2FYSA

Crystal structure of erk2 complex with kim peptide derived from mkp3
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
349
structure length
348
Chain Sequence
GPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Structural basis of docking interactions between ERK2 and MAP kinase phosphatase 3
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 88
structure length 348
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2fysA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2fysA01
2XEZA 2O5KA 4L46A 2ACXA 3RPRA 5AV2A 2VRXA 1UNGA 3TNPC 4EQUA 5BUIA 3OW4A 4NJDA 5CVHA 5KMLA 3W2PA 3UE4A 4CRSA 2IZTA 4L3JA 4O0WA 2X8EA 4ITJA 1W84A 4XG6A 2QOKA 3RAIA 4B0GA 5G1XA 3DDPA 2R0UA 3D2IA 3QTWA 3ZS5A 2YCRA 4DFLA 2HOGA 4AFEA 5EM5A 3MB6A 3MH3A 3FPQA 4L8MA 3FV8A 4QP6A 5CI6A 4L3PA 3SOCA 4BBFA 2DS1A 2W5BA 3IDPA 2EVAA 2J7TA 4K0YA 5HTCA 4WUNA 5EH0A 4QP9A 4N4SA 4U0IA 2XB7A 1G5SA 3IOPA 4QQCA 1KE9A 1JVPP 2PVMA 3OW3A 3BHUA 4KINA 4MH7A 4UXQA 1RQQA 4W8EA 5EQYA 1TQIA 2P2HA 4WBOA 4ZZNA 2UW8A 1BYGA 3MESA 5LQFA 5FP5A 2R0IA 4BCQA 4KB8A 3GU7A 2XBJA 3FQSA 2IZSA 2VO6A 3AMYA 3E64A 4AT4A 3KULB 5JKGA 4B8LA 4DGNA 1H24A 4YSJA 3I1AA 1OUKA 4FTJA 4X2KA 3DB6A 3RK7A 2OIBA 3CIKA 4H58A 3TV6A 3U51A 1LPUA 4WD5A 1OL6A 3R9HA 3OBJA 2IW6A 4Y73A 3UPZA 4HCUA 5CASA 2QU5A 5JFSA 4LYNA 5DR9A 4AOTA 3NIEA 4F64A 4F65A 4M67A 4BI1A 4QMTA 5HX8A 4EHZA 4FGBA 4QP8A 5E8SA 3O7LB 2EU9A 4F7LA 2OJFE 3BE2A 2RFSA 3CQWA 4ZY6A 5IQEA 4JS8A 3HUBA 4XEYA 3OP5A 3CXWA 3OXTA 4NCTC 4BR3A 2WU6A 1OVEA 4J1RA 4Z16A 3BYSA 3WZDA 4O38A 3FLZA 5FTGA 4LM5A 3KULA 3WZEA 2HW6A 2WB8A 3TEIA 5G6VA 5JT2A 2YM5A 2C3IB 1WFCA 2ITQA 4BIEA 2RFDA 4KA3A 4U5JA 5T68A 4RC4A 4ZJVA 5A46A 5A4TA 2NO3A 5CSVA 1FVRA 3IDBA 3DKGA 4G9CA 3GOPA 2O2UA 4O0TA 3BX5A 4ACDA 3O0GA 1ZOHA 4ANOA 4BHZA 5AAEA 1NY3A 3FMDA 2XNNA 3MY1A 1LUFA 2W7XA 2HW7A 4QP1A 3SX9A 2VTTA 4O0VA 4WNKA 3WE4A 3R01A 4GK3A 4G16A 4G6NA 5HG9A 3BV3A 3MTFA 2BDWA 3NW5A 4IWQA 4PPBA 4TZRA 4IVDA 3ZDIA 4BZOA 3DFAA 4KKEA 4DH7A 2OIQA 4EONA 2EWAA 4QO9A 4WG5A 5E90A 3FKNA 4E6QA 3BE9A 2QD9A 5KO1A 2XBAA 3CD8A 4PL4A 4G3CA 4OT5A 4RJ8A 4DGMA 3ZU7A 5BVKA 1LEWA 4LG4A 3E88A 3RI1A 5AP4A 4BI0A 5CAQA 3L8PA 3R8UA 3ERKA 3OF0A 2LGCA 4AW5A 3DPKA 3LLTA 4J95A 1UU9A 1AGWA 4NUSA 4KABA 1OGUA 1QPDA 4KNBA 5A4LA 1GIIA 3NCGA 2ZYBA 3F5XA 5L3AA 2QOCA 3BYOA 3G33A 3R7GA 5DWRA 4TYJA 2ZV8A 3AQVA 4X21A 2OKRA 4QMOA 2OSCA 5E8XA 5HO6A 2R64A 2PZRA 3FC1X 2Q83A 4O2ZA 5HIEA 1YI3A 5AIKA 4DEHA 5JGDA 3P79A 2QI8A 5L8LA 1OM1A 5LARA 5JFXA 3T3UA 3W16A 4ASEA 4QMPA 2O64A 1UWHA 4LOPA 2C47A 3N9XA 4GIIA 4IM0A 2YLFA 4RGJA 2PY3A 4YJVA 5GJGA 4KKGA 3NUNA 2C0TA 3OY3A 4RJ7A 5EHOA 5F94A 3W2QA 3W2OA 5HNIX 3WIGA 3LAUA 4J98A 1J7UA 2GS7A 4YZCA 3LFDA 2VV9A 4FUYA 3MGYA 4I93A 5A14A 3OOMA 2QKRA 3MY0A 4KIQA 5ANDA 5K0KA 2QHMA 3MS9A 3POZA 2VWZA 3RAHA 2H6DA 1XH4A 3KXZA 1OIUA 2QQ7A 3FMNA 4HZRA 4I6QA 4F4PA 3KFAA 2X9FA 3FE3A 4LV5A 4WSYA 1ZWSA 3QYZA 1J7IA 3OHTA 2JDRA 2W1IA 3LJ0A 1EH4A 2BDFA 2GPHA 3QZHA 1KV2A 3I0QA 4X6QC 2W0JA 2OW3A 3A7FA 2B4SB 3DJ5A 5DR2A 4CMOA 2ETKA 5K0XA 4G6LA 2ZM3A 3FI3A 4HGTA 3Q2JA 5DA3A 3ZSGA 5BVFA 1JSVA 3NR9A 4I22A 2VU3A 4ANBA 3N4VA 4R6VA 3C4FA 3A7HA 3KCKA 3DNDA 4E4XA 4TNDA 4X2FA 3O8UA 4MD7E 1ZOEA 2XKDA 4ALVA 4QMXA 1DM2A 4RX5A 1DI8A 3OZ6A 5I3OA 3FLSA 1H07A 3I60A 3LVPA 3UOLA 2BAJA 3MFRA 4ZLZA 2HWOA 5H2UA 4OTDA 5JH6A 4OAUC 4OTQA 5HNBA 1YW2A 3O2MA 3ZO3A 4UZDA 2W4KA 3A7IA 3QD0A 3TZMA 5IISA 4AN2A 3GBZA 5D9HA 4MF1A 4K6ZA 2VWVA 2XK4A 5ETFA 4FEWA 5FBNC 3DT1A 2OFUA 2JFMA 4I5HA 3AC3A 1IAJA 3LCSA 3BBTB 1MRUA 4QNAA 2XIKA 2OJIA 3H9FA 2WEIA 3PVUA 3HLLA 3A8XA 4LL5A 4RC3A 5EW8A 1S9JA 4FA2A 5CEPA 4JNWA 1WBVA 4FKGA 1WBOA 5F20A 4I6BA 4DTBA 1GY3A 3EB0A 3QC4A 5J5TA 3HMIA 1GIJA 1WBPA 2UZVA 3EYHA 4AA5A 2ZJWA 4YNEA 4DG0E 5KUPA 5DT3A 4OBOA 4D1XA 4H1MA 2YM7A 4O0YA 4A9SA 4YPDA 2ITVA 3ZXTA 2B55A 2JDSA 3DKCA 2PE0A 3W18A 2C6DA 3WYXA 2PVFA 4U44A 3ROYA 4AGCA 2GMXA 3QTIA 5FXSA 2B9JA 4EYMA 4NKSA 3Q3BA 3VBTA 3R73A 5CXHA 1M2QA 4IH8A 4R7HA 3PE2A 5IU2A 1SVHA 4MQ1A 3TNWA 3CCNA 2JIIA 3O17A 3G6HA 3RCDA 4BICA 3LKMA 2ESMA 3GT8A 5IQCA 2B9FA 2UZUE 3MVLA 2JKQA 4ZJIA 4DFXE 2X4FA 4AWIA 4KBCA 1GIHA 2O65A 4HYUA 3RPYA 3DNEA 4CG8A 5C8MA 4PDYA 4IAKA 5LVOA 4YC6A 4IQ6A 5FP6A 3PSDA 3LMIA 4FKTA 2Z7SA 4GS6A 4ZLYA 5AA8A 4ZS0A 4NW6A 2JIUA 5E8WA 5HLNA 3EN9A 5HG5A 4H05A 3I7BA 4QMZA 2WMBA 3QA0A 2F4JA 3C0GA 5CWZA 1Y6AA 3D83A 3QRTA 2C3LA 2JAMA 4N6ZA 4QNYA 5FM2A 3LMHA 1YWRA 3P7AA 5IA1A 3LXKA 2E9VA 4NCTA 4YZMA 1OL7A 3L1SA 5C1QB 2WTWA 4DF3A 3EN6A 4RT7A 3E8CA 3JVRA 2G2HA 4AQCA 4RJ3A 1WBSA 5CQUA 2RG6A 1H1QA 3G9NA 2XK7A 4M69B 4X2NA 3RWPA 4DGLC 5L8KA 1APME 1B38A 1R39A 2BROA 2OZAB 2ETMA 5AR7A 5BX0A 1YWNA 1W0XC 3BHTA 4F1MA 2YM4A 1JKLA 3JR1A 4F70A 1FQ1B 5B7VA 2C5NA 3RPVA 2ZVAA 1BL7A 1OKVA 3TXOA 3RKBA 3EQBA 3I6UA 3R7IA 5BYYA 1H27A 3FKLA 4Y95A 4ANMA 4QMSA 1OL5A 2G9XA 3UVPA 3PIXA 3WZKA 2IZUA 4O91A 3KXNA 1SZMA 2VO3A 2BIYA 3ZZEA 4TL0A 3DXQA 3FI8A 2UVZA 5KZIA 4XOZA 4MVFA 4XHKB 4DT8A 3AGLA 2C5OA 4FTQA 4FOCA 3DTCA 5CAOA 5ETCA 5L2SA 4Y46A 3EH9A 3RBWA 3GQIA 3JY0A 3A8WA 3JPVA 3UIUA 4EH4A 4PMPA 3TNQB 2UW3A 3CKWA 2UVXA 4Q5EA 4ALUA 3EQDA 1KE7A 4O21A 2OZAA 2Y6MA 1J91A 4UMTA 3QA8A 4R5SA 3A61A 3UNKA 4YBJA 4NSTA 3QTZA 5M56A 1PXNA 2CCHA 3IDCA 3NUSA 5AIRA 3DGKA 2XEYA 3QX4A 3RZBA 4DGGA 4GG5A 4P7EA 3OWPA 2W06A 3C1XA 2R3JA 4FTCA 1K2PA 2HZ4A 4CD0A 5I9WA 1HOWA 3KU2A 3C5UA 3GFEA 2WO6A 4IZ7A 1M2RA 5ANEA 5AUZA 3A62A 3WF8A 4QTEA 4U7ZA 5L4QA 3BEGA 4L68A 3U4WA 3IECA 4FKQA 4ZTRA 4BCFA 2A4LA 2GCDA 3H30A 3HDMA 3W2SA 1PYEA 3IW5A 3NVKI 3EN5A 5HNGA 1I44A 5AA9A 3OCGA 4LRJA 2YWPA 3QRIA 4QYYA 5FLFA 3HMPA 3TKHA 4EOKA 3PVBA 4ZIMA 1OPJA 3BYMA 3FZOA 1M52A 4JG7A 3OS3A 5JSMA 2XM9A 3LZBA 4O0SA 3JYAA 4CCUA 2OK1A 3EZRA 3PA4A 4FTKA 3NUUA 4L01A 3QD2B 4I21A 2WMWA 3Q4TA 1PXMA 1H4LA 4HVIA 4OW8A 3VIDA 4JBQA 4FKJA 3QBNA 3PP1A 4MBIA 4EH2A 3R02A 4ZTHA 4ZTQA 4YTFA 4OLIA 3V5WA 3LIJA 2OGVA 4EJ7A 3PJ3A 4CFNA 5A4CA 4YR8A 4BCHA 2YWVA 4Y5HA 4OTHA 3SOAA 3CE3A 2WMUA 4FSUA 1JKKA 4JRNA 3TL8A 4JOAA 3O51A 3RPSA 2WAJA 2IVSA 5LMAA 3VWAA 3OEZA 2CGXA 3C51A 5EI6A 5AR2A 4ZTLA 3T8OA 5AAGA 4E93A 2PL0A 3BCEA 1IR3A 3QYWA 3LFAA 1KUTA 3DZQA 4ZSJA 2W1DA 4GIHA 1ZMVA 4U8ZA 5AUTA 4AOIA 3R7EA 2W1CA 3E62A 3H0YA 2CN8A 2HENA 3TV4A 3UOJA 3BGPA 4AE9A 4DITA 2CKQA 4CMTA 4E5WA 4EH7A 3FJQE 4BTMA 3DZOA 4JR3A 3PXKA 2PUIA 5IA5A 4I5CA 3DJ6A 1PKGA 3KA0A 4K8AA 3RTPA 3QX2A 2XIYA 4O0XA 4QP2A 1XH9A 4KIKA 4Z9LA 2YIYA 4F08A 3UZPA 2ITYA 1URCA 2XH5A 3MFTA 4I1ZA 3OVVA 3D5XA 5EHLA 2UW9A 5EFQA 3SW4A 4CFFA 1Q97A 1Q8TA 4I0RA 4UEUA 4UZHA 1Y6BA 3KMMA 4G17A 4U3ZA 4ALWA 2WKMA 2YZAA 4UMQA 5EW3A 4GK2A 4NFMA 3D0EA 3NAYA 4BDEA 4FEUA 3DCVA 5FRIA 4ANSA 2HIWA 4MNEB 3S1HA 4ZS4A 3W10A 4NW5A 3ZLYA 3WF5A 2EXEA 4FNYA 3DXPA 5DYJA 3WE8A 2O0UA 4H36A 4WBBB 3UQGA 3EHAA 3EQHA 3F61A 3OCTA 3SDJA 4G2FA 3WF6A 1OIYA 1X8BA 3NIZA 3QQGA 2B1PA 2X39A 4JAIA 4FK6A 3FMKA 4MBJA 5J95A 3UVRA 2QG7A 2PZIA 4A9YA 4EHGA 3K54A 1VYWA 2W4OA 5IH4A 5GIPE 3KY2A 2J50A 3GUBA 4GG7A 1Z57A 5JGBA 2OXDA 3NS9A 3U55A 2WGJA 1ZZLA 2PYWA 3R21A 2XNBA 3ANQA 3P7CA 4CEGA 1JSUA 5EDQA 3KRWA 1OPKA 2PHKA 4JQ7A 1VEBA 4M66A 3R7VA 4HZSA 4MNEA 4C02A 3AMAA 4IHPA 3MTLA 3JS2A 2OXYA 3O71A 5HCYA 3F3TA 4YU2A 5B2MA 3II5A 3TDWA 4JDKA 3UO6A 2WQMA 3IGGA 4PV0A 4BYIA 4TWCA 1WBTA 2IVVA 4FKWA 4FTIA 4G6OA 5EOBA 4D2VA 5K4IA 3R9DA 5GIOE 4QYEA 2F2UA 3QTQA 3K5VA 2WQNA 3BU6A 5JQ5A 5LWNA 3DLSA 5CEOA 4FEQA 5GZAA 2WQBA 4NM7A 4RJ6A 3TIYA 5FTQA 4DTKA 4PTEA 3AC4A 3ORIA 1J3HA 4BCKA 2GFCA 4FIFA 1IA9A 3VNTA 5EYKA 5D41A 4JL9A 2VTMA 3RALA 3WIKA 1GAGA 1CSNA 4AW2A 4W4YA 5HOAA 3LXPA 1YRPA 2XS0A 3ZFYA 4CXAA 3TWJA 5CF6A 1H26A 1FGKA 4GEOA 4M0ZA 2EXMA 3BV2A 4QQTA 3MB7A 4YJNA 4CFXA 4QP4A 3VQHA 3F5UA 1V0OA 1YXTA 2C69A 3W8LA 4HOKA 1Q5KA 1UU3A 5HBJA 1J1CA 3CJGA 3RAKA 1KOAA 3I0OA 2FYSA 3NYNA 5ITAA 5HZNA 4LOQA 4EHEA 5E92A 2QCSA 3MPAA 2OFVA 2PMOX 4WUAA 3PWYA 3JVSA 4GU6A 1OB3A 2GS2A 2WD1A 3QQUA 3VUTA 2DUVA 5D12A 3E87A 4CT2A 1TKIA 3DAEA 3G0EA 3QXPA 4XV3A 2NPQA 3MSSA 4ZJJA 4BDFA 3A7GA 2FUMA 4OTRA 1AQ1A 3ZFMA 3AT4A 4FKOA 3PSCA 2WMAA 3C4ZA 5T3QA 3R8PA 1XH7A 1YKRA 3S3IA 4DEEA 3CEKA 3I5ZA 2X8IA 4OR5A 3H0ZA 4P4CA 5L6WL 4A4XA 4IADA 1XQZA 2GQGA 3Q4ZA 4DC2A 4QT1A 2VWIA 4GFOA 4IZ5A 3WOWA 4IC7A 4O7WA 2BCJA 4O27B 2P3GX 3C0HA 3BRBA 3W1FA 5EM8A 4YO6A 1OKYA 3L9MA 4LFIA 5H8BA 4FV2A 2I7QA 3NYVA 3O50A 2VWYA 3KN5A 3MH2A 1V0BA 4UWBA 2VX3A 3KVXA 4RMZA 1MQ4A 2PMNX 2KTYA 2X7FA 3R0TA 4J53A 4PRJA 2R3MA 2QU6A 3HECA 5CSHA 4NJ3A 5BVDA 3NUYA 3H4JA 2C1AA 1NT2A 4IBMA 4LGHA 2BAKA 5KMOA 2OJ9A 2YJSA 3W33A 2YCQA 3NYOA 2W5HA 4UYAA 5E8UA 2V62A 3OEFX 3SVVA 4EI4A 4USEA 5J1VA 3ITZA 2OIDA 2RG5A 4IFGA 4YHJA 2XKEA 3UC3A 1STCE 4UB7A 4JBPA 5HVKA 2GNHA 4IB0A 3SQQA 3GENA 3G6GA 4CCBA 3DQWA 1WVYA 4D28A 3QZFA 5HTIA 1YDSE 4Z7GA 4OUCA 2FGIA 1GZNA 2QOFA 4F9AA 3QD4A 5F1ZA 3K3JA 4RVKA 4AGUA 4G3FA 4C4FA 3QCXA 3M11A 3TKIA 5C8NA 4YTIA 1XHAA 4JVGA 4M7IA 2PUNA 3BEAA 2GHMA 2ZV7A 3AG9A 3PE1A 5E8TA 3ROCA 2OXXA 1Q41A 4CRLA 4F9CA 5J9YA 3QRUA 5AP1A 2V7AA 3HRCA 4NH1A 4ERWA 4FT3A 4KRCA 5I9VA 2C1BA 3RM7A 2YM6A 1KWPA 5CVFA 4TTHB 4CYJA 4QYFA 1TQPA 2XIRA 4GJ2A 4HNFA 5HO7A 2QVSE 3HMOA 2GS6A 1YHVA 2PULA 4HCTA 2UZBA 3FQHA 3P9JA 3ORTA 5AV3A 3A4PA 2B7AA 2ITZA 2PUPA 2Y4PA 5L2IA 3D4QA 4MF0A 4BFMA 2DWBA 4G31A 5C9CA 5LMBA 2I6LA 4Z3VA 1U46A 3U87A 4J8MA 3ZO2A 3DDQA 2GTNA 2QOQA 3GOKA 4KAOA 4CFVA 1NVSA 1ZMWA 4H3PA 3LQ8A 2GNLA 5F9EA 4HCVA 4WO5A 4FV4A 1J1BA 1Q3DA 4FSNA 5C4KA 3RZFA 4KBAA 5BMSA 2G1TA 4MK0A 3ORZA 3GQLA 5JZJA 1TVOA 1OITA 4XH6A 2WFYA 5ANOA 1VYZA 4GFGA 3V8WA 2P55A 3CS9A 1MQBA 4YMJA 3DBDA 3FLYA 4A7CA 3T9TA 3IG7A 2E9OA 1JWHA 1E9HA 2XRUA 4EHVA 5KMJA 2JIVA 2QOLA 4Z7HA 3V8SA 3D14A 3ZZWA 3COKA 3E92A 4FKVA 4A4OA 4AT3A 2CKPA 3EYGA 4OTFA 4YHFA 1G8SA 5IH5A 2YJRA 2YEXA 4WRGA 4YJRA 3GFWA 3R9RA 3RP9A 3DBCA 3FC2A 3OD6X 4EC9A 1W8CA 3NNXA 2F57A 4W4XA 4FV9A 4YC8A 3UTOA 4B8MA 3IKAA 5I9UA 4FZAB 4FZ7A 3EL8A 2C6IA 3R6XA 3KXMA 5EI2A 5CEQA 4S34A 3VS6A 3Q9WA 4UN0C 4E26A 3OXZA 4FT5A 5H8EA 4JDHA 4MXYA 5TE0A 3BLHA 3FQEA 3ZYAA 4MWIA 3ALNA 3PY3A 3Q52A 4AP7A 3PZHA 4U41A 2EXCX 2YM8A 3GP0A 3P78A 4EBWA 2PE2A 4F0IA 5CF5A 3V3VA 3WILA 4XUFA 3IGOA 4G3GA 2HZIA 3NZ0A 4FG8A 1P4OA 4RZVA 3VAPA 4IDVA 4NU1A 4H3BA 3KRLA 4NK9A 5KHWA 4FV3A 4UWCA 3HAVA 5CNNA 4IVAA 1CKIA 4R1YA 4AX8A 4DFYA 4EEVA 5IA3A 5K4JA 1UNHA 4YGAA 2CMWA 2REIA 4UMRA 2VO7A 4E8AA 4O2PA 5M53A 5FUTA 3R9OA 2IJMA 4KUJA 1Z5MA 1H1RA 2FSLX 3UZRA 3BPRA 5IF1A 4OBQA 3W8QA 3GU5A 3MPMA 3R8VA 4BRXA 3PIZA 1PRYA 4YLKA 3E8EA 4C61A 4F0FA 4R3PA 2R3KA 4H39A 5JRSA 4O7TA 1OL1A 3QRKA 4DFNA 3SAYA 1JSTA 4GRBA 5EDRA 5HG8A 3COHA 3CGFA 2YAAA 5DLSA 3F2NA 3IPHA 2BTRA 3PLAE 3WBLA 4BWPA 3N51A 2I0EA 5DN3A 2X6DA 3F2RA 3LXLA 2C4GA 2PMIA 2QLQA 3MBLA 1NA7A 2GNGA 2W5AA 3FL4A 3U4UA 3ZUUA 4AS0A 3BWJA 2ERKA 5HGIA 2NRUA 2V0DA 3TG1A 2QKWB 2WELA 2QR8A 3KF7A 3CKXA 3Q2MA 5AP3A 5DR6A 1PMUA 3I81A 5ICPA 3GCPA 4EK6A 4EOMA 3UBDA 4AA4A 1G8AA 4X2JA 4MXCA 5C03A 1OIRA 3LFFA 2G15A 4HVGA 5I9YA 5E1SA 2CNVA 3FZTA 1OL2A 4GUEA 1IEPA 4FICA 3W2CA 2X2MA 3ALOA 4DAWA 4HVHA 3R9NA 1LR4A 4CNHA 1A48A 2C6MA 4G34A 3BWFA 3ORMA 4BGHA 4FT9A 4I0SA 2C6TA 2VNYA 3O7LD 4ERKA 1MRYA 4PP9A 4C57A 3QQFA 2I0YA 3PXYA 3BLQA 3AXWA 4M84A 2VGOA 2UV2A 5M4CA 2BMCA 3R28A 5AP2A 4RIYB 4GKIA 2Z2WA 2OO8X 4MWHA 4BTJA 4ACGA 5DMZA 4RFYA 4FKPA 3UJGA 5L6OA 3QKLA 3KMUA 4FX3A 3PZEA 4HYHA 3BU3A 4M0YA 4ZTSA 1BI7A 5IA0A 3H10A 2G2FA 2JDOA 2XRWA 1YDTE 3EL7A 3KF4A 3L9NA 1YXSA 4OT6A 5FEQA 1XR1A 4BC6A 2J51A 2HY81 2JITA 2PMLX 4QD6A 2XUUA 4WNOA 3TCPA 5IMXA 5IZFA 1B6CB 4O84A 2GTMA 5B2LA 2PVNA 4IWPA 4KS7A 3D5WA 1O6YA 4PP7A 1YVJA 4RWLA 3FEGA 4BCPA 3FMLA 5KE0A 3L9LA 2YZLA 4JDJA 3DBEA 3CTQA 3ZUVA 3QTRA 5CVGA 4I20A 4RIYA 2QG5A 3V5PA 4IB5A 3GB2A 5AAFA 5BUJA 3AD5A 3FXWA 4MTAA 5CZIA 4YSMA 4BCJA 3VULA 3OT3A 3BZ3A 3DK6A 4DE4A 3KREA 4D0WA 2GSFA 3SXSA 4PNIA 5HBHA 1L8TA 4FVRA 4FKIA 5DGZA 2VTHA 2ZMCA 4UWYA 3VS5A 4YTHA 3VBVA 4OTPA 4BCIA 2HAKA 4C4GA 4P5ZA 3VC4A 2VTIA 3MV5A 4QMUA 3ZMMA 2ONLC 4U45A 5E1EA 4XRJA 3JUHA 1JKSA 4AZVA 3DK3A 5EM6A 4L67A 2IPXA 4E6CA 4ITHA 3DKOA 4DG2E 3ZRKA 2YDIA 3BYUA 4MD8E 4EC8A 2ETRA 1ND4A 1ZRZA 2ITUA 4G3DA 4DT9A 2PVLA 3KC3A 2X9EA 3CQUA 4FSYA 4EH9A 3E8DA 3R1SA 3FZRA 4WKQA 4G9RA 1RJBA 2ZMDA 3KVWA 4JBVA 4RA4A 5AR5A 4YJQA 4YP8A 4XLIA 4RWKA 5ETIA 2GHGA 2ERZE 2PVHA 3BU5A 4LMNA 4RFMA 5IG1A 2JKMA 2RSVA 4N0SA 3NUXA 3PY1A 4TT7A 1LEZA 3SC1A 3EQGA 4QPAA 3UIBA 3F2AA 3S4QA 1UNLA 2UW4A 4MEDA 3NUAA 2PUUA 5AUXA 2R3FA 5EKNA 3PWDA 5M08A 2BTSA 3SV0A 2XIXA 1IASA 2Y0AA 4AG8A 1KOBA 3NW7A 4BZNA 4U3YA 4IFCA 4BIBA 2YITA 1QPJA 2F2CB 2XMYA 4RFZA 3VW8A 4RRVA 4XOYA 3ZH8A 3ZLSA 4BY9E 2JLDA 3LFNA 4BWKA 3GCUA 5DRDA 3AC5A 4ACCA 2Y8OA 2UZNA 4GVJA 1YOJA 4YZ9A 4CTBA 5TT7A 4IAFA 4QQ5A 2WTCA 2PE1A 4EWQA 4QMVA 3EFWA 4FV8A 1OKZA 4C36A 3ATSA 4UYNA 2CGUA 2VUWA 3QL8A 2J6MA 1NVQA 4IX4A 4U97A 2CGWA 4C4EA 2X0GA 3TJDA 3ULIA 3VHKA 4K77A 5CTPA 3D94A 5M4IA 4M13A 5BYZA 1RW8A 3OMVA 4DBNA 3WZJA 4X0MA 4C0TA 4F1OA 4BB4A 3MFSA 1UU7A 3RM6A 5JRQA 2PZYA 2IW8A 4AUAA 2Y7JA 5KMIA 1P4FA 5CI7A 5GINE 5B0XA 2YIXA 4V05A 1OI9A 2F7EE 4CYIA 1PXOA 4BWXA 2I0VA 3Q60A 4F7JA 5IQDA 3DFCB 5HORA 1H08A 5HO8A 2XNOA 1JPAA 4JXFA 1M7NA 4LQMA 2H9VA 5FG8A 5CYIA 2XJ1A 5DIAA 2OF2A 5ANIA 3QUDA 3F69A 5GZ9A 4ACMA 3MVJA 4PNKA 2HWPA 3LFSA 4EH8A 1Q8ZA 5FGKA 4CV9A 4HGLA 4MXOA 3E5AA 3NX8A 4ORKA 4CG9A 4I0TA 1H25A 4PTGA 4JR7A 2XF0A 1M2PA 3VBQA 4LV8A 3SD0A 3C7QA 2R3PA 4JG6A 4DEDA 4D4RA 4EUUA 4C33A 4WG3A 3QUPA 5CU6A 4D5KA 4FTUA 1FVVA 3VJOA 3W2RA 5HTBA 3G90X 4BDKA 4C8BA 2BZKB 1XBCA 4FC0A 1KE6A 4RJ4A 4Y85A 3AMBA 4BHNA 3AC2A 3FHRA 4M69A 3R83A 4P90A 3V5QA 4E73A 4F7SA 1JBPE 3Q96A 3N4UA 3V8TA 4O7VA 1YDRE 2BAQA 2UZDA 5L8JA 3TZ8A 3IS5A 5IKWA 2WHBA 3R7OA 3GU8A 4NKAA 3N4TA 1REKA 3LFEA 2C6KA 2W1ZA 1H1PA 4YJSA 2JKOA 3ZEPA 4X6RA 1XBBA 4ID7A 4XG8A 5K9IA 3EOCA 2H8HA 3P4KA 3NUPA 3ZFXA 4U80A 4AN3A 4XJ0A 5FWKK 4IXPA 2JBPA 3PXRA 1WVWA 1W7HA 4MCVA 4JI9A 2JD5A 5GJFA 5L2WA 3F66A 4QMLA 4DINA 2ZM1A 3EQPA 5CALA 2C6OA 3ACKA 3ZCLA 4EKLA 4RIWB 3HEGA 4DCAA 3CBLA 5DNRA 4TN6A 5BVEA 3E3PA 2BRGA 3I7CA 3ORXA 3EQRA 3VBWA 2VN9A 2AC3A 3RWQA 5LVPA 2YFXA 4IW0A 2Y4IC 3UIMA 3VF8A 3HV4A 3VBYA 4FVQA 4RVTA 4C34A 4IB3A 5AADA 4IEBA 5AX9A 1FGIA 4E3CA 1UKHA 2W17A 3I6WA 4QP3A 3ZUTA 5AFVA 3V6SA 3IW7A 1Q99A 4RVLA 2OG8A 1H0VA 3F5PA 3OC1A 5DE2A 2VTNA 1FINA 3ZC5A 2H34A 2J0KA 5JQ8A 4AA0A 4L00A 3CR0A 3FI4A 1R0EA 3LM0A 3R22A 3D15A 3ORNA 5C01A 4RA5A 5HG7A 4EJNA 1ZLTA 2ONLA 3NDMA 4RIWA 4RQVA 2Q0NA 3DS6A 4XX9A 4FT0A 4FG9A 1WVXA 3I4BA 2GQRA 2UZWE 3DA6A 1A9UA 5ANGA 4DTAA 1PMVA 2J0IA 4YC3A 1Q8UA 3FWQA 2ZM4A 4FL1A 2BHHA 2CPKE 4GT3A 3FLNC 4L3LA 2YIRA 4D55A 2B0QA 3VS2A 2JDTA 2CGVA 4L52A 4YJOA 4BCOA 4E7WA 3PG1A 2OH0E 3QQJA 3E3BX 4JBOA 4RPVA 2G01A 4I92A 4JJRA 5A3XA 4CTCA 3KQ7A 2YACA 5GHVA 5ACBC 4NT4A 3TTIA 3ZONA 4B4LA 3Q9ZA 4BN1A 3D7ZA 5CT7A 4Y8DA 5A9UA 1OBDA 4EORA 4C2VA 3SRVB 2XYUA 3SGCA 4HJOA 3ZHPC 4F63A 3CGOA 4I6HA 1FMKA 4R3RA 4UX9A 3HX4A 4C4JA 3LXNA 1PKDA 2BFYA 3HRBA 3PXQA 2RL5A 4FSZA 2VZ6A 3MW1A 4FSQA 3H9OA 2X7OA 1Q62A 4I3ZA 1DAYA 4YNOA 2OH4A 4LUDA 3KK8A 1YWVA 2OU7A 1JNKA 3PXZA 2WPAA 5DHJA 4AF3A 3REPA 1GZ8A 2GNIA 5B2KA 2XK8A 4FIJA 4GYGA 4I5PA 4AZFA 1KSWA 1GOLA 3L9PA 3QTSA 4FSRA 3TZ7A 3DTWA 4V04A 1NXKA 5HHWA 1FVTA 5JFVA 3AD6A 5FXRA 3PDTA 2VWWA 3LFQA 3TKUA 3GNIB 4GW8A 3BELA 2YA9A 4USDA 2PVYA 3F88A 2Z02A 3ET7A 4AZTA 2CCIA 5CU4A 4RLKA 3SRVA 1W98A 1XH8A 3ANRA 3MH1A 2Z7RA 4L7FA 3ATTA 4HW7A 4DH8A 4D2WA 3A60A 4Q2AA 4S30A 4BDIA 5J1WA 2NNWB 3PVWA 2WMTA 4GMYA 2JFLA 4WHZA 4JIAA 1PXKA 2RGPA 5KHXA 5J87A 3U8WA 2WMRA 2J0MB 2ZDUA 4QMNA 5HEZA 4H1JA 3DOGA 4JAJA 4DCEA 5KZ0A 3RJCA 2PVKA 4Z55A 4C4HA 3ZO4A 3NW6A 2YISA 4FYNA 5DPVA 3TN8A 3BKBA 3Q4CA 5H8GA 4A06A 3C5IA 2X8DA 4XLVA 2VWUA 3VUMA 5M07A 3WF7A 2V55A 4YZNA 3UDBA 3ZDUA 4X2GA 4IM3A 4NM5A 5IUIA 4EOJA 3CY3A 3QCYA 5A4QA 1Q4LA 4IIRA 3PLSA 4EUTA 2R3RA 3QTXA 4BDCA 4F6SA 2QODA 4LGGA 4DA5A 4LRKA 3QC9A 4PF4A 2GHLA 2UZTA 1H0WA 4TYEA 4DEGA 3C4XA 2NP8A 5A6OA 5AP0A 3Q5ZA 1UV5A 4J71A 2BFXA 5IQFA 3HNGA 4W4VA 2R3LA 2WNTA 5BUEA 2XKFA 4F6UA 4FIEA 3GI3A 3VN9A 4PMSA 2BRNA 3C4CA 5HU9A 1V0PA 3LCKA 4S2ZA 3QHWA 4RIOA 5I0BA 4A4LA 3C50A 4EH6A 3HMNA 3IONA 4EK4A 1OZ1A 4V01A 4EH3A 3MIYA 4MYGA 4BTFA 5M4UA 3HP5A 5AP7A 1QL6A 2AUHA 3COMA 2YM3A 2DQ7X 1Y8GA 3Q4UA 4RC2A 3TUBA 4I5MA 5BVNA 5JGAA 4FTLA 5D7VA 1RE8A 1GZKA 3UMWA 5EK7A 2FSTX 2V7OA 5I4NA 4EOQA 2VNWA 3Q5IA 3O8TA 2B9IA 2W4JA 4AOJA 5J7HA 4PY1A 5L6PA 2WIHA 2CLXA 3D2KA 3MA3A 3UOHA 2J5EA 4D0XA 5IH6A 3EMGA 2IZRA 1WBNA 2Y4IB 1Q3WA 3UP7A 3BHYA 3MY5A 2BKZA 2W1HA 3FZSA 4XP3A 4XV9A 4DH3A 4E5BA 2XJ2A 3S00A 3FMHA 4D2PA 3BGQA 4GSBA 5DBXA 5FD2A 4O81A 2E9PA 4FIGA 4TWOA 3ZM4A 4FEVA 4NYEA 4RZWA 3C4WA 2DYLA 2XCHA 3Q9YA 3RHKA 3G51A 4EOIA 2C0IA 1ZYCA 2I1MA 3BI6A 3VBXA 4BDJA 1R0PA 5H9BA 5HLPA 5K3YA 2O3PA 3R63A 4YLJA 3GGFA 3OXIA 3G15A 3UC4A 1YXXA 1WAKA 4FTRA 4N70A 5AV0A 5HE1A 5JEBA 3POOA 4Y5QA 2O8YA 3WZUA 4JRVA 2PPQA 1PF8A 4AXAA 2W1FA 4O6LA 3EKNA 5A4EA 5BQ0A 4XMOA 5M55A 2YABA 4M97A 3FUPA 4FT7A 1ZYLA 1Q24A 4HVSA 2IN6A 1ZY4A 4ANLA 3P86A 3MFUA 5HVJA 1IA8A 4QTAA 3KXGA 4CV8A 5CAPA 4CMUA 2BILB 1OKWA 2OF4A 3UO5A 3GEQA 4YJPA 2ZB1A 5E8VA 3F3WA 3IW4A 3SHEA 4DFBA 4JX3A 4IX3A 3NPCA 4FR4A 4BGGA 1GJOA 4C7TA 1Y91A 4HGEA 4HPUE 3OY1A 4FKUA 4GVAA 5EYMA 3ZBXA 4F7NA 2WMSA 3C13A 4YPSA 1MP8A 3IK3A 1CKPA 3TV7A 3HV3A 4BBEA 4EYJA 5F4NA 1KV1A 3FHIA 3HV6A 2J2IB 4J7BA 2XKCA 5KNJA 2BUJA 3F3VA 4KKHA 3U6HA 3NAXA 1O6LA 3R8ZA 3EQFA 4AN9A 5BVOA 3QFVA 4O7RA 3VS0A 5IA2A 4IX5A 5IQAA 2C6LA 3DBFA 2I40A 1WZYA 5D10A 2YCSA 2Z7QA 4C38A 1QCFA 3NLBA 1ZOGA 4CQEA 4E4LA 2OWBA 4O0UA 2R4BA 3NRMA 1OMWA 3G2FA 4DGOA 4L42A 5AV4A 5IMEA 1BX6A 1JOWB 5DG5A 2JGZA 3QF9A 2X4ZA 1H28A 4RX9A 4JX7A 3VJNA 1SVGA 4B9DA 3ZOSA 2ITPA 3IW8A 3QGWA 3PJCA 5DOSA 3I5NA 4QYHA 5EDPA 4PWNA 2X1NA 4QTCA 1FOTA 1W83A 4F0GA 3MWUA 4E20A 3P1AA 5TR6A 2FO0A 3Q9XA 2Q0BA 4Y83A 4OAVB 2AYPA 4KIOA 4LRMA 4F09A 1H1SA 5HESA 4AAAA 5HU3A 5CNOA 3QAME 3PY0A 5CANA 5DEWA 5HCXA 5ETAA 3ZC6A 3R8MA 4CFMA 4GCJA 3OG7A 2UW7A 4BIDA 3LCOA 4AW1A 4UXLA 4YBKA 4AZWA 5AEPA 5TOZA 1YI6A 4FBXA 5LOHA 4O7NA 3ORLA 2CKOA 3KL8A 4UY9A 5E4HA 1R1WA 4YTCA 2FH9A 2IG7A 1VZOA 4BBMA 3M2WA 4GT5A 4TYGA 3SXRA 4AGWA 4I24A 5FM3A 3AC1A 4FKLA 1J7LA 3OROA 3LFCA 3FYJX 2CJMA 2HZ0A 3D9VA 3ELJA 3QXOA 2YHVA 2ITOA 5LWMA 4PQNA 4FUXA 2LAVA 2XK3A 4MX9A 3F82A 3CD3A 5FEEA 1BUHA 4DLJA 1GZOA 4IM2A 4WSQA 3TUDA 4HYSA 1U4DA 3OWLA 2R7BA 2VTPA 5BYLA 2BR1A 2WZJA 4NIFB 4QMQA 3GC0A 2OI4X 1QPEA 2W9FB 3MI9A 4TNBA 2ITXA 5HX6A 5M09A 4PPAA 4JDIA 4XS2A 4USFA 2QURA 1YXUA 2JBOA 2P0CA 3EIDA 2PU8A 5K5NA 3R04A 3OWKA 1H1WA 3VUIA 2WMXA 4QRCA 5CSXA 4K1BA 3TM0A 4F9BA 2A2AA 1R3CA 3QD3A 3UODA 4FIHA 3TT0A 4BDDA 1U5RA 4Q9SA 3PA3A 4FSMA 4NFNA 1ZYDA 3K2LA 3L8XA 5ACKA 4R1VA 2OJJA 2NRYA 3RCJA 3ORPA 3SG8A 4MBLA 2C5XA 3P08A 4C35A 4D2SA 4CFUA 2WTKC 1VJYA 2EB2A 3DKFA 3FSKA 4NIFA 2BDJA 5HD7A 5CF4A 3E93A 4TRLA 1YXVA 3PPKA 4GUBA 2OJGA 2XM8A 4K18A 5E8ZA 1REJA 5KCVA 3DJ7A 4EQCA 1XWSA 2PWLA 3THBA 4R5YA 3LJ2A 2GQSA 4FV6A 5IQIA 4O82A 4FKRA 4C58A 4R7IA 4L7SA 4RJ5A 5E8YA 4KSQA 5EHYA 3ZO1A 4E6DA 3E63A 2C30A 4CKIA 5C4LA 2X81A 3PXFA 5AR8A 5AJQA 4FZFB 4RX8A 4BCGA 2VTAA 5CT0A 4K11A 4GK4A 3NMUF 4R3CA 3B2WA 1BL6A 1K3AA 3GU4A 3WF9A 2QLUA 3L8SA 2W9ZB 4DH5A 2GU8A 4BCMA 4IJPA 2JEDA 1PJKA 3EQIA 4WOVA 3MYGA 3W55A 5AWMA 4S32A 2YDJA 3GVUA 4D2RA 4YZDA 1E1XA 5CQWA 5AUVA 3CLYA 2HZNA 2GFSA 3FY0A 3PPZA 4P2KA 3UGCA 4U6RA 3ULZA 3V51A 3VS1A 4EOOA 5GJDA 2F7ZE 5TO8A 5AP5A 3FMEA 4PDSA 2J0LA 4EOPA 2JAVA 1LP4A 4RX7A 5EG3A 3BHHA 1L3RE 3PUPA 3RAWA 1NVRA 2XA4A 3F7WA 3OBGA 4DH1A 5EQEA 5M06A 2UW0A 4XP0A 5GNKA 3MA6A 5IQBA 3F9NA 1Z9XA 2VWXA 3P23A 2EUFB 3VF9A 2KULA 3LQ3A 4NEUA 3IO7A 3WI6A 4D4YA 4MXZA 1SVEA 4EZ3A 1BI8A 2ZB0A 4WA9A 4EOLA 2P2IA 4R7BA 3T9IA 1DI9A 3VW6A 1F3MC 2PVRA 3ZSIA 5GZ8A 1F5QA 4CFWA 4PMTA 2QOBA 2QO7A 5HQ0A 1UVRA 1OECA 2WOTA 3R2YA 4TXCA 3UYTA 2BRHA 4FNZA 4LI5A 1ZYSA 1SYKA 3G5DA 3MVHA 2A19B 2BIKB 4ZAUA 5K5XA 4O7SA 3FXZA 4FSTA 4UMUA 2QOIA 3LW0A 4IVCA 1UKIA 2YIWA 4F6WA 3PA5A 4WIHA 3K5UA 2FSOX 5KKRC 3TUCA 3BYVA 1HCKA 2F7XE 4GV1A 4WNMA 2SRCA 4RWJA 3FLQA 4FV0A 4FL2A 1F0QA 2J5FA 4I6FA 5HBEA 4BCNA 2R3OA 4RSSA 4ENYA 1OUYA 1RDQE 3LQ5A 5BVWA 3SG9A 4RG0A 4L53A 5JMSA 5D1JA 5CSWA 4EZ7A 2BZIB 3LCDA 4ZXTA 5ANKA 5JK3A 4IB1A 2V5QA 2W1GA 4UALA 4M12A 5KBRA 3HRFA 3FBVA 4IDTA 4RQKA 2R3GA 3SW7A 4P5QA 5M44A 4ZZOA 2WTJA 3NGAA 3FAAA 3W32A 4ASZA 4TKSA 2QNJA 4FTTA 1FPUA 2P33A 4BF2A 2YCFA 2XIZA 3GCSA 3R00A 1FBNA 2CN5A 4IWDA 2WIPA 2XZSA 3HA6A 3FLWA 3B8RA 2XYNA 3CTHA 4N6YA 2PZ5A 4MXXA 4OGRA 5AMNA 4ZSGA 3GC9A 5DEYA 5M51A 2OLCA 2BPMA 3MJ2A 4O22A 2E9NA 5DFPA 2UW6A 5C27A 2X2LA 4FK3A 4QTBA 1GNGA 4ASDA 4X3FC 4EK3A 2XNMA 4M3QA 5L2TA 3ENHA 2VGPA 1O9UA 2A0CX 4D2TA 4EOSA 3KEXA 3OOGA 3RNYA 4BZDA 3LM5A 3QUEA 2WTIA 5LCKA 2F49A 1O6KA 2JC6A 3HVCA 3OUNB 4Q5HA 5AR3A 4CZUA 3MH0A 3V5LA 4RBLA 4CGAA 5IQHA 4MD9E 4ZMFA 2VTSA 2IVUA 3UG1A 5JN2A 4JIKA 3O8PA 2X7GA 5FTOA 2ITTA 3VO3A 1SMHA 3ACJA 4E6AA 4O1PA 2XCKA 4TPTA 4NTSA 3OWJA 1Q8YA 1IAHA 4BYJA 2QOOA 3CQEA 4PDPA 2E2BA 1ATPE 2YAKA 3EJ1A 4PDOA 4E4NA 3F6XA 4XNEA 4BDBA 2IO6A 2JDVA 4HNIA 5HE2A 1E1VA 2EB3A 2HXQA 3HDNA 4I4EA 5BPYA 4M15A 3B8QA 5I5ZA 2WTVA 1P5EA 5JZNA 4WRSA 2WTKB 4XBRA 2Y9QA 2WTDA 5CU3A 4GL9A 4DEAA 2CNQA 4PUZA 2C3JA 4KBKA 5HD4A 2WU7A 3KKVA 4FODA 3TIZA 3VRYA 3BHVA 2HYYA 4W8DA 3ENMA 3ZLWA 3BGZA 4QMWA 5H3QA 2FB8A 2W1EA 1AD5A 1JAMA 3FDNA 5J7BA 3HV7A 3SKCA 4FI1A 3RINA 3KGAA 3NWWA 4ZEGA 4QTDA 3WYYA 4EK8A 4J97A 4AU8A 4AZEA 4MKCA 1ERKA 2HY0A 4KSPA 4QMYA 5IQGA 4YUQA 2BHEA 4RIXB 4WT6A 1Q61A 5E7RA 3AOXA 3TNIA 3OCBA 3VS7A 4Y72A 4C37A 5AM7A 4PMMA 2IW9A 3ZLXA 4C59A 2B53A 3A99A 3UQCA 3AD4A 4LOOA 2YN8A 4IWOA 1JKTA 4O96A 3NNWA 3NNUA 3LHJA 2C5VA 3FSFA 3HL7A 3KXXA 5CZHA 1HCLA 1ZYJA 1FMOE 3PJ2A 2VX1A 2VTJA 4U43A 4IX6A 4ZSLA 4IANA 3ZSHA 2WMQA 4ZTNA 1KE5A 3CPCA 3KB7A 4LL0A 1CMKE 5DI1A 2CSNA 3QQHA 3FMMA 4FG7A 3BQCA 4C3FA 2ZDTA 3JY9A 5EW9A 4ANQA 4CZTA 3P0MA 4C3RA 4RIXA 2OICA 3TZ9A 3OCSA 4QPSA 1U54B 4AW0A 1UU8A 5IUGA 3CPBA 5J79A 5CEKA 2QO9A 3CC6A 4O1OA 2HK5A 3MN3A 1XBAA 4ZZMA 5I3RA 4HVDA 2RKUA 3KMWA 3QCSA 3R30A 3EZVA 3PG3A 4D1ZA 3BIZA 1UWJA 3DB8A 3DXNA 3OT8A 4QP7A 4ZMEA 4FVPA 3BBWA 2ITWA 4G1WA 2ITNA 2A1AB 2RF9A 3PJ8A 4IZYA 1K9AA 4NM0A 2BZHB 4W9WA 5FEDA 2E9UA 3R8LA 1PXLA 4D9UA 3OFMA 3S2PA 5EYCA 5KKRB 2C3KA 4TY1A 4BGQA 2ZV2A 5EQPA 5CXZA 2YLEA 3UYSA 4PX6A 4I4FA 4K9YA 4ONAA 2YDKA 5KMMA 5LMKC 2B54A 4FE2A 4R8QA 4IAYA 1U54A 4B6LA 1H01A 1R78A 3BQRA 4YZBA 1MUOA 5J5SA 2WQEA 4ITIA 4M68A 3IW6A 3EWHA 4FIIA 1Q8WA 3PRIA 4AE6A 4ARKA 2XJ0A 4TWPA 3F5GA 3V5JA 1MRVA 4KS8A 3GC7A 3R1NA 1U5QA 2O63A 3ORKA 1I09A 3IQ7A 4ENXA 2W96B 5FXQA 4J52A 3H9RA 4GJ3A 2XNPA 1IRKA 2AC5A 3CP9A 4WG4A 4GYIA 2RFEA 1QMZA 4JQ8A 3HP2A 3O23A 4UBAA 3A7JA 2XK6A 3FL5A 3HV5A 3JXWA 3RK9A 4BKZA 5EKOA 4FZDB 1NW1A 4X3FB 2H96A 4ACHA 1JLUE 3G0FA 3HKOA 3QQKA 3R1QA 3R2BA 4ZY4A 3KRRA 3FXXA 4O6EA 3P7BA 4J96A 3HMMA 3M1SA 4IC8A 1H00A 2PTKA 4FTNA 4U9AA 3ZXZA 2VTOA 3R7YA 4XG9A 2R2PA 2Z60A 4JQEA 5D11A 2C68A 4KIPA 3RHXA 1ZMUA 3HGKA 1PW2A 5I9XA 2R3NA 4DFUA 3DBQA 4II5A 5AP6A 5EYDA 3RMFA 4X3JA 5AUUA 4ZK5A 4EKKA 2W99B 4XV2A 4QPMA 2X6EA 3NCZA 4AGDA 3AT2A 4JG8A 2UZEA 5JFWA 3KRXA 4YJUA 3R1YA 3EFLA 5J8IA 3UNZA 3NVMB 4O7ZA 5J9LA 3EKKA 3TACA 1M7QA 4I41A 3ODYX 3QQLA 4X3FA 2J0JA 3RPOA 4EZ5A 5BNJA 2VO0A 4XG3A 2UW5A 5HE3A 3PRFA 5FQDC 4EBVA 2VD5A 4ZSEA 5CSPA 4PPCA 4IACA 2ZAZA 4ZOGA 4B99A 4FSWA 3SA0A 1TQMA 4L6QA 3WARA 3C0IA 4DBXA 4FTOA 4C3PA 5L2QA 3ZRLA 3LJ1A 3TJCA 4KIKB 4CZYB 5EM7A 4D4VA 3NEWA 4W9XA 4ZSAA 5IPJA 3FPMA 4IMYA 4L44A 2HCKA 2UZOA 5CAVA 4FKSA 5DVRA 3OTVA 2P4IA 3E7OA 5LVNA 3LE6A 3KCFA 4XG7A 3U9NA 4EH5A 2C6EA 3PSBA 5IEVA 4D5HA 3V5TA 3Q6WA 3COIA 3RK5A 3QALE 2RFNA 3BLRA 3UP2A 4C4IA 4FTMA 3CSVA 4TYHB 3QTUA 4X7QA 4F9YA 1CM8A 3GU6A 3QCQA 1URWA 3ZTXA 4BDHA 4HGSA 4IAZA 4YHTA 4FOBA 5LJJA 1XJDA 4O0RA 4B7TA 1PXIA 4YLLA 3O96A 1PYXA 3AT3A 5D7AA 3GCVA 2V22A 4D4SA 2XNGA 3NNVA 5C26A 2F9GA 4DFZE 4EK5A 4K33A 3AC8A 5BMMA 3LPBA 5HE0A 5CF8A 4DEIA 3T3VA 1WMKA 2BVAA 3QLGA 4QMMA 3GCQA 2R3QA 3MIAA 3DU8A 4OBPA 4FZ6A 1OBGA 4XG2A 3QZIA 4PTCA 3UIXA 1YOMA 3DV3A 5KMKA 1M17A 2PSQA 1A06A 4S33A 3TDVA 5FDPA 3UZTA 2HXLA 4DLIA 1M14A 1WCCA 4NM3A 4FMQA 5CENA 4TYHA 2BZJA 3FI2A 3AGMA 2BRMA 5CEIA 4MNFA 5ANJA 2WMVA 5HI2A 2W05A 4BL1A 4ZLOA 5LVMA 3VRZA 3UNJA 3CY2A 4BKYA 5EOLA 3V01A 1CTPE 4AFJA 4C2WA 4FV7A 4BDAA 4IZAA 2QONA 5HICA 1T46A 4U42A 2QR7A 4D9TA 4JLCA 2XVDA 1XO2B 3MJ1A 2FSMX 5LXMA 4FTAA 5AR4A 5FDXA 3QWKA 3VUDA 3KXHA 4WNPA 1XH5A 3HAMA 4KWPA 4MQ2A 5EI8A 4NWMA 4YURA 4MXAA 5LVLA 1G3NA 3CJFA 5C8KA 3A2CA 2XP2A 1YOLA 3ZEWA 1DS5A 2JKKA 3DQXA 4RLLA 3UMXA 5M4FA 1P14A 1OPLA 2OBJA 3Q53A 2Y6OA 3DK7A 3ID6C 5IEYA 5M57A 3EFKA 3C4EA 3VUHA 3MDYA 4HYIA 2PVJA 1QPCA 3D5UA 4A9RA 4EL9A 4FYOA 1B39A 3SLSA 3PVGA 5HIDA 3U9CA 4FV1A 4M8TA 3L8VA 3A4OX 3PTGA 4O86A 3R7UA 4ZTMA 4E4MA 3U54A 1ZXEA 4NZWB 3UVQA 5AM6A 4UV0A 2FVDA 3EN4A 4BTKA 2GNFA 2Z7LA 5IUHA 5AV1A 4XCUA 1PXJA 4KRDA 2CKEA 4RVMA 3OUKA 4IJ9A 4DYMA 1UA2A 4F1TA 2I0HA 4FV5A 4OTGA 2ZOQA 5IDNA 3VHEA 3FMJA 3R71A 5LMKA 1PMNA 4G3EA 4UMPA 1S9IA 4GFMA 1KE8A 3PFQA 3VUGA 3VS3A 2Z8CA 4FL3A 5A54A 1OIQA 2CDZA 4IAAA 3E7VA 4W4WA 4EWHA 3KN6A 4NL0A 2UVYA 3OTUA 3NYXA 2XNEA 4FEXA 3ZRMA 2WOUA 2R5TA 2BRBA 4IE9A 5I9ZA 5J9ZA 3LMGA 4FGRA 3RGFA 3E8NA 3I79A 4K2RA 5IEXA 4GU9A 2BALA 3HYHA 3RNIA 4CLJA 5CLPA 4XRLA 2A27A 4FNXA 2CNUA 1BMKA 2VWBA 4BKJA 4EQMA 3GXLA 4FNWA 2PK9A 3VVHA 3VS4A 1V1KA 1YHSA 2WEVA 4HPTE 3FZPA 4J8NA 5AX3A 3SXFA 4J99A 5KX8A 4OTIA 3DAJA 3IOKA 4APCA 5HLWA 2YIQA 4ZY5A 5TKDA 1Y57A 4C62A 5HKMA 4CLIA 1SNXA 3C9WA 2YERA 4JT3A 4MHAA 2R7IA 4F9WA 5KBQA 5KMNA 2QO2A 3LCTA 3B2TA 2FA2A 1ZZ2A 3EFJA 4AZSA 3GC8A 2J4ZA 2GDOA 3K3IA 3FY2A 3TI1A 5DH3A 3UPXA 4F99A 1ZAOA 2WQOA 3MVMA 3P5KA 3Q32A 4L9IA 5FBOA 1XH6A 1ZARA 2VTQA 1JQHA 1CDKA 4V0GB 4E1ZA 2VAGA 2WXVA 3EQCA 3VUKA 4APPA 3U6JA 5CU2A 4L43A 2R3HA 2CLQA 5CY3A 4AT5A 3U6IA 3V04A 4PL3A 2CHLA 4MAOA 3DY7A 3PPJA 4TWNA 5CAUA 3ODZX 3QWJA 3TTJA 5IA4A 4BI2A 3HA8A 3KRJA 5E9EA 4Q9ZA 4XG4A 5AUYA 3G9LX 3UOKA 3QRJA 1SNUA 2QC6A 3TNHA 3S95A 2QHNA 4D58A 4CSVA 4YJTA 4IVBA 3PP0A 1ZY5A 3EN7A 4A07A 3MPTA 3LOKA 4O7YA 5HVYA 4GH2A 4DEBA 1YQJA 1T45A 5E91A 4CT1A 5CU0A 4QYGA 3RVGA 3QKKA 2GNJA 3QZGA 4XYFA 4OTWA 4G5PA 3PIYA 4QQJA 4D1SA 2BKKA 4U79A 1PXPA 4V0GA 4XBUA 2B52A 4R77A 4CKJA 4DG3E 3QKMA 3QGYA 4L45A 2J9MA 3QLFA 4PL5A 4S31A 2VX0A 3LFBA 3QHRA 5F95A 4DHFA 3PJ1A 1CKJA 2R9SA 4H3QA 3DAKA 3HUCA 1IG1A 3UO4A 4QOXA 5AUWA 4RWIA 3M42A 4I23A 5IDPA 4CKRA 5DT4A 1XKKA 4U40A 3F3ZA 3VQUA 1BLXA 1PMEA 2UUEA 4XV1A 4O83A 3FZ1A 4TW9A 1YI4A 4ASXA 3QU0A 4DN5A 4O7LA 4N57A 5CEMA 5DT0A 3F7ZA 3HZTA 1DAWA 1VR2A 1Y8YA 3D7TB 4IAIA 4BDGA 4YO4A 4A9UA 4ANNA 2B9HA 3CTJA 4CQGA 4CVAA 1YHWA 1P2AA 5T6KA 2VTLA 4R78A 2ZV9A 1H8FA 3NSZA 1BKXA 1PY5A 4A9TA 3UQFA 4GT4A 4KD1A 2X2KA 4XP2A 2QOHA 3ETAA 2G2IA 3FKOA 3S0OA 2HELA 3KK9A 1W82A 2PZPA 3UG2A 3Q6UA 1PHKA 1U59A 3F3UA 5HCZA 5CX9A 4LMUA 4NTTA 4BVUA 5CS6A 2IVTA 5HIBA 4ZP5A 3V6RA 5LCJA 3D5VA 4FF8A 4GKHA 2R3IA 2C0OA 4I94A 2RIOA 3ZBFA 4LUEA 2J90A 2XK9A 5TF9A 2OZOA 3PYYA 4E5AX 3H3CA 4M14A 4AACA 4TYIA 5DRBA 3DLZA 4G5JA 3ZM9A 4LGDA 4U81A 3D7TA 3LLAA 3Q04A 1WBWA 2VTRA 1SM2A 2UZLA 3FYKX 2C5YA 5A6NA 2IWIA
chains in the Genus database with same CATH superfamily
2XEZA 2O5KA 4L46A 2ACXA 3RPRA 5AV2A 2VRXA 1UNGA 3TNPC 4EQUA 5BUIA 3OW4A 4NJDA 5CVHA 5KMLA 3W2PA 3UE4A 4CRSA 2IZTA 4L3JA 4O0WA 2X8EA 4ITJA 1W84A 4XG6A 2QOKA 3RAIA 4B0GA 5G1XA 3DDPA 2R0UA 3D2IA 3QTWA 3ZS5A 2YCRA 4DFLA 2HOGA 4AFEA 5EM5A 3MB6A 3MH3A 3FPQA 4L8MA 3FV8A 4QP6A 5CI6A 4L3PA 3SOCA 4BBFA 2DS1A 2W5BA 3IDPA 2EVAA 2J7TA 4K0YA 5HTCA 4WUNA 5EH0A 4QP9A 4N4SA 4U0IA 2XB7A 1G5SA 3IOPA 4QQCA 1KE9A 1JVPP 2PVMA 3OW3A 3BHUA 4KINA 4MH7A 4UXQA 1RQQA 4W8EA 5EQYA 1TQIA 2P2HA 4WBOA 4ZZNA 2UW8A 1BYGA 3MESA 5LQFA 5FP5A 2R0IA 4BCQA 4KB8A 3GU7A 2XBJA 3FQSA 2IZSA 2VO6A 3AMYA 3E64A 4AT4A 3KULB 5JKGA 4B8LA 4DGNA 1H24A 4YSJA 3I1AA 1OUKA 4FTJA 4X2KA 3DB6A 3RK7A 2OIBA 3CIKA 4H58A 3TV6A 3U51A 1LPUA 4WD5A 1OL6A 3R9HA 3OBJA 2IW6A 4Y73A 3UPZA 4HCUA 5CASA 2QU5A 5JFSA 4LYNA 5DR9A 4AOTA 3NIEA 4F64A 4F65A 4M67A 4BI1A 4QMTA 5HX8A 4EHZA 4FGBA 4QP8A 5E8SA 3O7LB 2EU9A 4F7LA 2OJFE 3BE2A 2RFSA 3CQWA 4ZY6A 5IQEA 4JS8A 3HUBA 4XEYA 3OP5A 3CXWA 3OXTA 4NCTC 4BR3A 2WU6A 1OVEA 4J1RA 4Z16A 3BYSA 3WZDA 4O38A 3FLZA 5FTGA 4LM5A 3KULA 3WZEA 2HW6A 2WB8A 3TEIA 5G6VA 5JT2A 2YM5A 2C3IB 1WFCA 2ITQA 4BIEA 2RFDA 4KA3A 4U5JA 5T68A 4RC4A 4ZJVA 5A46A 5A4TA 2NO3A 5CSVA 1FVRA 3IDBA 3DKGA 4G9CA 3GOPA 2O2UA 4O0TA 3BX5A 4ACDA 3O0GA 1ZOHA 4ANOA 4BHZA 5AAEA 1NY3A 3FMDA 2XNNA 3MY1A 1LUFA 2W7XA 2HW7A 4QP1A 3SX9A 2VTTA 4O0VA 4WNKA 3WE4A 3R01A 4GK3A 4G16A 4G6NA 5HG9A 3BV3A 3MTFA 2BDWA 3NW5A 4IWQA 4PPBA 4TZRA 4IVDA 3ZDIA 4BZOA 3DFAA 4KKEA 4DH7A 2OIQA 4EONA 2EWAA 4QO9A 4WG5A 5E90A 3FKNA 4E6QA 3BE9A 2QD9A 5KO1A 2XBAA 3CD8A 4PL4A 4G3CA 4OT5A 4RJ8A 4DGMA 3ZU7A 5BVKA 4DHJA 1LEWA 4LG4A 3E88A 3RI1A 5AP4A 4BI0A 5CAQA 3L8PA 3R8UA 3ERKA 3OF0A 2LGCA 4AW5A 3DPKA 3LLTA 4J95A 1UU9A 1AGWA 2XANA 4NUSA 4KABA 1OGUA 1QPDA 4KNBA 5A4LA 1GIIA 3NCGA 2ZYBA 3F5XA 5L3AA 2QOCA 3BYOA 3G33A 3R7GA 5DWRA 4TYJA 2ZV8A 3AQVA 4X21A 2OKRA 4QMOA 2OSCA 5E8XA 1W2DA 5HO6A 2R64A 2PZRA 3FC1X 2Q83A 4O2ZA 5HIEA 1YI3A 5AIKA 4DEHA 5JGDA 3P79A 2QI8A 5L8LA 1OM1A 5LARA 5JFXA 3T3UA 3W16A 4ASEA 4QMPA 2O64A 1UWHA 4LOPA 2C47A 3N9XA 4GIIA 4IM0A 2YLFA 4RGJA 2PY3A 4YJVA 5GJGA 4LDTA 4KKGA 3NUNA 2C0TA 3OY3A 4RJ7A 5EHOA 5F94A 3W2QA 3W2OA 5HNIX 3WIGA 3LAUA 4J98A 1J7UA 2GS7A 4YZCA 3LFDA 2VV9A 4FUYA 3MGYA 4I93A 5A14A 3OOMA 2QKRA 3MY0A 4KIQA 5ANDA 5K0KA 2QHMA 3MS9A 3POZA 2VWZA 3RAHA 2H6DA 1XH4A 3KXZA 1OIUA 2QQ7A 3FMNA 4HZRA 4I6QA 4F4PA 3KFAA 2X9FA 3FE3A 4LV5A 4WSYA 1ZWSA 3QYZA 1J7IA 3OHTA 2JDRA 2W1IA 3LJ0A 1EH4A 2BDFA 4FRFA 2GPHA 3QZHA 1KV2A 3I0QA 4X6QC 2W0JA 2OW3A 3A7FA 2B4SB 3DJ5A 5DR2A 4CMOA 2ETKA 5K0XA 4G6LA 2ZM3A 3FI3A 4HGTA 3Q2JA 5DA3A 3ZSGA 5BVFA 1JSVA 3NR9A 4I22A 2VU3A 4ANBA 3N4VA 4R6VA 3C4FA 3A7HA 3KCKA 3DNDA 4E4XA 4TNDA 4X2FA 3O8UA 4MD7E 1ZOEA 2XKDA 4ALVA 4QMXA 1DM2A 4RX5A 1DI8A 3OZ6A 5I3OA 3FLSA 1H07A 3I60A 3LVPA 3UOLA 2BAJA 3MFRA 4ZLZA 2HWOA 5H2UA 4OTDA 5JH6A 4OAUC 4OTQA 5HNBA 1YW2A 3O2MA 3ZO3A 3KIOC 4UZDA 2W4KA 3A7IA 3QD0A 3TZMA 5IISA 4AN2A 3GBZA 5D9HA 4MF1A 4K6ZA 2VWVA 2XK4A 5ETFA 4FEWA 5FBNC 3DT1A 2OFUA 2JFMA 4I5HA 3AC3A 1IAJA 3LCSA 3BBTB 1MRUA 4QNAA 2XIKA 2OJIA 3H9FA 2WEIA 3PVUA 3HLLA 3A8XA 4LL5A 4RC3A 5EW8A 1S9JA 4FA2A 5CEPA 4JNWA 1WBVA 4FKGA 1WBOA 5F20A 4I6BA 4DTBA 1GY3A 3EB0A 3QC4A 5J5TA 3HMIA 1GIJA 1WBPA 2UZVA 3EYHA 4AA5A 2ZJWA 4YNEA 4DG0E 5KUPA 5DT3A 4OBOA 4D1XA 4H1MA 2YM7A 4O0YA 4A9SA 4YPDA 2ITVA 3ZXTA 2B55A 2JDSA 3DKCA 2PE0A 3W18A 2C6DA 3WYXA 2PVFA 4U44A 3ROYA 4AGCA 2GMXA 3QTIA 5FXSA 2B9JA 4EYMA 4NKSA 3Q3BA 3VBTA 3R73A 5CXHA 4AQKA 1M2QA 4IH8A 4R7HA 3PE2A 5IU2A 1SVHA 4MQ1A 3TNWA 3CCNA 2JIIA 3O17A 3G6HA 3RCDA 4BICA 3LKMA 2ESMA 3GT8A 3PFYA 5IQCA 2B9FA 2UZUE 3MVLA 2JKQA 4ZJIA 4DFXE 2X4FA 4AWIA 4KBCA 1GIHA 4DHZA 2O65A 4HYUA 3RPYA 3DNEA 4CG8A 5C8MA 4PDYA 4IAKA 5LVOA 4YC6A 4IQ6A 5FP6A 3PSDA 3LMIA 4FKTA 2Z7SA 4GS6A 4ZLYA 5AA8A 4ZS0A 4NW6A 2JIUA 5E8WA 5HLNA 3EN9A 5HG5A 4H05A 3I7BA 4QMZA 2WMBA 3QA0A 2F4JA 1TZDA 3C0GA 1Y6AA 5CWZA 3D83A 3QRTA 2C3LA 2JAMA 4N6ZA 4QNYA 5FM2A 3LMHA 1YWRA 3P7AA 5IA1A 3LXKA 2E9VA 4NCTA 4YZMA 1OL7A 3L1SA 5C1QB 2WTWA 4DF3A 3EN6A 4RT7A 3E8CA 3JVRA 2G2HA 4AQCA 4RJ3A 1WBSA 5CQUA 2RG6A 1H1QA 3G9NA 2XK7A 4M69B 4X2NA 3RWPA 4DGLC 5L8KA 1APME 1B38A 1R39A 2BROA 2OZAB 2ETMA 5AR7A 5BX0A 1YWNA 1W0XC 3BHTA 4F1MA 2YM4A 1JKLA 3JR1A 4F70A 1FQ1B 5B7VA 2C5NA 3RPVA 2ZVAA 1BL7A 1OKVA 3TXOA 3RKBA 3EQBA 3I6UA 3R7IA 5BYYA 1H27A 3FKLA 4Y95A 4ANMA 4QMSA 1OL5A 2G9XA 3UVPA 3PIXA 3WZKA 2IZUA 4O91A 3KXNA 1SZMA 2VO3A 2BIYA 3ZZEA 4TL0A 3DXQA 3FI8A 2UVZA 5KZIA 4XOZA 4MVFA 4XHKB 4I6LA 3AGLA 2C5OA 4FTQA 4DT8A 4FOCA 3DTCA 5CAOA 5ETCA 5L2SA 4Y46A 3EH9A 3RBWA 3GQIA 3JY0A 4JMQA 3A8WA 3JPVA 3UIUA 4EH4A 4PMPA 3TNQB 2UW3A 3CKWA 2UVXA 4Q5EA 4ALUA 3EQDA 1KE7A 4O21A 2OZAA 2Y6MA 1J91A 4UMTA 3QA8A 4R5SA 3A61A 3UNKA 4YBJA 4NSTA 3QTZA 5M56A 1PXNA 2CCHA 3IDCA 3NUSA 5AIRA 3DGKA 2XEYA 3QX4A 3RZBA 4DGGA 4GG5A 4P7EA 3OWPA 2W06A 3C1XA 2R3JA 4FTCA 1K2PA 2HZ4A 4CD0A 5I9WA 1HOWA 3KU2A 3C5UA 3GFEA 2WO6A 4IZ7A 1M2RA 5ANEA 5AUZA 3A62A 3WF8A 4QTEA 4U7ZA 5L4QA 3BEGA 4L68A 3U4WA 3IECA 4FKQA 4ZTRA 4DDGA 4BCFA 2A4LA 2GCDA 2X0OA 3H30A 3HDMA 1PYEA 3W2SA 3IW5A 3NVKI 3EN5A 5HNGA 1I44A 5AA9A 3OCGA 4LRJA 2YWPA 3QRIA 4QYYA 5FLFA 3HMPA 3TKHA 4EOKA 3PVBA 4ZIMA 1OPJA 3BYMA 3FZOA 1M52A 4JG7A 3OS3A 5JSMA 2XM9A 3LZBA 4O0SA 3JYAA 4CCUA 2OK1A 3EZRA 3PA4A 4FTKA 3NUUA 4L01A 3QD2B 4I21A 2WMWA 3Q4TA 1PXMA 1H4LA 4HVIA 4OW8A 3VIDA 4JBQA 4FKJA 3QBNA 3PP1A 4MBIA 4EH2A 3R02A 4ZTHA 4ZTQA 4YTFA 4OLIA 3V5WA 3LIJA 2OGVA 4EJ7A 3PJ3A 4CFNA 5A4CA 4YR8A 4BCHA 2YWVA 4Y5HA 4OTHA 3SOAA 3CE3A 2WMUA 4FSUA 1JKKA 4JRNA 3TL8A 4JOAA 3O51A 3RPSA 2WAJA 2IVSA 5LMAA 3VWAA 3OEZA 2CGXA 3C51A 5EI6A 5AR2A 4ZTLA 3T8OA 5AAGA 4E93A 2PL0A 3BCEA 1IR3A 3QYWA 3LFAA 1KUTA 3DZQA 4ZSJA 2W1DA 4GIHA 1ZMVA 4U8ZA 5AUTA 4F78A 4AOIA 3R7EA 2W1CA 3E62A 3H0YA 2CN8A 2HENA 3TV4A 3UOJA 3BGPA 4AE9A 4DITA 2CKQA 4CMTA 4E5WA 4EH7A 3FJQE 4BTMA 3DZOA 4JR3A 3PXKA 2PUIA 5IA5A 4I5CA 3DJ6A 3BL9A 1PKGA 3KA0A 4K8AA 3RTPA 3QX2A 2XIYA 4O0XA 4QP2A 1XH9A 4KIKA 4Z9LA 2YIYA 2NYAA 4F08A 3UZPA 2ITYA 1URCA 2XH5A 3MFTA 4I1ZA 3OVVA 3D5XA 5EHLA 2UW9A 5EFQA 3SW4A 4CFFA 1Q97A 1Q8TA 4I0RA 4UEUA 4UZHA 1Y6BA 3KMMA 4G17A 4U3ZA 4ALWA 2WKMA 2YZAA 4UMQA 5EW3A 4GK2A 4NFMA 3D0EA 3NAYA 4BDEA 4FEUA 3DCVA 5FRIA 4ANSA 2HIWA 4MNEB 3S1HA 4ZS4A 3W10A 4NW5A 3ZLYA 3WF5A 2EXEA 4FNYA 3DXPA 5DYJA 3WE8A 2O0UA 4H36A 4WBBB 3UQGA 3EHAA 3EQHA 3F61A 3OCTA 3SDJA 4G2FA 3WF6A 1OIYA 1X8BA 3NIZA 3QQGA 2B1PA 2X39A 4JAIA 4FK6A 3FMKA 4MBJA 5J95A 3UVRA 2QG7A 2PZIA 4A9YA 4EHGA 3K54A 1VYWA 2W4OA 5IH4A 5GIPE 3KY2A 2J50A 3GUBA 4GG7A 1Z57A 5JGBA 2OXDA 3NS9A 3U55A 2WGJA 1ZZLA 2PYWA 3R21A 2XNBA 3ANQA 3P7CA 4CEGA 1JSUA 5EDQA 3KRWA 1OPKA 2PHKA 4JQ7A 1VEBA 4M66A 3R7VA 4HZSA 4MNEA 4C02A 3AMAA 4IHPA 3MTLA 3JS2A 2OXYA 3O71A 5HCYA 3F3TA 4YU2A 5B2MA 3II5A 3TDWA 4JDKA 3UO6A 2WQMA 3IGGA 4PV0A 4BYIA 4TWCA 1WBTA 2IVVA 4FKWA 4FTIA 4G6OA 5EOBA 4D2VA 5K4IA 3R9DA 5GIOE 4QYEA 2F2UA 3QTQA 3K5VA 2WQNA 3BU6A 5JQ5A 5LWNA 3DLSA 5CEOA 4FEQA 5GZAA 2WQBA 4NM7A 4RJ6A 3TIYA 5FTQA 4DTKA 4PTEA 3AC4A 3ORIA 1J3HA 4BCKA 2GFCA 4FIFA 1IA9A 3VNTA 5EYKA 5D41A 4JL9A 2VTMA 3RALA 3WIKA 1GAGA 1CSNA 4AW2A 4W4YA 5HOAA 3LXPA 1YRPA 2XS0A 3ZFYA 4CXAA 3TWJA 5CF6A 1H26A 1FGKA 4GEOA 4M0ZA 2EXMA 3BV2A 4QQTA 3MB7A 4YJNA 4CFXA 4QP4A 3VQHA 3F5UA 1V0OA 1YXTA 4O4DA 2C69A 3W8LA 4HOKA 1Q5KA 1UU3A 5HBJA 1J1CA 3CJGA 3RAKA 1KOAA 3I0OA 2FYSA 3NYNA 5ITAA 5HZNA 4LOQA 4EHEA 5E92A 2QCSA 3MPAA 4DHIB 2OFVA 2PMOX 4WUAA 3PWYA 3JVSA 4GU6A 3UDTA 1OB3A 2GS2A 2WD1A 3QQUA 3VUTA 2DUVA 5D12A 3E87A 3W0QA 4CT2A 1TKIA 3DAEA 3G0EA 3QXPA 4XV3A 4FJVA 2NPQA 3MSSA 4ZJJA 4BDFA 3A7GA 2FUMA 4OTRA 1AQ1A 3ZFMA 3AT4A 4FKOA 3PSCA 2WMAA 3C4ZA 5T3QA 3R8PA 1XH7A 1YKRA 3S3IA 4DEEA 3CEKA 3I5ZA 2X8IA 4OR5A 3H0ZA 4P4CA 5L6WL 4A4XA 4IADA 1XQZA 2GQGA 3Q4ZA 4DC2A 4QT1A 2VWIA 4GFOA 4IZ5A 3WOWA 4IC7A 4O7WA 2BCJA 4O27B 2P3GX 3C0HA 3BRBA 3W1FA 5EM8A 4YO6A 1OKYA 3L9MA 4LFIA 5H8BA 4FV2A 2I7QA 3NYVA 3O50A 2VWYA 3KN5A 3MH2A 1V0BA 4UWBA 2VX3A 3KVXA 4RMZA 1MQ4A 2PMNX 2KTYA 2X7FA 3R0TA 4J53A 4PRJA 2R3MA 2QU6A 3HECA 5CSHA 4NJ3A 3AKJA 5BVDA 3NUYA 3H4JA 2C1AA 1NT2A 4IBMA 4LGHA 2BAKA 5KMOA 2OJ9A 2YJSA 3W33A 2YCQA 3NYOA 2W5HA 4UYAA 5E8UA 2V62A 3OEFX 3SVVA 4EI4A 4USEA 5J1VA 3ITZA 2OIDA 2RG5A 4IFGA 4YHJA 2XKEA 3UC3A 1STCE 4UB7A 4JBPA 5HVKA 2GNHA 4IB0A 3SQQA 3GENA 3G6GA 4CCBA 3DQWA 1WVYA 4D28A 3UDSA 3QZFA 5HTIA 1YDSE 4Z7GA 3PUFC 4OUCA 2FGIA 1GZNA 2QOFA 4F9AA 3QD4A 5F1ZA 3K3JA 4RVKA 4AGUA 4G3FA 4C4FA 3QCXA 3M11A 3TKIA 5C8NA 4YTIA 1XHAA 4JVGA 4M7IA 2PUNA 3BEAA 2GHMA 2ZV7A 3AG9A 3PE1A 5E8TA 3ROCA 2OXXA 1Q41A 4CRLA 4F9CA 5J9YA 3QRUA 5AP1A 2V7AA 3HRCA 4NH1A 4ERWA 4FT3A 4KRCA 5I9VA 2C1BA 3RM7A 2YM6A 1KWPA 5CVFA 4TTHB 4CYJA 4QYFA 1TQPA 2XIRA 4GJ2A 4HNFA 5HO7A 2QVSE 3HMOA 2GS6A 1YHVA 2PULA 4HCTA 2UZBA 3FQHA 3P9JA 3ORTA 5AV3A 3A4PA 2B7AA 2ITZA 2PUPA 2Y4PA 5L2IA 3D4QA 4MF0A 4BFMA 2DWBA 4G31A 5C9CA 5LMBA 2I6LA 4Z3VA 1U46A 3U87A 4J8MA 3ZO2A 3DDQA 2GTNA 2QOQA 3GOKA 4KAOA 4CFVA 1NVSA 1ZMWA 4H3PA 3LQ8A 2GNLA 5F9EA 4HCVA 4WO5A 4FV4A 1J1BA 1Q3DA 4FSNA 5C4KA 3RZFA 4KBAA 5BMSA 2G1TA 4MK0A 3ORZA 3GQLA 5JZJA 1TVOA 1OITA 4XH6A 2WFYA 5ANOA 1VYZA 4GFGA 3V8WA 2P55A 3CS9A 1MQBA 4YMJA 3DBDA 3FLYA 4A7CA 3T9TA 3IG7A 2E9OA 1JWHA 1E9HA 2XRUA 3UDZA 4EHVA 5KMJA 2JIVA 2QOLA 4Z7HA 3V8SA 3D14A 3ZZWA 3COKA 3E92A 4FKVA 4A4OA 4AT3A 2CKPA 3EYGA 4OTFA 4YHFA 1G8SA 5IH5A 2YJRA 2YEXA 4WRGA 4YJRA 3GFWA 3R9RA 3RP9A 3DBCA 3FC2A 3OD6X 4EC9A 1W8CA 3NNXA 2F57A 4W4XA 4FV9A 4YC8A 3UTOA 4B8MA 3IKAA 5I9UA 4FZAB 4FZ7A 3EL8A 2C6IA 1XMMA 3R6XA 3KXMA 5EI2A 5CEQA 4S34A 3VS6A 3Q9WA 4UN0C 3TMOA 4E26A 3OXZA 4FT5A 5H8EA 4JDHA 4MXYA 5TE0A 3BLHA 3FQEA 3ZYAA 4MWIA 3ALNA 3PY3A 3Q52A 4AP7A 3PZHA 4U41A 2EXCX 2YM8A 3GP0A 3P78A 4EBWA 3NFGB 2PE2A 4F0IA 5CF5A 3V3VA 3WILA 4XUFA 3IGOA 4G3GA 2HZIA 3NZ0A 4FG8A 1P4OA 4RZVA 3VAPA 4IDVA 4NU1A 4H3BA 3KRLA 4NK9A 5KHWA 4FV3A 4UWCA 3HAVA 5CNNA 4IVAA 1CKIA 4R1YA 4AX8A 4DFYA 4EEVA 5IA3A 5K4JA 1UNHA 4YGAA 2CMWA 2REIA 4UMRA 2VO7A 4E8AA 4O2PA 5M53A 5FUTA 3R9OA 2IJMA 4KUJA 1Z5MA 1H1RA 2FSLX 1G8JA 1XMLA 3BPRA 3UZRA 5IF1A 4OBQA 3W8QA 3GU5A 3MPMA 3R8VA 4BRXA 3PIZA 1PRYA 4YLKA 3E8EA 4C61A 4F0FA 4R3PA 2R3KA 4H39A 5JRSA 4O7TA 1OL1A 3QRKA 4DFNA 4QDEA 3TYKA 3SAYA 1JSTA 4GRBA 5EDRA 5HG8A 3COHA 3CGFA 2YAAA 5DLSA 3F2NA 3IPHA 2BTRA 3PLAE 3WBLA 4BWPA 3N51A 2I0EA 5DN3A 2X6DA 3F2RA 3LXLA 2C4GA 2PMIA 2QLQA 3MBLA 1NA7A 2GNGA 2W5AA 3FL4A 3U4UA 3ZUUA 4AS0A 3BWJA 2ERKA 5HGIA 2NRUA 2V0DA 3TG1A 2QKWB 2WELA 2QR8A 3KF7A 3CKXA 3Q2MA 5AP3A 5DR6A 1PMUA 3I81A 5ICPA 3GCPA 4EK6A 4EOMA 3UBDA 4AA4A 1G8AA 4X2JA 4MXCA 5C03A 1OIRA 3LFFA 2G15A 4HVGA 5I9YA 5E1SA 2CNVA 3FZTA 1OL2A 4GUEA 1IEPA 4FICA 3W2CA 2X2MA 3ALOA 4DAWA 4HVHA 3R9NA 1LR4A 4CNHA 1A48A 2C6MA 4G34A 3BWFA 3ORMA 4BGHA 4FT9A 4I0SA 2C6TA 2VNYA 3O7LD 4ERKA 1MRYA 4PP9A 4C57A 3QQFA 2I0YA 3PXYA 3BLQA 3AXWA 4M84A 2VGOA 2UV2A 5M4CA 2BMCA 3R28A 5AP2A 4RIYB 3NFFB 4GKIA 2Z2WA 2OO8X 4MWHA 4BTJA 4ACGA 5DMZA 4RFYA 4FKPA 3UJGA 5L6OA 3QKLA 3KMUA 4FX3A 3PZEA 4HYHA 3BU3A 4M0YA 4ZTSA 1BI7A 5IA0A 3H10A 2G2FA 2JDOA 2XRWA 1YDTE 3EL7A 3KF4A 3L9NA 1YXSA 4OT6A 5FEQA 1XR1A 4BC6A 2J51A 2HY81 2JITA 2PMLX 4QD6A 2XUUA 4WNOA 3TCPA 5IMXA 5IZFA 1B6CB 4O84A 2GTMA 4AAYA 5B2LA 2PVNA 4IWPA 4KS7A 3D5WA 1O6YA 4PP7A 3VONA 1YVJA 4RWLA 3FEGA 4BCPA 3FMLA 5KE0A 3L9LA 2YZLA 4JDJA 3DBEA 3CTQA 3ZUVA 3QTRA 5CVGA 4I20A 4RIYA 2QG5A 3V5PA 4IB5A 3GB2A 5AAFA 5BUJA 3AD5A 3FXWA 4MTAA 5CZIA 4YSMA 4BCJA 2AQXA 3OT3A 3BZ3A 3DK6A 3VULA 4DE4A 3KREA 4D0WA 2GSFA 3SXSA 4PNIA 5HBHA 1L8TA 4FVRA 4FKIA 5DGZA 2VTHA 2ZMCA 4UWYA 3VS5A 4YTHA 3VBVA 4OTPA 4BCIA 2HAKA 4C4GA 4P5ZA 3VC4A 2VTIA 3MV5A 4QMUA 3ZMMA 2ONLC 2IF8A 4U45A 5E1EA 4XRJA 3JUHA 1JKSA 4AZVA 3DK3A 5EM6A 4L67A 2IPXA 4E6CA 1G8KA 4ITHA 3DKOA 4DG2E 3ZRKA 2YDIA 4O4FA 3BYUA 4MD8E 4EC8A 2ETRA 1ND4A 1ZRZA 2ITUA 4G3DA 4DT9A 2PVLA 3KC3A 2X9EA 3CQUA 4FSYA 4EH9A 3E8DA 3R1SA 3FZRA 4WKQA 4G9RA 1RJBA 2ZMDA 3KVWA 4JBVA 4RA4A 5AR5A 4YJQA 4YP8A 4XLIA 3AKLA 4RWKA 5ETIA 2GHGA 2ERZE 2PVHA 3BU5A 4LMNA 4RFMA 5IG1A 2JKMA 2RSVA 4N0SA 3NUXA 3PY1A 4TT7A 1LEZA 3SC1A 3EQGA 4QPAA 3UIBA 3F2AA 3S4QA 1UNLA 2UW4A 4MEDA 3NUAA 2PUUA 5AUXA 2R3FA 5EKNA 3PWDA 5M08A 2BTSA 3SV0A 2XIXA 1IASA 2Y0AA 4AG8A 1KOBA 3NW7A 4BZNA 4U3YA 4IFCA 4BIBA 2YITA 1QPJA 2F2CB 2XMYA 4RFZA 3VW8A 4RRVA 4XOYA 3ZH8A 3ZLSA 4BY9E 2JLDA 3LFNA 4BWKA 3GCUA 5DRDA 3AC5A 4ACCA 2Y8OA 2UZNA 4GVJA 1YOJA 4YZ9A 4CTBA 5TT7A 4IAFA 4QQ5A 2WTCA 2PE1A 4EWQA 4QMVA 3EFWA 4FV8A 1OKZA 4C36A 3ATSA 4UYNA 2CGUA 2VUWA 3QL8A 2J6MA 1NVQA 4IX4A 4U97A 2CGWA 4C4EA 2X0GA 3TJDA 3ULIA 3VHKA 4K77A 5CTPA 3D94A 5M4IA 4M13A 5BYZA 1RW8A 3OMVA 4DBNA 3WZJA 4X0MA 4C0TA 4F1OA 4BB4A 3MFSA 1UU7A 3RM6A 5JRQA 2PZYA 2IW8A 4AUAA 2Y7JA 5KMIA 1P4FA 5CI7A 5GINE 5B0XA 2YIXA 4V05A 1OI9A 2F7EE 4CYIA 1PXOA 4BWXA 2I0VA 3Q60A 4F7JA 5IQDA 3DFCB 5HORA 1H08A 5HO8A 2XNOA 1JPAA 4JXFA 1M7NA 4LQMA 2H9VA 5FG8A 5CYIA 2XJ1A 5DIAA 2OF2A 5ANIA 3QUDA 3F69A 5GZ9A 4ACMA 3MVJA 4PNKA 2HWPA 3LFSA 4EH8A 1Q8ZA 5FGKA 4CV9A 4HGLA 4MXOA 3E5AA 3NX8A 4ORKA 4CG9A 4I0TA 1H25A 4PTGA 4JR7A 2XF0A 1M2PA 3VBQA 4LV8A 3SD0A 3C7QA 2R3PA 4JG6A 4DEDA 4D4RA 4EUUA 4C33A 4WG3A 3QUPA 5CU6A 4D5KA 4FTUA 4AXFA 1FVVA 3VJOA 3W2RA 5HTBA 3G90X 4BDKA 4C8BA 2BZKB 1XBCA 4FC0A 1KE6A 4RJ4A 4Y85A 3AMBA 4BHNA 3AC2A 3FHRA 4M69A 3R83A 4P90A 3V5QA 4E73A 4F7SA 1JBPE 3Q96A 3N4UA 3V8TA 4O7VA 1YDRE 2BAQA 2UZDA 5L8JA 3TZ8A 3IS5A 5IKWA 2WHBA 3R7OA 3GU8A 4NKAA 3N4TA 1REKA 3LFEA 2C6KA 2W1ZA 1H1PA 4YJSA 2JKOA 3ZEPA 4X6RA 1XBBA 4ID7A 4XG8A 5K9IA 5BV3A 3EOCA 2H8HA 3P4KA 3NUPA 3ZFXA 4U80A 4AN3A 4XJ0A 5FWKK 4IXPA 2JBPA 3PXRA 1WVWA 1W7HA 4MCVA 4JI9A 2JD5A 5GJFA 5L2WA 3F66A 4QMLA 4DINA 2ZM1A 3EQPA 5CALA 2C6OA 3ACKA 3ZCLA 4EKLA 4RIWB 3HEGA 4DCAA 3CBLA 5DNRA 4TN6A 5BVEA 3E3PA 2BRGA 3I7CA 3ORXA 3EQRA 3VBWA 2VN9A 2AC3A