2FYSA

Crystal structure of erk2 complex with kim peptide derived from mkp3
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
349
structure length
348
Chain Sequence
GPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Structural basis of docking interactions between ERK2 and MAP kinase phosphatase 3
pubmed doi rcsb
source organism Rattus norvegicus
total genus 88
structure length 348
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2fysA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2fysA01
2W5BA 2XCHA 1PYXA 3FZ1A 3PXRA 2GNIA 3L8VA 4EWHA 4EOJA 4W4YA 4DFZE 1OL7A 3PWDA 4RWJA 3RK5A 1QPCA 5I9UA 2W1DA 1XH6A 3GVUA 3P08A 4FYNA 4JBVA 4ZSJA 4ACCA 4WBOA 5CAVA 3A7JA 3GT8A 3QXOA 4FOCA 4GK4A 2W05A 5AUXA 5IEYA 2BRHA 1H00A 3BHUA 4FKTA 4C58A 4FI1A 4ZZNA 4GW8A 5CALA 4FE2A 4I6QA 3UC4A 5FM3A 3ZSGA 4BN1A 4B0GA 5CU0A 2VTRA 4PMSA 4XJ0A 3MB6A 3RAIA 3DOGA 5IQEA 4MTAA 4CTCA 4YC3A 2WEIA 3I1AA 5HBHA 2SRCA 4KSPA 5JGAA 4BICA 2VNYA 4U9AA 4TN6A 2PMOX 4QP1A 4DEBA 2VWXA 4QP4A 4V0GB 4PMPA 4IWQA 2HY81 5AUTA 2EB2A 4ZP5A 3ZC6A 4ZS4A 3U9CA 1R0EA 4IMYA 1FGKA 2QOBA 4LMUA 4F6WA 3BEAA 3QCSA 2PZPA 3DJ5A 3QLFA 3TT0A 4EYJA 3JVSA 1WBWA 4BTKA 4FSQA 3W32A 1XBCA 1CKPA 3HUCA 3M42A 4CYJA 2E9NA 3LFFA 2GTMA 2OJIA 4II5A 3F6XA 1I44A 3FMKA 3ANRA 2UVXA 5KCVA 3DGKA 4RIYB 3FWQA 1YWNA 3PJ3A 5CQWA 5ETCA 4U79A 5LVLA 4EONA 2NNWB 1OKYA 2F49A 1ZY5A 3M1SA 5EW8A 3HV4A 4BKYA 4CFFA 2WQNA 4RJ4A 5AUYA 4KINA 4NU1A 2WMBA 4QQ5A 2WMAA 3MPAA 1J7UA 3GC9A 4KBCA 5JQ8A 4E1ZA 4RVLA 3UO6A 4L3JA 3EQRA 4DGLC 4ENXA 2WQEA 3VUDA 2F7XE 4NT4A 5CEOA 2OXXA 4FV1A 4WUNA 3S0OA 4DT9A 4E5BA 1VZOA 2W1FA 2YA9A 5KHWA 4FV0A 5ANDA 3HL7A 4AGWA 1Y57A 3LM5A 3PTGA 5BUEA 3PE2A 5CT7A 4FEXA 3VS4A 2YDKA 3QUPA 4IB3A 3JXWA 3U51A 4E93A 4O7SA 2WMXA 5GNKA 3G51A 4PP7A 4ZZOA 4JR3A 5BQ0A 2QD9A 3R9HA 2WQOA 4FV3A 2ITWA 4G3FA 5EHLA 4BCOA 5IA3A 2Z02A 1YOJA 2OH4A 4GVAA 4RT7A 4A9YA 5L2SA 3MS9A 2J0JA 3SKCA 3VW6A 4D0WA 3BHHA 3RTPA 4FKQA 3S95A 3OW3A 4YNOA 3UZPA 4BCPA 5A4QA 2J0IA 4MXXA 4ZS0A 4FSZA 3OS3A 4ENYA 5AP4A 3A7IA 3H3CA 2GS6A 3NW7A 4D4YA 2BPMA 3CJFA 3W55A 2R3NA 4DGNA 2C4GA 4M0YA 3BU5A 1GAGA 4IW0A 1OBGA 2YM3A 4XRJA 3U8WA 4ZIMA 2J51A 2JITA 3V6SA 4TWOA 4H36A 4GV1A 4UZDA 3QA0A 4RJ3A 3VVHA 4E7WA 4YTIA 4YSMA 2UZOA 1V0BA 3HYHA 2OZAB 2GHMA 1P5EA 4C3FA 3A4OX 4B7TA 1WBVA 5IH6A 4QMNA 1KUTA 2ERZE 3ZRLA 5CVGA 5C8MA 3ZLSA 3II5A 5FM2A 4ZMEA 4C2VA 3O0GA 4XG8A 2E2BA 4YUQA 4M97A 2IG7A 3ZYAA 1OUKA 1URCA 4X6RA 2B7AA 4Q2AA 5EHOA 5L3AA 5HCXA 4JX7A 4D55A 4LUEA 4O7LA 3FI3A 4AZSA 2JDTA 1BL7A 4IWDA 2HWPA 4FTMA 3FMLA 3HMPA 2HZ0A 4TNDA 3FKLA 5L8KA 3MVLA 4QT1A 2R3OA 2Y0AA 4DYMA 2OJ9A 4YZNA 3KN6A 3QQGA 4J97A 2OJFE 2XK3A 4DBXA 1FMKA 4OTIA 2ITXA 4OTPA 5M09A 2QU5A 4WNOA 2CGVA 2W4OA 3GCSA 5L8JA 2JFLA 3P78A 3MVMA 2Y6MA 4O22A 2ZYBA 4XG3A 3QFVA 3LFBA 5F94A 4L53A 1MRYA 4FTAA 4QMVA 3ZBXA 4FTNA 3NNXA 4G6OA 4JL9A 1WBNA 3BRBA 3EQFA 3SXSA 2W17A 4UV0A 4CFNA 4EC8A 1W0XC 3ZO4A 4K2RA 3PA5A 2ZV8A 4FKSA 3LCOA 3RGFA 2VX0A 2C0OA 5IUGA 2OLCA 1M2RA 3LVPA 2O0UA 5FBNC 3LFEA 4MWHA 3AMBA 4R6VA 4AW0A 3AXWA 1H1QA 2EXMA 4DGMA 4CT1A 4CKRA 4JRNA 3VWAA 2BZIB 1OIYA 3KRXA 5A6OA 4JOAA 4MXYA 2XIXA 4JRVA 5I5ZA 5E7RA 2QR8A 4D0XA 2WOUA 4D2VA 1GIHA 3RJCA 3W8QA 1SVHA 2A2AA 5I9YA 3ZCLA 5JN2A 2GNHA 2YCRA 1YI3A 3ZM4A 2PUIA 2ZDTA 2G2IA 2PUPA 4KIKB 1H24A 3Q2MA 4F09A 3ACKA 3QKKA 4F1MA 4ERWA 3HA6A 5F1ZA 5TT7A 3UVPA 4RA4A 3ALOA 2C6DA 3Q5ZA 2QLUA 1Q3WA 5BYYA 1O6LA 2OF4A 1M2PA 4XS2A 5T68A 4CMOA 2RF9A 2XZSA 3LXLA 3Q6WA 4G6NA 4LRKA 5LVMA 1YRPA 3BBTB 3I79A 3F5GA 4QP9A 2Y4IC 2QURA 5F9EA 3R8LA 3WILA 2X9FA 4OAVB 3VHKA 1ZYCA 2UW5A 3EB0A 5AP1A 2WMRA 2W06A 3ZO1A 4Y46A 5CSHA 3OCSA 3UC3A 4CNHA 4PRJA 4ERKA 1XH8A 3NZ0A 2HZNA 1YOLA 2VTNA 1PMVA 4FIEA 2IVSA 2JDRA 4EK4A 1JLUE 5EYCA 3JVRA 3NW6A 4FOBA 5CZHA 3ALNA 2FGIA 4IAZA 4YHFA 1SVEA 1XQZA 1Q8UA 3MYGA 5HTCA 4Y83A 5AV0A 3VBVA 4YNEA 5KMMA 3F3TA 2O63A 3HV6A 4MK0A 2PU8A 3QTSA 2G15A 3B2TA 3LXPA 4HYHA 3OCTA 3LXNA 2C6IA 3CD8A 2WMUA 4FSNA 1UKHA 4TNBA 2JKOA 4TYJA 3LZBA 5D1JA 2ZB0A 5IQHA 4YHTA 2PWLA 3DK7A 2XRUA 2PUNA 1REJA 5HGIA 5HIDA 4EH9A 1QPDA 4YO6A 2KTYA 4AUAA 4DFNA 3LFCA 2BHEA 3D9VA 1ZYSA 2WOTA 4ID7A 4IVBA 3VUKA 4NFMA 4BI2A 1U59A 2CSNA 3TN8A 5EYMA 4UALA 2YM5A 1ZZ2A 4M68A 3ZFYA 3ODZX 4APCA 2W5HA 3MTFA 3UNJA 5J7HA 3RPSA 2P2IA 3LCSA 4WIHA 1DAYA 2VV9A 1U46A 3NUPA 3FMHA 5DR6A 4YSJA 2IPXA 3RPOA 3UOKA 4FL1A 4BDGA 4D4VA 3OP5A 4PPAA 3FSKA 4N6YA 5E8TA 1KOAA 3HMIA 1WAKA 3NNWA 2B54A 5AADA 3AGMA 2YIWA 3FZTA 3MFSA 3OT8A 4GEOA 3R21A 4QQJA 1BL6A 1J3HA 1OITA 4JBOA 3VS2A 3V8WA 1IAJA 2XIRA 4PTCA 3EFJA 3QTWA 1RDQE 4FIIA 5KMLA 2ZM1A 4FKVA 3AC3A 3I6UA 2QHNA 2WU7A 4F7JA 4WG4A 2WMVA 3RNIA 2XNOA 4BCIA 3D14A 2B53A 3COHA 3BLQA 3O8PA 4OBQA 5HOAA 5AUUA 3AMYA 3K3IA 2YACA 3PJ8A 5ANIA 4PTGA 1SNUA 4BKJA 4AG8A 2XM8A 5AV2A 5AWMA 2WMSA 4D2WA 3GU6A 2C6MA 3ITZA 2XUUA 5AAFA 4RWLA 4FV5A 2Z7QA 3O7LD 4IACA 3JS2A 5M55A 3AC8A 2OBJA 4U0IA 5I9ZA 4QMYA 3NMUF 4FT7A 3BV3A 2XNPA 3NX8A 3OXZA 4F1OA 3QWJA 3CC6A 5DT0A 5K5NA 5L2IA 4YTCA 3ORIA 3VULA 3NR9A 1RE8A 3FZPA 5IA2A 4YJQA 4OAUC 3TWJA 4BGQA 5M53A 3ATSA 3EQPA 2JDSA 4TY1A 3EOCA 1YDRE 5ETAA 5HU3A 5M4FA 1WVWA 4EK8A 5KZ0A 4K18A 1UVRA 1OKWA 3GU5A 3UZRA 3AQVA 3C5IA 2BCJA 3ENMA 3CKXA 4XV2A 3PXZA 4BHNA 2PVKA 4FSRA 5EW9A 4JIAA 3SOCA 3IPHA 2QU6A 4TW9A 4IAYA 3VHEA 3NWWA 2YIRA 2VWIA 2PVNA 2PZIA 4IC7A 4IEBA 5A4EA 5BUIA 3KREA 4AN2A 2ZM4A 3IQ7A 2OW3A 2CN8A 5HTIA 4D58A 3GI3A 3F82A 4B8MA 5LXMA 1JVPP 3NDMA 2HY0A 4I0TA 4R7HA 5GJFA 4C2WA 5AAGA 4EH7A 5DHJA 1QCFA 4AGUA 4YJVA 4K0YA 5CXZA 3BV2A 2GFSA 4CCUA 3G33A 3PLSA 3PPKA 4IAIA 3V8TA 5CT0A 5J9LA 3HV3A 2QODA 5GJDA 2YJSA 4D9TA 2QG7A 5AR8A 4O7YA 2C6OA 5D12A 3QYWA 4H1JA 4EUUA 4N6ZA 3KXHA 4KB8A 3DXQA 2A19B 4DH7A 4R1YA 4H05A 4RX5A 3CPCA 2HAKA 2QVSE 4W4XA 3KK8A 3E8NA 4HVSA 3ZZWA 2XYNA 1YKRA 3MJ1A 5GZAA 3G0FA 5FDPA 5I9VA 3BQRA 2WTWA 5AMNA 5EQEA 5L8LA 3VS6A 4ASEA 4C37A 1LEZA 3OXTA 5I4NA 4RC2A 4UMRA 4D28A 4AA0A 5BVFA 2EVAA 2PK9A 2GU8A 3TKHA 4XLIA 4CV8A 3MA6A 3E93A 3S4QA 4C4IA 4CZUA 3FHIA 3OBJA 5CANA 3QTXA 1KV2A 3FAAA 4FTIA 3R7YA 3S3IA 3NVMB 1OIRA 4U41A 2BMCA 4BWKA 4E6QA 2UW8A 5H8GA 3MV5A 3BZ3A 4YTFA 4FV8A 4YMJA 3QTZA 5IZFA 2C3IB 2PZ5A 2C47A 2JEDA 3QTQA 4FTJA 1M2QA 2V7OA 5BVNA 4AT3A 2Y4IB 3SVVA 1FGIA 1WMKA 3IDCA 3UPZA 3WYXA 4FUYA 1BI8A 4X21A 3WF7A 2CKEA 3P7CA 4F0GA 3IGOA 3PZEA 4ANSA 1VYWA 3EWHA 4DH3A 3AG9A 3UYTA 1H07A 5E8XA 4LOOA 3UMWA 5DOSA 4E4LA 4J99A 2OZOA 3Q4CA 3E3BX 4GUBA 4HGEA 2PVHA 5D7AA 3DKFA 3D5WA 3W2SA 3WZKA 4DFLA 1VR2A 2YWPA 4KABA 3QGWA 5H9BA 4C57A 3EN4A 4BIEA 3JPVA 3R04A 4EJ7A 2BFYA 3FE3A 2W4KA 3U9NA 4JDJA 3UZTA 4HCTA 3EL8A 1WBTA 3MJ2A 1YHVA 2JIIA 3QQJA 4RBLA 4S31A 4C36A 4WUAA 1H27A 3W33A 3TV7A 4EOOA 4O96A 2XNGA 1BX6A 3HLLA 3S00A 5EDQA 1Q8YA 3VUTA 1OI9A 5FGKA 4BCFA 1YXUA 1MRVA 5E91A 3LOKA 1PYEA 4KBKA 3CS9A 1WVYA 4DC2A 2V22A 1H4LA 4D2PA 3LXKA 4X3JA 5J5TA 4GFOA 5BUJA 2W1HA 2W5AA 3ORTA 4ITJA 4RQKA 1YXTA 5IQCA 2X2KA 1W98A 3D5XA 3EIDA 3MH3A 1UA2A 1XWSA 4MXZA 4EBWA 5AFVA 3GQLA 4L9IA 1OECA 2VTLA 3SC1A 3VUGA 1A9UA 1QMZA 4IFGA 4OTWA 4EHGA 3ZM9A 3E3PA 4AA5A 4C4FA 1LP4A 4IZAA 4AF3A 5DE2A 5IA4A 5KUPA 2XKDA 3KMUA 4NTTA 4O81A 4UYAA 2QO2A 4GU9A 3NEWA 4JQ8A 4N70A 4F08A 4ASXA 4BGGA 3GC7A 1PF8A 1VEBA 3EQDA 3GQIA 2YLEA 3MVHA 4ZSGA 5BVEA 5DEWA 3EHAA 3QRIA 1SYKA 2WTKB 3D83A 1H1PA 3BGPA 5DVRA 4XP3A 1P4FA 4JS8A 1PMUA 5IDNA 3PPJA 4U42A 4XP2A 4EQUA 2YCQA 5CI7A 2CHLA 4DN5A 3VUHA 4LL0A 2UZBA 3TIZA 3PE1A 4PP9A 2IO6A 2VTJA 1KSWA 3FHRA 4DGOA 3UVQA 3VIDA 3A8WA 2YAAA 3DPKA 4GSBA 5M4CA 5E4HA 4EOLA 4CZTA 1WCCA 1JSVA 4UMQA 3D4QA 2B9HA 3TJCA 1F5QA 2JIUA 2ZM3A 3FXWA 2XMYA 5DYJA 5L2QA 2YDIA 4EK3A 2BROA 4BCHA 3U4WA 3QZIA 4CFXA 4OT6A 3ZDIA 3NRMA 4DEHA 2NPQA 4BVUA 1Z9XA 3SW4A 2RL5A 2R3PA 3O51A 4H58A 4TWCA 4WG3A 3PDTA 2R3KA 3P7BA 3A7FA 3FZRA 4XRLA 4QYHA 1L8TA 3MH2A 3P7AA 4CG8A 4C33A 5A3XA 1CTPE 3H9RA 3T9IA 5AR2A 5KMKA 4I5CA 3Q6UA 3OROA 3G9NA 3MY1A 5KHXA 4HNIA 2OWBA 2VTOA 3OEFX 4JAIA 4EUTA 3MY5A 1ZYDA 2R3GA 2XBAA 4FVPA 4IWPA 3VS1A 3TACA 3ZMMA 1Q62A 3ROYA 3ZHPC 4DAWA 1ZRZA 2UW7A 4IZ5A 3PG1A 5LJJA 2X4ZA 3QQUA 1Y91A 2X1NA 4O0VA 3WF6A 3A2CA 2R7IA 4P5QA 3HV5A 1WBOA 2WFYA 3R8PA 2X4FA 4FZDB 2QKRA 1REKA 4IAFA 3FMDA 4NK9A 1Q99A 4AACA 4DHFA 4QQTA 2CNUA 2ETKA 2ITNA 4XNEA 2OO8X 4YJRA 5EQYA 3UQCA 3OC1A 4QMSA 1DAWA 4Z55A 5EM5A 4MNEB 5LCKA 1Y8GA 2BRMA 3DK3A 4TT7A 4UEUA 4JDKA 1JKTA 3EQIA 3NIEA 2OI4X 3W16A 4UMUA 2WQMA 4C61A 5IMEA 1JOWB 2WD1A 5AR4A 1DI8A 4AOTA 5CNNA 5IH5A 3QX2A 3QHWA 4FT5A 1Q3DA 4ANQA 5CZIA 2VWBA 3ODYX 4FGBA 1GZNA 5ANEA 3VS5A 1H26A 4G1WA 1KE8A 3GC8A 3HGKA 4RVMA 3SRVB 4AXAA 1F3MC 3QTRA 3LM0A 3OOGA 1OL6A 2XVDA 3I0QA 4WBBB 1Z5MA 4HVDA 4I4EA 2XIYA 5BMSA 3O7LB 5HO6A 5FQDC 3KFAA 2GQGA 3HUBA 4ITHA 3I81A 4QRCA 3CXWA 5J87A 3KU2A 3O50A 4FF8A 3UPXA 4CEGA 3Q2JA 3ORZA 4BBEA 2OFUA 2JBPA 5IQGA 3IW7A 3MWUA 3F5UA 3MN3A 2ITUA 3NLBA 4MAOA 4P4CA 4RLKA 4ZTNA 2I7QA 3L9MA 5J5SA 2WGJA 2PZYA 4I5MA 1FVTA 2WIHA 2WO6A 3CP9A 3QCXA 2GPHA 3LCKA 3R8VA 1IASA 2C3LA 3UBDA 3R1NA 4MNEA 5LVPA 4RX7A 4MD7E 2OIBA 2WXVA 5TE0A 2REIA 3U87A 4IAKA 4FTOA 3FLWA 5ITAA 3CQWA 1UKIA 3EZVA 3K3JA 3F5PA 4MCVA 4A07A 3HX4A 3D94A 1PXIA 2VWYA 3N4TA 1JKKA 3R9RA 2FSOX 4S2ZA 3PVUA 4ONAA 4QD6A 1Q8TA 2R0IA 3MIAA 1CM8A 2C6LA 3F9NA 2C5NA 3CY2A 4BYIA 4J1RA 3POOA 3QU0A 4J7BA 4QMPA 4U7ZA 2R0UA 3KL8A 2B9JA 2F4JA 4FVRA 2FA2A 3BBWA 4BTJA 5D41A 3HNGA 4ANOA 4FKLA 3EN5A 4UWCA 3WI6A 5LWMA 2CCIA 3L9LA 3GXLA 2XIKA 3VS3A 1YHWA 3KULA 4RWKA 4Y8DA 4D2RA 5AAEA 2CGXA 1H01A 3BHVA 2GMXA 3LFNA 2JFMA 2FH9A 1RW8A 4QTAA 3VQUA 4ITIA 2ERKA 1PXLA 3UE4A 3LFQA 4TWNA 3Q53A 4J53A 1VJYA 5D11A 4ZJJA 2X7GA 3UODA 3P0MA 2CKPA 3D2KA 4XH6A 4AZFA 3I7BA 4M0ZA 4PPBA 4PX6A 4G34A 4O6LA 5C27A 4OR5A 3R28A 4DFYA 5LVNA 3KY2A 3E7VA 2BKZA 2EUFB 4XHKB 3G9LX 3D15A 4JBQA 5B2KA 3R22A 1I09A 3EMGA 5ACKA 3OW4A 2QOHA 3LJ0A 4G3CA 5J79A 3DKOA 4KA3A 4WHZA 4OTDA 4JXFA 4WA9A 4H1MA 1V0OA 4FZAB 3MI9A 4RLLA 2BRGA 3F3WA 4FSMA 3LQ3A 5M4UA 1M17A 1MUOA 3ZXTA 4GFGA 3RPVA 4ZLYA 2A0CX 4DG2E 3FLQA 1L3RE 2QCSA 3OD6X 4L44A 4UMTA 4S33A 5AR3A 4BDDA 2ETMA 4LG4A 4AS0A 1UU7A 5L6PA 2XF0A 2G01A 2X6EA 4ARKA 4DH5A 4MF1A 2OXDA 2BRNA 2VD5A 2RG6A 4I0SA 5BMMA 4HW7A 5AP6A 3C4CA 3MH1A 2VTTA 1PXPA 2P4IA 1STCE 4G9RA 4YJPA 5CAUA 4NL0A 5EKOA 4F9AA 4AW2A 1H1RA 4J8MA 1QL6A 3ULIA 1XHAA 1Q4LA 2ZVAA 3BGZA 4QMWA 3NSZA 3F5XA 2OH0E 4X3FC 1JQHA 4E73A 5K4JA 4QMUA 3PWYA 3LMGA 1XH4A 5CU2A 3SOAA 4E20A 3FKNA 5HORA 4XG2A 2F7EE 4M3QA 3EQCA 4O0RA 3ZZEA 5ETIA 4M12A 4P90A 2PE0A 3KCFA 3TKUA 3FYJX 3OTUA 1E1VA 2I1MA 3PA3A 3R7GA 2ZB1A 3BWFA 4F64A 4Z3VA 4O0WA 3E92A 3LIJA 5FTQA 3F2AA 2CCHA 4MBJA 4HVHA 4QO9A 3QRUA 4AE9A 1Q5KA 4KD1A 4GKHA 4YPSA 5HG7A 3QD2B 3ATTA 3UTOA 4BDBA 3TUBA 1ZMUA 2P2HA 3UDBA 3CGFA 4QPSA 3RI1A 1ZLTA 1Q41A 2VN9A 3PVWA 4HVIA 2J9MA 3F3VA 2VO7A 5JGBA 5L2WA 2BRBA 3KK9A 1LR4A 2OJGA 2FSLX 4IE9A 1ZZLA 4XOYA 5E8ZA 4O83A 3P1AA 3IECA 3LMHA 2RFEA 4NM3A 4F9CA 2OG8A 3A99A 4PPCA 2PTKA 2Y4PA 4ZSLA 1J7IA 3SHEA 4PDPA 2UZVA 4FV2A 4EJNA 2XK8A 2GCDA 4DFXE 4UY9A 3V04A 4YURA 4USEA 3DBEA 4F70A 4OBOA 1JKLA 1H1SA 3KVXA 3WE4A 3U6JA 3FXZA 1URWA 4I6FA 4CQEA 5HX8A 5H8EA 4MBIA 3DXNA 5K4IA 4RIXB 2HENA 1OB3A 5HG9A 2RGPA 4G9CA 1H1WA 3NUSA 1Q61A 2VTAA 3MDYA 4IFCA 4QNAA 5FEDA 3VAPA 3V5QA 4M84A 4FC0A 4RA5A 3SLSA 3GU4A 5A4TA 1OL2A 1ZOEA 4JR7A 3QCYA 2XNMA 4G3GA 4GRBA 2YIXA 2B9IA 3E8CA 3KXNA 1CSNA 4UYNA 4DGGA 4E6CA 2PULA 5JFSA 3UVRA 4ZAUA 4ZY5A 2I0VA 5HVYA 3SX9A 4O6EA 4M8TA 4XG6A 4TWPA 4X2KA 4PMMA 1ZXEA 5A9UA 3OCGA 3QA8A 4O2ZA 3KRLA 3L1SA 2AC5A 3P5KA 1GOLA 3TNWA 4E4XA 3RK9A 3H30A 4G16A 4UWYA 2C6KA 3BHYA 3ROCA 4FIFA 3CJGA 4WG5A 4C59A 5LVOA 3PSDA 3C50A 3OUKA 5HTBA 3SA0A 4DE4A 3DJ7A 1AQ1A 4YJNA 5EOLA 2RFDA 3KXGA 5ANJA 3RWPA 1UNLA 5A14A 4EHEA 4FT3A 1XBAA 1XR1A 2Q0NA 4IJPA 3ZRKA 4CVAA 2NO3A 2X6DA 3QD0A 4RIXA 2W7XA 4I41A 1R3CA 1PKDA 1WBPA 2NP8A 4FSUA 4GJ2A 4MVFA 2QLQA 3R63A 5CY3A 4ALUA 2XIZA 4ALVA 4CKJA 4AOIA 3T9TA 2H9VA 3TDWA 3VJNA 2UZLA 4O2PA 2QO7A 2BR1A 2RFSA 4LRMA 2BFXA 3FY0A 3QUDA 5JZJA 3ACJA 3MIYA 5TOZA 4G6LA 2PZRA 4GVJA 4WRGA 3MFRA 5EOBA 2XKCA 4XG7A 3CR0A 4MBLA 4PL4A 3JY0A 2QOFA 3QLGA 4YZ9A 3L8XA 3TTJA 3O8UA 4OGRA 3V5TA 2OU7A 5FTOA 5LARA 2JKMA 4TPTA 2J90A 3SXFA 1IAHA 4O0TA 4BB4A 4EL9A 5HX6A 4GKIA 4EOIA 3K2LA 3OZ6A 3QZFA 5TO8A 5CU3A 3R9DA 4EOQA 3GCQA 2XS0A 2F7ZE 2JKKA 2R3HA 3NAYA 2WB8A 3Q9ZA 1MRUA 3D7TB 3MGYA 5AIKA 3PSBA 4BR3A 4I22A 2O64A 3MTLA 4QTEA 3F69A 4YGAA 2VUWA 2ITVA 4D1XA 3B8QA 3Q32A 1BYGA 4CGAA 4DEEA 1PXMA 3A8XA 3IO7A 4I3ZA 1GJOA 3PJ2A 4JJRA 3I60A 3CY3A 3PIXA 4RJ7A 3DFCB 4LL5A 2XNEA 3OFMA 4KKHA 3DS6A 3C5UA 1LPUA 2BAQA 2WELA 4K1BA 4F63A 4ZXTA 2R3LA 3RINA 4IX5A 5CEIA 4O27B 2PVLA 3R00A 4HVGA 3DKGA 4G5JA 1PXOA 4Y72A 3BLRA 3WZJA 4F6SA 3COMA 2WTVA 2RSVA 4USFA 3PJ1A 3LFDA 2VO6A 1Q8WA 2YJRA 3MPMA 2WTIA 4QTBA 4WSYA 4O1PA 5I3OA 3R9NA 3C51A 2HCKA 5CTPA 5GIOE 3I5NA 1U54A 4F0FA 4LGGA 4P7EA 4PWNA 3QKMA 3FUPA 4APPA 2YABA 4I6BA 3SQQA 4RFZA 5CLPA 5CXHA 3H10A 3GUBA 4ZJIA 3R9OA 4X3FB 3QF9A 4M14A 4AOJA 2CDZA 3HDMA 4MD9E 2BALA 3D7TA 4RGJA 3QD4A 4UBAA 1G8AA 2CMWA 2XB7A 3BLHA 4Y73A 2DYLA 3D0EA 3Q4TA 4BZDA 5C8KA 2ONLC 3CCNA 2QOKA 3A62A 1ZMWA 2VO3A 3KGAA 3N4VA 1H28A 2B9FA 4FA2A 5EDRA 2JDOA 3F7WA 4F7NA 3R83A 3CEKA 2W1ZA 4I20A 5DGZA 5KBQA 4ZLOA 5CENA 3LAUA 1O6KA 3D2IA 5JFVA 4C34A 3IW5A 1W8CA 3VO3A 4BF2A 4BKZA 2XEZA 3AGLA 2UVZA 4JG7A 4E3CA 3N9XA 4AFEA 2Q83A 2F57A 3DLZA 3EFWA 4FZ6A 2XRWA 5L2TA 3E88A 4U3YA 2VX1A 5CX9A 4LGHA 2AUHA 2UW6A 4YC6A 4K11A 2RKUA 4PNIA 3LFSA 2QNJA 1ZYLA 1XH7A 2YERA 4K9YA 3Q04A 3MW1A 3GU7A 3MY0A 3C4WA 3FL4A 4WD5A 4WNPA 3T3VA 4ZTLA 4FVQA 3S1HA 4GK2A 3QZHA 4RVKA 3DAJA 1OM1A 4KKGA 4O0SA 4X3FA 5EI2A 2R5TA 5CYIA 3LHJA 2V5QA 5CF8A 5DN3A 2CN5A 5IQFA 1OMWA 4NJ3A 4KAOA 2HELA 4LGDA 1XKKA 3NUUA 1S9JA 3PUPA 4L45A 4YLKA 2ZJWA 3BYOA 2BDWA 5DG5A 1QPEA 3EQGA 4M69A 5F4NA 3UMXA 4EC9A 3PZHA 4I0RA 4L42A 4B4LA 5CF4A 2J5EA 4ASZA 4BCMA 4O38A 3NPCA 3I0OA 3R8UA 3U6IA 4BTFA 5IUIA 3NIZA 3RWQA 3W2QA 4L67A 1P2AA 1U5QA 5TF9A 4H3QA 5IU2A 2HIWA 4OTQA 3FMNA 4C02A 4UN0C 4GMYA 3C1XA 4U80A 3P79A 1JSUA 5FEQA 4KIQA 4L8MA 3TZ8A 3WARA 2VWUA 3E62A 5C01A 4Q5HA 4YO4A 3WZDA 4QYGA 2UZTA 4RZWA 5AUVA 3FMEA 5DMZA 5J9YA 1FVRA 4DCAA 2J0KA 2YZAA 3IDPA 4R8QA 5E8YA 4BDEA 2A4LA 3F66A 5IF1A 3QHRA 3UYSA 3HMNA 3FQSA 5A46A 4W8DA 2E9VA 4IWOA 2ZMCA 5E92A 2VGPA 2ZV7A 3HVCA 2W99B 3FI8A 3HP2A 4A9SA 2PMLX 3MFTA 3AD5A 4E4NA 2IZRA 4XV9A 2YM8A 4GK3A 4HCVA 4YC8A 3VNTA 4ACGA 3DZQA 4C62A 2X2MA 5A6NA 4JI9A 2F9GA 4O7RA 5IISA 4BDKA 4FKOA 2C6TA 4GCJA 3QALE 5T6KA 3AT3A 4CYIA 2ZOQA 5EI6A 3NUXA 4N4SA 3B8RA 4ZJVA 4QQCA 5LMBA 3Q3BA 2HXQA 5ICPA 1BLXA 3COIA 3PY3A 2XJ0A 1PXJA 4W4VA 1Z57A 4FTQA 2R3JA 5HO7A 2IJMA 1G5SA 3ZONA 2UV2A 4AT4A 2YLFA 1OL1A 2W96B 5HIEA 1MQBA 3O17A 1NA7A 4EOKA 2QG5A 1X8BA 5DR2A 5HI2A 3OWKA 4TYGA 5AUZA 2VTIA 3OUNB 3ZC5A 4RPVA 4ZMFA 4G5PA 2BILB 4C38A 1OVEA 4GL9A 4ZY6A 4MYGA 3HAMA 5LOHA 3C13A 5AJQA 2QKWB 4FZFB 3WF8A 5CSXA 4DINA 4U5JA 4EH3A 4EQCA 3V5WA 4PUZA 2HXLA 3UIXA 2OICA 4W9WA 2EWAA 2BVAA 3CPBA 4PL5A 2P55A 3WOWA 3TUCA 3KVWA 4RX8A 2ITQA 3FYKX 5K0KA 3D5VA 4AA4A 3DK6A 4AT5A 4FV4A 4EORA 3OT3A 4G2FA 4KRDA 3GB2A 5GHVA 1NVRA 2XH5A 3HEGA 5T3QA 2CPKE 3TJDA 3UGCA 1S9IA 2PYWA 4JNWA 3FBVA 3SAYA 5EK7A 1OKVA 3PYYA 3H4JA 3Q4UA 3REPA 2CKQA 2W1IA 2GSFA 3ZUUA 4JBPA 4YBKA 4DG0E 3V51A 3AT2A 3T8OA 3UIUA 4HJOA 4LYNA 2H96A 3E8EA 4F9YA 1W84A 4YLJA 3CBLA 3A61A 2WEVA 1ZWSA 3VC4A 2R7BA 5JEBA 2CNVA 2RIOA 4IZYA 2VNWA 5IUHA 5JZNA 3RPRA 4FBXA 1DI9A 4J8NA 2C5OA 3BU6A 3THBA 4XOZA 5BVWA 3TL8A 2UVYA 4FKUA 4AZTA 4C4EA 1A06A 3RHXA 3L8PA 2J5FA 4CG9A 1M7NA 4AGCA 5HESA 1UV5A 5AP3A 2WTJA 4V01A 5FBOA 2UW3A 3ORNA 1J91A 4NKSA 4NW6A 1IR3A 4DLJA 4CQGA 3DCVA 2WQBA 1JNKA 3RM6A 1TQPA 3VRYA 5E8WA 3RMFA 5GIPE 3BX5A 2FSMX 2QOOA 1FQ1B 2R2PA 3CD3A 3FZOA 4JIKA 4U97A 5G1XA 4LOQA 1HCLA 4P5ZA 4IAAA 5KO1A 4R7BA 5BVOA 5I0BA 3KN5A 5E8SA 3UO4A 5AV4A 2YCSA 4EZ5A 3DAEA 5M57A 4O86A 4R1VA 1PMNA 2V7AA 4RX9A 4PL3A 3DB6A 1R1WA 4ZTMA 2PY3A 5TKDA 4F6UA 5BVDA 3HMOA 4B6LA 4NTSA 3LFAA 4USDA 4BDIA 4EKLA 5KBRA 5C4LA 3LJ1A 3CSVA 2CGWA 4IH8A 2VU3A 4IVAA 3ZH8A 4M67A 2X39A 3VBWA 1PY5A 2EXEA 2XNNA 4O21A 4HGSA 5CVFA 5DT4A 4C3RA 3VUIA 4CTBA 5H3QA 4MQ2A 3GOKA 4Z9LA 2QR7A 4O0YA 5FG8A 4O82A 5HIBA 2O5KA 3TTIA 4NH1A 4EHVA 3A7HA 3N51A 5LMKC 3DAKA 4RMZA 5IQDA 4E5WA 1PHKA 4F1TA 4QMLA 4YJTA 5JRQA 1HCKA 2O8YA 2HW7A 3H0ZA 3K54A 3Q9XA 1DM2A 4DLIA 3OHTA 4RQVA 4YTHA 4YJOA 1PMEA 4DTAA 3RCJA 2OF2A 3BHTA 5DLSA 4DTBA 2QI8A 3FQEA 3UP2A 3DBCA 3QAME 5L6OA 4B99A 3UO5A 1PW2A 1QPJA 3KC3A 4WRSA 2XJ1A 3RALA 2ONLA 2YHVA 4X7QA 5HKMA 3EFKA 1UU9A 3QTUA 2YN8A 4ACHA 3CGOA 3R2BA 4CZYB 3LLAA 4HZRA 5IPJA 3KEXA 4U8ZA 2BIKB 2DWBA 2DUVA 2UZNA 3BQCA 3L9PA 4FTTA 4KWPA 3BEGA 4LV5A 4FR4A 4U43A 4CFVA 4LUDA 4EOPA 2GTNA 5AR7A 5FRIA 2R4BA 4EZ7A 5CAQA 5HLWA 5HG8A 1ZARA 4YZCA 3NCGA 2WMWA 3GOPA 3TZ9A 4QMQA 2FSTX 5JSMA 3IOPA 3CE3A 4XV3A 1GNGA 4EBVA 4J52A 2UZEA 3HECA 3SD0A 4FIHA 1K3AA 4R78A 3HP5A 3Q60A 1CKIA 4KRCA 3QRKA 2XK9A 4B9DA 1XJDA 1E9HA 4D4RA 4I92A 4K8AA 4O7NA 5CF5A 4L6QA 4QPAA 4JX3A 2FVDA 1OGUA 3R7UA 5DNRA 4Q9ZA 2VTHA 4U81A 4FNWA 3SW7A 3HKOA 4GYIA 3OMVA 4QTDA 3LE6A 4QYYA 3RKBA 1K2PA 1P14A 4AN9A 3RAKA 2PVYA 5CSPA 2XKFA 1XH9A 4EOMA 4L00A 5LQFA 1FOTA 3TXOA 4LQMA 3EYGA 3G0EA 2YDJA 3DQXA 1WFCA 4DEGA 1OIQA 2XEYA 3IONA 3L9NA 5FP5A 2B52A 5AM7A 4H39A 5EYKA 5EQPA 1APME 4QPMA 4XBUA 4PY1A 2LAVA 2QOIA 1JPAA 2IVUA 2XK7A 2YM6A 3TZ7A 5IQIA 2E9PA 4BGHA 3VW8A 3HV7A 3ZTXA 5I9WA 3KULB 3NNVA 1SZMA 5GZ9A 5IA1A 2Y9QA 3H9OA 3FC1X 2C3KA 3IGGA 3IW4A 3MVJA 4L7FA 5BVKA 2IZTA 1TQIA 4ORKA 3AC5A 4FEWA 3G5DA 4AQCA 2ZV9A 2XK6A 1Y6AA 3NYNA 5ANOA 4N0SA 3ID6C 1YW2A 3F3UA 3DBQA 4JG8A 3P86A 5HHWA 1OBDA 3FKOA 4ANNA 4IIRA 4Q5EA 2JKQA 4NEUA 2W9FB 1YI4A 4TYHA 5C4KA 2UZUE 2WMTA 1U5RA 1YXSA 2PHKA 3BE2A 2GS7A 5EYDA 1OPJA 3G2FA 4ZSEA 4FG9A 2IW8A 5KKRC 5HLNA 2XP2A 4DFUA 3PP1A 4I24A 4MD8E 2B0QA 4F7LA 2PVFA 4NCTC 4RIWA 4PNKA 3R71A 5B7VA 4IDVA 3VF8A 5HE1A 3GFWA 4JDHA 1V1KA 1J1CA 3ZXZA 3QZGA 4D5KA 4WT6A 4IBMA 4XCUA 4E6DA 5EKNA 3HMMA 4BDHA 5C8NA 3BYVA 4DH1A 4M13A 2PVJA 3VBTA 3BE9A 3QCQA 5IDPA 3P4KA 3RZFA 2FYSA 4ZK5A 3VUMA 5I9XA 1NW1A 1FINA 4YJUA 4AW1A 3DDQA 2QHMA 4I5PA 3DB8A 2IN6A 2YFXA 4IQ6A 4FL2A 1OPKA 4UB7A 1KOBA 4XG9A 1NVSA 4W9XA 2VRXA 3W1FA 3O23A 4IHPA 4TYEA 5DFPA 2VGOA 2RG5A 5FXQA 3TKIA 2E9UA 5EI8A 2NRYA 2VZ6A 2BTRA 1YWVA 2R64A 4CV9A 2C6EA 2VWWA 4IB0A 3KMMA 1JAMA 2ITPA 3OG7A 5CEKA 4RC4A 2PSQA 2GNJA 2JGZA 3DBFA 2I40A 3GBZA 2YM7A 4NYEA 4EQMA 4TL0A 3BU3A 1OL5A 4A9UA 1K9AA 1GZOA 4I94A 5FLFA 4BCKA 5GJGA 3RM7A 2QOCA 4FKRA 4TZRA 5HZNA 4DTKA 3GENA 5AUWA 2BZJA 3BIZA 3RZBA 4R5YA 3TNPC 2C30A 4ZEGA 5IEXA 5M44A 2GNLA 1JWHA 3WIGA 2VTQA 4O1OA 3W2RA 3FLYA 3G90X 4XLVA 3TDVA 4OTRA 4FV7A 2GQSA 3DTWA 4BHZA 5HCZA 4MX9A 3F2NA 2GNFA 2I0HA 3L8SA 4D2SA 4IC8A 5IEVA 5DI1A 4F4PA 3EN6A 4GG5A 4GU6A 3ZRMA 5CEPA 2CKOA 4RIOA 3Q4ZA 1UU3A 1IRKA 2GNGA 4FIJA 3ZO2A 3ZO3A 5M07A 1V0PA 2J6MA 2O2UA 4DEIA 5IQAA 4M7IA 5CQUA 5M08A 4BCNA 2W0JA 3WBLA 4R77A 4A9RA 4TXCA 4FKGA 4F65A 3QQHA 4FSTA 1UNGA 3GCUA 5AR5A 2AC3A 1SMHA 3PIYA 4CLJA 3OEZA 5JKGA 5IQBA 3FQHA 3KKVA 3H0YA 3G6GA 3R7EA 5HBJA 4KS8A 4C7TA 2X7FA 2E9OA 1P4OA 2J0LA 4IX4A 4IM0A 4O0UA 4BC6A 5GINE 3W2PA 3ET7A 2PVMA 3EJ1A 3UQGA 4YU2A 4QYEA 5CEQA 4OW8A 4FT0A 5B2MA 4G3EA 4R3RA 4EKKA 2H34A 1KE7A 5BNJA 2I0YA 4BY9E 5KE0A 3R73A 4AFJA 4JG6A 3UOHA 4IDTA 4Z7GA 5D7VA 5DWRA 4ANBA 2WHBA 1J7LA 3TNQB 4LMNA 4RFMA 5DR9A 3DZOA 3UOJA 4V0GA 3PLAE 5CNOA 4XX9A 4CLIA 3MH0A 5D10A 2C69A 5EG3A 4BIDA 2YISA 4U44A 3F7ZA 4NM0A 3FL5A 1SM2A 4I93A 5JGDA 3AC1A 4BCQA 2VTSA 4U45A 3ZLYA 4CT2A 3FLNC 3U4UA 4DEDA 4F99A 3R0TA 4LFIA 3UQFA 3Q9YA 4BCJA 4RIYA 1JSTA 3OVVA 1LEWA 2A27A 4IB1A 2X81A 2X8EA 1XO2B 2A1AB 3TV6A 2Y6OA 4D4SA 2Z8CA 3OY1A 1KE5A 1M52A 2YM4A 2OIQA 3COKA 4DG3E 5LMKA 1UNHA 2X8IA 5AP0A 4FK6A 2O3PA 3LLTA 3OTVA 3BYMA 2XNBA 2GHLA 3WF5A 3ORLA 1EH4A 4F9WA 2R3QA 4EH8A 3DKCA 2CNQA 5BX0A 4E6AA 1G3NA 5M56A 3ETAA 1H0VA 2ZV2A 5ACBC 3V5JA 2BUJA 4GIHA 4MKCA 3PXKA 1U4DA 2WNTA 2GDOA 4F9BA 5EM8A 3EKKA 3CIKA 3RNYA 3PSCA 5EHYA 3UIBA 3KF4A 4BRXA 3R7VA 4C35A 4E5AX 4UXLA 2G9XA 3ZEPA 3ORPA 4UXQA 3V5LA 1FVVA 5FWKK 1IA8A 1KE6A 4FSYA 4I1ZA 5HICA 5IA5A 3C4ZA 3VJOA 1LUFA 2PPQA 3PVBA 4YJSA 5AIRA 4CFWA 4CMUA 5FP6A 4FICA 2V55A 2ITOA 5ANGA 4D1SA 3TNHA 5AA8A 5JT2A 2BDFA 3GCPA 3LCDA 2UUEA 2XCKA 3ORXA 3WZUA 3KXXA 2CGUA 1BMKA 2GFCA 4ANLA 4NW5A 3PY0A 3RBWA 3G6HA 1NT2A 3U54A 4PTEA 4A06A 3PJCA 4L68A 5AP5A 4GT3A 2I0EA 1ATPE 2PMNX 3HA8A 3ORMA 3I5ZA 5CAPA 1PJKA 3AC4A 4LM5A 3O71A 2H6DA 1YI6A 3JY9A 4HYUA 2IZUA 4CCBA 5KKRB 4DF3A 4HOKA 5IKWA 3TCPA 4BWPA 4GJ3A 2QO9A 3V01A 3C4EA 2C68A 2OZAA 3EH9A 3LQ5A 4FMQA 4K6ZA 4NZWB 3V3VA 4NSTA 3ANQA 1O9UA 3R8MA 4KS7A 4WKQA 2BAKA 2DQ7X 2ETRA 4KNBA 2WZJA 4YZBA 3RK7A 3UP7A 4D2TA 3BPRA 4Y95A 5AP7A 2QQ7A 4C4JA 5FXSA 4R5SA 3NUAA 4OUCA 3IK3A 4ZTSA 4L52A 3EZRA 4G17A 4G31A 1B39A 2ZMDA 5CVHA 3Q96A 3PIZA 3N4UA 2WU6A 5C26A 3FJQE 4I4FA 4BCGA 4NIFB 3JR1A 1U54B 5L6WL 5JK3A 4PDOA 3QQKA 1R39A 4NJDA 5DPVA 2OFVA 4RFYA 5KMOA 4J95A 3PXYA 2JAVA 2W4JA 2ITTA 4I5HA 3UG2A 5KMIA 3V5PA 5E8VA 2R9SA 4N57A 2J7TA 3NVKI 2X9EA 1KE9A 3E64A 3LKMA 3T3UA 4CD0A 3EYHA 4BDFA 3NW5A 4J96A 4BZOA 4HYIA 3KB7A 2C5YA 3QGYA 5CI6A 5CU4A 4HCUA 2X0GA 2FUMA 2X7OA 3FC2A 4KIOA 2HZ4A 4W8EA 5HVJA 3WF9A 4PDYA 4L43A 3W2CA 1YWRA 2CJMA 3U6HA 2ESMA 2X2LA 4NWMA 2RFNA 2W1CA 4FL3A 4NCTA 3TIYA 4BWXA 3KMWA 2YIYA 4EK5A 5CAOA 5AEPA 4GT5A 5KZIA 1RJBA 2C1AA 1TVOA 3D5UA 5HNIX 3ZBFA 2OSCA 4CFUA 2BKKA 3MESA 4C8BA 5EM6A 4P2KA 4JAJA 4OTFA 4R3CA 4KBAA 4XMOA 2NRUA 3H9FA 5J95A 2IW6A 4A7CA 4EH4A 4IANA 1KV1A 2BZHB 2C5VA 4L46A 3GU8A 1UU8A 4FEVA 4ASDA 3NYXA 4NIFA 3MPTA 5D9HA 2J50A 4JVGA 4KIKA 2Z7LA 5AV1A 3CQEA 4IADA 4QP3A 4C3PA 4AZWA 4CSVA 3PFQA 1IEPA 1A48A 3GFEA 4AP7A 5F95A 2GS2A 3OF0A 4H3PA 3DJ6A 4O7VA 5FTGA 1CMKE 4A4XA 2P3GX 2UW0A 5HU9A 3GEQA 2WAJA 4RZVA 4RSSA 3TUDA 5HBEA 5KX8A 2G2HA 5FUTA 1BI7A 4H3BA 5EDPA 3SGCA 4X0MA 1H0WA 4RG0A 2QOQA 4M69B 4G3DA 3SDJA 5CS6A 4FKIA 4U40A 3DFAA 4L3LA 4QP7A 3KXMA 4OT5A 3TEIA 4BDAA 4K33A 3ENHA 3U55A 2Z2WA 5BYZA 4ALWA 2IWIA 4I21A 3I4BA 4PMTA 4ZSAA 2X8DA 4BTMA 3FLZA 1H08A 2VX3A 4BDCA 2BIYA 4DBNA 4EZ3A 4TYIA 3R6XA 5HE2A 1GIJA 4HNFA 2LGCA 3QRTA 4BBFA 4IXPA 3QC9A 4FNXA 4BFMA 4IVDA 4DA5A 4HPUE 4Y85A 2VWVA 1H8FA 3E63A 3ZOSA 5JQ5A 2OXYA 3IG7A 4R7IA 1GZ8A 3AC2A 2WTKC 3TM0A 4Y5QA 1YXVA 5AX9A 5HD7A 4U3ZA 4V05A 4WO5A 2JD5A 4OBPA 3PRIA 4IZ7A 4QOXA 4UWBA 3AT4A 5A4LA 3BYSA 1YHSA 2UW4A 5DBXA 4DH8A 5IA0A 5E1EA 4WOVA 4DITA 4YPDA 4C4GA 4PV0A 1AD5A 3WYYA 5HLPA 3QYZA 2B4SB 1Q24A 1Q8ZA 3QX4A 1JKSA 2WTDA 4EEVA 5IMXA 3R7IA 3BELA 4D1ZA 3R2YA 5TR6A 5CEMA 2IVTA 3BGQA 1YDSE 2YWVA 4GUEA 3FXXA 2ZDUA 4X2JA 4ZTHA 4EH2A 1FPUA 4Z16A 5JRSA 2HYYA 2OKRA 4L01A 4MXOA 5DIAA 3TI1A 5LCJA 4FZ7A 5E9EA 3IDBA 4PDSA 3QXPA 4O91A 4S30A 3PP0A 3PA4A 3ERKA 3R1SA 4FNYA 3PPZA 5AM6A 5M4IA 2XJ2A 5M06A 4EHZA 2F2UA 2JDVA 3AD4A 3KF7A 3R01A 5G6VA 1PXNA 3AD6A 4GFMA 3IOKA 4EH6A 3C4XA 3ZEWA 2J0MB 5LWNA 2P0CA 2YCFA 4CMTA 3LPBA 5CF6A 4KIPA 1B6CB 1ERKA 1B38A 1VYZA 3RVGA 5BYLA 3NYVA 3QRJA 1T46A 3ZLWA 3FSFA 4UX9A 3SG8A 4RWIA 3FEGA 2BDJA 3DNEA 4MQ1A 3DLSA 5HNBA 4D5HA 4RC3A 5HVKA 4ACDA 1O6YA 5L4QA 2PMIA 4FTLA 2ACXA 3GP0A 5K5XA 3ZDUA 1SNXA 5DA3A 4NM5A 3VF9A 4EI4A 1OZ1A 4FX3A 2AYPA 4RJ5A 1W7HA 5FEEA 4TKSA 3WZEA 5KNJA 5B0XA 2H8HA 1DS5A 1YDTE 2G1TA 2WIPA 4QP8A 1PKGA 1SVGA 4IJ9A 4WNMA 4HGTA 3VBQA 3W18A 3LQ8A 3CQUA 1WBSA 1UWHA 4FUXA 3LJ2A 4IM2A 2YAKA 1XBBA 2JAMA 3OXIA 4FT9A 5J1WA 4XV1A 5J9ZA 2W9ZB 3M11A 3UNKA 2XBJA 3IKAA 4B8LA 3PG3A 5CU6A 1JBPE 4FSWA 2F2CB 3QTIA 4CRSA 3PRFA 4V04A 5A54A 4HPTE 5HNGA 3BCEA 3FMJA 4M15A 4A9TA 1Y6BA 3O2MA 4NFNA 4J98A 2QC6A 4BI0A 3W8LA 2P33A 3QL8A 3MSSA 4QMXA 2BAJA 3R02A 2EB3A 3DQWA 3E7OA 2WPAA 3POZA 3KA0A 4IX3A 3TNIA 2OJJA 3OWPA 4IB5A 4E4MA 2BTSA 2UW9A 3C4FA 3QWKA 4J71A 1OUYA 3P9JA 4FEQA 1KWPA 4O0XA 3IW8A 4XP0A 4CFMA 4QMTA 5A4CA 1PRYA 3OOMA 4LRJA 4FKPA 2IZSA 4E26A 4FG8A 4FTRA 3M2WA 4DCEA 3I7CA 3C7QA 3W10A 1NXKA 4A4LA 3K5VA 3VS0A 4C4HA 2I6LA 3D7ZA 4GIIA 5JMSA 2OGVA 5HD4A 5FD2A 1M7QA 2J4ZA 2VWZA 2VTMA 3C0GA 5EFQA 3VRZA 3AOXA 3DV3A 3GC0A 2PUUA 4W4WA 4D9UA 1TQMA 4O7TA 2JBOA 1PXKA 5HG5A 4ANMA 4FTKA 4HZSA 4O7WA 5HE0A 2PVRA 3ZLXA 4ZTRA 4AE6A 4S32A 3FPQA 4AN3A 5IG1A 3SV0A 1BUHA 3HRFA 4BYJA 5E1SA 3V8SA 2ITZA 5CSVA 4YR8A 1GZKA 2XKEA 4FGRA 4JQEA 3V6RA 3GGFA 3NGAA 4UMPA 4FTUA 4YHJA 4ZOGA 4FKWA 3QUEA 4EWQA 3NUNA 3EQBA 4JDIA 4K77A 3CTHA 5JFXA 3UG1A 4CKIA 3IS5A 4AX8A 1IA9A 4XUFA 3HRCA 4MNFA 4OTHA 2XM9A 4QP2A 4MWIA 1ZYJA 3MB7A 4LOPA 3EN7A 4QP6A 4GS6A 5DH3A 3VQHA 1RQQA 2R3FA 3E5AA 3ORKA 4RJ6A 3OBGA 2DS1A 3LCTA 4CRLA 2WMQA 3E8DA 5CASA 3SXRA 4U6RA 2HK5A 3ZFXA 2YIQA 3A4PA 4FKJA 4WSQA 3FV8A 3NAXA 3R30A 3VS7A 2PE2A 5K9IA 3S2PA 1FBNA 4L7SA 5J1VA 3RHKA 2GHGA 3BYUA 4YZDA 1ZY4A 4I6HA 4BI1A 5HCYA 2JIVA 5JFWA 4FODA 2C0TA 4BZNA 3NCZA 5HQ0A 2YZLA 4DT8A 5FXRA 1ZOGA 4BIBA 5ETFA 4CXAA 3AMAA 3Q5IA 3VN9A 2Z7SA 4AZVA 4YP8A 5K0XA 3VBYA 5KMJA 3F88A 3DDPA 4IVCA 3OCBA 2VO0A 4S34A 3RCDA 2YEXA 1CKJA 2R3IA 3G15A 3TZMA 4QMOA 4X2NA 3LW0A 2JLDA 3NNUA 3HRBA 4UZHA 5LMAA 3RAWA 4ZZMA 3JYAA 3QBNA 5K3YA 1AGWA 5H8BA 4EOSA 1WZYA 4FV9A 5KMNA 2C1BA 3DNDA 4MXCA 3UNZA 4RRVA 2YITA 4MXAA 3O96A 2BZKB 4PQNA 5E8UA 4LV8A 1WVXA 2WTCA 4ZY4A 4KUJA 2Y8OA 4BDJA 3KCKA 2B55A 4KKEA 3OWJA 1J1BA 4NKAA 1MQ4A 4ACMA 3R1YA 4JLCA 5DT3A 2EU9A 1H25A 5EM7A 4EK6A 3SG9A 2V0DA 1YOMA 1OKZA 3EQHA 2PL0A 3O8TA 3DA6A 2XYUA 2FO0A 4XEYA 3Q9WA 3E87A 2Q0BA 5HEZA 4AAAA 3JUHA 2O65A 4QMZA 2XA4A 3RPYA 1R0PA 3RP9A 3QQLA 1T45A 3B2WA 3MBLA 3QC4A 4GG7A 4X2GA 2C3JA 3ZU7A 1TKIA 2Z7RA 4XG4A 5I3RA 2B1PA 3EFLA 4GYGA 1F0QA 2ZAZA 4OTGA 4MH7A 2EXCX 4MF0A 4TRLA 5IH4A 4LI5A 4PF4A 4GH2A 5CWZA 3BWJA 4DEAA 4TTHB 4NUSA 2WKMA 5C9CA 3FI4A 3A7GA 5DEYA 5BPYA 3A60A 4HYSA 1M14A 3MA3A 5AA9A 3EL7A 3KQ7A 4ZLZA 2CLQA 1BKXA 5GZ8A 3EKNA 1W83A 2PE1A 4AW5A 2VAGA 3P23A 4O7ZA 3F61A 3ZSIA 2V62A 3MFUA 3ZUVA 3QKLA 4MEDA 3I6WA 4FV6A 3R8ZA 3FPMA 3NYOA 3CTJA 2HOGA 3FI2A 4FTCA 2IW9A 2HZIA 4AGDA 4TYHB 4MHAA 4HGLA 4Q9SA 3UJGA 4QYFA 3DY7A 5HE3A 1G8SA 3QD3A 2HWOA 2G2FA 4EH5A 2IVVA 3NS9A 2C5XA 4AWIA 2BHHA 2OIDA 3NUYA 4RVTA 4OLIA 2OK1A 4FYOA 5FDXA 3PXFA 3ZSHA 2R3RA 1R78A 4RIWB 5J7BA 5J8IA 5E90A 2ITYA 3ZFMA 1E1XA 1IG1A 3FMMA 2KULA 1Q97A 3W2OA 3HAVA 3F2RA 2Z60A 5AX3A 3LMIA 4IX6A 3WIKA 5B2LA 3RAHA 3FDNA 3ZS5A 3QQFA 4DFBA 3K5UA 4QNYA 3IW6A 4FEUA 4GT4A 4AZEA 3OY3A 3BI6A 1YQJA 2XK4A 1YVJA 3BKBA 4FK3A 4NM7A 5JH6A 3C0IA 3DXPA 4F7SA 1HOWA 3FY2A 3TG1A 5AV3A 3GCVA 1ZAOA 3VBXA 3KRJA 4O84A 4I23A 4YBJA 4JT3A 1CDKA 3C9WA 5M51A 5C1QB 4Z7HA 1GY3A 5C03A 1OPLA 3PY1A 2FB8A 2UZDA 5ANKA 1NVQA 4BBMA 4BL1A 2QOLA 4WNKA 4YZMA 3C0HA 3FZSA 4FIGA 2W1EA 1GIIA 2CLXA 1ZOHA 4X6QC 2QONA 3CTQA 4F0IA 3FLSA 3HZTA 4Y5HA 3UIMA 3ZUTA 4QTCA 3KXZA 1OIUA 2UZWE 3F3ZA 5EH0A 3GNIB 1ND4A 2C0IA 5H2UA 4YLLA 2HW6A 3HDNA 4L3PA 3ELJA 3ULZA 4XYFA 5AP2A 4E8AA 4X2FA 3OWLA 1Y8YA 2R3MA 4KSQA 4JQ7A 4R3PA 5DRDA 5EW3A 4M66A 4QMMA 3R7OA 3DBDA 3EN9A 3PXQA 2W1GA 3DTCA 2VTPA 4AU8A 3TV4A 3Q52A 2GQRA 3CKWA 2JC6A 1FMOE 3PVGA 4XBRA 3CLYA 1XH5A 3KRWA 4EYMA 3R1QA 1MP8A 1UWJA 1W82A 4FG7A 4FNZA 4ZTQA 4A4OA 5HO8A 3UOLA 3WE8A 4RJ8A 3DT1A 5CSWA 5F20A 4C0TA 4IM3A 3KRRA 2J2IB 5DRBA 1YXXA 3DU8A 2Y7JA 3SRVA 1NY3A 1ZMVA
chains in the Genus database with same CATH superfamily
2W5BA 2XCHA 1PYXA 3FZ1A 3PXRA 2GNIA 3L8VA 4EWHA 4EOJA 4W4YA 4DFZE 1OL7A 3PWDA 4RWJA 3RK5A 1QPCA 5I9UA 2W1DA 1XH6A 3GVUA 3P08A 4FYNA 4JBVA 3W0PA 4ZSJA 4ACCA 4WBOA 5CAVA 3A7JA 3GT8A 3QXOA 4FOCA 4GK4A 2W05A 5AUXA 5IEYA 2BRHA 1H00A 3BHUA 4FKTA 4C58A 4FI1A 4ZZNA 4GW8A 5CALA 4FE2A 4I6QA 3UC4A 5FM3A 3ZSGA 4BN1A 4B0GA 5CU0A 2VTRA 4PMSA 4XJ0A 3MB6A 3RAIA 3DOGA 5IQEA 4MTAA 4CTCA 4YC3A 2WEIA 3I1AA 5HBHA 4O4CA 2SRCA 4KSPA 5JGAA 4BICA 2VNYA 4U9AA 4TN6A 2PMOX 4QP1A 4DEBA 2VWXA 4QP4A 4V0GB 4PMPA 4IWQA 2HY81 5AUTA 2EB2A 4ZP5A 3ZC6A 4ZS4A 3U9CA 1R0EA 4IMYA 1FGKA 2QOBA 4LMUA 4F6WA 3BEAA 3QCSA 2PZPA 3DJ5A 3QLFA 3TT0A 4EYJA 3JVSA 1WBWA 4BTKA 4FSQA 3W32A 1XBCA 1CKPA 3HUCA 3M42A 4CYJA 2E9NA 3LFFA 2GTMA 2OJIA 4II5A 3F6XA 1I44A 3FMKA 3ANRA 2UVXA 5KCVA 3DGKA 4RIYB 3FWQA 1YWNA 3PJ3A 5CQWA 5ETCA 4U79A 5LVLA 4EONA 2NNWB 1OKYA 2F49A 1ZY5A 3M1SA 5EW8A 3HV4A 4BKYA 4CFFA 2WQNA 4O4FA 4RJ4A 5AUYA 4KINA 4NU1A 2WMBA 4QQ5A 2WMAA 3MPAA 1J7UA 3GC9A 4KBCA 5JQ8A 4E1ZA 4RVLA 3UO6A 4L3JA 3EQRA 4DGLC 4ENXA 2WQEA 3VUDA 2F7XE 4NT4A 5CEOA 2OXXA 4FV1A 4WUNA 3S0OA 4DT9A 4E5BA 1VZOA 2W1FA 2YA9A 5KHWA 4FV0A 5ANDA 3HL7A 4AGWA 1Y57A 3LM5A 3PTGA 5BUEA 3PE2A 5CT7A 4FEXA 3VS4A 2YDKA 3QUPA 4IB3A 3JXWA 3U51A 4E93A 4O7SA 2WMXA 5GNKA 3G51A 4PP7A 4ZZOA 4JR3A 5BQ0A 2QD9A 3R9HA 2WQOA 4FV3A 2ITWA 4G3FA 5EHLA 4BCOA 5IA3A 2Z02A 1YOJA 2OH4A 4GVAA 4RT7A 4A9YA 5L2SA 3MS9A 2J0JA 3SKCA 3VW6A 4D0WA 3BHHA 3RTPA 4FKQA 3S95A 3OW3A 4YNOA 3UZPA 4BCPA 5A4QA 2J0IA 4MXXA 4ZS0A 4FSZA 3OS3A 4ENYA 5AP4A 3A7IA 3H3CA 2GS6A 3NW7A 4D4YA 2BPMA 3CJFA 3W55A 2R3NA 4DGNA 2C4GA 4M0YA 3BU5A 1GAGA 4IW0A 1OBGA 2YM3A 4XRJA 3U8WA 4ZIMA 2J51A 2JITA 3V6SA 4TWOA 4H36A 4GV1A 4UZDA 3QA0A 4RJ3A 3VVHA 4E7WA 4YTIA 4YSMA 2UZOA 1V0BA 3HYHA 2OZAB 2GHMA 1P5EA 4C3FA 3A4OX 4B7TA 1WBVA 5IH6A 4QMNA 1KUTA 2ERZE 3ZRLA 5CVGA 5C8MA 3ZLSA 3II5A 5FM2A 2XALA 4ZMEA 4C2VA 3O0GA 4XG8A 2E2BA 4YUQA 4M97A 2IG7A 3ZYAA 1OUKA 1URCA 4X6RA 2B7AA 4Q2AA 5EHOA 5L3AA 5HCXA 4JX7A 4D55A 4LUEA 4O7LA 3FI3A 4AZSA 2JDTA 1BL7A 4IWDA 2HWPA 4FTMA 3FMLA 3HMPA 2HZ0A 4TNDA 3FKLA 5L8KA 3MVLA 4QT1A 2R3OA 2Y0AA 4DYMA 2OJ9A 4YZNA 3KN6A 3QQGA 4J97A 2OJFE 2XK3A 4DBXA 1FMKA 4OTIA 2ITXA 4OTPA 5M09A 2QU5A 4WNOA 2CGVA 2W4OA 3GCSA 5L8JA 2JFLA 3P78A 3MVMA 2Y6MA 4O22A 2ZYBA 4XG3A 3QFVA 3LFBA 5F94A 4L53A 1MRYA 4FTAA 4QMVA 3ZBXA 4FTNA 3NNXA 4G6OA 4JL9A 1WBNA 3BRBA 3EQFA 3SXSA 2W17A 4UV0A 4CFNA 4EC8A 1W0XC 3ZO4A 4K2RA 3PA5A 2ZV8A 4FKSA 3LCOA 3RGFA 2VX0A 2C0OA 5IUGA 2OLCA 1M2RA 3LVPA 2O0UA 5FBNC 3LFEA 4MWHA 3AMBA 4R6VA 4AW0A 3AXWA 1H1QA 2EXMA 4DGMA 4CT1A 4CKRA 4JRNA 3VWAA 2BZIB 1OIYA 3KRXA 5A6OA 4JOAA 4MXYA 2XIXA 4JRVA 5I5ZA 5E7RA 2QR8A 4D0XA 2WOUA 4D2VA 1GIHA 3RJCA 3W8QA 1SVHA 2A2AA 5I9YA 3ZCLA 5JN2A 2GNHA 2YCRA 1YI3A 3ZM4A 2PUIA 2ZDTA 2G2IA 2PUPA 4KIKB 1H24A 3Q2MA 4F09A 3ACKA 3QKKA 4F1MA 4ERWA 3HA6A 5F1ZA 5TT7A 3UVPA 4RA4A 3ALOA 2C6DA 3Q5ZA 2QLUA 1Q3WA 5BYYA 1O6LA 2OF4A 1M2PA 4XS2A 5T68A 4CMOA 2RF9A 2XZSA 3LXLA 3Q6WA 4G6NA 4LRKA 5LVMA 1YRPA 3BBTB 3I79A 3F5GA 4QP9A 2Y4IC 2QURA 5F9EA 3R8LA 3WILA 2X9FA 4OAVB 3VHKA 1ZYCA 2UW5A 3EB0A 5AP1A 2WMRA 2W06A 3ZO1A 4Y46A 5CSHA 3OCSA 3UC3A 4CNHA 4PRJA 4ERKA 1XH8A 3NZ0A 2HZNA 1YOLA 2VTNA 1PMVA 4FIEA 2IVSA 2JDRA 4EK4A 1JLUE 5EYCA 3JVRA 3NW6A 4FOBA 5CZHA 3ALNA 2FGIA 4IAZA 4YHFA 1SVEA 1XQZA 1Q8UA 3MYGA 5HTCA 4Y83A 5AV0A 3VBVA 4YNEA 5KMMA 3F3TA 2O63A 3HV6A 4MK0A 2PU8A 3QTSA 2G15A 3B2TA 3LXPA 4HYHA 3OCTA 3LXNA 2C6IA 3CD8A 2WMUA 4FSNA 1UKHA 4TNBA 2JKOA 4TYJA 3LZBA 5D1JA 2ZB0A 5IQHA 4YHTA 2PWLA 3DK7A 2XRUA 2PUNA 1REJA 5HGIA 5HIDA 4EH9A 1QPDA 4YO6A 2KTYA 4AUAA 4DFNA 3LFCA 2BHEA 3D9VA 1ZYSA 2WOTA 4ID7A 4IVBA 3VUKA 4NFMA 4BI2A 2CNUA 1U59A 2CSNA 3TN8A 5EYMA 4UALA 2YM5A 1ZZ2A 4M68A 3ZFYA 3ODZX 4APCA 2W5HA 3MTFA 3UNJA 5J7HA 3RPSA 2P2IA 3LCSA 4WIHA 1DAYA 2VV9A 1U46A 3NUPA 3FMHA 5DR6A 4YSJA 2IPXA 3RPOA 3UOKA 4FL1A 4BDGA 4D4VA 3OP5A 4PPAA 3FSKA 4N6YA 5E8TA 1KOAA 3HMIA 1WAKA 3NNWA 2B54A 5AADA 3AGMA 2YIWA 3FZTA 3MFSA 3OT8A 4GEOA 3R21A 4QQJA 1BL6A 1J3HA 1OITA 4JBOA 3VS2A 3V8WA 1IAJA 2XIRA 4PTCA 3EFJA 3QTWA 1RDQE 4FIIA 5KMLA 2ZM1A 3W0NA 4FKVA 3AC3A 3I6UA 2QHNA 2WU7A 4F7JA 4WG4A 2WMVA 3RNIA 2XNOA 4BCIA 3D14A 2B53A 3COHA 3BLQA 3O8PA 4OBQA 5HOAA 5AUUA 3AMYA 3K3IA 2YACA 3PJ8A 5ANIA 4PTGA 1SNUA 4BKJA 4AG8A 2XM8A 5AV2A 5AWMA 2WMSA 4D2WA 3GU6A 2C6MA 3ITZA 2XUUA 5AAFA 4RWLA 4FV5A 2Z7QA 3O7LD 4IACA 3JS2A 5M55A 3AC8A 2OBJA 4U0IA 5I9ZA 4QMYA 3NMUF 4FT7A 3BV3A 2XNPA 3NX8A 3OXZA 4F1OA 3QWJA 3CC6A 5DT0A 5K5NA 5L2IA 4YTCA 3ORIA 3VULA 3NR9A 1RE8A 3FZPA 5IA2A 4YJQA 4OAUC 3TWJA 4BGQA 5M53A 3ATSA 3EQPA 2JDSA 4TY1A 3EOCA 1YDRE 5ETAA 5HU3A 5M4FA 1WVWA 4EK8A 5KZ0A 4K18A 1UVRA 1OKWA 3GU5A 3UZRA 3AQVA 3C5IA 2BCJA 3ENMA 3CKXA 4XV2A 3PXZA 4BHNA 2PVKA 4FSRA 5EW9A 4JIAA 3SOCA 3IPHA 2QU6A 4TW9A 4IAYA 3VHEA 3NWWA 2YIRA 2VWIA 2PVNA 2PZIA 4IC7A 4IEBA 5A4EA 5BUIA 3KREA 4AN2A 2ZM4A 3IQ7A 2OW3A 2CN8A 5HTIA 4D58A 3GI3A 3F82A 4B8MA 5LXMA 1JVPP 3NDMA 2HY0A 4I0TA 4R7HA 5GJFA 4C2WA 5AAGA 4EH7A 5DHJA 1QCFA 4AGUA 4YJVA 4K0YA 5CXZA 3BV2A 2GFSA 4CCUA 3G33A 4DDIA 3PLSA 3PPKA 4IAIA 3V8TA 5CT0A 5J9LA 3HV3A 2QODA 5GJDA 2YJSA 4D9TA 2QG7A 5AR8A 4O7YA 2C6OA 5D12A 3QYWA 4H1JA 4EUUA 4N6ZA 3KXHA 4KB8A 3DXQA 2A19B 4DH7A 4R1YA 4H05A 4RX5A 3CPCA 2HAKA 2QVSE 1W2CA 4W4XA 3KK8A 3E8NA 4HVSA 3ZZWA 2XYNA 1YKRA 3MJ1A 5GZAA 3G0FA 5FDPA 5I9VA 3BQRA 2WTWA 5AMNA 5EQEA 5L8LA 3VS6A 4ASEA 4C37A 1LEZA 3OXTA 5I4NA 4RC2A 4UMRA 4D28A 4AA0A 5BVFA 2EVAA 2PK9A 2GU8A 3TKHA 4XLIA 4CV8A 3MA6A 5CF4A 3E93A 3S4QA 4C4IA 4CZUA 3FHIA 3OBJA 5CANA 3QTXA 1KV2A 3FAAA 4FTIA 3R7YA 3S3IA 3NVMB 1OIRA 4U41A 2BMCA 4BWKA 4E6QA 2UW8A 5H8GA 3MV5A 3BZ3A 4YTFA 4FV8A 4YMJA 3QTZA 5IZFA 2C3IB 2PZ5A 2C47A 2JEDA 3QTQA 4FTJA 1M2QA 2V7OA 5BVNA 4AT3A 2Y4IB 3SVVA 1FGIA 1WMKA 3IDCA 3UPZA 3WYXA 4FUYA 1BI8A 4X21A 3WF7A 2CKEA 3P7CA 4F0GA 3IGOA 3PZEA 4ANSA 1VYWA 3EWHA 4DH3A 3AG9A 3UYTA 1H07A 5E8XA 4LOOA 3UMWA 5DOSA 4E4LA 4J99A 2OZOA 3Q4CA 3E3BX 4GUBA 4HGEA 2PVHA 5D7AA 3DKFA 3D5WA 3W2SA 3WZKA 4DFLA 1VR2A 2YWPA 4KABA 3QGWA 5H9BA 4C57A 3EN4A 4BIEA 3JPVA 3R04A 4EJ7A 2BFYA 3FE3A 2W4KA 3U9NA 4JDJA 3UZTA 4HCTA 1G8JA 3EL8A 1WBTA 3MJ2A 1YHVA 2JIIA 3QQJA 4RBLA 4S31A 4C36A 4WUAA 1H27A 3W33A 3TV7A 4EOOA 4O96A 2XNGA 1BX6A 3HLLA 3S00A 5EDQA 1Q8YA 3VUTA 1OI9A 5FGKA 4BCFA 1YXUA 1MRVA 5E91A 4BJJA 3LOKA 1PYEA 4KBKA 3CS9A 3W0SA 1WVYA 4DC2A 2V22A 1H4LA 4D2PA 3LXKA 4X3JA 5J5TA 4GFOA 5BUJA 2W1HA 2W5AA 3ORTA 4ITJA 4RQKA 1YXTA 5IQCA 2X2KA 1W98A 3D5XA 3EIDA 3MH3A 1UA2A 1XWSA 4MXZA 4EBWA 5AFVA 3GQLA 4L9IA 1OECA 2VTLA 3SC1A 3VUGA 1A9UA 1QMZA 4IFGA 4OTWA 4EHGA 3ZM9A 3E3PA 4AA5A 4C4FA 1LP4A 4IZAA 4AF3A 5DE2A 5IA4A 5KUPA 2XKDA 3KMUA 4NTTA 4O81A 4UYAA 2QO2A 4GU9A 3NEWA 4JQ8A 4N70A 4F08A 4ASXA 4BGGA 3GC7A 1PF8A 1VEBA 3EQDA 3GQIA 2YLEA 3MVHA 4ZSGA 5BVEA 5DEWA 3EHAA 3QRIA 1SYKA 2WTKB 3D83A 1H1PA 3BGPA 5DVRA 4XP3A 1P4FA 4JS8A 1PMUA 5IDNA 3PPJA 4U42A 4XP2A 4EQUA 2YCQA 5CI7A 2CHLA 4DN5A 3VUHA 4LL0A 2UZBA 3TIZA 3PE1A 4PP9A 2IO6A 2VTJA 1KSWA 1TFFA 3FHRA 4DGOA 3UVQA 3VIDA 3A8WA 2YAAA 3DPKA 4GSBA 5M4CA 5E4HA 4EOLA 4CZTA 1WCCA 1JSVA 4UMQA 3D4QA 2B9HA 3TJCA 1F5QA 2JIUA 2ZM3A 3FXWA 2XMYA 5DYJA 5L2QA 2YDIA 4EK3A 2BROA 4BCHA 3U4WA 3QZIA 4CFXA 4OT6A 3ZDIA 3NRMA 4DEHA 2NPQA 4BVUA 1Z9XA 3SW4A 2RL5A 2R3PA 3O51A 4H58A 4TWCA 4WG3A 3PDTA 2R3KA 3P7BA 3A7FA 3FZRA 4XRLA 4QYHA 1L8TA 3MH2A 3P7AA 4CG8A 4C33A 5A3XA 1CTPE 3H9RA 3T9IA 5AR2A 5KMKA 4I5CA 3Q6UA 3OROA 3G9NA 3MY1A 5KHXA 4HNIA 2OWBA 2VTOA 3OEFX 4JAIA 4EUTA 3MY5A 1ZYDA 2R3GA 2XBAA 4FVPA 4IWPA 3VS1A 3TACA 3ZMMA 1Q62A 3ROYA 3ZHPC 4DAWA 1ZRZA 2UW7A 4IZ5A 3PG1A 5LJJA 2X4ZA 3QQUA 1Y91A 2X1NA 4O0VA 3WF6A 3A2CA 2R7IA 4P5QA 3HV5A 1WBOA 2WFYA 3R8PA 2X4FA 4FZDB 2QKRA 1REKA 4IAFA 3FMDA 4NK9A 1Q99A 4AACA 4DHFA 4QQTA 1ST4A 2ETKA 2ITNA 4XNEA 2OO8X 4YJRA 5EQYA 3UQCA 3OC1A 4QMSA 1DAWA 4Z55A 4JMQA 5EM5A 4MNEB 5LCKA 1Y8GA 2BRMA 3DK3A 4TT7A 4UEUA 4JDKA 1JKTA 3EQIA 3NIEA 2OI4X 3W16A 4UMUA 2WQMA 4C61A 5IMEA 1JOWB 2WD1A 5AR4A 1DI8A 4AOTA 5CNNA 5IH5A 3QX2A 3QHWA 4FT5A 1Q3DA 4ANQA 5CZIA 2VWBA 3ODYX 4FGBA 1GZNA 5ANEA 3VS5A 1W2DA 1H26A 4G1WA 1KE8A 3GC8A 3HGKA 4RVMA 3SRVB 4AXAA 1F3MC 3QTRA 3LM0A 3OOGA 1OL6A 2XVDA 3I0QA 4WBBB 1Z5MA 4HVDA 4I4EA 2XIYA 5BMSA 3O7LB 5HO6A 5FQDC 3KFAA 2GQGA 3HUBA 4ITHA 3I81A 4QRCA 3CXWA 5J87A 3KU2A 3O50A 4FF8A 3UPXA 4CEGA 3Q2JA 3ORZA 4BBEA 2OFUA 2JBPA 5IQGA 3IW7A 3MWUA 3F5UA 3MN3A 2ITUA 3NLBA 4MAOA 4P4CA 4RLKA 4ZTNA 2I7QA 3L9MA 5J5SA 2WGJA 2PZYA 4I5MA 1FVTA 2WIHA 2WO6A 3CP9A 3QCXA 2GPHA 3LCKA 3R8VA 1IASA 2C3LA 3UBDA 3R1NA 4MNEA 5LVPA 4RX7A 4MD7E 2OIBA 2WXVA 5TE0A 2REIA 3U87A 4IAKA 4FTOA 3FLWA 5ITAA 3CQWA 1UKIA 3EZVA 3K3JA 3F5PA 4MCVA 4A07A 3HX4A 3D94A 1PXIA 2VWYA 3N4TA 1JKKA 3R9RA 2FSOX 4S2ZA 3PVUA 4ONAA 4QD6A 1Q8TA 2R0IA 3MIAA 1CM8A 2C6LA 3F9NA 2C5NA 3CY2A 4BYIA 4J1RA 3POOA 3QU0A 4J7BA 4QMPA 4U7ZA 2R0UA 3KL8A 2B9JA 2F4JA 4FVRA 2FA2A 3BBWA 4BTJA 5D41A 3HNGA 4ANOA 4FKLA 3EN5A 4UWCA 3WI6A 5LWMA 2CCIA 3L9LA 3GXLA 2XIKA 3VS3A 1YHWA 3KULA 4RWKA 4Y8DA 4D2RA 5AAEA 2CGXA 1H01A 3BHVA 2GMXA 3LFNA 2JFMA 2FH9A 1RW8A 4QTAA 3VQUA 4ITIA 2ERKA 1PXLA 3UE4A 3LFQA 4TWNA 3Q53A 4J53A 1VJYA 5D11A 4ZJJA 2X7GA 3UODA 3P0MA 2CKPA 3D2KA 4XH6A 4AZFA 3I7BA 4M0ZA 4PPBA 4PX6A 4G34A 4O6LA 5C27A 4OR5A 3R28A 4DFYA 5LVNA 3KY2A 3E7VA 2BKZA 2EUFB 4XHKB 3G9LX 3D15A 4JBQA 5B2KA 3R22A 1I09A 3EMGA 5ACKA 3OW4A 2QOHA 3LJ0A 4G3CA 5J79A 3DKOA 4KA3A 4WHZA 4OTDA 4JXFA 4WA9A 4H1MA 1V0OA 4FZAB 3MI9A 4RLLA 2BRGA 3F3WA 4FSMA 3LQ3A 5M4UA 1M17A 1MUOA 3ZXTA 2X0QA 4GFGA 3RPVA 4ZLYA 2A0CX 4DG2E 3FLQA 1L3RE 2QCSA 3OD6X 4L44A 4UMTA 4S33A 5AR3A 4BDDA 2ETMA 4LG4A 4AS0A 1UU7A 5L6PA 2XF0A 2G01A 2X6EA 4ARKA 4DH5A 4MF1A 2OXDA 2BRNA 2VD5A 2RG6A 4I0SA 5BMMA 4HW7A 5AP6A 3C4CA 3MH1A 2XARA 2VTTA 1PXPA 2P4IA 1STCE 4G9RA 4YJPA 5CAUA 4NL0A 5EKOA 4F9AA 4AW2A 1H1RA 4J8MA 1QL6A 3ULIA 1XHAA 1Q4LA 2ZVAA 3BGZA 4QMWA 3NSZA 3F5XA 2OH0E 4X3FC 1JQHA 4E73A 5K4JA 4QMUA 3PWYA 3LMGA 1XH4A 5CU2A 3SOAA 4E20A 3FKNA 5HORA 4XG2A 2F7EE 4M3QA 3EQCA 4O0RA 3ZZEA 5ETIA 4M12A 4P90A 2PE0A 3KCFA 3TKUA 3FYJX 3OTUA 1E1VA 2I1MA 3PA3A 3R7GA 2ZB1A 3BWFA 4F64A 4Z3VA 2NYAA 4O0WA 3E92A 3LIJA 5FTQA 3F2AA 3PUFC 2CCHA 4MBJA 4HVHA 4QO9A 3QRUA 4AE9A 1Q5KA 4KD1A 4GKHA 4YPSA 5HG7A 3QD2B 3ATTA 3UTOA 4BDBA 3TUBA 1ZMUA 2P2HA 3UDBA 3CGFA 4QPSA 3RI1A 1ZLTA 1Q41A 2IEWA 2VN9A 3PVWA 4HVIA 2J9MA 3F3VA 2VO7A 5JGBA 5L2WA 2BRBA 3KK9A 1LR4A 2OJGA 2FSLX 4IE9A 1ZZLA 4XOYA 5E8ZA 4O83A 3P1AA 3IECA 3LMHA 2RFEA 4NM3A 4F9CA 2OG8A 3A99A 4PPCA 2PTKA 2Y4PA 4ZSLA 1J7IA 3SHEA 4PDPA 3P5JC 2UZVA 4FV2A 4EJNA 2XK8A 2GCDA 4DFXE 4UY9A 3V04A 4YURA 4USEA 3DBEA 4F70A 4OBOA 1JKLA 1H1SA 3KVXA 3WE4A 3U6JA 3FXZA 1URWA 4I6FA 4CQEA 5HX8A 5H8EA 4MBIA 3DXNA 5K4IA 4RIXB 2HENA 1OB3A 5HG9A 2RGPA 4G9CA 1H1WA 3NUSA 1Q61A 2VTAA 3MDYA 4IFCA 4AQKA 4QNAA 5FEDA 3VAPA 4DHIB 3V5QA 4M84A 4FC0A 4RA5A 3SLSA 3GU4A 5A4TA 1OL2A 1ZOEA 4JR7A 3QCYA 2XNMA 4G3GA 4GRBA 2YIXA 2B9IA 3E8CA 3KXNA 1CSNA 4UYNA 4DGGA 4E6CA 2PULA 5JFSA 3UVRA 3AKJA 4ZAUA 4ZY5A 2I0VA 5HVYA 3SX9A 4O6EA 4M8TA 4XG6A 4TWPA 4X2KA 4PMMA 1ZXEA 5A9UA 3OCGA 3QA8A 4O2ZA 3KRLA 3L1SA 2AC5A 3P5KA 4O4BB 1GOLA 3TNWA 4E4XA 3RK9A 3H30A 4G16A 4UWYA 2C6KA 3BHYA 3ROCA 4FIFA 3CJGA 4WG5A 4C59A 5LVOA 3PSDA 3C50A 3OUKA 5HTBA 3SA0A 4DE4A 3DJ7A 1AQ1A 4YJNA 5EOLA 2RFDA 3KXGA 5ANJA 3RWPA 1UNLA 5A14A 4EHEA 4FT3A 1XBAA 1XR1A 2Q0NA 4IJPA 3ZRKA 4CVAA 2NO3A 2X6DA 3QD0A 4RIXA 2W7XA 4I41A 1R3CA 1PKDA 1WBPA 2NP8A 4FSUA 4GJ2A 4MVFA 2QLQA 3R63A 5CY3A 4ALUA 2XIZA 4ALVA 4CKJA 4DDGA 4AOIA 2XANA 3T9TA 2H9VA 3TDWA 3VJNA 4QDVA 2UZLA 4O2PA 2QO7A 2BR1A 2RFSA 4LRMA 2BFXA 3FY0A 3QUDA 5JZJA 3ACJA 3MIYA 5TOZA 3NFFB 4G6LA 2PZRA 4GVJA 4WRGA 3MFRA 5EOBA 2XKCA 4XG7A 3CR0A 4MBLA 4PL4A 3JY0A 2QOFA 3QLGA 4YZ9A 3L8XA 3TTJA 3O8UA 4OGRA 3V5TA 2OU7A 5FTOA 5LARA 2JKMA 4TPTA 2J90A 3SXFA 1IAHA 4O0TA 4BB4A 4EL9A 5HX6A 4GKIA 4EOIA 3K2LA 3OZ6A 3QZFA 5TO8A 5CU3A 3R9DA 4EOQA 3GCQA 2XS0A 2F7ZE 2JKKA 2R3HA 3NAYA 2WB8A 3Q9ZA 1MRUA 3D7TB 3MGYA 5AIKA 3PSBA 4BR3A 4I22A 2O64A 3MTLA 4QTEA 3F69A 4YGAA 2VUWA 2ITVA 4D1XA 3B8QA 3Q32A 1BYGA 4CGAA 4DEEA 1PXMA 3A8XA 3IO7A 4I3ZA 1GJOA 3PJ2A 4JJRA 3I60A 3CY3A 3PIXA 4RJ7A 3DFCB 4LL5A 2XNEA 3OFMA 4KKHA 3DS6A 3C5UA 1LPUA 2BAQA 2WELA 4K1BA 4F63A 4ZXTA 2R3LA 3RINA 4IX5A 5CEIA 4O27B 2PVLA 3R00A 4HVGA 3DKGA 4G5JA 1PXOA 4Y72A 3BLRA 3WZJA 4F6SA 3COMA 2WTVA 2RSVA 4USFA 3PJ1A 3LFDA 2VO6A 1Q8WA 2YJRA 3MPMA 2WTIA 4QTBA 4WSYA 4O1PA 5I3OA 3R9NA 3C51A 2HCKA 5CTPA 5GIOE 3I5NA 1U54A 4F0FA 4LGGA 4P7EA 4PWNA 3QKMA 3FUPA 4APPA 2YABA 4I6BA 3SQQA 4RFZA 5CLPA 5CXHA 3H10A 3GUBA 4ZJIA 3R9OA 4X3FB 3QF9A 4M14A 4AOJA 2CDZA 3HDMA 4MD9E 2BALA 3D7TA 4RGJA 3QD4A 4UBAA 1G8AA 4AAYA 2CMWA 2XB7A 3BLHA 4Y73A 4AXCA 2DYLA 3D0EA 3Q4TA 4BZDA 5C8KA 2ONLC 3CCNA 2QOKA 3A62A 1ZMWA 2VO3A 1XMLA 3KGAA 3N4VA 1H28A 2B9FA 4FA2A 5EDRA 2JDOA 3F7WA 4F7NA 3R83A 3CEKA 2W1ZA 4I20A 5DGZA 4LDTA 4AXFA 5KBQA 4ZLOA 5CENA 3LAUA 1O6KA 3D2IA 5JFVA 4C34A 3IW5A 1W8CA 3VO3A 4BF2A 4BKZA 2XEZA 3AGLA 3W0OA 2UVZA 4JG7A 4E3CA 3N9XA 4AFEA 2Q83A 2F57A 3DLZA 3EFWA 4FZ6A 2XRWA 5L2TA 3E88A 4U3YA 2VX1A 5CX9A 4LGHA 2AUHA 2UW6A 4YC6A 4K11A 2RKUA 4PNIA 3LFSA 2QNJA 1ZYLA 1XH7A 2YERA 4K9YA 3Q04A 3MW1A 3GU7A 3MY0A 3C4WA 3FL4A 4WD5A 4WNPA 3T3VA 4ZTLA 4FVQA 3S1HA 4GK2A 3QZHA 4RVKA 3DAJA 1OM1A 4KKGA 4O0SA 4X3FA 5EI2A 2R5TA 5CYIA 3LHJA 2V5QA 5CF8A 5DN3A 2CN5A 5IQFA 1OMWA 4NJ3A 4KAOA 2HELA 4LGDA 1XKKA 3NUUA 1S9JA 3PUPA 4L45A 4YLKA 2ZJWA 3BYOA 2BDWA 5DG5A 1QPEA 2A98A 3EQGA 4M69A 5F4NA 3UMXA 3PZHA 4I0RA 4L42A 4B4LA 4EC9A 2J5EA 4ASZA 4BCMA 4O38A 3NPCA 3I0OA 3R8UA 3U6IA 4BTFA 5IUIA 3NIZA 3RWQA 3W2QA 4L67A 1P2AA 1U5QA 5TF9A 4H3QA 5IU2A 2HIWA 4OTQA 3FMNA 4C02A 4UN0C 4GMYA 3C1XA 4U80A 3P79A 1JSUA 5FEQA 4KIQA 4L8MA 3TZ8A 3WARA 2VWUA 3E62A 5C01A 4Q5HA 4YO4A 3WZDA 4QYGA 2UZTA 4RZWA