2FYSA

Crystal structure of erk2 complex with kim peptide derived from mkp3
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
349
structure length
348
Chain Sequence
GPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of docking interactions between ERK2 and MAP kinase phosphatase 3
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
total genus 88
structure length 348
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2fysA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2fysA01
4R8QA 3NW7A 5HVKA 1XH7A 3H4JA 3QHRA 1VEBA 4GIHA 4FV6A 3U54A 4R5YA 4GYGA 2F7EE 3LMIA 3BWFA 4DLIA 4JXFA 2CGVA 3E87A 2XCHA 2Y4IB 1CSNA 2IPXA 3BPRA 4DFNA 3U6IA 5EOBA 4QQCA 4IANA 4DH5A 5AA9A 4KS7A 2WGJA 3AGLA 1U54A 3ENHA 2BALA 3HUCA 3IS5A 3R21A 3GB2A 4I22A 1CMKE 3VUGA 1J1BA 2X2LA 5M09A 3WZKA 3OY1A 2WELA 3V5JA 5CU0A 4FT7A 4FI1A 2WTDA 4O0RA 2F57A 4DFLA 3LMGA 4J71A 1Q8ZA 2ONLA 5IUHA 4BZOA 3JY0A 4Q5EA 5I9ZA 3QZHA 3QQGA 1LP4A 4U80A 4JDJA 3OC1A 3K3JA 5I9YA 4OTGA 5EYDA 1SNUA 1OKWA 3CJGA 4ERKA 1Z5MA 4B8LA 3EFJA 2YEXA 5IQFA 3DK6A 4NWMA 5CAPA 3FY0A 4CFVA 4NSTA 3MVMA 1H0VA 3THBA 3ZC6A 4UMRA 3ZO2A 2VNYA 4FIFA 2PL0A 4GUBA 2X81A 4U44A 5TKDA 2QKRA 3FZSA 4J96A 3EQPA 4IBMA 4AOIA 4RJ7A 3E3PA 3FI4A 4XBRA 4IZ5A 4AOJA 4D1ZA 1H24A 5HCYA 4CFMA 4CXAA 3ORXA 3LMHA 2XM9A 4IAKA 3CLYA 3R63A 5ACBC 4X0MA 4BGGA 2CNQA 4NW5A 4FSWA 2YWVA 3VUMA 4BY9E 1WAKA 4GV1A 2X1NA 3MVHA 1PMVA 1MRYA 4WHZA 4YBKA 5TR6A 4E4XA 4RA4A 4MEDA 4FL1A 1OL6A 2W4OA 2WTJA 3A4PA 4G16A 4EZ7A 2W1HA 1AQ1A 2C1AA 3C1XA 2PZRA 3SA0A 3VQUA 4C8BA 4GJ3A 3VRYA 3HMIA 5LJJA 2C6EA 4YPDA 3OP5A 4AP7A 2OLCA 4FT3A 5CSVA 3V5QA 4FX3A 4C59A 3EQRA 4L9IA 2HY81 1H08A 2SRCA 5AR8A 3TUCA 3FMEA 3R7IA 1WBVA 3FMKA 5EDQA 1YXSA 2BAQA 2W9ZB 1RE8A 3A4OX 3C4WA 3DBCA 3P23A 4W8DA 5HIDA 5KE0A 4CFFA 2PVRA 5AUYA 5CQUA 5DYJA 3BHTA 4EWHA 5CU2A 4IAAA 3KMUA 3MH0A 1GIIA 2XYUA 3NX8A 5HNBA 1YW2A 3BQCA 1OL1A 4IM0A 5ICPA 1CDKA 3UIXA 1ZYSA 3A7FA 3IOPA 4V0GB 4BTJA 5M53A 4RVMA 3EKNA 4AT5A 4QP8A 2DQ7X 3W8LA 5HE3A 3QRKA 3UNZA 4RFYA 3PRFA 4CRSA 5M4IA 4UMPA 3OCSA 4BDKA 4OT5A 3WF8A 2W1EA 5L4QA 3WZDA 4K9YA 4ZSAA 3SW7A 4QQ5A 3UO6A 3QUPA 3K2LA 4I41A 3KU2A 3PIYA 4QMSA 3UC3A 3PE1A 2R7IA 4GU6A 3ZBFA 2XIRA 4RQKA 3JPVA 2J51A 4JBVA 3SKCA 4ZEGA 4QT1A 3P7CA 5KCVA 2ERKA 3BLHA 5JFXA 3DZQA 3SGCA 4BKYA 3R8UA 4L43A 2QI8A 1URCA 3V01A 4TN6A 4FZ7A 4AU8A 4MD7E 4UMQA 3ATTA 2P2IA 3GVUA 5HCZA 1V1KA 1HCKA 4XMOA 4GKHA 4U6RA 1E1VA 2A27A 2X2KA 3P79A 3PPKA 5D1JA 3UC4A 5L8KA 2F2CB 2XNNA 2VAGA 2WTIA 2VWXA 3BIZA 5EM7A 5C1QB 4ANSA 3FXWA 5EDRA 1REJA 3KEXA 3QU0A 3SQQA 2C69A 5AJQA 3TWJA 3DTWA 2XKDA 2Q83A 4CNHA 2XS0A 4I93A 4YC3A 5E90A 5A4TA 2UZDA 3AMBA 3DBEA 4U45A 4CQEA 3OW4A 2QG5A 3VF8A 4IC8A 4QMZA 3ZUUA 2R2PA 2PUIA 4O82A 5KBQA 4USFA 2PHKA 5B0XA 1R0PA 3AD6A 4RA5A 3GUBA 4AAAA 3EN6A 3EZVA 4IZ7A 3GBZA 4KIOA 3BV3A 3HMMA 4AZEA 3IW5A 2HCKA 4C3PA 4HYUA 5CLPA 1NVQA 2R7BA 4M69A 4M15A 4F9BA 2EXMA 3ZMMA 4BI0A 4EI4A 5IUGA 4CRLA 2QOLA 5DPVA 4LM5A 4YC6A 1GZOA 2QVSE 3QZIA 4I0SA 4TW9A 4F09A 4WKQA 3G9NA 3LZBA 2JIUA 4QNYA 4D2VA 4PMTA 5JH6A 3D5VA 4Z9LA 3QD4A 3Q9ZA 3EQBA 1J1CA 2I0EA 3KC3A 3TJCA 3R00A 5JQ5A 2H6DA 2W1IA 3UYTA 1OM1A 4K0YA 3EB0A 1U46A 2OFUA 3W33A 4HW7A 4AT4A 4KBAA 1U4DA 3NR9A 2XB7A 2RIOA 5EKOA 2AYPA 4FTUA 4NH1A 4G5JA 4QPMA 5DR9A 1B6CB 2YLFA 5LVLA 2RFEA 4HJOA 4AX8A 3DXNA 5CNOA 2G1TA 2XVDA 4EK3A 5DR6A 1W83A 4M3QA 4C3FA 2QOIA 4DEHA 3RMFA 1YHVA 4LGDA 3ZCLA 4G31A 1KE5A 3IGGA 5D10A 5LVOA 1P4FA 5AEPA 5HD7A 5E9EA 1YDSE 5FGKA 2WEVA 2JDSA 4PL5A 4DH7A 2R9SA 3FXZA 5AFVA 5AP0A 3ET7A 3EQCA 3S95A 4JX3A 5AUTA 3ZRKA 4O91A 3JVSA 2HWPA 4FVQA 2UV2A 2VWVA 3TI1A 3R7EA 4I1ZA 1H1RA 4QMVA 2W7XA 4QMXA 3ULIA 3PP1A 1GAGA 3KN5A 2R4BA 4C57A 4PTCA 5AR5A 3R7VA 1ERKA 4NFMA 2ERZE 3OHTA 4FSQA 4BYJA 4DN5A 4BDJA 4I23A 4AZSA 2GQSA 3HMOA 2VO7A 4KBCA 2CPKE 3ZLYA 4M8TA 1PHKA 2JIIA 3GI3A 3ETAA 1R78A 4FEQA 4UWBA 4Y83A 3ZU7A 2OU7A 3PY0A 5DN3A 4E1ZA 1M52A 4JDHA 3BHYA 4IB0A 4ID7A 3C4XA 1CKIA 4AGDA 1YOJA 3PSDA 5BX0A 4MXYA 3OFMA 4EKLA 4D58A 4DEGA 2I6LA 5M08A 4EZ3A 5BQ0A 4ASDA 3G90X 3ZM4A 4M66A 4J95A 4L00A 5HKMA 3S3IA 3EOCA 4FSNA 2C0TA 3QC4A 1M17A 3GENA 3QTWA 4G17A 4KAOA 4BZNA 3UE4A 1RDQE 3KN6A 4ACMA 5DR2A 3VHEA 4YNEA 3UIUA 4EOKA 1FMKA 2R3FA 2KULA 4FSUA 3D2IA 2BRGA 5CEKA 4PDSA 1KE8A 2CJMA 4M13A 3T3UA 3PTGA 5HTCA 4V01A 2JBPA 2RG6A 4L01A 4BYIA 3BKBA 4JQ8A 1HOWA 5CSXA 4CZTA 3R1SA 3RJCA 2IW8A 5FEDA 3SOAA 1TKIA 3KCFA 2WIPA 4M67A 3DGKA 3PJ2A 4ZLYA 4I5MA 2HWOA 4QNAA 4F0GA 4E5BA 1BI7A 5EHLA 4FTKA 4HPTE 1H1WA 3HP2A 3GOKA 4E73A 5EI8A 3OVVA 4FT5A 2VTTA 1BX6A 2YM5A 4WG5A 3TKIA 2UZUE 2VU3A 5GZ8A 2W5BA 2FYSA 4PL4A 4RC2A 5HQ0A 4IB1A 3ENMA 5KKRC 1ATPE 1JNKA 4E7WA 4ACHA 3R9HA 1OUKA 2DS1A 4IVCA 4RX5A 3ORLA 2GSFA 4PF4A 3GQIA 5BUEA 2Q0BA 3PLSA 1PMEA 4D28A 5JGBA 3F6XA 3O7LD 3BGZA 5GZ9A 3GU6A 4TYHA 1YHSA 1G5SA 3OEZA 4HZRA 4S32A 3OWPA 5DHJA 2AUHA 4X7QA 5CXZA 5AIRA 4BTFA 5DVRA 4U8ZA 5DFPA 4RBLA 1WVYA 4KS8A 5T68A 5AV4A 5L2TA 1KWPA 5ETAA 4O0UA 4I92A 4XHKB 4YJPA 5A3XA 4KABA 2ZV2A 2PYWA 3WZJA 3R01A 4JL9A 2XM8A 2P0CA 4YJQA 5A54A 5IQBA 4W4XA 4FF8A 3TN8A 4NUSA 3OD6X 2J6MA 3MPMA 3H0YA 4KUJA 4R77A 4USDA 5DT0A 4EH5A 3TDWA 2UUEA 3R30A 2BUJA 5CSWA 4C4JA 4RGJA 5AUWA 3HL7A 3FI8A 1FVTA 3EQFA 5LOHA 4O84A 2XK8A 3KULA 5EOLA 4P90A 3TV4A 3LM5A 4Y73A 1DAYA 3FMJA 4FYOA 4AZVA 4R6VA 2CGWA 4PPCA 1FPUA 5FXSA 5HOAA 1PXNA 3KGAA 4O1PA 2IZTA 2WQNA 3MTLA 3NW5A 2JGZA 2HAKA 4HYIA 4N6YA 4FKVA 4K18A 1LEZA 1RW8A 2B53A 3OWJA 3P0MA 4TYJA 4GJ2A 1ZMWA 5DE2A 4OAVB 4TWNA 2UW3A 2OI4X 2YM3A 3GXLA 5FP5A 4C0TA 3W32A 4GT5A 5IEXA 3TCPA 4EOMA 1SNXA 2X9FA 4FKQA 3D5WA 4IWQA 4EUTA 5GJGA 1EH4A 4DEBA 4BBFA 4O7RA 1PKGA 2UVZA 4IVBA 1JSUA 4CSVA 3EN9A 1YI4A 4LL0A 3A7HA 3QXOA 4ZSGA 5CF5A 2XK7A 4M0ZA 2C5XA 4IACA 4AOTA 5HE0A 5M4FA 1W84A 2HW7A 2R3LA 3L9NA 3ORPA 5CZHA 3R8MA 1A9UA 3K5VA 3R7GA 4G3EA 4IH8A 2R3HA 2CKOA 3UZTA 2X2MA 5JQ8A 3MWUA 2HK5A 4FEUA 5CTPA 4LRKA 4LFIA 5BYYA 3ZRMA 3WILA 4E20A 3V5PA 5A9UA 3I4BA 2R3NA 4EQMA 4TZRA 3QTZA 4L45A 4Q5HA 5EQPA 3HV6A 2BFYA 3NEWA 3NIZA 2C6MA 4QP3A 4QPAA 3KXMA 2QU5A 2VWUA 3EQDA 2B55A 2JAVA 3NGAA 3QTSA 3K54A 4GFOA 5JKGA 4G1WA 4GL9A 3BYMA 4L3JA 3RAWA 2RSVA 4YHJA 5ANKA 2XBAA 3LXLA 4U97A 3N4VA 1PJKA 4ZJVA 3I79A 5TF9A 3BBWA 3M1SA 4MWHA 4O0WA 3NCGA 1KE7A 5HIEA 2PMLX 2BTRA 4O0XA 3RNIA 2YJSA 4L7SA 4DEAA 4EQCA 5IA2A 4BB4A 3Q5IA 2WMWA 3E62A 4A9UA 2FA2A 4HZSA 2NPQA 5AP7A 2EVAA 4ZTRA 2C6DA 4XG2A 3RPOA 3W2OA 2JKMA 3DLSA 1UU9A 2HZNA 4QTAA 5IISA 4RIWB 1W0XC 1IR3A 4U79A 3PVUA 4Z3VA 3PPZA 2E9UA 4WRGA 5TE0A 5HE2A 5FP6A 1IAHA 1XBBA 4RJ8A 5CT7A 3DJ5A 4I4FA 5J87A 4O7SA 1ZZLA 3LXNA 4DFUA 4IX4A 3GNIB 1Q24A 3A62A 4MXAA 3LJ2A 4OTIA 1M2QA 3ORIA 3CC6A 3D94A 3QRTA 4FNXA 3FHIA 3TZ9A 4HOKA 5C9CA 3Q6UA 4PDPA 5E8YA 4ALUA 5IDNA 4YR8A 2REIA 1PF8A 2Y4IC 3R8ZA 4IJPA 1UU7A 3LFNA 5AR4A 4ZJJA 3RM6A 1B38A 4EYJA 3GQLA 2UW5A 3IW4A 5BVWA 4F0IA 1G8SA 4YP8A 3CGOA 4AE6A 2P33A 2DUVA 2OF4A 2VTNA 3CEKA 3F5XA 4C38A 1UNLA 3FBVA 4KIQA 3SXRA 4EOPA 4FGRA 4U9AA 3ZBXA 1OMWA 4LI5A 5D41A 4ANNA 4YUQA 3SHEA 4BGHA 2JAMA 3W2CA 5HICA 4JAJA 2GHGA 2WTCA 5AWMA 4F65A 3T8OA 5GJFA 3COMA 4YZ9A 3JXWA 3COHA 5AP5A 4J7BA 3SX9A 3WE4A 4MVFA 4E4LA 3EL7A 4QD6A 2F7ZE 2UW6A 3RHKA 3TZ8A 3FL4A 4WT6A 4CCBA 3HMPA 1KV2A 4EH9A 1H07A 3FI2A 1WVWA 3M11A 4GEOA 2OFVA 1VYWA 2ZVAA 4PTEA 4QP7A 1A48A 3WZUA 4AUAA 4BIBA 5F9EA 1ZY5A 4EHVA 4FTAA 1OBGA 3BE2A 2VUWA 3RZBA 2VWZA 4U5JA 2A2AA 5M51A 4NYEA 1DM2A 3VJNA 1PKDA 3ROYA 5LARA 3F9NA 2E9VA 1XH8A 2X7FA 4IZAA 4IZYA 3DB8A 3R2YA 2X8DA 3FAAA 2GFCA 2V7AA 2B9IA 3R9DA 5A6NA 3FKNA 4IDVA 5L8LA 2QC6A 2OZAA 4TT7A 2XK4A 2YA9A 3HA6A 2OW3A 3F5UA 3LFSA 5IG1A 4EONA 4I3ZA 4II5A 4EWQA 3SRVB 5HLWA 5A4CA 2CCHA 3Q5ZA 4IHPA 4PX6A 4O0VA 4ANMA 2GNFA 4MBJA 1UU8A 2CHLA 4I6QA 3LCTA 1W98A 1O6LA 1UKIA 1APME 2BDFA 5M57A 3LOKA 3PZHA 5I9XA 3FY2A 1CKPA 1PW2A 4MF1A 3FMNA 1FGIA 1T45A 4HNIA 4W9WA 5BVEA 5K5XA 5CVHA 2WEIA 1OBDA 2BKZA 4TRLA 4RJ5A 1XH4A 3QTIA 5IMXA 2V22A 1YRPA 4WIHA 4N6ZA 3OCBA 4XRLA 4D4RA 2J7TA 1BI8A 5M07A 3ZSHA 2Y8OA 3Q9WA 5JFWA 3WF6A 3F2NA 3Q2MA 2WMBA 4EK6A 4D5HA 3E7OA 2G2IA 2BFXA 4XRJA 3POOA 3C13A 4XV9A 3PJ1A 1YXXA 4V04A 4YNOA 3F5PA 2NO3A 1GIJA 2HZ0A 4UB7A 1URWA 4WNPA 2X6EA 4AZWA 2F2UA 2VTPA 3B8QA 3QXPA 3LVPA 4HVSA 2VTOA 3AC2A 1BMKA 3V5TA 3GCSA 3FI3A 4ONAA 3FL5A 3BE9A 3QD2B 1R0EA 2QU6A 3EN4A 3ORNA 4QP6A 4OBPA 4TY1A 3TACA 5J5SA 4X21A 4DFYA 4HCUA 2E9NA 3GC8A 3QL8A 2YDIA 4ZMFA 3EN5A 3TIYA 3HX4A 3QRIA 4XG7A 3MFTA 1M2PA 3BU5A 2GFSA 2ETRA 2GCDA 2W96B 2PWLA 2YDJA 4I6HA 4EUUA 2OXXA 4FSTA 5JMSA 4JIKA 5K4IA 4QMYA 4ALVA 5DBXA 3NNXA 3R1QA 3ZLWA 3DDPA 4JBQA 3IPHA 3FMDA 3OUNB 4WNMA 5CF8A 5DT4A 2R3PA 4BIEA 2O63A 3I0OA 1YHWA 4ZTMA 5B7VA 1H1PA 3KKVA 4IADA 3MH3A 2ZV9A 4YLJA 2BMCA 5HU3A 1WZYA 2XIZA 4RLLA 2WMVA 4H58A 4ENYA 3U51A 4C58A 2Y0AA 1Y8YA 3EHAA 3NYOA 4I20A 4ZXTA 4B6LA 4L53A 3BGPA 4XBUA 2QOKA 1FVVA 4FKPA 1XO2B 4QTBA 3VBQA 3LCSA 2PE0A 2WZJA 4O7NA 4FNYA 4YJOA 3I1AA 3RM7A 5K4JA 3TKUA 1KUTA 5I4NA 4R1VA 3BCEA 3SVVA 3PSBA 4MXCA 3EFLA 3RINA 2C1BA 1OKYA 4EH8A 2I0YA 5JT2A 4FG8A 5IA5A 4OGRA 4WOVA 4B7TA 4BKZA 5LXMA 2IO6A 5HG9A 4AFJA 4GRBA 2R0UA 2YERA 4B0GA 4I5PA 2Z2WA 4YO4A 3WI6A 3ZO4A 2PY3A 5K5NA 1LPUA 4QQJA 4ANBA 3WBLA 2VTQA 3QUDA 4QPSA 4UZHA 5DIAA 3LE6A 3HUBA 4NM7A 1GZ8A 4A9YA 2CMWA 1JKLA 3CQWA 4YJRA 5T6KA 4H39A 4RX9A 5FLFA 4GYIA 2BRBA 2C3IB 2OO8X 4K1BA 3ZUTA 4FSMA 3T9IA 3U4WA 3D83A 5L8JA 2OIQA 3I5NA 5CX9A 4A06A 4I0TA 3G2FA 4FTMA 5C03A 2J0KA 3FQSA 3W55A 4F9CA 1GY3A 3I6UA 3FKLA 5IKWA 5IQDA 3FSKA 2W5HA 3E8EA 3LPBA 1Y8GA 4RWIA 2UVYA 5HG5A 4BICA 3AXWA 3LJ1A 4WD5A 4E5AX 4IWOA 3MESA 1V0BA 3DBFA 4R3CA 3QLGA 5D7VA 4C02A 4ZZNA 1OECA 4O0SA 4GFGA 4BDGA 1GNGA 4Y85A 4C4HA 5KMLA 3IW7A 4YMJA 4CYIA 4AZFA 5HVYA 4PP7A 1PMNA 3NZ0A 4EC9A 3ZXTA 5IA4A 3H30A 5M4UA 3Q3BA 4PP9A 2WQBA 1W7HA 4KIKA 3ERKA 3AT4A 3TNQB 5M55A 4E6DA 2X6DA 3PP0A 2QNJA 5JGAA 1S9IA 3R73A 5IU2A 1DAWA 2WO6A 3CY2A 4HCVA 4MQ2A 4XG9A 3QD3A 3ZOSA 5GIPE 1XR1A 3HDMA 5I9UA 3Q60A 4FSRA 4AW5A 1XWSA 3EFKA 4B4LA 2VTJA 3WZEA 4C2VA 2RL5A 3FC2A 3TNWA 4Y95A 1H00A 5IA0A 3UYSA 1KSWA 2V5QA 1F3MC 4YO6A 3V3VA 4ASZA 3SAYA 5BVNA 2OIDA 4RRVA 3FLNC 5FM3A 4ANLA 2C5NA 4JIAA 2BRHA 3H3CA 3PA3A 4FKSA 2ZM1A 4U43A 3UPXA 4BCHA 5EYKA 5JZNA 3U6JA 2OICA 2X8EA 2Y7JA 3HNGA 2YCFA 4DH3A 5HLPA 4AQCA 3T3VA 3MVLA 1CKJA 3HRFA 1Y91A 5CU6A 4FIGA 2VD5A 4O96A 4FVPA 5I9VA 2YM6A 3KFAA 4ZS4A 1XQZA 4IAIA 2IZSA 2HZIA 3D2KA 5DT3A 2ZB1A 4KKEA 1XJDA 4CYJA 5KZ0A 5HHWA 4NIFA 4A7CA 3H10A 3LJ0A 4IW0A 1F5QA 4AN3A 3FMMA 2ITQA 4EHGA 3PY1A 4Q9SA 2XIXA 4GG7A 3UMXA 3A8XA 1KOAA 3WIGA 3ZLXA 5LVPA 3RVGA 3RWQA 2QD9A 5HGIA 3R71A 3IDCA 3KRWA 4O0TA 2VX0A 3ZC5A 4BVUA 3UIBA 1OL7A 3PSCA 3TZ7A 4I4EA 5K0XA 4EOJA 1UWHA 4MNEB 3VF9A 1H1QA 2VO6A 4YZMA 2WIHA 2WOTA 4QMMA 3TT0A 2IVTA 4KBKA 3KVWA 4CMUA 4F4PA 1NT2A 3IO7A 2CKEA 3QQJA 3VS6A 4TWPA 3CPBA 4ACDA 4EH7A 3GFEA 2CGXA 4KRDA 1Z57A 3IK3A 3VRZA 3PA4A 3DKOA 3UNJA 2GNIA 3F7ZA 5CI7A 4BR3A 2AC5A 4OBOA 1VJYA 3IOKA 5AR2A 4F64A 1SZMA 5IDPA 4AACA 3D14A 2QLUA 4BCMA 5KNJA 5GJDA 1TQIA 2IG7A 1MUOA 3PDTA 4CD0A 5M56A 5AUXA 2HXLA 1NXKA 4PDOA 5LWMA 2CLXA 4FV4A 4LOPA 4BCFA 2ITPA 3FMLA 4FUXA 5BMMA 3AT3A 2ITNA 4YTIA 3JVRA 4JOAA 2IW9A 4LOOA 2Z7RA 2ZOQA 5CS6A 3AC1A 4CMTA 3RBWA 4AT3A 5AP6A 3TKHA 1Y6AA 3HGKA 3U8WA 5C4KA 4KRCA 4UYAA 1K2PA 2QQ7A 3L8PA 4JJRA 4MD9E 2W05A 3ZEPA 3QQHA 3PY3A 4JR7A 2B9JA 1H1SA 3V8SA 2C6KA 1I44A 3TJDA 4HYHA 4IB3A 4DE4A 2PK9A 4FKGA 1M14A 4MH7A 1SMHA 4BWKA 1A06A 3P4KA 2X0GA 4FKUA 3N4UA 4I21A 5CVGA 3AMAA 2OF2A 4DGLC 4JRNA 4AS0A 5IA3A 3BLRA 4ENXA 2HW6A 2XZSA 1OIQA 4G6NA 3LAUA 4EOOA 5KMKA 3OMVA 2E9PA 5ETFA 3ZZEA 4EK4A 4ZLZA 5J95A 1MRVA 5AR7A 3UJGA 5CZIA 4ZOGA 5AP1A 2OK1A 3F69A 3VO3A 4OT6A 2WMQA 4CVAA 1GJOA 4DFBA 2EWAA 1Y6BA 2GTMA 3RGFA 4BRXA 3KRLA 5CNNA 3NNUA 3PIZA 4RT7A 2PMIA 3VN9A 5EHYA 2UW8A 3FKOA 3FZOA 5F95A 1ZOHA 2ITOA 3BI6A 5AV3A 3C0IA 3QTXA 2B54A 2JDRA 1YQJA 3ORKA 5J8IA 2O0UA 3GC7A 2X39A 3DFAA 3AG9A 5CALA 2PVFA 3R1YA 3FLSA 4G2FA 4AE9A 4JDIA 5CYIA 4GK3A 4G9CA 5JRSA 4ERWA 4G34A 4LV8A 3CCNA 2GS2A 3RTPA 3VHKA 1WVXA 4CFWA 4U40A 5CAQA 3LXPA 4AA0A 1REKA 4ITJA 1K3AA 4YJVA 5IZFA 4O7YA 3UMWA 4C4GA 3CBLA 3F3WA 3TIZA 3BGQA 4D9TA 3PZEA 2I1MA 3QQUA 3OF0A 4EC8A 4FSYA 5AR3A 2O8YA 4MX9A 1FVRA 4EHEA 3TL8A 4GK2A 4QMQA 1GIHA 1KE6A 2ITVA 3R04A 5C01A 3GCPA 2W06A 3N9XA 4PY1A 4YZBA 3UZPA 1O6KA 3DAEA 3AC5A 4RZWA 3WF7A 4F6UA 2XNOA 2FVDA 2VO3A 1NY3A 2CN5A 2C5YA 2RFNA 1Q3DA 3P5KA 2JEDA 4QMPA 5DI1A 3ZFMA 5DG5A 3ZRLA 4RJ3A 2UW4A 4FK3A 4MQ1A 4KWPA 4PNIA 4DTKA 3CS9A 4BCNA 1OL2A 3QGWA 4GUEA 1R3CA 2ITWA 5L6PA 4DH8A 3VUHA 4HNFA 5HTIA 2DWBA 4BDHA 4CZYB 1PXLA 4JNWA 4RG0A 2V55A 4RIYA 4X2KA 4H1JA 4HGEA 4QYHA 2JLDA 4FV5A 5G6VA 1J91A 4WG4A 5EYMA 2EUFB 1BL6A 3VBVA 2C3JA 2XKCA 3VNTA 4N4SA 4S31A 2NRUA 4E4NA 4NTSA 2ZJWA 3UP2A 5EYCA 5CASA 4JG7A 2YFXA 3NNWA 3VUTA 2P3GX 5IQAA 3NUUA 2PVYA 4XP0A 2PMNX 4U3YA 5KUPA 2WQMA 3ZONA 2VRXA 4CGAA 4FTJA 4K11A 3CP9A 4U42A 5FD2A 4EEVA 4R3PA 2LAVA 1H27A 2VNWA 3OUKA 3P7BA 4D2SA 4KIPA 4UWYA 2IVVA 5HO8A 2XMYA 5GZAA 3QWKA 3TTJA 4AN9A 4WBBB 4QYEA 4WUNA 5I5ZA 5IQIA 4TYGA 1OPKA 1XHAA 2PZ5A 5HO6A 2PZPA 4IX6A 3P78A 4U81A 3G6HA 5CEPA 2YHVA 4FV3A 5F20A 4FV0A 4BBMA 2JD5A 3OT3A 3PA5A 3WYXA 2W1CA 2XJ1A 4RFMA 5HBEA 3DCVA 4IX5A 1YWNA 1YDTE 2C6OA 2OXDA 2V62A 3KK9A 4NIFB 3F3VA 2ITZA 4ZTLA 5EDPA 1VYZA 3FWQA 4F9YA 1JWHA 2HYYA 3KCKA 3DT1A 3CD8A 5LWNA 3NDMA 2X8IA 4KA3A 3TZMA 4C36A 4FT0A 3PVBA 5AUVA 5CSPA 4M12A 5J9ZA 3JY9A 3EMGA 2OJFE 2XEZA 3HMNA 4KSPA 4Y46A 3D5XA 5HU9A 3KL8A 3DY7A 4J8MA 4RIXB 2CNUA 3L8VA 1SVEA 2I40A 5KKRB 3GU4A 4RVTA 5FEQA 5T3QA 3DQXA 2WTKC 3FLQA 3PJ8A 1Q62A 4K77A 3RKBA 1F0QA 2J2IB 3GGFA 4QOXA 2UZBA 1DI9A 5EKNA 1VR2A 3RP9A 3MY5A 4H36A 4DF3A 4O86A 3NYVA 3MY1A 3CKXA 4PMMA 2PE1A 4FOCA 3VBXA 4DCAA 4QYYA 4IE9A 1JBPE 4YHTA 3MJ1A 2J50A 4GK4A 4IXPA 3G15A 2VWYA 4FBXA 2DYLA 3ZYAA 2YIQA 4UN0C 3D15A 4UMTA 4I5HA 5HBHA 2VTLA 4LL5A 2C5VA 4DGMA 2YWPA 1BL7A 3LFFA 4L3LA 2R3IA 3EYGA 3GFWA 4GCJA 4ZJIA 1Q61A 1P5EA 2C47A 3G0FA 3GU8A 3KVXA 3OOGA 3KY2A 1YXUA 3PRIA 3QD0A 4FICA 4U7ZA 3MH1A 5AMNA 2VWIA 3DV3A 4J53A 3V6RA 2G01A 3NIEA 4I6BA 5CI6A 3W16A 4M97A 2JC6A 4HGSA 2BVAA 2OJIA 3BQRA 3KRJA 3G5DA 4EL9A 1WBTA 3QFVA 2X9EA 1LEWA 4KNBA 3DLZA 4F7SA 4JLCA 5FTQA 4BWPA 5LMKA 5DWRA 4FKLA 4BHNA 2UZTA 4Q9ZA 4K8AA 4OW8A 4XUFA 4GFMA 4UALA 4C61A 4CCUA 2O5KA 2QODA 2CSNA 4GSBA 3RK7A 3MA6A 3W2SA 3LLTA 1ZMVA 3LIJA 2VTSA 4RVKA 3RPRA 2J4ZA 3EIDA 4YTCA 4LOQA 4UMUA 3DKCA 3MIYA 2HY0A 4UXLA 4X2FA 4BI1A 2R3GA 3BYOA 3MB7A 1AGWA 5CU3A 4CQGA 3PUPA 3RNYA 4E3CA 2C5OA 4X3JA 1Q8TA 2PVLA 3A7GA 3LCDA 5H8GA 3LQ3A 2OGVA 2YN8A 2WQEA 2CGUA 3FSFA 4G3DA 5LMAA 5JGDA 4FTTA 4X3FC 4N70A 3UIMA 3FZPA 4RWJA 4YTFA 4P4CA 5H3QA 1NVSA 3FEGA 2PVMA 2VZ6A 5DEWA 2Z60A 3OT8A 4X2JA 1KE9A 2XNBA 3D5UA 5C27A 3QC9A 1ZARA 4IFGA 1TQPA 4OTPA 5C8NA 3E8NA 4FOBA 4F63A 2VTIA 3BEGA 3T9TA 1LR4A 2BIKB 2UZWE 4GW8A 4BTKA 2OH0E 5L3AA 3QYWA 4EOSA 2PUPA 3FE3A 4K33A 1V0PA 2C6IA 2GPHA 5DNRA 1PXJA 3NVKI 3C4EA 1FGKA 4LGGA 4RPVA 4C7TA 4F70A 2GNJA 1H01A 3C4ZA 4LMNA 3RZFA 3QQKA 3ZH8A 2OBJA 4OTFA 1L3RE 3E8DA 2JFLA 5IF1A 4E5WA 2XKFA 4I5CA 4YZCA 3VS7A 5H9BA 3BU3A 3ZO1A 2IZRA 3OZ6A 4FKRA 2YLEA 4WSQA 2GS6A 4Y5HA 4DLJA 3MBLA 4ZY4A 3NVMB 2G15A 3II5A 3KXNA 3ULZA 1XH6A 2UZVA 2O64A 3BYSA 5DOSA 1QPJA 3QRUA 2V0DA 1OKVA 4IDTA 3DNDA 2BHHA 5FBOA 5HG7A 3R28A 4EBVA 4FV9A 4NFNA 1L8TA 3PXZA 3LFQA 4XV2A 5EI2A 5AM7A 4YJNA 2RG5A 2GTNA 3VS5A 2WKMA 3KMWA 5HZNA 4YBJA 4OTQA 4PUZA 4YJSA 3F3UA 3VUKA 2XJ2A 3OWLA 4E4MA 5BPYA 1TVOA 3NNVA 2ZDTA 4UZDA 1BLXA 5EK7A 4DFXE 3ACJA 3NYNA 3OXTA 3W8QA 4LUEA 5A4EA 5FWKK 2BAJA 3LQ8A 4FZDB 3Q96A 3WOWA 5A4QA 3A7JA 2YZAA 4WUAA 2BROA 2YABA 2W1FA 4JS8A 3VS2A 2Z02A 3P7AA 3EJ1A 3VS1A 3EKKA 4F9WA 1OITA 3PYYA 3Q6WA 4XG3A 5HBJA 4DTAA 4EOIA 2FH9A 4L67A 4EBWA 4R7IA 4BZDA 1WCCA 5HI2A 4LMUA 4QYGA 2BAKA 2QONA 2VGOA 2C30A 3MFUA 4U3ZA 5I9WA 2ZAZA 5IH5A 3DKFA 4IAYA 3MDYA 2CLQA 1PXKA 3F2RA 5CF4A 1OIUA 4S33A 2UW7A 4G6OA 1PRYA 1ND4A 3ZM9A 4RIXA 5FQDC 4F6WA 4FKWA 3G0EA 1WBWA 2YM4A 2XH5A 3AGMA 3ALOA 4NM0A 4BL1A 2ZM4A 1BUHA 4X6RA 3VW8A 4MTAA 2BRNA 2J0MB 3QBNA 4WA9A 4IM2A 5BVFA 3IG7A 2QR8A 2WOUA 2XKEA 2W99B 3ORMA 3LFAA 4JQEA 2UZLA 4PRJA 4O7LA 3QGYA 5EM8A 3CE3A 3S0OA 3NCZA 3NRMA 5AV2A 3SC1A 4GKIA 4O7VA 4FIEA 4W4YA 3WE8A 3H0ZA 4BCGA 3RCDA 1PXMA 1RQQA 5IMEA 5C8KA 3KQ7A 3N51A 4BN1A 4DH1A 5J7BA 3QZFA 4RZVA 4EHZA 3QA0A 2YITA 2XNGA 4IVDA 4TWOA 5E91A 3R7OA 2O3PA 5E8SA 3A60A 2HIWA 4FTIA 4QTDA 4RX7A 3VBYA 1WBOA 5LCKA 3E64A 4AGUA 4BCJA 5JFSA 4CG9A 3A61A 3HKOA 4RQVA 5CAVA 4FZ6A 4LYNA 1WBNA 4H3QA 3OWKA 3F66A 5GIOE 3QX4A 3ZUVA 4G3GA 4BCIA 5CAOA 4OTRA 4BHZA 3HV5A 4GIIA 2PZYA 5E8XA 5HX8A 2LGCA 3PG1A 3QLFA 3MTFA 4MHAA 2IN6A 5L2IA 4KD1A 5H8BA 3E92A 2XA4A 4PPBA 3CKWA 4TNDA 2C0OA 3I60A 4QP4A 5A6OA 5CWZA 2J0JA 2XIYA 2XNEA 5CQWA 4MBLA 2H34A 4XG8A 3RALA 3IW6A 4R7BA 4FEVA 2QOFA 4NEUA 2J9MA 2UW0A 4V0GA 3MGYA 3R8VA 2GNGA 4BTMA 4QTCA 2H8HA 3HV4A 3LFBA 4F7LA 4OTDA 4QTEA 3I6WA 3Q32A 4J52A 4NKAA 3R9OA 4EH4A 4HVGA 3A7IA 4YSMA 2PUNA 4UEUA 4XLVA 4ZTNA 5EI6A 3UO5A 3LXKA 4HVIA 3Q2JA 3KRRA 4XS2A 3R7YA 5H8EA 1PXIA 3FC1X 5CY3A 2I7QA 2RFDA 3KULB 3P86A 4FTQA 4O2ZA 5TT7A 1HCLA 3KXXA 4FGBA 2JDVA 4YZNA 4M7IA 4ZZOA 3MH2A 3UQGA 4PWNA 2VTMA 5AUZA 3O8UA 3C4CA 4H3PA 5IUIA 3CR0A 3ATSA 1FOTA 2R3OA 3C5UA 1MRUA 2YCRA 4F1OA 4F6SA 4FUYA 3W2PA 5J5TA 4HPUE 5BNJA 3RCJA 3LCKA 4Z7GA 3B2WA 2CNVA 3SXSA 3O17A 3QTQA 3BWJA 3ALNA 5TO8A 1Z9XA 1WBSA 3GU7A 2OKRA 4E8AA 5FDPA 4XH6A 5AP2A 4L52A 1UU3A 3S1HA 3PG3A 4LUDA 3GCVA 2P2HA 2ZV8A 3VWAA 3L9PA 4FODA 2GMXA 3JR1A 4O1OA 5DH3A 5HX6A 3EH9A 3VQHA 3DK3A 1OPLA 1Q5KA 3MN3A 3U9NA 4C4EA 2NRYA 3ID6C 2I0HA 2HZ4A 1IRKA 4TL0A 5C8MA 4O7ZA 4YC8A 4MXZA 5EFQA 3ZHPC 2XCKA 2E9OA 3QRJA 4A4OA 3VBTA 2X7GA 2XP2A 2QKWB 5HLNA 3FPQA 5HO7A 3B8RA 4L8MA 2VTHA 1XH9A 4F7NA 3IONA 3TXOA 3KREA 3P1AA 2EXEA 2R3KA 4FEWA 4TTHB 3QTUA 5GINE 4ITHA 4CKIA 4D2RA 2YACA 3V5WA 3O2MA 3QCQA 5IEYA 2ZDUA 2Z7QA 3I81A 1P14A 4QO9A 4NJDA 4X3FB 4IWPA 4UWCA 2ESMA 4AWIA 3U9CA 4WNKA 5BMSA 3M42A 4GU9A 4F99A 3DXQA 4PTGA 3AD4A 4KB8A 4XOZA 1J7IA 3R7UA 2B9FA 5LCJA 4R5SA 3FZRA 4ITIA 4J97A 4QMWA 4B99A 5EW9A 4FKTA 4MXOA 5HVJA 1XH5A 4AW0A 5J9YA 2UW9A 1K9AA 4M69B 4EK8A 3FPMA 4S2ZA 3FLYA 3MI9A 4A07A 3UQFA 4QP2A 2YDKA 4RWKA 2QO7A 4AN2A 2EB3A 3ZSIA 5C26A 3UVRA 4RJ4A 1TQMA 4DBXA 4XLIA 2R64A 5FTOA 3ROCA 4D0XA 3IKAA 4Z55A 1U59A 5GHVA 4FA2A 5LMBA 5D9HA 4ZSEA 2XBJA 3NMUF 2KTYA 3ORZA 5FTGA 4IM3A 4AW1A 1IG1A 1JPAA 4BDBA 2VX3A 4XEYA 3ZFXA 2WU6A 4AG8A 5FRIA 4GH2A 1PXOA 2P4IA 5HIBA 4F0FA 4JBPA 4N0SA 3QQFA 3QQLA 4MD8E 5E8VA 3LLAA 2WMXA 2GNHA 3HA8A 2WMAA 5JRQA 1E1XA 3MPAA 5HEZA 3D7ZA 3ZEWA 2RKUA 4AGCA 1P4OA 2JKKA 4ZZMA 3ZXZA 2P55A 5AA8A 2GQRA 1JQHA 2PSQA 2VWWA 3OY3A 4WO5A 4O6EA 4NKSA 3PIXA 4HYSA 4FSZA 3NSZA 5DEYA 3PFQA 4B9DA 3PXFA 5J7HA 2R3RA 3R9RA 1OL5A 3Q4TA 1NVRA 2W1GA 4FK6A 5L6WL 3DJ7A 5CEQA 4AFEA 4BI2A 4PMSA 4DHFA 2V7OA 5KHXA 5L2QA 3O50A 3QTRA 5DRDA 4A4XA 3OG7A 4CV8A 5CF6A 4X2GA 3UP7A 1XKKA 1U5RA 5DMZA 5IH4A 4C35A 3DAJA 3EWHA 2CKQA 1XBCA 2IW6A 3RPSA 3NAXA 4EJNA 4AZTA 4ZY5A 2BDWA 2G2FA 3AOXA 4JR3A 4C37A 4JQ7A 4ORKA 4ACCA 1M2RA 4XX9A 1SVHA 3CD3A 4OUCA 4FNZA 4FKJA 1IA9A 3UTOA 2WTVA 4B8MA 1YWRA 2XYNA 3DZOA 4D2PA 1R1WA 2G2HA 3DQWA 3D0EA 2RF9A 2OJJA 5A4LA 4ZTQA 4YGAA 4DGOA 5FG8A 1ZYDA 3NYXA 3G6GA 3ANRA 3TUBA 2EB2A 3DJ6A 5K0KA 1UKHA 3DPKA 3FMHA 3QCSA 4RIOA 4BKJA 2QG7A 4DFZE 3OBGA 3UOLA 5E8ZA 3DS6A 3HRBA 1STCE 2XUUA 3MJ2A 1Q99A 4D0WA 2IJMA 5E7RA 3BHHA 4EH6A 5H2UA 4XV1A 5B2KA 3D7TA 3PXYA 4FTLA 3HAVA 1ZMUA 3AT2A 3KXZA 3COKA 4MF0A 4DGGA 4F08A 5C4LA 4K6ZA 2BZKB 4CKRA 2CKPA 1H26A 3MIAA 5EM6A 4FZAB 4A9SA 1Q41A 3EZRA 4RWLA 2A0CX 3FXXA 3VUDA 4N57A 3TNPC 1JOWB 4WBOA 4RIYB 4TWCA 3COIA 5BYZA 5A14A 3VVHA 2JDOA 2QLQA 4L42A 2G9XA 4EQUA 4DEIA 4DBNA 1MQ4A 3SRVA 3CTJA 3E5AA 3Q4UA 4W8EA 4HGTA 1VZOA 3I5ZA 4APCA 5BUJA 2FSOX 2PU8A 3LFEA 4BCPA 1S9JA 5ANEA 5AAGA 4NU1A 2BKKA 1SVGA 3GC9A 3TV6A 3LFCA 4P5QA 4C3RA 3UNKA 5EG3A 3OW3A 4FTCA 5L2SA 2YM8A 5HG8A 4QMUA 1JVPP 4FVRA 4GT3A 4J1RA 4NZWB 5E1SA 3HVCA 3TDVA 4M0YA 2C3LA 4FV8A 2HELA 2PTKA 3BLQA 2QHNA 3U87A 5KMJA 3DBDA 4EOQA 4I6FA 3L9MA 4MCVA 3I7CA 4HVDA 1W82A 5KMOA 5GNKA 1PY5A 1AD5A 3S4QA 1XBAA 1GZNA 4BDCA 1U5QA 3D4QA 4CFXA 4BCOA 1M7NA 4RC3A 4XOYA 3RWPA 1J3HA 1SM2A 1JSVA 1ZOEA 1YKRA 2XJ0A 4H1MA 1YOMA 4YURA 2NP8A 1YXVA 2ZYBA 2WU7A 3PXQA 2GQGA 4QQTA 3HRCA 5I3OA 4CZUA 3OCGA 5KBRA 2ZMDA 3UVPA 3ZDUA 3DAKA 4DGNA 3SW4A 2C3KA 5AAFA 3H9RA 4ARKA 4BBEA 3UQCA 2PVJA 2R3JA 1G3NA 3CY3A 4MK0A 3W1FA 2XRUA 3AMYA 4LRMA 4MXXA 3GOPA 5EQEA 2OG8A 3Q04A 4U0IA 4E26A 4O2PA 3O8TA 3CGFA 4IAFA 4YLLA 4DCEA 5CAUA 3C0HA 3HV3A 3QKMA 2EU9A 3OBJA 2B4SB 3S2PA 4O21A 5FXRA 4Y5QA 3HP5A 5G1XA 5ANOA 1ZXEA 1SYKA 2Y6OA 4ALWA 4R7HA 4DEEA 4HCTA 2OJ9A 4TYEA 2BTSA 3TG1A 3UZRA 3FYKX 3KRXA 5D7AA 3KA0A 2VX1A 4XP2A 1PXPA 3VBWA 5M06A 3OROA 3V04A 3HDNA 3MFSA 3R8LA 1PYXA 5LMKC 3ORTA 3OS3A 1J7LA 2EXCX 3BEAA 3DFCB 3IGOA 4FMQA 1CTPE 4RFZA 4EKKA 4EZ5A 1H4LA 4PMPA 2J90A 3Q53A 2YM7A 1X8BA 5ANIA 5L6OA 2WTWA 2X4ZA 5AUUA 2FSLX 3QCYA 4DITA 5D11A 3KXGA 1ZYJA 4RJ6A 4ZSLA 4XYFA 2IWIA 1IASA 4BCQA 3NW6A 1E9HA 4YLKA 2FSMX 4O7TA 2XIKA 4P5ZA 4C2WA 4D5KA 5IQGA 3QCXA 4EH3A 5AAEA 2WMUA 3CJFA 2PVHA 2OH4A 3FQHA 4TYHB 3W2RA 3FV8A 4BDIA 4FTRA 5AADA 1YWVA 2OSCA 3ZLSA 2XF0A 3O71A 4FR4A 3SLSA 4A4LA 4MWIA 1ZYLA 1O9UA 5A46A 3BBTB 1IEPA 3E3BX 4FC0A 4HVHA 4MNEA 3WF5A 1Q3WA 3E8CA 3L8SA 3C0GA 4H3BA 4O22A 4I24A 4L6QA 5FBNC 3VS3A 2BRMA 3D9VA 3LCOA 4G9RA 4LG4A 4IVAA 5CANA 3R22A 4OR5A 4ANOA 3OXIA 4D1SA 5HD4A 2WXVA 3E63A 4HGLA 3BZ3A 5E8TA 3PWYA 4UV0A 3VC4A 4S34A 3WF9A 3IDBA 4O38A 3ZO3A 4FTNA 2RFSA 5AM6A 2OZOA 4PL3A 2GS7A 2WMTA 2R3MA 2GNLA 3OTVA 4UX9A 3OOMA 2O2UA 1OIRA 2IVUA 4PNKA 3CSVA 4MYGA 1MQBA 2O65A 5EH0A 4CLJA 4XG4A 1R39A 3RI1A 3LKMA 2QOOA 1YVJA 3K5UA 3GCQA 4MKCA 3KK8A 3F2AA 2Y9QA 4W4VA 4YJUA 4DAWA 3NUYA 3IDPA 3C7QA 1Q8UA 3L1SA 3Q9YA 1BKXA 5EW8A 5BYLA 4JG8A 4CTBA 1JKTA 2PZIA 5TOZA 3ZZWA 1ZRZA 3AQVA 3N4TA 4DTBA 1GZKA 2GDOA 4F1MA 4IX3A 2PPQA 1ZY4A 4RMZA 4NJ3A 3G33A 3EQHA 3RK5A 3M2WA 5KMIA 2J0IA 4CT1A 4TXCA 1OKZA 4Z16A 5J79A 2QOQA 3R6XA 2JBOA 2W0JA 4YZDA 3REPA 4BDAA 3O7LB 2XK6A 1KV1A 4BFMA 2WMRA 4UY9A 4O6LA 3R9NA 4Z7HA 2QR7A 4IWDA 4R1YA 3FLWA 3PJ3A 1B39A 4FG9A 4RX8A 5DGZA 3ODZX 4F7JA 5DRBA 2PUUA 4GT4A 2OIBA 2C6LA 3FQEA 4QRCA 5JEBA 1M7QA 1ZWSA 3FJQE 4PV0A 1IA8A 5J1WA 1DS5A 4EH2A 2OJGA 4MAOA 3KMMA 4JG6A 4D4VA 4S30A 4GG5A 4TYIA 4MBIA 1FBNA 3DK7A 4D1XA 1JKSA 2E2BA 2J5FA 4GMYA 3VW6A 3LFDA 5JSMA 2A4LA 1UV5A 2QHMA 3MVJA 4ZK5A 4A9RA 1QPEA 4XG6A 4C34A 1LUFA 5I3RA 3U55A 4I94A 4UYNA 5F4NA 1YOLA 1O6YA 5ETCA 4JDKA 1OPJA 3KF7A 4LRJA 3SDJA 4YU2A 3U4UA 2C68A 4EYMA 4TPTA 3P08A 2BZJA 5IQHA 3ZTXA 3DNEA 3W2QA 3OTUA 2WD1A 3G9LX 1OI9A 2QOHA 2JIVA 4GVJA 2JITA 3BELA 5KZIA 2IZUA 4BF2A 5E1EA 3V6SA 2ITTA 2IVSA 5IH6A 2QOCA 4O83A 1GOLA 3EFWA 2QCSA 4TKSA 3VS4A 2FO0A 5F94A 4C33A 5FDXA 3FHRA 3UOKA 3MYGA 3FUPA 3V8TA 2YCQA 4NW6A 4IFCA 3SD0A 3HV7A 3NLBA 4CV9A 2XK9A 3Q4ZA 4J99A 2W4JA 3PXKA 4ZIMA 4Q2AA 4D9UA 3UOJA 2XNPA 3NUPA 4OTHA 4M84A 5JK3A 3W18A 4AGWA 5HCXA 2YIXA 4XJ0A 3F7WA 4TNBA 4YPSA 1OVEA 3ZDIA 2BCJA 3IQ7A 5JFVA 1KOBA 2I0VA 2VO0A 4C4IA 1QL6A 3MV5A 4MNFA 3GCUA 4R3RA 3TM0A 4C62A 2VTRA 5KMMA 1OB3A 2PVKA 5AX9A 2QO9A 2BR1A 3BV2A 3QX2A 5ANJA 3VULA 2XK3A 4DC2A 3UVQA 3DU8A 4Y72A 3V5LA 4JX7A 3PWDA 5CSHA 3V8WA 4JRVA 2BHEA 3BYVA 2OWBA 3P9JA 3UBDA 2HXQA 2YJRA 4KINA 3Q52A 4X2NA 4ZAUA 4USEA 4BDFA 3SG9A 1OZ1A 3EN7A 3GP0A 4YHFA 3R1NA 4DEDA 4BDEA 4LGHA 1U54B 1FMOE 3FDNA 3GEQA 4CLIA 2WAJA 3O96A 4D4SA 3A2CA 4QMTA 5FXQA 4NL0A 3MB6A 3AC3A 2WPAA 2UVXA 1PYEA 1CM8A 3QHWA 2ACXA 2QOBA 3TUDA 3FZ1A 3VIDA 5FUTA 4ZMEA 2X4FA 2R5TA 3F3ZA 3RK9A 4FG7A 2WNTA 4ZTHA 3QA8A 4WG3A 4FV2A 3W10A 3NWWA 4J98A 3QUEA 4L46A 3TNHA 5ITAA 4JVGA 3JUHA 1YXTA 3UG1A 3DXPA 3MS9A 4CT2A 4FIIA 1QPCA 2AC3A 3CTQA 4DINA 2R3QA 3OXZA 1ZLTA 3CPCA 5IEVA 3EYHA 5HORA 2W1DA 3NUXA 4NTTA 1Q8WA 1Q8YA 3RPVA 5M4CA 5HESA 4OAUC 3QKLA 4IAZA 2XNMA 5M44A 4FV7A 3QF9A 4QMNA 4I0RA 4X6QC 3F88A 3DBQA 3QALE 4O27B 3ZS5A 3E88A 3HLLA 4O81A 2BZHB 4L44A 5CU4A 2FGIA 3A99A 2WQOA 4M14A 2QURA 5ETIA 4E6CA 3L9LA 4XP3A 3FZTA 2ZM3A 4IQ6A 4ZLOA 1YI6A 2GU8A 4IC7A 4KIKB 2UZOA 4D4YA 4BCKA 4FZFB 3UDBA 4FNWA 4GVAA 2WB8A 4DG2E 3TTIA 2PULA 4OBQA 3PVGA 2B9HA 5LQFA 1WFCA 2H9VA 2Z7SA 1ZYCA 3DDQA 3K3IA 3QZGA 4CMOA 4P2KA 3R83A 3PLAE 3MPTA 3C51A 2R0IA 2OXYA 2WFYA 3OCTA 3PVWA 2FB8A 4NM5A 3C9WA 5CT0A 4JT3A 3R0TA 4AA5A 5HTBA 5EW3A 1FINA 3DB6A 5FM2A 4ZP5A 2YZLA 5JN2A 2UZEA 5KX8A 3KXHA 3KF4A 4W9XA 5J1VA 3NAYA 4NCTA 2JKQA 3F5GA 5CVFA 5CEOA 4ZSJA 1UWJA 4DA5A 1WBPA 2JDTA 3BRBA 3O0GA 1IAJA 3I7BA 5DLSA 1H8FA 3HYHA 4FTOA 4XCUA 4G5PA 1H0WA 4E6AA 4JBOA 4EORA 5L2WA 2XEYA 4ASEA 2VGPA 3Q9XA 3RAIA 4FIHA 5KHWA 3V51A 3CQUA 2J0LA 3S00A 1Y57A 4NK9A 2BIYA 1JSTA 5J9LA 4RLKA 4A9TA 5HNIX 2F4JA 4EJ7A 2B52A 4JI9A 3GT8A 3UG2A 4RC4A 5KMNA 2OZAB 3ODYX 2GHLA 5ANGA 3NUSA 3QYZA 5BVOA 1P2AA 2CN8A 3UO4A 5IA1A 2ITYA 5B2LA 3BHVA 4PDYA 3O51A 4E93A 2YISA 3VUIA 4UBAA 4WNOA 1FQ1B 2W17A 3WYYA 3L8XA 2RGPA 4NT4A 5B2MA 5DA3A 2A19B 4Y8DA 1Q4LA 3EL8A 4ZS0A 2NNWB 5K3YA 4DYMA 2ZB0A 4CFNA 4FT9A 2C0IA 4W4WA 2Y6MA 3GU5A 3ACKA 1NW1A 1ZZ2A 1JLUE 3O23A 3EQIA 2C4GA 3LQ5A 3BX5A 5AV0A 4WSYA 3AC8A 4BIDA 4FE2A 2ONLC 3PPJA 4FL3A 2PVNA 4FKIA 2CDZA 2WHBA 3KB7A 4CEGA 2ITUA 3MW1A 4QP9A 2QO2A 3DOGA 4CKJA 2C6TA 4V05A 1YI3A 4DT8A 2HOGA 3B2TA 3F3TA 4KKHA 3WIKA 4DT9A 3UODA 3F82A 3DA6A 3QKKA 5CXHA 3BU6A 3IECA 5ANDA 4U41A 5BVKA 5F1ZA 2F49A 4AW2A 1Q97A 3U6HA 4C4FA 2B0QA 5IQEA 2FSTX 5CEIA 3AD5A 1PMUA 1V0OA 2YIRA 2H96A 3D7TB 3MFRA 3E93A 1W8CA 3POZA 4YSJA 2ETMA 3MA3A 5CEMA 3AC4A 5E8WA 2A1AB 2VN9A 4YTHA 3VAPA 2ETKA 4H05A 5HNGA 4BDDA 4L7FA 1OGUA 3RAKA 5EQYA 3E7VA 3VS0A 1QPDA 1UVRA 4D2TA 1DI8A 3CQEA 3EQGA 3R2BA 3PJCA 4O0YA 1MP8A 4AF3A 4ACGA 4D2WA 3SG8A 3SOCA 5IQCA 4APPA 2PMOX 3HZTA 4D55A 3H9OA 3NPCA 5BUIA 3H9FA 4FL2A 2PE2A 4OTWA 3O8PA 4IJ9A 3JS2A 1H28A 1JKKA 2W4KA 3HEGA 4BWXA 3ANQA 1ZAOA 2W5AA 2VWBA 4JAIA 3ZSGA 2FUMA 3OEFX 2BPMA 3TV7A 3UPZA 4FKOA 4ZY6A 4BC6A 3C5IA 2JFMA 1OIYA 1ZOGA 2B7AA 3ZFYA 4L68A 3C50A 2XRWA 3BHUA 2Z7LA 3NUNA 3UOHA 1OUYA 1UNGA 4IEBA 4KKGA 1QCFA 1UNHA 4NCTC 3GC0A 4QP1A 5BVDA 5AP4A 4L3PA 5EM5A 4F9AA 4DG3E 4PPAA 3LM0A 1T46A 5K9IA 3I0QA 1G8AA 3RHXA 5HE1A 4FV1A 4QMLA 2Q0NA 4BGQA 5JZJA 4G3CA 3SXFA 1YDRE 1RJBA 3FLZA 4XV3A 1I09A 4RSSA 4QMOA 1BYGA 3HECA 3F61A 5D12A 3BYUA 4J8NA 5E92A 2BILB 4P7EA 3CTHA 3NS9A 5AX3A 3RPYA 4AXAA 2F9GA 4EOLA 3DTCA 1UA2A 4G3FA 2GHMA 4M68A 4PQNA 4EK5A 5I0BA 1JAMA 3QAME 3ITZA 4E6QA 5FEEA 2J5EA 4QYFA 2YCSA 4RVLA 3RAHA 3UGCA 2VTAA 5LVMA 3CXWA 1J7UA 2YIYA 2WTKB 5AV1A 4ANQA 4CG8A 4DG0E 4UXQA 4K2RA 4NM3A 3C4FA 4GS6A 4IB5A 4LQMA 1QMZA 2HENA 3DKGA 2YAKA 3LHJA 4CFUA 3QWJA 2W9FB 3A8WA 2BZIB 3FYJX 4FYNA 4LV5A 4YJTA 4G6LA 4WRSA 3IW8A 3R02A 3WARA 2X7OA 4R78A 3LW0A 5CENA 3G51A 2BDJA 3Q4CA 5IPJA 2ITXA 2YAAA 2ZV7A 5AP3A 2WMSA 2VV9A 3SV0A 4IMYA 1H25A 4KSQA 4AA4A 2B1PA 5E4HA 3VJOA 2JKOA 4O7WA 4FEXA 5EHOA 2ZMCA 3ELJA 3HAMA 4XNEA 5AIKA 4ZTSA 2YIWA 4FIJA 4F1TA 4OLIA 2Y4PA 3PXRA 4X3FA 3MSSA 5LVNA 3NUAA 5ACKA 3TNIA 3PE2A 2CCIA 2F7XE 3TEIA 4CTCA 1NA7A 2W1ZA 1WMKA 3JYAA 3MY0A 4RIWA 4IIRA 3R8PA 5E8UA 2Z8CA 4ASXA 5KO1A 3CIKA 2UZNA
chains in the Genus database with same CATH superfamily
4R8QA 3NW7A 5HVKA 1XH7A 3H4JA 3QHRA 1VEBA 4GIHA 4FV6A 3U54A 4R5YA 4GYGA 2F7EE 3LMIA 3BWFA 4DLIA 4JXFA 3AKKA 2CGVA 3E87A 2XCHA 2Y4IB 1CSNA 2IPXA 3BPRA 4DFNA 3U6IA 5EOBA 4QQCA 4IANA 4DH5A 5AA9A 4KS7A 2WGJA 3AGLA 1U54A 3ENHA 2BALA 3HUCA 3IS5A 3R21A 3GB2A 4I22A 1CMKE 3VUGA 1J1BA 2X2LA 5M09A 3WZKA 3OY1A 2WELA 3V5JA 5CU0A 4FT7A 4FI1A 2WTDA 4O0RA 2F57A 4DFLA 3LMGA 4J71A 1Q8ZA 2ONLA 5IUHA 4BZOA 3JY0A 4Q5EA 5I9ZA 3QZHA 3QQGA 1LP4A 4U80A 4JDJA 3OC1A 3K3JA 5I9YA 4OTGA 5EYDA 1SNUA 1OKWA 3CJGA 4ERKA 1Z5MA 4B8LA 3EFJA 2YEXA 5IQFA 3DK6A 4NWMA 5CAPA 3FY0A 4O4EA 4CFVA 4NSTA 3MVMA 1H0VA 3THBA 3ZC6A 4UMRA 3ZO2A 1G8JA 2VNYA 4FIFA 2PL0A 4GUBA 2X81A 4U44A 5TKDA 2QKRA 3FZSA 4J96A 3EQPA 4IBMA 4AOIA 4RJ7A 3E3PA 3FI4A 4XBRA 4IZ5A 4AOJA 4D1ZA 1H24A 5HCYA 4CFMA 4CXAA 3ORXA 3LMHA 2XM9A 4IAKA 3CLYA 3R63A 5ACBC 4X0MA 4BGGA 2CNQA 4NW5A 4FSWA 2YWVA 3VUMA 4BY9E 1WAKA 4GV1A 3W0OA 2X1NA 3MVHA 1PMVA 1MRYA 4WHZA 4YBKA 5TR6A 4E4XA 4RA4A 4MEDA 4FL1A 1OL6A 2W4OA 2WTJA 3A4PA 4G16A 4EZ7A 2W1HA 1AQ1A 2C1AA 3C1XA 2PZRA 3SA0A 3VQUA 4C8BA 4GJ3A 3VRYA 3HMIA 5LJJA 2C6EA 4YPDA 3OP5A 4AP7A 2OLCA 4FT3A 5CSVA 3V5QA 4FX3A 4C59A 3EQRA 4L9IA 2HY81 1H08A 2SRCA 5AR8A 3TUCA 1G8KA 3FMEA 3R7IA 1WBVA 3FMKA 5EDQA 1YXSA 2BAQA 2W9ZB 1RE8A 3A4OX 3C4WA 3DBCA 3P23A 4W8DA 5HIDA 5KE0A 4CFFA 2PVRA 5AUYA 5CQUA 5DYJA 3BHTA 4EWHA 5CU2A 4IAAA 3KMUA 3MH0A 1GIIA 2XYUA 3NX8A 5HNBA 1YW2A 3BQCA 1OL1A 4IM0A 5ICPA 1CDKA 3UIXA 1ZYSA 3A7FA 3IOPA 4V0GB 4BTJA 5M53A 4RVMA 3EKNA 4AT5A 4QP8A 2DQ7X 3W8LA 5HE3A 3QRKA 3UNZA 4RFYA 3PRFA 4CRSA 5M4IA 4UMPA 3OCSA 4BDKA 4OT5A 3WF8A 2W1EA 5L4QA 3WZDA 4K9YA 4ZSAA 3SW7A 4QQ5A 3UO6A 3QUPA 3K2LA 4I41A 3KU2A 3PIYA 4QMSA 3UC3A 3PE1A 3W0SA 2R7IA 4GU6A 3ZBFA 2XIRA 4RQKA 3JPVA 2J51A 4JBVA 3SKCA 4ZEGA 4QT1A 3P7CA 5KCVA 2ERKA 3BLHA 5JFXA 3DZQA 3SGCA 4BKYA 3R8UA 4L43A 2QI8A 1URCA 3V01A 4TN6A 4FZ7A 4AU8A 4MD7E 4UMQA 3ATTA 2P2IA 3GVUA 5HCZA 1V1KA 1HCKA 4XMOA 4GKHA 4U6RA 1E1VA 2A27A 2X2KA 3P79A 3PPKA 5D1JA 3UC4A 5L8KA 2F2CB 2XNNA 2VAGA 2WTIA 4AXFA 2VWXA 3BIZA 5EM7A 5C1QB 4ANSA 3FXWA 5EDRA 1REJA 3KEXA 3QU0A 3SQQA 2C69A 5AJQA 3TWJA 3DTWA 2XKDA 2Q83A 4CNHA 2XS0A 4I93A 4YC3A 5E90A 5A4TA 2UZDA 3AMBA 3DBEA 4U45A 4CQEA 3OW4A 2QG5A 3VF8A 4IC8A 4QMZA 3ZUUA 2R2PA 2PUIA 4O82A 5KBQA 4USFA 2PHKA 5B0XA 1R0PA 3AD6A 4RA5A 3GUBA 4AAAA 3EN6A 3EZVA 4IZ7A 3GBZA 4KIOA 3BV3A 3HMMA 4AZEA 3IW5A 2HCKA 4C3PA 4HYUA 5CLPA 1NVQA 2R7BA 4M69A 4M15A 4F9BA 2EXMA 3ZMMA 4BI0A 4EI4A 5IUGA 4CRLA 2QOLA 5DPVA 4LM5A 4YC6A 1GZOA 2QVSE 3QZIA 4I0SA 4TW9A 4F09A 4WKQA 3G9NA 3LZBA 2JIUA 4QNYA 4D2VA 4PMTA 5JH6A 3D5VA 4Z9LA 3QD4A 3Q9ZA 3EQBA 1ST4A 1J1CA 2I0EA 3KC3A 3TJCA 3R00A 5JQ5A 2H6DA 2W1IA 3UYTA 1OM1A 4K0YA 3EB0A 1U46A 2OFUA 3W33A 4HW7A 4AT4A 4KBAA 1U4DA 3NR9A 2XB7A 2RIOA 5EKOA 2AYPA 4FTUA 4NH1A 1W2CA 4G5JA 4QPMA 5DR9A 1B6CB 2YLFA 5LVLA 2RFEA 4HJOA 4AX8A 3DXNA 5CNOA 2G1TA 2XVDA 4EK3A 5DR6A 1W83A 4M3QA 4C3FA 2QOIA 4DEHA 3RMFA 1YHVA 4LGDA 3ZCLA 4G31A 1KE5A 3IGGA 5D10A 5LVOA 1P4FA 5AEPA 5HD7A 5E9EA 1YDSE 5FGKA 2WEVA 2JDSA 4PL5A 4DH7A 2R9SA 3FXZA 4QEBA 5AFVA 5AP0A 3ET7A 3EQCA 3S95A 4JX3A 5AUTA 3ZRKA 4O91A 3JVSA 2HWPA 4FVQA 2UV2A 2VWVA 3TI1A 3R7EA 4I1ZA 1H1RA 4QMVA 2W7XA 4QMXA 3ULIA 3PP1A 1GAGA 3KN5A 2R4BA 4C57A 4PTCA 5AR5A 3R7VA 1ERKA 4NFMA 2ERZE 3OHTA 4FSQA 4BYJA 4DN5A 4BDJA 4I23A 4AZSA 2GQSA 3HMOA 2VO7A 4KBCA 2CPKE 3ZLYA 4M8TA 1PHKA 2JIIA 3GI3A 3ETAA 1R78A 4FEQA 4UWBA 4Y83A 3ZU7A 2OU7A 3PY0A 5DN3A 4E1ZA 1M52A 4JDHA 3BHYA 4IB0A 4ID7A 3C4XA 1CKIA 4AGDA 1YOJA 3PSDA 5BX0A 4MXYA 3OFMA 4EKLA 4D58A 4DEGA 2I6LA 5M08A 4EZ3A 5BQ0A 1OGYA 4AQKA 4ASDA 3G90X 3ZM4A 4M66A 4J95A 4L00A 5HKMA 3S3IA 3EOCA 4FSNA 2C0TA 3W0MA 3QC4A 1M17A 3GENA 3QTWA 4G17A 4KAOA 4BZNA 3UE4A 1RDQE 3KN6A 4ACMA 5DR2A 3VHEA 4YNEA 3UIUA 4EOKA 1FMKA 2R3FA 2KULA 4FSUA 3D2IA 2BRGA 5CEKA 4PDSA 1KE8A 2CJMA 4M13A 3T3UA 3PTGA 5HTCA 4V01A 2JBPA 2RG6A 4L01A 4BYIA 3BKBA 4JQ8A 1HOWA 5CSXA 4CZTA 3R1SA 3RJCA 2IW8A 5FEDA 3SOAA 1TKIA 3KCFA 2WIPA 4M67A 3DGKA 3PJ2A 4ZLYA 4I5MA 2HWOA 4QNAA 4F0GA 4E5BA 1BI7A 5EHLA 4FTKA 4HPTE 1H1WA 3HP2A 3GOKA 4E73A 5EI8A 2ZFYA 3OVVA 3UDSA 4FT5A 2VTTA 1BX6A 2YM5A 4WG5A 3TKIA 2UZUE 2VU3A 5GZ8A 2W5BA 2FYSA 4PL4A 4RC2A 5HQ0A 4IB1A 3ENMA 5KKRC 1ATPE 1JNKA 4E7WA 4ACHA 3R9HA 1OUKA 2DS1A 4IVCA 4RX5A 3ORLA 2GSFA 4PF4A 3GQIA 5BUEA 2Q0BA 3PLSA 1PMEA 4D28A 5JGBA 3F6XA 3O7LD 3BGZA 5GZ9A 3GU6A 4TYHA 1YHSA 1G5SA 3OEZA 4HZRA 4S32A 3OWPA 5DHJA 2AUHA 4X7QA 5CXZA 5AIRA 4BTFA 5DVRA 4U8ZA 5DFPA 4RBLA 1WVYA 4KS8A 5T68A 5AV4A 5L2TA 1KWPA 5ETAA 4O0UA 4I92A 4XHKB 4YJPA 5A3XA 4KABA 2ZV2A 2PYWA 3WZJA 3R01A 1W2FA 4JL9A 2XM8A 2P0CA 4YJQA 5A54A 5IQBA 4W4XA 4FF8A 3TN8A 4NUSA 3OD6X 2J6MA 3MPMA 3H0YA 4KUJA 4R77A 4USDA 5DT0A 4EH5A 1XMMA 3TDWA 2UUEA 3R30A 2BUJA 5CSWA 4C4JA 4RGJA 5AUWA 3HL7A 3FI8A 1FVTA 3EQFA 5LOHA 4O84A 2XK8A 3KULA 5EOLA 4P90A 3TV4A 3LM5A 4Y73A 1DAYA 3FMJA 4FYOA 4AZVA 4R6VA 2CGWA 4PPCA 1FPUA 5FXSA 5HOAA 1PXNA 3KGAA 4O1PA 2IZTA 2WQNA 3MTLA 3NW5A 2JGZA 2HAKA 4HYIA 4N6YA 4FKVA 4K18A 1LEZA 1RW8A 2B53A 3OWJA 3P0MA 4TYJA 4F78A 4GJ2A 1ZMWA 5DE2A 4OAVB 4TWNA 2UW3A 2OI4X 2YM3A 3GXLA 5FP5A 4DDIA 1XMLA 4C0TA 3W32A 4GT5A 5IEXA 3TCPA 4EOMA 1SNXA 2X9FA 4FKQA 3D5WA 4IWQA 4EUTA 5GJGA 1EH4A 4DEBA 3VONA 4BBFA 4O7RA 1PKGA 2UVZA 4IVBA 1JSUA 4CSVA 3EN9A 1YI4A 4LL0A 3A7HA 3QXOA 4ZSGA 5CF5A 2XK7A 4M0ZA 2C5XA 4IACA 4AOTA 5HE0A 5M4FA 1W84A 2HW7A 2R3LA 3L9NA 3ORPA 5CZHA 3R8MA 1A9UA 3K5VA 3R7GA 4G3EA 4IH8A 2R3HA 2CKOA 3UZTA 2X2MA 5JQ8A 3MWUA 2HK5A 4FEUA 5CTPA 4LRKA 4LFIA 5BYYA 3ZRMA 3WILA 4E20A 3V5PA 5A9UA 3I4BA 2R3NA 4EQMA 4TZRA 3QTZA 4L45A 4Q5HA 5EQPA 3HV6A 2BFYA 3NEWA 3NIZA 2C6MA 4QP3A 4QPAA 3KXMA 2QU5A 2VWUA 3EQDA 2B55A 2JAVA 3NGAA 3QTSA 3K54A 4GFOA 5JKGA 4G1WA 4GL9A 3BYMA 4L3JA 3RAWA 2RSVA 4YHJA 5ANKA 2XBAA 3LXLA 4U97A 3N4VA 1PJKA 4ZJVA 3I79A 5TF9A 3BBWA 3M1SA 4MWHA 4O0WA 3NCGA 1KE7A 5HIEA 2PMLX 2BTRA 4O0XA 3RNIA 2YJSA 4L7SA 4DEAA 4EQCA 5IA2A 4BB4A 3Q5IA 2WMWA 3E62A 4A9UA 2FA2A 4HZSA 2NPQA 5AP7A 2EVAA 4ZTRA 3W0NA 2C6DA 4XG2A 3RPOA 3W2OA 2JKMA 3DLSA 1UU9A 2HZNA 4QTAA 5IISA 4RIWB 1W0XC 1IR3A 4U79A 3PVUA 4Z3VA 3PPZA 2E9UA 4WRGA 5TE0A 5HE2A 5FP6A 4AXDA 1IAHA 1XBBA 4RJ8A 5CT7A 3DJ5A 4I4FA 5J87A 4O7SA 1ZZLA 3LXNA 4DFUA 4IX4A 3GNIB 1Q24A 3A62A 4MXAA 3LJ2A 4OTIA 1M2QA 3ORIA 3CC6A 3D94A 3QRTA 4FNXA 3FHIA 3TZ9A 4HOKA 5C9CA 3Q6UA 4PDPA 5E8YA 4ALUA 5IDNA 4YR8A 2REIA 1PF8A 2Y4IC 3R8ZA 4IJPA 1UU7A 3LFNA 5AR4A 4ZJJA 3RM6A 1B38A 4EYJA 3GQLA 2UW5A 3IW4A 5BVWA 4F0IA 1G8SA 4YP8A 3CGOA 4AE6A 2P33A 2DUVA 2OF4A 2VTNA 3CEKA 3F5XA 4C38A 1UNLA 3FBVA 4KIQA 3SXRA 4EOPA 4FGRA 4U9AA 3ZBXA 1OMWA 4LI5A 5D41A 4ANNA 4YUQA 3SHEA 4BGHA 2JAMA 3W2CA 5HICA 4JAJA 2GHGA 2WTCA 5AWMA 4F65A 3T8OA 5GJFA 3COMA 4YZ9A 3JXWA 3COHA 5AP5A 4J7BA 3SX9A 3WE4A 4MVFA 4E4LA 3EL7A 4QD6A 2F7ZE 2UW6A 3RHKA 3TZ8A 3FL4A 1TFFA 4WT6A 4LV7A 4CCBA 3HMPA 1KV2A 4EH9A 1H07A 3FI2A 1WVWA 3M11A 4GEOA 2OFVA 5BV3A 1VYWA 2ZVAA 4PTEA 4QP7A 1A48A 3WZUA 2AQXA 4AUAA 4BIBA 5F9EA 1ZY5A 4EHVA 4FTAA 1OBGA 3BE2A 2VUWA 2XANA 3RZBA 2VWZA 4U5JA 2A2AA 5M51A 4NYEA 1DM2A 3VJNA 2A98A 1PKDA 3ROYA 5LARA 3F9NA 2E9VA 1XH8A 2X7FA 4IZAA 4IZYA 3DB8A 3R2YA 2X8DA 3FAAA 2GFCA 2V7AA 2B9IA 3R9DA 5A6NA 3FKNA 4IDVA 5L8LA 2QC6A 2OZAA 4TT7A 2XK4A 2YA9A 3HA6A 2OW3A 3F5UA 3LFSA 5IG1A 4EONA 4I3ZA 4II5A 4EWQA 3SRVB 5HLWA 5A4CA 2CCHA 3Q5ZA 4IHPA 4PX6A 4O0VA 4ANMA 2GNFA 4MBJA 1UU8A 2CHLA 4I6QA 3LCTA 1W98A 1O6LA 1UKIA 1APME 2BDFA 5M57A 3LOKA 3PZHA 5I9XA 3FY2A 1CKPA 1PW2A 4MF1A 3FMNA 1FGIA 1T45A 4HNIA 4W9WA 5BVEA 5K5XA 5CVHA 2WEIA 1OBDA 2BKZA 4TRLA 4RJ5A 1XH4A 3QTIA 5IMXA 2V22A 1YRPA 4WIHA 4N6ZA 3OCBA 4XRLA 4D4RA 2J7TA 1BI8A 5M07A 3ZSHA 2Y8OA 3Q9WA 5JFWA 3WF6A 3F2NA 3Q2MA 2WMBA 4EK6A 4D5HA 3E7OA 2G2IA 2BFXA 4XRJA 3POOA 3C13A 4XV9A 3PJ1A 1YXXA 4DHIB 4V04A 4YNOA 3F5PA 2NO3A 1GIJA 2HZ0A 4UB7A 1URWA 4WNPA 2X6EA 4AZWA 2F2UA 2VTPA 3B8QA 3QXPA 3LVPA 4HVSA 2VTOA 3AC2A 1BMKA 3V5TA 3GCSA 3FI3A 4ONAA 3FL5A 3BE9A 3QD2B 1R0EA 2QU6A 3EN4A 3ORNA 4QP6A 4OBPA 4TY1A 3TACA 5J5SA 4X21A 4DFYA 4HCUA 2E9NA 3GC8A 3QL8A 2YDIA 4ZMFA 3EN5A 3TIYA 3HX4A 3QRIA 4XG7A 3MFTA 1M2PA 3BU5A 2GFSA 2ETRA 2GCDA 2W96B 2PWLA 2YDJA 4I6HA 4EUUA 2OXXA 4FSTA 5JMSA 4JIKA 5K4IA 4QMYA 4ALVA 5DBXA 3NNXA 3R1QA 3ZLWA 3DDPA 4JBQA 3IPHA 3FMDA 3OUNB 4WNMA 5CF8A 5DT4A 2R3PA 4BIEA 2O63A 3I0OA 1YHWA 4ZTMA 5B7VA 1H1PA 3KKVA 4IADA 3MH3A 2ZV9A 4YLJA 2BMCA 5HU3A 1WZYA 2XIZA 4RLLA 2WMVA 4H58A 4ENYA 3U51A 4C58A 2Y0AA 1Y8YA 3EHAA 3NYOA 4I20A 4ZXTA 4B6LA 4L53A 3BGPA 4XBUA 2QOKA 1FVVA 4FKPA 1XO2B 4QTBA 3VBQA 3LCSA 2PE0A 2WZJA 4O7NA 4FNYA 4YJOA 3I1AA 3RM7A 5K4JA 3TKUA 1KUTA 5I4NA 4R1VA 3BCEA 3SVVA 3PSBA 4MXCA 3EFLA 3RINA 2C1BA 1OKYA 4EH8A 2I0YA 5JT2A 4FG8A 5IA5A 4OGRA 4WOVA 4B7TA 4BKZA 5LXMA 2IO6A 5HG9A 4AFJA 4GRBA 2R0UA 2YERA 4B0GA 4I5PA 2Z2WA 4YO4A 3WI6A 3ZO4A 2PY3A 5K5NA 1LPUA 4QQJA 4ANBA 3WBLA 2VTQA 3QUDA 4QPSA 4UZHA 5DIAA 3LE6A 3HUBA 4NM7A 1GZ8A 4A9YA 2CMWA 1JKLA 3CQWA 4FJVA 4YJRA 5T6KA 4H39A 4RX9A 5FLFA 4GYIA 2BRBA 2C3IB 2OO8X 4K1BA 3ZUTA 4FSMA 3T9IA 3U4WA 3D83A 5L8JA 2OIQA 3I5NA 5CX9A 4A06A 4I0TA 3G2FA 4FTMA 5C03A 2J0KA 3FQSA 3W55A 4F9CA 1GY3A 3I6UA 3FKLA 5IKWA 5IQDA 3FSKA 2W5HA 3E8EA 3LPBA 1Y8GA 4RWIA 2UVYA 5HG5A 4BICA 3AXWA 3LJ1A 4WD5A 4E5AX 4IWOA 3MESA 1V0BA 3DBFA 4R3CA 3QLGA 5D7VA 4C02A 4ZZNA 1OECA 4O0SA 4GFGA 4BDGA 1GNGA 4Y85A 4C4HA 5KMLA 3IW7A 4YMJA 4CYIA 4AZFA 5HVYA 4PP7A 1PMNA 3NZ0A 4EC9A 3ZXTA 5IA4A 3H30A 5M4UA 3Q3BA 4PP9A 2WQBA 1W7HA 4KIKA 3ERKA 3AT4A 3TNQB 5M55A 4E6DA 2X6DA 3PP0A 2QNJA 5JGAA 1S9IA 3R73A 5IU2A 1DAWA 2WO6A 3CY2A 4HCVA 4MQ2A 4XG9A 3QD3A 3ZOSA 5GIPE 1XR1A 3HDMA 5I9UA 3Q60A 4FSRA 4AW5A 1XWSA 3EFKA 4B4LA 2VTJA 3WZEA 4C2VA 2RL5A 3FC2A 3TNWA 4Y95A 1H00A 5IA0A 3UYSA 1KSWA 2V5QA 1F3MC 4YO6A 3V3VA 4ASZA 3SAYA 5BVNA 2OIDA 4RRVA 3FLNC 5FM3A 4ANLA 2C5NA 4JIAA 2BRHA 3H3CA 3PA3A 4FKSA 2ZM1A 4U43A 3UPXA 4BCHA 5EYKA 5JZNA 3U6JA 2OICA 2X8EA 2Y7JA 3HNGA 2YCFA 4DH3A 5HLPA 4AQCA 3T3VA 3MVLA 1CKJA 3HRFA 1Y91A 5CU6A 4FIGA 2VD5A 4O96A 4FVPA 5I9VA 2YM6A 3KFAA 4ZS4A 1XQZA 4IAIA 2IZSA 2HZIA 3D2KA 5DT3A 2ZB1A 4KKEA 1XJDA 4CYJA 5KZ0A 5HHWA 4NIFA 4A7CA 3H10A 3LJ0A 4IW0A 1F5QA 4AN3A 3FMMA 2ITQA 4EHGA 3PY1A 4Q9SA 2XIXA 4GG7A 3UMXA 3A8XA 1KOAA 3WIGA 3ZLXA 5LVPA 3RVGA 3RWQA 2QD9A 5HGIA 3R71A 3IDCA 3KRWA 4O0TA 2VX0A 3ZC5A 4BVUA 3UIBA 1OL7A 3PSCA 3TZ7A 4I4EA 5K0XA 4EOJA 1UWHA 4MNEB 3VF9A 1H1QA 2VO6A 4YZMA 2WIHA 2WOTA 4QMMA 3TT0A 2IVTA 4KBKA 3KVWA 4CMUA 4F4PA 1NT2A 3IO7A 2CKEA 3QQJA 3VS6A 4TWPA 3CPBA 4ACDA 4EH7A 3GFEA 2CGXA 4KRDA 1Z57A 3IK3A 3VRZA 3PA4A 3DKOA 3UNJA 2GNIA 3F7ZA 5CI7A 4BR3A 4AXCA 2AC5A 4OBOA 1VJYA 3IOKA 5AR2A 4F64A 1SZMA 5IDPA 4AACA 3D14A 2QLUA 4BCMA 5KNJA 5GJDA 1TQIA 2IG7A 1MUOA 3PDTA 4CD0A 5M56A 5AUXA 2HXLA 1NXKA 4PDOA 5LWMA 2CLXA 4FV4A 4LOPA 4BCFA 2ITPA 3FMLA 4FUXA 5BMMA 3AT3A 2ITNA 4YTIA 3JVRA 4JOAA 2IW9A 4LOOA 2Z7RA 2ZOQA 5CS6A 3AC1A 4CMTA 3RBWA 4AT3A 5AP6A 3TKHA 1Y6AA 3HGKA 3U8WA 5C4KA 4KRCA 4UYAA 1K2PA 2QQ7A 3L8PA 4JJRA 4MD9E 3P5JC 2W05A 3ZEPA 3QQHA 3PY3A 4JR7A 2B9JA 1H1SA 3V8SA 2C6KA 1I44A 3TJDA 4HYHA 4IB3A 4DE4A 2PK9A 4FKGA 1M14A 4MH7A 1SMHA 4BWKA 1A06A 3P4KA 2X0GA 4FKUA 3N4UA 4I21A 5CVGA 3AMAA 2OF2A 4DGLC 4JRNA 4AS0A 5IA3A 3BLRA 4ENXA 2HW6A 2XZSA 1OIQA 4G6NA 3LAUA 4EOOA 5KMKA 3OMVA 2E9PA 5ETFA 3ZZEA 4EK4A 4ZLZA 5J95A 1MRVA 5AR7A 3UJGA 5CZIA 4ZOGA 5AP1A 2OK1A 3F69A 3VO3A 4OT6A 2WMQA 4CVAA 1GJOA 3UDZA 4DFBA 2EWAA 1Y6BA 2GTMA 3RGFA 4BRXA 3KRLA 5CNNA 3NNUA 3PIZA 4RT7A 2PMIA 3VN9A 5EHYA 2UW8A 3FKOA 3FZOA 5F95A 1ZOHA 2ITOA 3BI6A 5AV3A 3C0IA 3QTXA 2B54A 2JDRA 1YQJA 3ORKA 5J8IA 2O0UA 3GC7A 2X39A 3DFAA 3AG9A 5CALA 2PVFA 3R1YA 3FLSA 4G2FA 4AE9A 4JDIA 5CYIA 4GK3A 4G9CA 5JRSA 4ERWA 4G34A 4LV8A 3CCNA 2GS2A 3RTPA 3VHKA 1WVXA 4CFWA 4U40A 5CAQA 3LXPA 4AA0A 1REKA 4ITJA 1K3AA 4YJVA 5IZFA 4O7YA 3UMWA 4C4GA 3CBLA 3F3WA 3TIZA 3BGQA 4D9TA 3PZEA 2I1MA 3QQUA 3OF0A 4EC8A 4FSYA 5AR3A 2O8YA 4MX9A 1FVRA 4EHEA 3TL8A 4GK2A 4QMQA 1GIHA 1KE6A 2ITVA 3R04A 5C01A 3GCPA 2W06A 3N9XA 4PY1A 4YZBA 3UZPA 1O6KA 3DAEA 3AC5A 4RZWA 3WF7A 4F6UA 2XNOA 2FVDA 2VO3A 1NY3A 2CN5A 2C5YA 2RFNA 1Q3DA 3P5KA 2JEDA 4QMPA 5DI1A 3ZFMA 5DG5A 3ZRLA 4RJ3A 2UW4A 4FK3A 4MQ1A 4KWPA 4PNIA 4DTKA 3CS9A 4BCNA 1OL2A 3QGWA 4GUEA 1R3CA 2ITWA 5L6PA 4DH8A 3VUHA 4HNFA 5HTIA 2DWBA 4BDHA 4CZYB 1PXLA 4JNWA 4RG0A 2V55A 4RIYA 4X2KA 4H1JA 4HGEA 4QYHA 2JLDA 4FV5A 5G6VA 1J91A 4WG4A 5EYMA 2EUFB 1BL6A 3VBVA 2C3JA 2XKCA 3VNTA 4N4SA 4S31A 2NRUA 4E4NA 4NTSA 2ZJWA 3UP2A 5EYCA 5CASA 4JG7A 2YFXA 3NNWA 3VUTA 2P3GX 5IQAA 3NUUA 2PVYA 4XP0A 2PMNX 4U3YA 5KUPA 2WQMA 3ZONA 2VRXA 4CGAA 4FTJA 4K11A 3CP9A 4U42A 5FD2A 4EEVA 4R3PA 2LAVA 1H27A 2VNWA 3OUKA 3P7BA 4D2SA 4KIPA 4UWYA 2IVVA 5HO8A 2XMYA 5GZAA 3QWKA 3TTJA 4AN9A 4WBBB 4QYEA 4WUNA 5I5ZA 5IQIA 4TYGA 4AAYA 1OPKA 1XHAA 2PZ5A 5HO6A 2PZPA 4IX6A 3P78A 4U81A 3G6HA 5CEPA 2YHVA 4FV3A 5F20A 4FV0A 4BBMA 2JD5A 3OT3A 3PA5A 3WYXA 2W1CA 2XJ1A 4RFMA 5HBEA 3DCVA 4IX5A 1YWNA 1YDTE 2C6OA 2OXDA 2V62A 3KK9A 4NIFB 3F3VA 2ITZA 4ZTLA 5EDPA 1VYZA 3FWQA 4F9YA 1JWHA 2HYYA 3KCKA 3DT1A 3CD8A 5LWNA 3NDMA 2X8IA 4KA3A 3TZMA 4C36A 4FT0A 3PVBA 5AUVA 5CSPA 4M12A 5J9ZA 3JY9A 3EMGA 4AXEA 2OJFE 2XEZA 3HMNA 4KSPA 4Y46A 3D5XA 5HU9A 3KL8A 3DY7A 4J8MA 4RIXB 2CNUA 3L8VA 1SVEA 2I40A 5KKRB 3GU4A 4RVTA 5FEQA 5T3QA 3DQXA 2WTKC 3FLQA 3PJ8A 1Q62A 4K77A 3RKBA 1F0QA 2J2IB 3GGFA 4QOXA 2UZBA 1DI9A 5EKNA 1VR2A 3RP9A 3MY5A 4H36A 4DF3A 4O86A 3NYVA 3MY1A 3TMOA 3CKXA 4PMMA 2PE1A 4FOCA 3VBXA 4DCAA 4QYYA 4IE9A 1JBPE 4YHTA 3MJ1A 2J50A 4GK4A 4IXPA 3G15A 2VWYA 4FBXA 2DYLA 3ZYAA 2YIQA 4UN0C 3D15A 4UMTA 4I5HA 5HBHA 2VTLA 3AKLA 4LL5A 2C5VA 4DGMA 2YWPA 1BL7A 3LFFA 4L3LA 2R3IA 3EYGA 3GFWA 4GCJA 4ZJIA 1ST0A 1Q61A 1P5EA 2C47A 2IEWA 3G0FA 3GU8A 3KVXA 3KY2A 1YXUA 3OOGA 3PRIA 3QD0A 4FICA 3MH1A 5AMNA 2VWIA 3DV3A 4J53A 3V6RA 2G01A 3NIEA 4I6BA