZA 1ATPE 2YIWA 2OICA 2YACA 4N6ZA 4BC6A 1FVTA 4OTFA 4I6BA 4DEIA 3UQFA 4D4SA 5E8ZA 4HVGA 3KXGA 4QMZA 4AWIA 3O8UA 3JYAA 5AV2A 4C38A 2XKEA 4M0YA 4FSNA 5M4IA 1CKPA 4QTCA 4CFVA 3OXIA 4YR8A 4CQGA 3UMWA 3VAPA 2QOHA 4BWKA 3W18A 5JFVA 2QKRA 4DN5A 2VTMA 2PPQA 4HPUE 2O64A 2QOKA 4NM0A 4EL9A 2Y6MA 3DCVA 2ETMA 3MN3A 5D10A 2PVYA 2OGVA 4GJ3A 3FMLA 4O22A 5C01A 3S95A 3FXWA 1YHSA 4CKRA 4C36A 3HV6A 4FTRA 5HEZA 1M52A 3U8WA 1YI6A 2YCQA 3PTGA 5M51A 4FBXA 4BICA 3VUKA 4C3RA 3KMUA 3VN9A 4C4JA 2B52A 4RWIA 4BIBA 3EN6A 2CMWA 4DEDA 4USEA 2GQGA 2OJGA 4NIFB 5HTBA 2ZM4A 3C9WA 1Y6AA 4JAJA 4D4RA 1MRYA 4P4CA 1BYGA 5IH4A 2YWVA 3U6IA 2JAVA 4ANBA 2Z7QA 4FNZA 4FTKA 2F9GA 4FTIA 2A4LA 2B4SB 5K4JA 4PL3A 2PULA 5HBJA 2BAKA 2UZEA 2YIYA 1Q4LA 4WRSA 5ANJA 5BMSA 5M08A 4CFUA 5B2KA 3QTRA 5HG5A 4BGGA 1Y8GA 1GZNA 3BIZA 3MH1A 5HIDA 5EHOA 4YJUA 5JGAA 1YXXA 3U4UA 1IR3A 3WBLA 4J98A 3F6XA 5AP4A 4BCHA 2WELA 3SX9A 3VUDA 4A4XA 3R7VA 1B39A 3LCDA 1Q8ZA 5HE3A 4XV2A 2WQEA 4C62A 3UQCA 4RZVA 4P90A 4FZ7A 5KO1A 3KFAA 4IC7A 2XB7A 3KXMA 5B0XA 4KUJA 4IX6A 2A19B 4RIOA 1OKVA 5HLPA 4NW5A 3ZSGA 3Q6UA 3II5A 5IA3A 4II5A 4RA5A 2R3QA 2ZDTA 3MI9A 3IDCA 5I9YA 2CKOA 3BKBA 4CYIA 3RINA 2WTIA 4S32A 3C4XA 3MW1A 3ODZX 4LGGA 4O0SA 3EQBA 3GXLA 3BV3A 2ITWA 2FYSA 3KK8A 4GG7A 3ULIA 4C8BA 5CT7A 2FUMA 4GT5A 3SOAA 3U55A 1JNKA 2W9ZB 4QP1A 5CTPA 1H8FA 5KUPA 2GTNA 2C6OA 2PVKA 2YM4A 3ENHA 3KGAA 2Y9QA 5DEYA 2PZ5A 4F6WA 3O7LD 2I0HA 5E1SA 2R5TA 3E7VA 2BUJA 4G34A 4PY1A 5EI2A 1H27A 4ZEGA 1JPAA 3KULA 5F95A 2ZMDA 5F94A 4CEGA 5J1VA 2BTRA 3SRVA 4PV0A 4N0SA 4JRNA 1R0PA 3NAYA 2XNNA 5HHWA 2JLDA 4GH2A 4B0GA 4FNWA 4PNIA 4DHFA 2C4GA 5BVFA 1XH7A 4JBVA 2VWVA 4G31A 4ZSEA 4B6LA 4GW8A 3FDNA 2RIOA 2PUIA 3O50A 4M97A 4U3YA 3SKCA 3R01A 5KMJA 3OWJA 3EN4A 3GU4A 1Q99A 5H9BA 5HCZA 2W1ZA 4EORA 2WOUA 2YERA 4PL5A 4DINA 5KHWA 5HLNA 5DVRA 3KRLA 4QTEA 4BVUA 5CSWA 2XF0A 3U54A 3FZSA 4KABA 1YHVA 4O7LA 4F63A 2GFCA 4DFLA 2I1MA 4M12A 2DWBA 1WBNA 2X7GA 3ZEPA 2QG5A 5TE0A 3BX5A 3R28A 3BLRA 3SXRA 3QQKA 4MXXA 2WQOA 3FZ1A 3E92A 3U6HA 2F7ZE 3CP9A 3HECA 2R3JA 2QU6A 2BHHA 1RDQE 2H9VA 4DEEA 1DI9A 2UV2A 5CEKA 3F5UA 4RVLA 4PPBA 3UDBA 1UU3A 4X2JA 4JT3A 4QRCA 5GNKA 4DLJA 3MJ1A 5DA3A 2AUHA 2CGUA 1ZARA 3Q4TA 2OSCA 1GIIA 5AV4A 5IA2A 4FV0A 2B9HA 4ZMFA 5K3YA 4FIFA 3P7BA 4TT7A 3UIXA 4RIYA 5AM7A 1YXUA 4E4MA 2PZYA 2QKWB 3KRRA 4RX9A 4LM5A 3R9RA 1VJYA 2B54A 2ITTA 2Y4IB 2FSTX 4QTBA 4O2ZA 5HG8A 5C26A 1S9JA 2RFNA 4CMUA 4G6OA 4FG9A 2IPXA 4BI2A 2JIIA 1W98A 3DDPA 4NH1A 3FMDA 3GC7A 3A4OX 3N9XA 4RIWB 3ZU7A 4PMPA 4UV0A 1YDTE 4B7TA 2BZKB 2YLFA 4U40A 3VS0A 4O82A 2A0CX 4FV6A 2JBOA 3MFSA 1Y6BA 5A6OA 2NNWB 2WMVA 2P33A 4FSYA 1BI7A 2VTNA 3RHKA 4F09A 5M55A 5FTGA 3NMUF 3F3ZA 4CT2A 3CTQA 3UODA 2FA2A 4AF3A 5EM7A 3FQSA 5KMKA 2R3PA 4GYGA 5K5NA 3B8RA 2XH5A 3E8DA 5AAGA 3I6UA 2G2HA 3L8XA 5IEVA 4NWMA 2RGPA 2W1CA 5AR3A 4ANSA 3JXWA 3VUGA 4LMUA 4G5PA 4IIRA 3P23A 4PRJA 1ZMWA 2W05A 3GCSA 2QLQA 5CS6A 3R2YA 3QHRA 5IPJA 3HGKA 3QZFA 3FPQA 3RM6A 3HUCA 3TTIA 3QYWA 4TYHB 4Y85A 3C0GA 4X3FC 4O0YA 4RC2A 2XK4A 4V05A 4PDOA 1Q61A 4X3JA 2PVNA 5IQGA 4XLVA 1KE5A 2OFUA 3V6SA 3PRIA 4BHNA 2GHLA 4FG7A 4U7ZA 5HD4A 3KRXA 3H30A 5J8IA 4UZHA 3GU8A 2GDOA 3FI4A 3PJ1A 5K0XA 2OZAB 3B2WA 4PP7A 3F3VA 3RNYA 3VQUA 2P4IA 4ENYA 3R30A 5AA8A 4AOIA 2X8IA 2R64A 3CXWA 5FXSA 4AX8A 2W5HA 1J1BA 3ZFMA 3MH2A 1FOTA 1PXLA 2ITZA 2UVXA 4H39A 2FSLX 3GC0A 5HG9A 4YJTA 1YKRA 3OC1A 4IJPA 3ZXTA 5L6PA 2KULA 4O1OA 3KF7A 3KN6A 5FBNC 4RFYA 3NPCA 4QMPA 3RP9A 4AFJA 1NT2A 3TIYA 4FT9A 2XIZA 2BIYA 2J0JA 4X3FA 5HGIA 3RMFA 4X6RA 1ZZLA 2OIDA 2BRBA 3HA8A 4E73A 2DUVA 1YHWA 2XK7A 4I3ZA 4LRJA 3TNPC 3TV7A 4APCA 4FVPA 4JOAA 2PU8A 4TYGA 4WBBB 2IWIA 3CD8A 3DZOA 3B8QA 4AT5A 4ACHA 3I60A 4FSUA 4FIEA 4V0GA 5F4NA 3CEKA 3G0EA 4YZNA 3Q5IA 4CNHA 2CPKE 2XNOA 4XG8A 4ZS4A 5KBQA 3FLSA 2XIRA 4O7ZA 5JH6A 2PMOX 3CY3A 4DG0E 3W2QA 5CZHA 1BL7A 4EYJA 4RC3A 3PDTA 4YZ9A 4FKLA 2CLXA 5ACBC 2PUNA 4ACGA 1XH4A 3LE6A 3W33A 3QX2A 4D2RA 2X1NA 3FMEA 5AUTA 3V8SA 3BBWA 1IASA 3NGAA 4FVQA 1HCKA 4FV7A 4IM3A 2X8EA 4PDPA 5FTQA 1J7LA 2R4BA 4CZUA 3THBA 4L6QA 3TJCA 4IZAA 3UOLA 3ORPA 2A27A 4ZSAA 4IBMA 1AQ1A 4EQCA 2R2PA 4DEHA 3QWKA 4IC8A 3UZRA 5M07A 4C4IA 2PMIA 3QQFA 4F4PA 4TYEA 4Y5QA 5AR7A 3R8LA 4UMQA 3ITZA 2VNWA 3NNUA 3G6HA 5E91A 3CQEA 4O0VA 4FKRA 5E8XA 3E8CA 1H1QA 2LGCA 2C0IA 4CKIA 4ZK5A 4D2SA 5HORA 4U81A 5AP5A 2QC6A 4FV4A 4KB8A 4M7IA 5IQCA 2JBPA 1J7UA 4FK6A 5FG8A 4AS0A 4AE6A 3QTIA 4D1ZA 4EUTA 4CVAA 3EYGA 5LVMA 1LEZA 3WZUA 3H9RA 2CGWA 3RAWA 1YRPA 4PMTA 4ALWA 4EOIA 3D7TA 3C4ZA 3RZBA 4AT4A 3KN5A 4C4GA 1BL6A 2UW0A 2XJ1A 1XKKA 4XRLA 4QP4A 4WRGA 3RAHA 3IOPA 4QMTA 4X6QC 3ZO1A 1O9UA 3L8VA 4JVGA 4L46A 3WF5A 4TN6A 4H3PA 1K2PA 5FXQA 5AEPA 2YM8A 4OBOA 4ANLA 5HU3A 3UPXA 3MFUA 5J7HA 1VEBA 4TRLA 4AP7A 3DU8A 4O21A 3F88A 4HVHA 3NNWA 1YOLA 1I44A 1STCE 5T3QA 2C3LA 2RL5A 5CF6A 4FIJA 3EWHA 3QRIA 3FQEA 3LFNA 4FKIA 4IM2A 1OUKA 2JFLA 3KVWA 4O6EA 1CSNA 5AV1A 5C4LA 4HGTA 3NAXA 3R7YA 5H8GA 3K5VA 4WA9A 3MIYA 5AUXA 2ZMCA 5BVKA 3TZ9A 3K3IA 4D1SA 2XKFA 3A7FA 5I9VA 4LMNA 5I4NA 4I94A 3U4WA 3ZCLA 2ITNA 2R9SA 3NUAA 2C0OA 3PSCA 2NPQA 2QURA 2BPMA 4ANNA 5CANA 4E5BA 4PDYA 1AD5A 2FGIA 2EXMA 3QQJA 5DGZA 3ENMA 2VUWA 3VJOA 3UQGA 3D0EA 4CFMA 3AOXA 4YZBA 2Y4PA 1Q41A 3DNDA 1W0XC 4F9AA 3U9NA 4XLIA 4WNOA 1XH9A 3NUNA 3H3CA 5I9WA 4I0TA 2GS2A 4HVDA 2Q0NA 1PXNA 1EH4A 4YJOA 2PVLA 3PLAE 4PUZA 1M2QA 2ZDUA 5AX3A 3AD4A 2WIPA 4L00A 5LWNA 3N51A 2PY3A 3OEZA 4AFEA 5BUJA 5L4QA 5JSMA 4CT1A 3V5LA 2YM3A 3NS9A 4L01A 1OL5A 4NIFA 5F1ZA 3OOGA 3OTVA 5CLPA 1KWPA 4OTHA 5HO7A 4DH5A 5DH3A 4HJOA 2DYLA 2XK9A 5E7RA 2BALA 2PL0A 2PZPA 3LFSA 4RIYB 3UG2A 4WG3A 4CSVA 3VS3A 4D5HA 3GCUA 4D1XA 5IQBA 3ZEWA 3QC9A 4E20A 3NX8A 2GTMA 4V01A 4OT5A 1PHKA 3L9MA 4IH8A 4XS2A 4I92A 5DT3A 3W2OA 5TOZA 1E9HA 1Q24A 3LZBA 4PMMA 4YZDA 1U59A 2EU9A 3U9CA 4UBAA 3FEGA 1V0PA 2ZV2A 4GVAA 3A7JA 3MESA 2UW8A 3CLYA 2E9OA 5AUYA 2CN8A 1I09A 4D0XA 5J79A 5A54A 3DAKA 3QCYA 2Q83A 3CPBA 4YPSA 5ETFA 4BDIA 3IG7A 2XCKA 4HYSA 3COHA 4S31A 3PE1A 4YNOA 1FBNA 3HV5A 4FL2A 4O38A 3R83A 3GC8A 4A9YA 3A2CA 5FEDA 3EZRA 2UW7A 4JQ7A 4B99A 1P4OA 2IVSA 1U4DA 2C5VA 2J51A 4WOVA 4BRXA 3EQPA 5IUGA 3ZC5A 2WMQA 4IB0A 3OT3A 2HCKA 4FYOA 1LP4A 1NVQA 2E9NA 2ZYBA 2UZVA 5KNJA 4JAIA 4FGRA 3KCKA 1UKHA 2RSVA 2W4JA 3W2PA 4ACMA 5BVOA 4F6SA 2BRMA 3D15A 2J0KA 3PP1A 2EXCX 3FSKA 4CCBA 2GHMA 2VV9A 2UW3A 3QZHA 4C61A 1TKIA 2IVTA 2UZNA 4JR7A 4MCVA 5CU3A 1GIHA 2BDJA 2J9MA 4QQCA 5M06A 4EUUA 4NJ3A 4TWCA 1ZXEA 2J50A 1H1RA 3MVHA 5CEIA 3TNQB 4E4LA 4H05A 2UW6A 3F2NA 3O23A 4EEVA 2QU5A 4M68A 2C6LA 3RVGA 1H00A 3BEGA 3FV8A 5G1XA 2QOQA 1W82A 2FO0A 4E7WA 3ET7A 4J7BA 3ELJA 3ALNA 3I81A 2BZIB 4YSMA 3S4QA 4A9UA 3Q2MA 5FRIA 2UZWE 3D83A 3V5WA 4IE9A 2VTAA 2HY81 4GIIA 4NSTA 1J91A 5L2IA 4LYNA 1LUFA 2OKRA 2YM5A 3PYYA 2YIXA 2RFDA 3Q32A 4RQKA 5KZ0A 4GT4A 1OL1A 2GS6A 5IUHA 3LCSA 3QUDA 3RM7A 3QTXA 2ZVAA 2BROA 4CD0A 4PF4A 5FQDC 2IN6A 3NVKI 4OTDA 5BYZA 3RPVA 4CTCA 5IDNA 3OCTA 3VF8A 4YJSA 1PF8A 1UV5A 4UMPA 4CG8A 2REIA 2XM8A 2R3LA 5E8VA 1UU8A 4I0RA 4P5QA 4FKSA 4RVKA 5HBHA 3QZGA 4NUSA 3AGLA 5JN2A 3SG9A 4LV8A 4ZJVA 1ZY4A 5EH0A 4BBEA 2BCJA 1UNHA 2OIQA 3HV3A 4RWLA 4KSQA 4YC3A 4P2KA 4EK6A 2WMRA 3LCKA 5IDPA 5EDQA 2C30A 5HNBA 3UC3A 3M42A 3PG3A 4K18A 4BCKA 3HMIA 3D5WA 4JXFA 3W16A 5EYMA 4YTCA 4X2KA 3O7LB 4QO9A 5IMXA 4PNKA 1IA9A 3GCPA 3LIJA 4L52A 3MTLA 5E8SA 4I5MA 4YJPA 1JKTA 1Q97A 2HZNA 2HW6A 2R7BA 3A62A 2VU3A 4R1VA 3TL8A 5IQEA 3EFLA 5CU0A 3EKNA 3ZLWA 5BQ0A 4QTDA 4RT7A 3ZC6A 4EOLA 2YHVA 4RLKA 1UNGA 3CQWA 1YVJA 3CTJA 2OU7A 2VWZA 3GP0A 4IWQA 3LXPA 5TF9A 4AT3A 2EVAA 4XG7A 3MSSA 3FSFA 2VO7A 3GOKA 4GU9A 3PIZA 3O0GA 4UB7A 1PJKA 5HTIA 2OBJA 4RIWA 5EDRA 3QCXA 2OH0E 4I21A 1PY5A 3AXWA 2PE2A 3L8SA 5FTOA 1GJOA 2J5FA 3D5XA 2WMTA 5HVKA 1NVRA 1QMZA 3PVWA 3F3TA 4S33A 4IVDA 2C1BA 2BKZA 4WG5A 3ZOSA 2WEIA 4JQEA 2XEYA 5IQFA 3EFWA 1XBBA 4J8NA 2NP8A 1IEPA 4MXYA 4DH7A 2BIKB 4NM5A 4XG4A 3ORMA 4YO6A 3PRFA 5DPVA 3LQ8A 2YFXA 2H34A 3NUPA 3OUKA 3PWYA 3PZHA 3QTUA 4FSMA 3PA4A 5TR6A 2OJIA 4HCTA 2YWPA 4AW0A 3G0FA 2IVVA 1OUYA 3LJ2A 2QCSA 3O8TA 4TYHA 4C3PA 3PA3A 4DCEA 4QQ5A 5CF5A 3KC3A 4JIAA 4MTAA 4FEXA 3MFRA 1YDRE 2VX0A 4CLJA 1XH8A 4S34A 4PQNA 3KMMA 3D7TB 3TWJA 4CZTA 4ITHA 3MIAA 5JFWA 5CSXA 3AMAA 1WBSA 1XH6A 3SLSA 2ERZE 1JLUE 3VVHA 3F61A 4FR4A 4L7SA 4LI5A 1WBPA 3HRCA 4EHZA 5CU6A 2BRHA 4U8ZA 3P79A 3DKFA 3PVBA 4W4WA 3F82A 4RGJA 5D9HA 5AUUA 2QO2A 2WTWA 1JKSA 4EOOA 3PE2A 4XV3A 3QRTA 4OTQA 3ERKA 4YGAA 4E6DA 4AE9A 4UALA 1P2AA 4EONA 2VTLA 3A8XA 3HMPA 4IAYA 3MH0A 4IAIA 5IA0A 1CTPE 1XBCA 2JDOA 3VRYA 4PPAA 3FKOA 4QPAA 3DZQA 4NEUA 3K3JA 1E1XA 3W2RA 1H28A 3HEGA 4EWQA 5BVDA 5IU2A 4MD9E 2FH9A 4U0IA 3B2TA 2YCRA 2YM6A 2BVAA 4RX5A 4QP3A 5EI6A 3HVCA 3VULA 2R0UA 4YU2A 2BR1A 4QYYA 4KINA 1U5QA 4RJ3A 3BCEA 4J96A 3BLQA 3P9JA 4MWIA 3BE2A 3TM0A 3DJ6A 2HW7A 4TNBA 4ZAUA 4DT9A 3EQDA 4BL1A 3FHIA 4KD1A 3SHEA 4FV8A 2OW3A 5LVNA 4D9TA 3UVPA 5KZIA 2UZBA 4DTAA 2PHKA 3S3IA 4HNFA 2UW4A 3ZM9A 3EZVA 3KY2A 4R5SA 2J6MA 5TKDA 4ZJIA 4YUQA 1XO2B 5CEOA 5I5ZA 2CN5A 4FKPA 4IAAA 2W4OA 5CAPA 4TYIA 4M69A 3RZFA 3NYOA 4PMSA 3OCGA 5ICPA 4FEUA 4NM3A 5F20A 4FKOA 2ITYA 2ITUA 2VTIA 5IG1A 5HE2A 3QD3A 3MY5A 4KWPA 3S1HA 4UWBA 3Q5ZA 2OFVA 2R3OA 5BVNA 2CKQA 1KUTA 1B38A 1OVEA 2YIQA 4ZSGA 3T3VA 3CIKA 3PXRA 5ETCA 1H4LA 4HYUA 4YJQA 3NCZA 3F2AA 4ASZA 4FV9A 3QX4A 3V5TA 3ZO4A 5LXMA 2BDFA 2IO6A 2OJ9A 3ZRLA 3DAEA 3MS9A 4MBLA 3G90X 3QRJA 4NU1A 3BHYA 4N70A 1QL6A 2V55A 4W9XA 5E8YA 3ANRA 4FUYA 4F70A 5LMBA 3NSZA 4IB5A 3NIZA 2YM7A 4I5HA 4J99A 2C3IB 3CJFA 2JIUA 3TZ8A 5CEMA 4CMTA 3PXZA 4YJNA 4O91A 4BCPA 5HX6A 4F6UA 4AG8A 3UNKA 4DFUA 4QP7A 5HICA 2Z60A 2GNLA 4FSTA 2B1PA 4GUBA 3Q4ZA 3KCFA 1BI8A 3BHVA 3GNIB 5D7AA 2C5NA 4Y8DA 5ACKA 4QP6A 4QYHA 3DXNA 1WVYA 5AADA 1OPJA 4AXAA 4WT6A 5DI1A 2Z02A 4ALUA 5CNOA 1XR1A 2PVHA 5AMNA 3FE3A 4H1JA 3VBQA 3AC1A 2X2LA 3GOPA 5AP1A 3NUUA 4GVJA 4W4YA 5DOSA 1XBAA 5ANEA 4KRCA 4MKCA 5CQWA 5AAFA 2VWBA 4R3RA 2QQ7A 3CC6A 3RTPA 4QP9A 3DNEA 3I7CA 1V1KA 5L8JA 2CCHA 1PMNA 4IWPA 1V0OA 4EWHA 1G8SA 3VHEA 3SXSA 3ZFXA 4G3GA 5KMLA 5FM3A 4WNPA 4GJ2A 5IA5A 2R3RA 3R8ZA 3V3VA 4AW5A 3NLBA 4FKJA 5LCJA 4O7VA 5EQEA 5HCXA 3GU7A 5L2SA 2R3FA 2O5KA 4MYGA 5HX8A 5E1EA 1RQQA 3R8UA 3RWQA 3BWJA 3L8PA 1JQHA 5ANGA 3ATTA 1YDSE 3VS4A 3LQ3A 5TO8A 5JFXA 4RQVA 5AV0A 3ACJA 3UIBA 1F5QA 4BZOA 3QKMA 2EXEA 3NR9A 3NYVA 2WQNA 4JL9A 4EZ3A 4FMQA 4F64A 3UOHA 4DBXA 2BKKA 4QMWA 3P86A 3R22A 2YDKA 3R73A 3RPOA 2G9XA 3ZDIA 4E6QA 5JRQA 5LMKC 5HOAA 3F5PA 5CI6A 5M4UA 4I24A 4I6HA 5GJDA 5HIBA 3W8LA 3KL8A 3R9NA 3R7IA 3ZXZA 4Z7GA 3RALA 4RJ8A 3Q6WA 2OF4A 4O7WA 1UWJA 2QOBA 3VBWA 3QALE 2PVRA 4JS8A 5CSVA 5D1JA 3HZTA 1BLXA 2WZJA 5FEQA 3I7BA 4B8LA 4FYNA 2X9EA 4D2VA 5HE0A 5CT0A 4WKQA 2OG8A 2JAMA 2IVUA 2X8DA 4LUDA 1GAGA 2UZLA 1W84A 2Y7JA 3CS9A 3H0ZA 3MJ2A 3LJ0A 4FIIA 4QP8A 4E5WA 3ZLSA 3Q04A 4YBJA 1IA8A 3TKHA 3QRKA 2JD5A 4JIKA 4Y73A 5E8WA 4IDVA 4U79A 4UXLA 4YC6A 3HL7A 4GT3A 4KIQA 4IZYA 2QOLA 3PJ2A 4QMMA 4TWOA 4AZSA 3Q2JA 3LXKA 3FUPA 1P14A 5EKOA 2C69A 4G3DA 3TUDA 3NWWA 4XG3A 1YOMA 4HW7A 3BU6A 4NJDA 2B53A 5LMKA 3GFWA 3PSDA 3UJGA 3K54A 4K11A 4BDBA 5K9IA 1RJBA 2J0MB 3OTUA 5CAVA 5L3AA 2QG7A 3PUPA 3TIZA 4ZLYA 3FI8A 1T46A 4GK4A 4D2WA 2C6TA 2DS1A 3OUNB 4AZTA 1O6LA 3DPKA 4EH5A 5JK3A 2PZRA 5AR4A 3V8WA 4BCGA 2OH4A 2V7OA 3EN5A 4S30A 2GNHA 3ORKA 5EW3A 3OCBA 4H58A 2C6IA 3PPJA 4TY1A 4EC8A 3ZS5A 5KCVA 3BI6A 3D14A 4N6YA 3AMBA 5HESA 4QMXA 4BDFA 3C0IA 4F65A 3T9TA 3FY2A 4ANQA 4MWHA 4WSQA 4O7TA 5C1QB 2VWIA 4BGQA 5AP6A 3HX4A 5CXZA 5CU2A 2HZIA 3HMOA 3O71A 2EUFB 3UYTA 4ZP5A 3LPBA 3TTJA 4CMOA 5CAQA 4UY9A 4J1RA 5IH6A 3E62A 3FZTA 3MA3A 1OIYA 1YW2A 5E8TA 1UKIA 2G01A 4L43A 3DQXA 1OL6A 3HP5A 3PVUA 5C27A 4ZY6A 5I9UA 3H10A 5HKMA 2XIKA 3CD3A 1ND4A 1S9IA 4IWOA 3VW6A 4DAWA 2UVZA 3P08A 1XJDA 2G2FA 4XMOA 4UMRA 3BHHA 4L67A 4FK3A 3UOKA 5IA4A 3FLQA 4JDIA 3G2FA 5EW9A 3ZZWA 5GZAA 5JGDA 3ZONA 4LG4A 5EYKA 3FMNA 5CAOA 5C8MA 2JFMA 1M2PA 3CTHA 3IW7A 2BAJA 2IZUA 3MPTA 2PE0A 4RMZA 4C35A 4IAKA 3OP5A 5AUVA 3TI1A 3F3WA 3QYZA 1MRUA 2G1TA 3NIEA 4MAOA 2YISA 2WMAA 4DFBA 3QF9A 4H3QA 1DM2A 2XEZA 4I20A 4DG3E 4F7SA 5GZ8A 4M3QA 4HZSA 5H2UA 1REJA 1WZYA 3C7QA 2J0LA 4GU6A 4JBPA 5JQ5A 2UW5A 4E1ZA 4FC0A 2CCIA 3OXZA 4WUAA 4ZTSA 3VBXA 2UUEA 4ARKA 4BTKA 5M44A 3Q53A 4LGDA 3SW7A 4JQ8A 4YURA 2W1IA 3I5ZA 3OW3A 5EK7A 4TL0A 1YXSA 3QTQA 1VR2A 3QFVA 4GMYA 2VO0A 3D5VA 2AC3A 5CSPA 4FE2A 3EQGA 3IKAA 2JEDA 3BGZA 3CGOA 5E9EA 2G15A 2VWUA 3QQUA 4UXQA 3EYHA 3VHKA 4L3LA 3DTCA 4KIOA 1JKKA 3BELA 5EQPA 1J7IA 5AR8A 4YJVA 5AX9A 4AGUA 4YHFA 4BF2A 3MDYA 4LL0A 5LWMA 3KA0A 2IW8A 1FINA 4U41A 5BX0A 2HXQA 1E1VA 3DBDA 5ANOA 4M69B 1ZOHA 4ZTNA 5C03A 4K8AA 2R7IA 4WD5A 4ASXA 5FGKA 4KBKA 4Q2AA 3UVRA 4I93A 3W2SA 2A1AB 3E88A 3FLNC 2YN8A 3FBVA 4O7YA 4MEDA 2HYYA 3WI6A 4G5JA 4R77A 2ZV7A 5IUIA 1SVGA 4G6NA 2BHEA 5IKWA 1IAHA 4F1TA 4RSSA 4XJ0A 4DEBA 4P7EA 4IB1A 4JX7A 1M7NA 2BZHB 5ETAA 3NUSA 4EBWA 4IAZA 4OTPA 2GHGA 2W1GA 5EOBA 2WNTA 3DKGA 2WHBA 4Y72A 2BRNA 4GFOA 2OJFE 3W55A 4DGMA 2VO6A 4IW0A 2ZOQA 3OVVA 4XX9A 3MVMA 4K0YA 3H9FA 3RHXA 3HRBA 1MRVA 5E8UA 5HVYA 3ZO3A 3MPAA 4G3EA 1G8AA 2WO6A 3DV3A 4PTCA 4NKAA 3DBQA 5DEWA 5CSHA 3U87A 1ZAOA 2W1FA 3QTWA 2PWLA 3RBWA 4TW9A 5LOHA 2HZ4A 2OLCA 4PPCA 4U6RA 4YC8A 2LAVA 2X9FA 4LRMA 2Y8OA 3HMNA 4YTFA 1J1CA 4FZDB 4FKGA 2PTKA 2ZJWA 4QMOA 4TWPA 2XBAA 2OK1A 5LARA 4JR3A 2V0DA 2WQBA 4ZTMA
chains in the Genus database with same CATH superfamily
4FSZA 3RKBA 2HY0A 3NNXA 4KS7A 3LLAA 4EHGA 3NFGB 3MWUA 5DR6A 1LPUA 4EKKA 5A9UA 1KE8A 2WMUA 4GS6A 4AN9A 4DFYA 3MVLA 4GIHA 4IAFA 4XP3A 2YIRA 3RK5A 3ZLXA 2W0JA 3N4VA 3PJ3A 4XV1A 1R78A 3Q96A 3ZDUA 5EQYA 4GCJA 4C58A 1OKYA 3FMJA 2B9JA 1JBPE 2C3KA 3NW5A 5J95A 4M15A 3RI1A 3GI3A 1KOAA 2GQSA 5ITAA 2B9IA 3ATSA 3EFKA 4BWXA 3IDPA 3Q60A 3QTZA 4OLIA 3SA0A 4OAUC 3ZSHA 2O2UA 2VWXA 2JDTA 2QO7A 3LXNA 3EN7A 4BIEA 2WD1A 3QLGA 5FD2A 1R39A 4JX3A 3SDJA 2YA9A 4CV8A 3R1NA 3R6XA 2W17A 2AC5A 3F9NA 5BVWA 2ITXA 3S2PA 4E8AA 2X81A 1YXTA 3QHWA 5DR2A 4HYHA 4QYFA 3FLWA 3CKXA 3CR0A 4IQ6A 2WU7A 4CRSA 2HXLA 3ODYX 4J97A 5D12A 3FI2A 4F08A 4ZS0A 5JRSA 3QKKA 2J2IB 1OGUA 3DAJA 3MTFA 3PZEA 4YTIA 5DG5A 3MB7A 5CALA 4FSQA 4BCQA 1OPKA 3A61A 4MXOA 2XS0A 5EYDA 1Y8YA 1ZYSA 4OR5A 3LMIA 3WARA 4CLIA 5JMSA 5K5XA 3QL8A 2X6EA 4JDHA 1OB3A 2BRGA 2WEVA 3C4EA 3JY9A 1JSTA 3NRMA 4WUNA 2ITQA 4CFFA 3WIKA 2QR8A 5DR9A 2C5XA 2JKMA 2QR7A 4I4FA 2PMLX 3RK9A 4CYJA 4QT1A 2IZSA 2QODA 2XYUA 2CKEA 1DS5A 3ZHPC 2OWBA 4C3FA 5A4CA 4XP0A 3VUMA 4E4XA 1PXPA 2YJRA 3C5IA 5FBOA 4WG4A 3ZUUA 4Z9LA 3LFAA 3C4FA 4KBCA 3W32A 3AC4A 2XNMA 3P78A 1KE9A 5HO6A 3BHTA 3S00A 4NTTA 4FT7A 4ITIA 3R1SA 4GRBA 4BBFA 1H25A 5M4FA 4IX4A 4DFXE 1UU9A 3QXPA 3E93A 2BMCA 1FQ1B 4MK0A 3DLZA 1BKXA 4UX9A 5KMOA 1W7HA 3PXYA 3ZBFA 4RFMA 3SQQA 4ZMEA 4AACA 3DBFA 4IVAA 3V01A 1OIRA 2YAAA 2XYNA 5FLFA 3WZEA 4YP8A 1ZYJA 3AKJA 4IZ7A 4FG8A 4O7RA 5AAEA 2R3GA 2XVDA 4B4LA 4YSJA 2RF9A 3FZRA 3VF9A 4BZNA 3F5XA 2WOTA 4WHZA 4AXCA 4FV3A 3AC3A 3DA6A 5HG7A 4O4DA 2GNGA 2QLUA 3DTWA 4F0GA 5IH5A 5M4CA 4R6VA 4R7IA 2ONLC 4G3FA 4FEVA 2WTKB 4FEQA 5JEBA 2F2UA 4MF0A 2C1AA 2PZIA 2O8YA 4EK5A 4X2NA 4Q5EA 3DK7A 3O5AA 3AD6A 3EH9A 2AEGA 4EQUA 5AUWA 2CNQA 2ETRA 4FA2A 3TMOA 4EBVA 1K3AA 2I40A 3LAUA 1OECA 3FHRA 3Q4UA 4ZIMA 5BV3A 3GCVA 2I0VA 2YAKA 3E8NA 4O1PA 5EG3A 4FRFA 3JR1A 3DBEA 4L44A 4AAYA 2UZUE 4PWNA 1FPUA 1OM1A 3AT4A 3FYKX 3R8VA 3ULZA 4GKIA 5TT7A 3KXXA 3ALOA 4NK9A 3LFBA 4L42A 4RIXA 5FDPA 3SOCA 4XG9A 4BZDA 4FV5A 1U54B 3UDZA 3QA8A 3BPRA 1YOJA 3WYYA 3OFMA 4AAAA 2W99B 1W83A 1PXJA 4YLJA 1OBGA 4L9IA 4C33A 5DYJA 5EM5A 4E3CA 3E3PA 2XIXA 3GQIA 3JVSA 3PA5A 3PLSA 2BZJA 5ETIA 2VGPA 3WYXA 4BGHA 5JKGA 1DAYA 1WBOA 3JS2A 3QWJA 3EKKA 4FVRA 4IX3A 4J95A 2I0YA 4QPMA 5LMAA 2OI4X 3LQ5A 4A4LA 4EK8A 5CEPA 2Z2WA 4CXAA 2CKPA 2VTRA 4K9YA 3ZRKA 2XP2A 3VONA 3QBNA 2GNIA 4FTOA 2W9FB 4KKGA 5CF4A 4F7NA 3IDBA 2R3HA 3E63A 2XJ2A 4LOPA 2VTHA 3CJGA 3SC1A 2OJJA 1PKGA 4JDJA 3NW6A 3LCOA 3TXOA 1URWA 4CZYB 2YDJA 2HENA 4FZFB 2C5YA 5EYCA 3LM5A 4U45A 5CNNA 3WF8A 3V5JA 2XRUA 1A06A 2CNVA 1YQJA 4GG5A 4O96A 2IZRA 2ZM1A 3COMA 4I41A 4IJ9A 2SRCA 3SAYA 3VS7A 3G9LX 1JSUA 2EB3A 2JKQA 3OWKA 4QMLA 3UMXA 4FICA 4M14A 4RX7A 2B9FA 3WZKA 3DKOA 4O83A 3L9NA 3BRBA 5BPYA 3PIYA 4C57A 2GPHA 3Q9WA 3BYMA 4XRJA 3IQ7A 4OTGA 2UZOA 3UVQA 4AGCA 1SZMA 4F9YA 3AT3A 4WNKA 3CY2A 4QP2A 4EI4A 3HAVA 1H1PA 4IXPA 3GC9A 3MA6A 3GT8A 3ZLYA 3ZZEA 4L53A 1RW8A 5DWRA 5EDPA 5ANIA 5HZNA 3MV5A 3ZUTA 4LV5A 2WFYA 2A98A 3Q4CA 2QOCA 4AW2A 1Q8UA 4TXCA 2X2MA 2HK5A 3LFQA 2XK3A 4MNFA 5I3OA 3MFTA 3QC4A 5FUTA 3TDWA 1J3HA 3HUBA 1NA7A 4FOCA 2XMYA 3EQRA 3FWQA 5DIAA 4RZWA 3DQWA 4FKQA 1Q62A 5C8NA 3DY7A 5DNRA 5DFPA 2XM9A 1REKA 4XP2A 3PP0A 2X4FA 4BCJA 2C6EA 2Y6OA 4D28A 4RBLA 3LHJA 4DGGA 4D2PA 1SNUA 3MY0A 5AIRA 5AP7A 4ZTRA 2EB2A 4F7LA 2RKUA 2VRXA 2ITOA 1OZ1A 2HELA 1CDKA 3IGOA 4K2RA 4UYNA 5DBXA 5HNIX 3FPMA 5G6VA 4XH6A 3PFYA 2I0EA 3MH3A 4I23A 3V5QA 2XKDA 4L45A 2O63A 3RPSA 4BCOA 4FTQA 3JY0A 4DFZE 5HQ0A 2RFEA 2QI8A 3TT0A 2CGVA 4XYFA 2CHLA 3O2MA 3TV6A 1OBDA 4A9RA 5CU4A 5A3XA 4EH8A 3TEIA 5EM8A 4D0WA 3RJCA 2NRUA 4ID7A 3OMVA 5KKRB 4ITJA 5A6NA 4H1MA 1OL7A 4NT4A 4X2FA 1UWHA 3PFQA 3FI3A 1OI9A 3C4WA 3QXOA 3G6GA 2X2KA 4M67A 4D58A 2RFSA 3KKVA 3VC4A 5JGBA 4L3JA 4HGLA 4O0RA 3TACA 1H1SA 3T3UA 4BI1A 4BY9E 3N4TA 2OXDA 3TNWA 3F66A 5DN3A 4X0MA 4ZY4A 4DDIA 3GBZA 4JBQA 5KBRA 4F9BA 2HOGA 4I6FA 4HCUA 1CMKE 3R04A 4UMTA 5AP2A 4APPA 2F2CB 4O7SA 3O51A 2OF2A 5M53A 4FTLA 3HLLA 5HVJA 1QPEA 3NEWA 2WMXA 3AD5A 3IONA 3QQGA 4R8QA 3NUXA 4FF8A 4KNBA 2OXYA 3GQLA 4BKZA 5DT0A 2R3IA 4ZY5A 2YABA 5CWZA 3G33A 3QD2B 4QYGA 2G2IA 2C3JA 4BJJA 4XOYA 3UNZA 2Y0AA 3QD4A 5J1WA 1GOLA 4LV7A 5HD7A 4KRDA 2WGJA 1Y57A 4NCTC 4EJ7A 3FKLA 4L8MA 4EK3A 4BYJA 4IFGA 4BCNA 3P5KA 1JSVA 2UZTA 2Z7LA 4MBJA 3F2RA 4AW1A 3NFFB 3WZJA 2XNGA 5LCKA 4GKHA 3QKLA 4AOTA 1GZ8A 4AZFA 4JDKA 1SM2A 3R7OA 1MUOA 5BMMA 5KX8A 2E9PA 4O84A 3MB6A 4JBOA 4RLLA 4MF1A 4ERKA 4FEWA 3DK6A 2F7XE 4H3BA 2I7QA 4FTMA 3FY0A 2YZLA 3BGPA 1O6KA 4Z7HA 1XHAA 1H08A 3R63A 2WTVA 3OG7A 3TZ7A 2ERKA 4FV1A 3C50A 4V04A 4X21A 3O17A 4F99A 3IECA 1GNGA 5HIEA 3VWAA 2JGZA 5A4TA 2GNJA 2WMWA 3VQHA 1M17A 2YITA 1PXKA 3C1XA 5IQIA 3LVPA 3AC8A 3VS6A 3I1AA 5AR2A 3TKIA 4KIPA 1Q5KA 2F7EE 4QMYA 3F3UA 4Q5HA 3TNHA 3R00A 4EHEA 4EH7A 5D7VA 1TQMA 2VO3A 4O4FA 4LFIA 4NCTA 4C02A 5BUIA 5GIOE 4YPDA 3BYVA 3I79A 4BDAA 2VWYA 1ZWSA 1G5SA 4UMUA 4LQMA 3DFAA 5L6WL 3LFFA 1YI4A 4DLIA 1FMKA 4P5ZA 5A14A 5BUEA 3PG1A 4B8MA 4MX9A 3M2WA 4UEUA 4C0TA 3V04A 3OY3A 4ENXA 2XUUA 2W1HA 4IVBA 2VTJA 3QQHA 4MD7E 3IW6A 3NNVA 4BKYA 4FODA 4U42A 5L8LA 5CENA 1ZY5A 3HAMA 3W0OA 2IG7A 5F9EA 4BR3A 2IJMA 1PRYA 1BMKA 3CPCA 3EJ1A 5M57A 4DH3A 1U5RA 2VTSA 3HKOA 2J5EA 5DRDA 2JITA 3UZTA 4MVFA 4EH9A 4QQJA 1FVVA 2ITVA 3FLYA 4G6LA 1Y91A 3N4UA 4QDEA 5D41A 2R3MA 4FKTA 3IS5A 4FTUA 3R9HA 2XCHA 3OS3A 4YZMA 1V0BA 3V8TA 5AR5A 5IISA 5KMMA 3AKKA 5GJFA 3FC1X 2E2BA 1DI8A 3BYUA 3NYXA 5IEYA 3EQHA 4FZ6A 4F9WA 5B2MA 4D5KA 3WILA 1ZLTA 3FYJX 4FTNA 4F7JA 4RIXB 3TUCA 2PVMA 1WBWA 1PXMA 2CSNA 2GMXA 1W2FA 3BZ3A 2EWAA 2J0IA 3I6WA 1IAJA 4ZOGA 4ANOA 2QVSE 5L2QA 4MNEB 3PY1A 3Q3BA 3FQHA 5FXRA 3MPMA 1A48A 4EOPA 4Z55A 4FIHA 3UO6A 1CKIA 3EMGA 3MY1A 3VBVA 4YZCA 3QGYA 3UGCA 2C68A 3EL7A 3EQIA 4AZWA 4KIKB 1T45A 2X39A 4J8MA 4BKJA 4UZDA 1IG1A 5DE2A 5C4KA 4F78A 4AU8A 3V51A 2ZAZA 4C4FA 4FKWA 1YWVA 2Z8CA 2Z7RA 4OW8A 1HOWA 3FMHA 4GV1A 2WPAA 4XG2A 3BU3A 4YJRA 5J9YA 3I0QA 3IW5A 3AMYA 4NTSA 4XCUA 4RRVA 2GQRA 4DCAA 3TN8A 1WCCA 2YCSA 1DAWA 3JUHA 3LFEA 4MHAA 5AIKA 3U51A 1PXIA 3TV4A 2WMBA 3DT1A 3OY1A 3R1YA 3ZSIA 5DT4A 3ZUVA 5I9XA 4RX8A 3A60A 5B2LA 1JKLA 4ACCA 2GU8A 5L2WA 4AOJA 4FSWA 4IB3A 2XRWA 5CXHA 4EH3A 4QMSA 2WTKC 2ZV9A 3P7CA 3PJ8A 5C9CA 2XALA 3RK7A 4RJ6A 2WQMA 1GZKA 4G1WA 4O27B 4EHVA 5CYIA 4USFA 3K5UA 3D4QA 4BDGA 3CBLA 1YWRA 2W1DA 4JI9A 4IACA 4X2GA 1OPLA 2QNJA 3NW7A 3ORXA 4KS8A 2RG6A 3W0QA 4CGAA 1R3CA 4OBPA 4BCFA 4NFMA 4ZTLA 3UPZA 3GGFA 4DT8A 4BDDA 4Z16A 1Q8YA 4G9RA 3RCJA 4QEBA 3PXKA 4DE4A 4RWJA 1ZOGA 2W5AA 3OHTA 2C5OA 3ZFYA 4CFNA 3SVVA 4M84A 3LKMA 3BQRA 2AYPA 1W8CA 3VW8A 3LM0A 1OMWA 3Q52A 1OIQA 4EH2A 3QZIA 3OOMA 4E5AX 3PWDA 1MQBA 4M0ZA 2XK8A 2GCDA 3OBJA 2ETKA 2YJSA 4TYJA 3R0TA 4BTJA 3DB8A 3WIGA 3L1SA 4GK2A 3DB6A 3BHUA 1QCFA 2WTDA 4IEBA 4IFCA 5K0KA 3E64A 1URCA 3TUBA 2B7AA 4DYMA 3EN9A 5HTCA 1KE7A 3WZDA 2PMNX 4RJ4A 2F49A 4RJ7A 4U9AA 5GHVA 2X6DA 4EOMA 2XJ0A 2ZB0A 4EZ7A 3C4CA 4A7CA 4CFXA 1HCLA 4O0WA 3H0YA 2PSQA 4GK3A 4UWYA 4DC2A 4R3PA 3ZM4A 4R3CA 5IEXA 5AP3A 5GIPE 4A07A 4WNMA 3F7WA 3NDMA 2B0QA 3LMHA 3E7OA 2H6DA 3FC2A 3O8PA 3ZTXA 5H3QA 5KMNA 4C37A 1YXVA 4MUQA 1FVRA 4DGOA 4ZXTA 3A99A 4BDJA 3WF9A 4YLKA 4A06A 3DXQA 3OCSA 3KXZA 1JVPP 1U54A 4KBAA 1WAKA 4ANMA 4U44A 4E6AA 2WTCA 1KV2A 2VAGA 4ZZOA 3VUHA 3FL5A 4XNEA 1AGWA 2XZSA 1XWSA 3DBCA 2J7TA 3GUBA 3IGGA 4TZRA 4R78A 5H8EA 4NZWB 4AZVA 3UZPA 3T9IA 3EB0A 3D2IA 2OXXA 3KF4A 3FZOA 3COIA 5AA9A 5HBEA 2F57A 4RC4A 1H01A 2C6KA 5H8BA 3FLZA 3KRJA 4TPTA 4MXCA 1SVHA 4GFMA 4RJ5A 3QAME 4O0XA 3EOCA 3UTOA 5T6KA 4K33A 5KE0A 1KE6A 3KQ7A 3QA0A 4CCUA 1QPJA 5CAUA 3C13A 4HCVA 5CVFA 4FT5A 3RPYA 4RA4A 3R9OA 4C2WA 3E8EA 5IZFA 3NZ0A 4A9TA 5LQFA 2R3NA 5KHXA 4HGEA 4FIGA 4GFGA 3HYHA 4O6LA 4JG6A 5CY3A 3R7UA 4PTEA 4IADA 1FGIA 2ZV8A 5ANKA 3LFCA 4EYMA 3IW4A 4LDTA 4LGHA 1WBVA 1ZYLA 3POZA 4QMVA 4RVTA 5LJJA 2BILB 5IMEA 5CVHA 4F1OA 3R1QA 3OXTA 4DHIB 3QTSA 1M2RA 2JDVA 5AJQA 5EOLA 1MP8A 5CI7A 3W0RA 4I6QA 3PY3A 5EI8A 1UNLA 3VUIA 4QDVA 3P4KA 5ANDA 4CV9A 1F3MC 1H24A 5EW8A 3KXHA 4ONAA 3CQUA 5LVPA 1QPCA 4CQEA 2VNYA 2C0TA 3KK9A 1ZMVA 3WE8A 3RPRA 1P5EA 3RAIA 5JFSA 4YBKA 4YHJA 5E90A 4ZJJA 1ZRZA 5M56A 2YCFA 3ORLA 4E4NA 5KKRC 4CTBA 2WXVA 3EIDA 5E4HA 3FJQE 3KVXA 1H26A 4S2ZA 1UU7A 2O3PA 3HDMA 4QNYA 2NO3A 4F0FA 1JAMA 2WMSA 4FKUA 2XNBA 4JRVA 5J9LA 2BFXA 2JIVA 1OIUA 4W4VA 3DK3A 3QUPA 4FV2A 2XIYA 1Z9XA 3CKWA 4ZSLA 4BCIA 1M14A 2WTJA 5CQUA 4ZZNA 5JZJA 1PKDA 2VD5A 4J71A 2UVYA 2IW9A 1U46A 4JLCA 5EM6A 1GIJA 3VJNA 2VTQA 3RNIA 4DH1A 1UA2A 2XKCA 4LUEA 3I4BA 1GY3A 3Q9XA 3JVRA 3ORIA 4X7QA 5AWMA 4OTWA 4BTMA 4DEAA 1NY3A 1R0EA 4EC9A 5IF1A 4BDEA 4E26A 4YLLA 4EJNA 4C59A 3VBTA 3KREA 1KOBA 1Q8WA 4NM7A 4OUCA 2C6DA 3T8OA 4BTFA 2FSMX 4LOQA 3OD6X 3BQCA 3D7ZA 1WVWA 3OW4A 4DTKA 4HVIA 5CASA 3LCTA 3LOKA 3HDNA 4N57A 4TWNA 4DG2E 2CLQA 3PVGA 4NFNA 3SGCA 2YEXA 5J7BA 4FKVA 3A8WA 3RWPA 5A4EA 3PY0A 1WVXA 1XQZA 1Q3WA 4AUAA 3QCQA 2ITPA 5IQAA 1SYKA 3D94A 3TNIA 2O65A 4FTCA 1TVOA 3GU5A 3POOA 5IA1A 1WFCA 3FMKA 4AZEA 3TZMA 2WKMA 1R1WA 3L9LA 3GVUA 3WF7A 4DF3A 2HZ0A 4AXDA 4D2TA 3DJ7A 3G9NA 4XV9A 4U43A 4Y46A 2HWOA 3VS2A 4O7NA 5JT2A 4O2PA 3LJ1A 4QNAA 5DRBA 3H4JA 3UNJA 4RG0A 3D2KA 1ZOEA 2ZB1A 1TQIA 1VZOA 2HIWA 3OWLA 4FGBA 4BIDA 5BYYA 4DH8A 4XBUA 4K1BA 4BN1A 3LXLA 4EK4A 2ESMA 3EHAA 1YWNA 4R7HA 2W7XA 4RVMA 4L68A 4YNEA 2VGOA 4EH4A 3F69A 2JKKA 4TKSA 4ZSJA 5JQ8A 5BNJA 4WIHA 1F0QA 2QOIA 4HNIA 4LOOA 5HCYA 4DTBA 1VLRA 1VYWA 4U3ZA 3K2LA 3GEQA 3W8QA 4HGSA 3VS1A 4AGWA 2HAKA 2VTTA 3VO3A 3UP2A 3V5PA 1PYEA 3W2CA 5EHLA 1K9AA 2A2AA 3EL8A 3R7GA 2VWWA 4ASDA 1W2DA 4PDSA 3R02A 1TQPA 3DXPA 2FSOX 2GS7A 4QPSA 5A4QA 5BYLA 4DDGA 2V62A 2C6MA 4AN3A 1PXOA 1B6CB 4JJRA 4AGDA 4U97A 3FXXA 1Q8TA 4XOZA 2IW6A 2VZ6A 3AC5A 3KULB 5A46A 4FOBA 4FTTA 4G9CA 4ASEA 5HO8A 3SRVB 3KU2A 4J52A 1APME 4UYAA 3MYGA 5AM6A 2CNUA 3WOWA 2CGXA 3EQCA 5D11A 3FAAA 4BBMA 3QLFA 4FL1A 3CSVA 2JKOA 1BUHA 4L3PA 5J5TA 2GSFA 4RWKA 4UN0C 4NW6A 2VN9A 3DJ5A 3AQVA 2BFYA 5BVEA 4EQMA 2Z7SA 3GENA 4AQCA 3BWFA 2WIHA 3SD0A 3VIDA 3IW8A 3VUTA 1SNXA 2XNEA 3V6RA 3M11A 3DOGA 3AGMA 3BYOA 3QU0A 4E93A 2R3KA 3ORTA 2P55A 2JC6A 3G15A 3KB7A 2X4ZA 1H07A 3PJCA 2BTSA 3HMMA 3A7IA 5J87A 3KMWA 2VX1A 3AG9A 3FKNA 4QTAA 4DITA 3BLHA 3HRFA 1ZZ2A 4QYEA 3UO5A 2E9UA 4DA5A 3EQFA 4JG7A 3QGWA 1O6YA 4GSBA 3PXFA 3E87A 4FNXA 4FI1A 4HYIA 3G5DA 5L8KA 4YHTA 1PMEA 5GZ9A 1UVRA 2PE1A 5CF8A 2P2HA 2VX3A 4IX5A 4JG8A 3C0HA 4CFWA 4FL3A 4N4SA 4FX3A 4DEGA 4KSPA 5LVLA 4DGLC 4EKLA 3CGFA 3FXZA 4A9SA 1JOWB 4YTHA 3WE4A 3ORZA 2XA4A 4DBNA 3ACKA 3TKUA 3E5AA 3GFEA 3S0OA 5FEEA 5FP5A 4ZLZA 3GCQA 4FZAB 4KKEA 4I5PA 4MBIA 3I0OA 3ZRMA 5EFQA 3BL7A 5HE1A 3CE3A 2KTYA 3NUYA 4HZRA 3RAKA 3E3BX 3WF6A 3IPHA 3OZ6A 4XG6A 4D4YA 4BWPA 3EFJA 4ACDA 4MXAA 2CDZA 3BE9A 2W06A 1QPDA 3I5NA 4BDHA 3DGKA 3QUEA 3M1SA 5DLSA 1L8TA 3GB2A 4I5CA 4UWCA 3U6JA 4MH7A 5L2TA 2J90A 2YZAA 2YLEA 2RG5A 1GZOA 1ZYDA 4CRLA 1BX6A 1Z5MA 4JNWA 3SXFA 3AT2A 5KMIA 5GINE 5A4LA 3HV7A 2XNPA 1X8BA 3OEFX 2W96B 3ORNA 4I22A 3UO4A 4MNEA 4U80A 3P0MA 4IWDA 4AA5A 2V7AA 2FVDA 5EKNA 1KV1A 1WMKA 4W4XA 3UC4A 3C5UA 3HA6A 4OT6A 3BYSA 3R2BA 2BDWA 4QMUA 4C2VA 5HLWA 4B9DA 3OF0A 5C8KA 4G17A 3H9OA 1LEWA 4KIKA 2ONLA 5AV3A 4OAVB 4TNDA 4Y5HA 2PVFA 3MVJA 1PYXA 4PTGA 4U5JA 5FM2A 3UYSA 4MQ1A 2OIBA 3CCNA 4QMQA 2FB8A 2C47A 4H36A 3P7AA 4XHKB 1NXKA 3ROYA 2P3GX 2PK9A 2W4KA 4QD6A 4FNYA 4G3CA 4LRKA 3W1FA 4C4EA 4W8EA 2GFSA 4ZTQA 5L6OA 4QOXA 2OZOA 3SW4A 4TTHB 3UIUA 3A7GA 5B7VA 4GEOA 1Q3DA 1XH5A 3PPKA 4R1YA 3TDVA 3AC2A 5EHYA 4PX6A 2B55A 3ZH8A 4IDTA 4O0TA 2PUUA 3OWPA 3OT8A 4MQ2A 3F5GA 4Q9SA 5IQHA 4KA3A 2P2IA 2H96A 5AP0A 4XUFA 3UG1A 2JDSA 4EOKA 4WO5A 4YMJA 3UOJA 4IMYA 4G16A 3TCPA 4W8DA 4D9UA 1SVEA 2Y4IC 4O81A 4IVCA 3ETAA 3KXNA 4XEYA 4K6ZA 5CZIA 3IK3A 3Q9YA 5HI2A 4BYIA 4XBRA 2W5BA 3LLTA 3MBLA 4Q9ZA 2QOFA 4LL5A 3QRUA 2X7FA 3R9DA 1FMOE 2JDRA 3D9VA 1ZYCA 4OTRA 2ZM3A 4BI0A 2ACXA 4Z3VA 4EOSA 4EOJA 4PP9A 4K77A 3ANQA 4NKSA 2PUPA 1OITA 5I0BA 1RE8A 4WSYA 4Y83A 5CVGA 2V22A 4ZTHA 4WBOA 1XMMA 4F1MA 1H1WA 3R7EA 1OKZA 2XK6A 4X3FB 3TJDA 4ZLOA 4O86A 2UZDA 1SMHA 3SV0A 5JZNA 1VYZA 4MD8E 3GU6A 5HU9A 5AFVA 3BBTB 3RGFA 3QD0A 3ROCA 4DFNA 2O0UA 2WU6A 2X7OA 1OKWA 3HNGA 2DQ7X 1NVSA 3D5UA 1PW2A 3L9PA 4R5YA 1TFFA 1M7QA 1ERKA 4BB4A 1H0WA 4FT3A 3RCDA 1H0VA 5I9ZA 3A4PA 3COKA 2CJMA 2X0GA 2F4JA 3BEAA 3UE4A 3VS5A 4CG9A 4V0GB 3PSBA 4G2FA 3ZYAA 3P1AA 1FGKA 2QO9A 2WB8A 4IZ5A 4KAOA 4EOQA 4USDA 4EZ5A 3ID6C 4GYIA 5FP6A 1P4FA 3MGYA 3VBYA 1OL2A 3C51A 3R8MA 4I4EA 2GNFA 4NL0A 4ORKA 4R7BA 1PMVA 2H8HA 4FSRA 3HV4A 4D55A 3ZO2A 4AN2A 4DGNA 4RPVA 1G3NA 4AA4A 3SG8A 3QQLA 4HPTE 3FZPA 1ZMUA 3BGQA 4FT0A 4I0SA 4IANA 4O0UA 4AA0A 4FTAA 4A4OA 4KKHA 4EH6A 2QHNA 1YI3A 4OTIA 3UIMA 1PMUA 4F9CA 2AQXA 2E9VA 3BU5A 3DS6A 4J53A 2R0IA 2PVJA 3REPA 2QONA 5LVOA 1L3RE 2P0CA 3O96A 3PXQA 3DFCB 3DDQA 4C7TA 4F0IA 4ERWA 3QCSA 2QHMA 3PIXA 5DMZA 4QMNA 2HWPA 2XBJA 4L7FA 4NYEA 5AUZA 4QQTA 2NRYA 3NCGA 4GUEA 4BFMA 3IOKA 4BCMA 3ZMMA 3FL4A 1JWHA 4BDCA 1CKJA 3R8PA 3LW0A 3KEXA 4MXZA 5FDXA 3UBDA 4FUXA 1NW1A 1LR4A 4W9WA 3HP2A 3UP7A 3Q9ZA 4ZZMA 4BHZA 4M66A 2UW9A 5K4IA 5IQDA 4RFZA 3OROA 5DHJA 2OO8X 5E92A 5J9ZA 4HOKA 4C4HA 5M09A 4C34A 3JPVA 5GJGA 2YDIA 1IRKA 1CM8A 1KSWA 4M13A 3KRWA 4PL4A 2BAQA 2VTPA 3LFDA 2W1EA 4IHPA 4D4VA 1Z57A 4CKJA 3NVMB 2WAJA 5J5SA 2QD9A 3R71A 5HNGA 3NYNA 5FWKK 4OGRA 2Q0BA 3VRZA 3LMGA 4BDKA 4HVSA 3R21A 3W10A 3FMMA 2V5QA 2I6LA 4GL9A 4FTJA 4OBQA 4E6CA 3DKCA 4IM0A 1A9UA 2OZAA 3BV2A 5T68A 4YO4A 3TG1A 3IO7A 2IZTA 3VNTA 2QOOA 2J4ZA 3DLSA 3A7HA 1WBTA 3ZBXA 2PYWA 4I1ZA 3OBGA 3G51A 5CX9A 5CEQA 2VTOA 5I3RA 1MQ4A 4M8TA 4Y95A 4ALVA 3PPZA 3F7ZA 1ATPE 2YIWA 2OICA 2YACA 4N6ZA 4BC6A 1FVTA 4OTFA 4AQKA 4I6BA 4DEIA 3UQFA 4D4SA 5E8ZA 3W0SA 4HVGA 3KXGA 4QMZA 4AWIA 3O8UA 3JYAA 5AV2A 4C38A 2XKEA 4M0YA 4FSNA 5M4IA 1CKPA 4QTCA 4CFVA 3OXIA 4YR8A 4CQGA 3UMWA 3VAPA 2QOHA 4BWKA 3W18A