3MIAA

Crystal structure of hiv-1 tat complexed with atp-bound human p-tefb
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
333
structure length
324
Chain Sequence
b'VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 9
publication title Crystal structure of HIV-1 Tat complexed with human P-TEFb.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 98
structure length 324
sequence length 333
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2010-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3miaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3miaA01
2J0IA 3KU2A 3O8UA 2PY3A 1AQ1A 3FMHA 3HV7A 3QD0A 4YJQA 3GCVA 3JPVA 3P7CA 3NNUA 3CJFA 5K5NA 5IQCA 4ANOA 5AUWA 3V5JA 3PXRA 4NH1A 4WT6A 2V5QA 3QC4A 1J1BA 2YDJA 3DBDA 4MXOA 3I60A 4QMYA 1QPEA 5I9XA 1JPAA 2P2HA 2QONA 4E6QA 4BCOA 2YM8A 2GPHA 3ENMA 3BYVA 2GHGA 4TYJA 2JIVA 4O82A 2OJ9A 2XNPA 3HUCA 3ELJA 4DH1A 4UALA 3RZFA 4FTUA 3UO4A 1UU3A 4DEHA 5FTOA 3LFQA 2XNMA 1UV5A 3ZUVA 4JBOA 2XEZA 3T3VA 4O22A 4FGBA 3U87A 3ULZA 2C6TA 4RZVA 2JGZA 2A2AA 3HMOA 4U79A 2FGIA 3QGWA 2UZNA 4C3PA 4M15A 3ORPA 3SLSA 4OT6A 5K9IA 3HDNA 3MPTA 4CLIA 4U42A 1Q4LA 2UZOA 5HNBA 4L45A 4R6VA 3U6JA 3R9DA 1GIJA 1UU8A 3ODZX 4PWNA 3TNPC 3CTJA 4R78A 4IXPA 5AP1A 2WTJA 2V0DA 4O7SA 4QMPA 4U0IA 1YVJA 2R3NA 3PUPA 1PY5A 4NM3A 1J7LA 2F7XE 4B0GA 4EYMA 3UDBA 3QC9A 4IFGA 3RZBA 4EUUA 4GW8A 4RBLA 5M56A 3DXNA 2UVZA 3RK9A 4ALWA 2CGUA 2QVSE 5M44A 3ATTA 3UOLA 2PVLA 4BTJA 3FWQA 3D7TB 3QYWA 4FG9A 3LHJA 2ZB1A 4FV3A 1OB3A 2NRYA 4Q5HA 2A0CX 1OM1A 2EVAA 4BCIA 4FOCA 5L2IA 2VWUA 3ZRMA 3R71A 4FT7A 3IGOA 3UQGA 4ZJIA 2EWAA 4RWLA 3R00A 3T9IA 4ANQA 1FOTA 4NKAA 3UMWA 4DFXE 3AC8A 3HVCA 5JH6A 3Q9ZA 2CN5A 2BHEA 2C1BA 4ID7A 4FTJA 3EYHA 4PNIA 4UEUA 5G6VA 2F2CB 3GCUA 3R8PA 3DAJA 2Y4IC 4G2FA 3BYSA 5T3QA 2XA4A 3LQ5A 3ZONA 5IH4A 3ATSA 5KHXA 2VTMA 4DTKA 2FA2A 4ZK5A 2REIA 4RQVA 5BVWA 3DJ6A 5FEQA 5HTBA 1OPKA 1H1RA 1ZZLA 3VBWA 4O0WA 4JR7A 1JOWB 2A1AB 3D5WA 3C1XA 3GFWA 2WELA 4CFWA 3D83A 5A46A 4QO9A 3BWJA 2QOLA 1B39A 5DPVA 2W06A 3KXXA 4ZZMA 4FTCA 3D5UA 5HCXA 4W9WA 5BMMA 2W1IA 2WAJA 4L7FA 4XUFA 4LUDA 4IM3A 4RJ3A 4D55A 3NUSA 4D4VA 5KCVA 2ESMA 3UIBA 3KMUA 3PLSA 5GZAA 2RSVA 4DCEA 2XBAA 2XUUA 2XYUA 3NLBA 2W1CA 3SHEA 1J3HA 2VX3A 1H28A 4ZZOA 2QQ7A 3BRBA 1NVRA 3GC0A 2BZJA 2UV2A 2W4KA 3LCOA 4OGRA 3AXWA 4DFUA 3H30A 4YR8A 5I9ZA 2ZV7A 2R4BA 3G15A 4L52A 3GU4A 2W05A 1VEBA 3E8DA 2UW0A 3IS5A 2ZB0A 3HV5A 3NMUF 3LOKA 1ZZ2A 5C27A 4MKCA 3DFCB 3UP2A 2ZV8A 2IO6A 2OXXA 3FMLA 4LOQA 4DEDA 4IC7A 2IJMA 1M14A 2NP8A 4QMVA 3PP1A 5AR7A 3ZXTA 5FXSA 2B54A 2PVFA 3FL4A 3RNYA 4E8AA 4BVUA 5JRQA 3FYJX 4CV9A 4OTPA 4ZSAA 4CCBA 5C4KA 3P86A 4ZY4A 3ENHA 2Y6MA 3ANQA 5TOZA 4BWPA 4PTEA 4AU8A 3BIZA 4I0RA 3VUHA 4S2ZA 4NJ3A 4Z16A 1SNUA 3W33A 4BB4A 4JIKA 4MQ2A 4ASXA 4TWCA 2J90A 2XJ1A 1UKIA 3EHAA 4K77A 5H8GA 4BFMA 2HY81 2OXYA 3NUYA 4F9YA 3QZHA 4O84A 2VTPA 1P5EA 3I81A 4U8ZA 5T68A 4AT5A 3TDVA 3CS9A 5IEYA 3L8SA 4ZEGA 4FTAA 4R5YA 3QD2B 1KE9A 5GZ9A 4N0SA 1APME 3FMNA 3G90X 3MIYA 4L3LA 1PXOA 5LARA 3BLRA 2WQOA 3I5NA 4RFZA 4QYGA 3UG1A 4DGOA 2YM5A 3F3TA 2J50A 3EWHA 4AFJA 2YHVA 2P4IA 2GNLA 3DKCA 5DT3A 3W1FA 4WA9A 3TL8A 3UIUA 3ZDUA 4BHZA 3D5VA 1OIUA 4EK5A 1AD5A 4WKQA 4IZYA 3QQKA 3PA3A 4RIXB 3QZFA 4DG0E 4L01A 4MNFA 3FKOA 4ANMA 5D11A 3QTIA 4QYFA 4L7SA 1J91A 3TCPA 4I6FA 1T46A 3TACA 3T8OA 1H26A 4GS6A 3G2FA 2YAAA 1JQHA 4QMZA 3MFUA 4GK3A 4OW8A 2I0HA 2XCKA 3NYXA 4DITA 3I6WA 3NGAA 4FNWA 4JDJA 2VWBA 1PXJA 4AS0A 4F0IA 1OZ1A 3ODYX 1FINA 5J8IA 2F7EE 2JC6A 4QQTA 1CKJA 1LR4A 4QNYA 3EFKA 4IC8A 3C4XA 4JS8A 4QYYA 5J7BA 4O83A 4KB8A 4C4FA 3G6HA 3P7BA 1Y8YA 4AW1A 3I7BA 3C0HA 3W16A 2RGPA 4RZWA 4ZZNA 3R8VA 1FPUA 3FKNA 3HP5A 2XIZA 4KA3A 4MD8E 3W10A 4NT4A 2EB3A 4FEUA 3GFEA 3QRTA 5CEPA 3L8VA 4D58A 4V0GA 4IAAA 4D0XA 1H1QA 2HW7A 4L00A 3TNQB 5BMSA 2ETKA 2BR1A 4QNAA 2F4JA 1PXNA 3SXSA 3GI3A 2G2FA 4QTBA 3FMKA 4AACA 3NYNA 3IW4A 3HAMA 3MJ2A 3ROYA 3D9VA 2X7GA 2WO6A 2ITPA 2YM3A 3ORKA 1H0VA 2YIWA 3EIDA 3F3UA 4GVAA 4MBJA 3S2PA 1G3NA 3ZEWA 4BCKA 3D2KA 5HG8A 3VAPA 4C38A 2HY0A 4RVMA 3NNXA 3TV4A 4WRGA 5BUEA 2ITOA 5C26A 2VV9A 5AV0A 3F6XA 4ASZA 3QZGA 1PF8A 4XG4A 5FP5A 3R9RA 3MVHA 4IB0A 5L2TA 4K1BA 4AOTA 4JJRA 4WUAA 4EK8A 4FKGA 2O2UA 3UVQA 5GNKA 4YZNA 3F3ZA 3Q6UA 5CZHA 1H27A 4YHJA 3MY0A 3N4UA 2OFUA 3FQHA 3NIZA 2G15A 4TRLA 4D2VA 2FSOX 3HAVA 1XH9A 1XHAA 3ZO3A 4BCMA 4JDHA 4CKIA 4JT3A 3EQFA 3FI2A 5JMSA 2QC6A 4XMOA 4CD0A 3CR0A 1DM2A 3FZSA 1H0WA 3PPKA 4K6ZA 4BF2A 5KMKA 1TQMA 5HO7A 2YIXA 3FI3A 2WMQA 2UZTA 4CSVA 5TE0A 1JKTA 3EN6A 5CEIA 4DH7A 2IG7A 4KAOA 1RJBA 2WMXA 1T45A 3CP9A 3RALA 3VBYA 3I7CA 2HWPA 4FE2A 4K9YA 2X2KA 4XBRA 4EL9A 1VJYA 4RWIA 2XNOA 5IF1A 4RVLA 4RX8A 3G6GA 4KIPA 1OKWA 3RAKA 4E20A 4E3CA 3LCKA 4A9SA 3THBA 5F95A 3U4UA 2VWYA 2WGJA 3FSFA 3QTXA 2CMWA 1NT2A 1MQBA 4LGHA 2ZMDA 4WG4A 4PRJA 5E8WA 4KIKB 4ACMA 3D94A 4FT0A 5I5ZA 4I22A 1BI8A 2C3JA 5BYLA 3GOKA 4FSWA 5ANEA 3PFQA 4L8MA 5HLNA 1XJDA 3PPJA 2QOOA 4AN2A 3DKFA 4NFMA 1WFCA 1UNGA 4AA4A 2BZKB 4TYGA 4K2RA 4E6AA 3FY0A 3OW4A 4QMMA 4YTIA 3EMGA 4YURA 4NM7A 4GH2A 4GRBA 4IVAA 3VQUA 3AT2A 3DZOA 4EBVA 3TUDA 5LVLA 4KS8A 2YM4A 3OUNB 2E9OA 4BN1A 2P2IA 2WEIA 4LRKA 4WSYA 3I6UA 4PDPA 3ZBXA 5IQAA 3TM0A 4ZSGA 4BWXA 3OHTA 4FKUA 3R30A 4W4VA 3EQPA 2QOBA 2YWVA 4L9IA 4ZTNA 4JRNA 3Q2MA 2RIOA 4FSMA 4FT3A 5AP5A 4C4HA 4CZTA 1Q8WA 3S4QA 3W2PA 2GDOA 3DBEA 4U9AA 4UBAA 3GQLA 4JVGA 3FE3A 2BDJA 5EYDA 1H25A 1YHWA 1IEPA 2QLUA 1YI6A 4DFNA 5HVYA 2UW3A 3GNIB 4BCHA 4D28A 3MS9A 1NW1A 3IW7A 4J97A 4L53A 3A7GA 3PZHA 1ZYCA 2FO0A 3FUPA 3C4EA 3FXWA 4APPA 4FKVA 3GU8A 3WF7A 3R9HA 3K5UA 2BRGA 4J96A 2DUVA 4WNOA 1L3RE 1YWRA 1SYKA 5KKRB 5AM6A 5K0XA 2JFMA 2ONLC 1UNLA 4ERWA 3LQ3A 3RPOA 2Z2WA 1LPUA 3QZIA 3ZSIA 5BUIA 4YNEA 2CKPA 1GZOA 2G9XA 3PY1A 3Q4ZA 3TV7A 5CTPA 3VUDA 4YO4A 5TF9A 4YUQA 5J9ZA 4OBQA 5JQ8A 1IAHA 1KOAA 1PKGA 3PY3A 3R01A 4MF0A 3P7AA 2X0GA 3VWAA 3I5ZA 4EWQA 5E9EA 1W7HA 3BI6A 5CSHA 1V1KA 2ACXA 3SD0A 5HLWA 4L42A 4FC0A 4I41A 4GFOA 5E91A 4FV2A 3NS9A 1ZYLA 3OWPA 4Z7GA 3FAAA 4YU2A 1PMVA 5FP6A 2RF9A 3FQSA 3KY2A 5CXZA 3WOWA 2ONLA 4BTMA 2ZOQA 2GQGA 2WTKB 3KXGA 5EOBA 4ALVA 2E9NA 3Q2JA 3PY0A 5E8UA 1NVQA 4ENXA 2WU6A 2UW6A 4I5MA 3UMXA 3K2LA 3OVVA 5K5XA 4PPBA 3PWYA 2W1DA 4CLJA 3F5XA 4G3EA 3D5XA 2EUFB 3KF4A 4FX3A 1GJOA 1R0PA 2XJ2A 2C6IA 4G34A 3PJ1A 4MEDA 5EFQA 2WMBA 5EQEA 2C6LA 3IG7A 3MW1A 4MF1A 3UO5A 3K5VA 4AZTA 4Z7HA 4ZTQA 5JN2A 3W8QA 2QOFA 3E87A 1VR2A 2WMTA 2VWXA 2YN8A 3QRJA 4R7BA 3S00A 3WBLA 1ZYDA 4NTSA 2WTIA 3JY0A 4RIYB 4LYNA 3REPA 2C0IA 3H10A 2OGVA 4DFLA 5FTGA 3V5PA 3CTQA 4TYHA 1Z57A 3KA0A 4FOBA 3C0GA 3N4VA 4L68A 4I1ZA 2EXEA 2W1GA 5FUTA 4IJPA 4FVQA 2VGOA 3AC3A 5IA5A 1CM8A 2V7AA 3ZFXA 3F7WA 1HCKA 3OBGA 4GK4A 4GJ3A 3NZ0A 1NVSA 2A4LA 4D1ZA 4F09A 2X6EA 3DA6A 2I6LA 2BALA 4YLJA 3U8WA 4E73A 2XYNA 4EZ3A 4ITJA 4IJ9A 2C6MA 3FZ1A 4NIFA 2QNJA 1OKZA 3ACKA 4F65A 2V62A 4WBBB 3TEIA 2UW4A 2GS2A 4WNPA 1Y8GA 3B8RA 3H9RA 4GCJA 5HE2A 3QXOA 3HRBA 2RG6A 3HV3A 2E9UA 4O38A 5CI6A 3UNKA 1U59A 3CD8A 4BR3A 4KWPA 3VBXA 2OIQA 4GEOA 2IW8A 3VBQA 3VHEA 4ASDA 4FZFB 4EQCA 2W1EA 2O65A 3IK3A 2UZVA 3ALOA 5E92A 4WRSA 4FTLA 4AZEA 4X6RA 2XM8A 4L3JA 3VS4A 2RG5A 4MBLA 3L8PA 4YP8A 4QMLA 3R7YA 5ETCA 5CF5A 5EOLA 3V5QA 5LJJA 4XRLA 4USDA 4TW9A 3M11A 1Q62A 4XP2A 5LMBA 3ZU7A 2OJJA 5FDPA 1A48A 3ZCLA 4R7IA 4FA2A 3O71A 1YXSA 3QWKA 4OTGA 4F7NA 3NYVA 3KMWA 1GZKA 2WQNA 2X9FA 5EI2A 1CKIA 4N4SA 2VRXA 4UN0C 4JQEA 2P55A 1ZAOA 3LJ1A 5CY3A 3BCEA 3TJCA 3GU5A 4H3PA 4YHTA 4B8MA 5I9WA 2W99B 5HI2A 3DLZA 4C37A 1JLUE 3B2TA 1JWHA 4TT7A 5IKWA 3LKMA 3FQEA 2GNGA 4FZ6A 4IB3A 4XV3A 5A6OA 5J9LA 3BBWA 4JOAA 1U54B 2C0OA 3SW7A 4IB5A 3ORTA 1JKKA 3GGFA 4L3PA 3BWFA 5J1WA 2FH9A 2OZAA 5K4IA 3V5WA 5DR2A 4BDDA 4NW5A 3FEGA 3K3IA 4NYEA 2JFLA 5ANGA 1V0BA 1QPJA 1PXPA 4BCPA 3GC9A 5CI7A 1HCLA 3ORZA 3VJOA 3MY1A 3FPQA 5EH0A 1FBNA 3DKGA 4WSQA 4O7VA 4XRJA 2XS0A 5J87A 1CSNA 4MVFA 5A3XA 4O0XA 2XKCA 2V55A 3KCFA 2VWWA 3PSCA 2XB7A 2YERA 3E63A 3OD6X 5I9VA 4F0FA 1A9UA 4IE9A 4PY1A 3F88A 4Q2AA 3V8WA 4HPTE 3SG8A 3F61A 1WVYA 5CVHA 5BNJA 4DEIA 3D14A 2I40A 3EL7A 2YCQA 3LIJA 1G8SA 4CG8A 1Q41A 2YJRA 2ITNA 1U4DA 2A19B 5LWNA 1FVRA 2WMAA 1ZOHA 3OWLA 2C30A 5HU3A 4AN9A 5HZNA 5LVPA 1W0XC 3V04A 5CT0A 3EZRA 2P3GX 2YAKA 3R28A 5AP3A 2OJGA 4BDCA 1LP4A 4YC6A 4EC9A 2W17A 2CSNA 2WKMA 1V0PA 5CAPA 4KBCA 5I4NA 5KMNA 3H3CA 3HRCA 4EKKA 4GFGA 5E7RA 3PXZA 3Q3BA 2UW8A 3KVWA 4DFBA 5F9EA 3FPMA 4FIGA 2WQEA 3HKOA 4O2ZA 4UWCA 4BIEA 4D1XA 4EC8A 2AYPA 2CGWA 5AR4A 3KXZA 4C02A 1F0QA 3FYKX 5M4FA 2CCIA 4MX9A 5J79A 5JGDA 2R3FA 4NSTA 4XEYA 3DBFA 4XV9A 5FG8A 2VTRA 3FMDA 5D1JA 1RW8A 5CF8A 2PVKA 4RFMA 4Q9ZA 4Q5EA 2YIRA 3JR1A 4NKSA 2CCHA 3ZRKA 5DLSA 3UPZA 3EQDA 5FEDA 3ROCA 3L9LA 3DQXA 5DRDA 3MVMA 4JX3A 5EM5A 3QBNA 4CZYB 3QTRA 5LCJA 5FBNC 2FYSA 3QALE 4EH4A 4XCUA 4IDTA 4UXQA 5FM2A 3HX4A 3WF6A 4BBEA 1OIRA 2VZ6A 3FHRA 5KX8A 5KBQA 5EW9A 4HGLA 4X2KA 3IO7A 3R1NA 3MVJA 3CJGA 4ZLYA 5DE2A 4IMYA 3LCDA 2CKOA 3FZPA 4AOIA 2R0UA 2QOCA 1JBPE 5M4UA 4YZMA 3FLYA 1MRVA 2UZLA 3PLAE 1O9UA 4G3GA 4J8NA 3MFSA 2OU7A 2RFEA 3LFNA 4Y8DA 3OC1A 3VBTA 2X9EA 4BDBA 4FKLA 4IEBA 4QD6A 2C6EA 2WQMA 2ITWA 1OL7A 2GFSA 3HRFA 5C8MA 5CENA 1ND4A 4Y85A 3E88A 4KIQA 4HVGA 5AUVA 2CN8A 2X39A 3Q9WA 4BIDA 4FICA 5GINE 5JK3A 5E8TA 5HG9A 4XH6A 4N6YA 4I4FA 2QKWB 4UMPA 3ORXA 1WBPA 4WG3A 1LEWA 3NNVA 1ZOGA 4ACGA 3PSDA 2J5FA 5IMEA 5E8YA 1PRYA 4OBOA 1XBCA 4LMNA 2QG5A 2OH4A 1PHKA 3BEAA 2PTKA 3ZFYA 2I0VA 2QOQA 2BROA 5DFPA 4AFEA 5CSXA 4XG2A 3GCPA 2OXDA 1QPCA 4PX6A 4ACCA 1ZLTA 4PPAA 3I0OA 4KUJA 3BEGA 3QCXA 4HVHA 1OPJA 4EHZA 1GOLA 3C0IA 4HZSA 1WBOA 4AUAA 5LQFA 4GIHA 2O8YA 3FZRA 4I24A 3V8TA 4H36A 3G0FA 4L44A 4MTAA 3R83A 4C4EA 2J9MA 1KE5A 4TXCA 4IAKA 5ETIA 3RHKA 2J6MA 3RPVA 2LAVA 3RBWA 3VW6A 3ZRLA 2VTJA 1PJKA 4IVBA 4E93A 4CFVA 4OTQA 4AW5A 3DAKA 3DK7A 2Q0BA 3VBVA 1DAWA 2WOUA 2CLXA 4DEAA 2X4FA 1M52A 4BCQA 5JT2A 4JQ7A 4E4MA 4CT2A 3NPCA 5HX8A 4X2FA 3U55A 3ALNA 2OK1A 2XKEA 5CNOA 3Q6WA 4W8DA 5JEBA 5AR8A 3UNZA 4D5HA 2PZIA 4O1OA 4O7LA 4FSTA 3PVWA 5HICA 3UC4A 4TKSA 3WZUA 3AC1A 4E26A 2WMSA 1RDQE 4D2TA 2I0EA 2XK8A 4X21A 3ZFMA 4DFYA 2B7AA 2R3PA 3P23A 2BKKA 3KN5A 4GG7A 4DGMA 4Z3VA 3A7HA 3TDWA 4FNYA 4HGSA 5KMMA 3BPRA 4S33A 3DJ7A 3COMA 3E62A 3LVPA 5JSMA 3VUMA 4O7NA 4EJ7A 1XH4A 4D4SA 1PYXA 4FVRA 2H8HA 3QU0A 4FYNA 4HYSA 4S31A 3ZOSA 4C3FA 4EH7A 4FSRA 4FTOA 5HVJA 3A7FA 4GU6A 3NDMA 3G51A 2OH0E 4O0RA 5CLPA 4YJUA 2W1HA 5HCYA 1OUYA 4TTHB 3SQQA 4R1YA 1I09A 3ORLA 2C5XA 4CXAA 3QQGA 3MESA 4NU1A 4ZY6A 3UE4A 3NWWA 3VJNA 3VUIA 5CF4A 4FODA 5I9YA 3CE3A 2GFCA 4FEQA 3KXHA 5DA3A 3MWUA 5E8VA 5EYKA 5K0KA 4F7LA 1URWA 5LCKA 2YACA 3Q60A 5CU6A 5HOAA 4FIIA 4KRDA 4CEGA 2X4ZA 4I23A 2RFNA 4GG5A 1CKPA 1TQPA 4M14A 3BU5A 5EDPA 3RPSA 4J7BA 4G1WA 4KIOA 4O0VA 4TWPA 3ZUUA 4I4EA 3VS3A 4V04A 4QMTA 3E64A 2R3RA 4CFXA 2B53A 4EH8A 3DB8A 4P5ZA 3ZLWA 2Y0AA 3LQ8A 4QT1A 4RA5A 4C4JA 4CVAA 4IZ7A 4PMSA 2PMIA 4TWOA 4FV7A 3U51A 3DY7A 4RWJA 3O17A 3ZMMA 4BI0A 3A99A 2JKQA 3VO3A 3OUKA 4LI5A 4AGWA 3COKA 5CX9A 1QPDA 3D7TA 1Y57A 4AWIA 4DBNA 2C3KA 2V7OA 2PSQA 2BDWA 5CNNA 5HEZA 3QWJA 2GS7A 5BQ0A 4UWBA 5I3RA 4FKQA 4QOXA 4HYHA 5CU3A 4BDIA 2Z7QA 4WOVA 4AZSA 2C6OA 5E4HA 4QYHA 2OKRA 1H8FA 4CZUA 2XP2A 4GK2A 4DFZE 5KMLA 3AT3A 3CY2A 3ZXZA 2OZOA 5E90A 2BAKA 4RJ7A 2JDSA 3HMNA 2JIIA 3G9LX 4MQ1A 1W82A 3WYXA 5H3QA 5B2LA 2HK5A 4QQ5A 5DH3A 3PSBA 2QO7A 3CLYA 3KGAA 2CNVA 4EH6A 3WIKA 5DG5A 2BKZA 1JKLA 4ZTRA 3ZSHA 5DEYA 4WO5A 3UIMA 2C5YA 4YZBA 3NW5A 2YDKA 3OROA 4TPTA 4XG7A 4IIRA 4DLJA 2PVJA 2R0IA 4LL0A 4GJ2A 3Q9XA 2YZLA 4D1SA 4A4OA 4CCUA 3FBVA 3IDPA 2OICA 1H08A 5IA3A 5HIDA 4X7QA 3WF8A 4RVKA 2BILB 3F3WA 2QO2A 4AW0A 2KTYA 3QX4A 2JAMA 4E6DA 2VO0A 5IQBA 3QXPA 3VULA 2JKMA 3OY3A 2NNWB 4BCFA 4AP7A 4KSQA 4FTQA 4E5BA 1Q5KA 3KRRA 4EQUA 5EHYA 3NUUA 3SXRA 5BVDA 4LFIA 4W4WA 2CDZA 4FKRA 2C5NA 1JVPP 3O96A 4DEEA 2PHKA 3PIXA 4FSYA 3HNGA 4J8MA 3OP5A 2UZBA 1ZWSA 1M2PA 4EZ7A 2BRHA 2YDIA 2GQSA 2WZJA 4UYNA 4AZVA 1U5RA 1YDRE 5TO8A 3OEFX 4R77A 2IZRA 1GNGA 2CKEA 4GSBA 4O2PA 5L2QA 1QL6A 3O0GA 2R3LA 3OCSA 4D2WA 2W0JA 4ZS0A 4I5PA 2F7ZE 4UMQA 4DG2E 3F7ZA 3RM6A 4J1RA 3FXXA 3IKAA 5CYIA 3SRVB 4YLLA 4AF3A 3AC5A 3LMHA 3NW6A 4F7SA 4X2JA 4DCAA 4B8LA 1OI9A 3NVMB 3ZLYA 2X8IA 3A7JA 4F9WA 4G31A 4N70A 4YO6A 3W2QA 4BI2A 4QP3A 3UPXA 4UMRA 2O63A 1P4FA 2ITTA 1BMKA 5J7HA 4D4YA 2W5AA 5AADA 1DI9A 3CKWA 4LV5A 3AG9A 3FI4A 2IVUA 4R3RA 2PK9A 3SG9A 3MH0A 3R1QA 3R04A 1OL6A 4IDVA 4M67A 3S0OA 1YXVA 4I21A 4RIOA 4XV1A 3ZM9A 4FKIA 3OXIA 5T6KA 1NA7A 2XIXA 3DCVA 3BYOA 1K3AA 3VS7A 3PJ3A 4WD5A 3R7OA 4CFUA 4UMUA 2FSLX 4EBWA 3DZQA 3P0MA 5JGBA 4JBVA 3H9OA 5CAUA 3R8MA 4F1OA 5GZ8A 5BVEA 1DAYA 3DXQA 3VIDA 5AEPA 5EKNA 3I79A 4YZCA 4PV0A 3GXLA 5BVNA 4O7RA 5CASA 5L8KA 5D7VA 5HBEA 2XVDA 4LM5A 3W32A 4U7ZA 2OI4X 2ZDTA 2GNJA 3EQHA 3W2SA 3TIZA 3V01A 1Q8ZA 2JDTA 5EM8A 4ENYA 3A7IA 3FLSA 4DHFA 3TUCA 3ZZWA 5IQIA 4EH5A 5AV3A 3PRFA 4X3FB 4UV0A 4YJRA 2XCHA 5BYZA 4QTCA 3C7QA 3QL8A 4C0TA 2WQBA 4RIXA 3RK5A 4J71A 4GYIA 4RPVA 1LEZA 5L6OA 5DT0A 3RAIA 1OKYA 3FZOA 2BIKB 1MRUA 4CYJA 1FVTA 4JBQA 4C61A 2PULA 3L1SA 4QMUA 4XP3A 3TJDA 2BCJA 1FGKA 1WCCA 4A07A 3C13A 3R8LA 4EH2A 4EOMA 4RX5A 5HNIX 4AT3A 3LFEA 5GJGA 2G01A 5IQGA 4AW2A 2IZTA 3PG1A 4ZSLA 3TNHA 1R39A 3WILA 3PIZA 5D10A 2VWVA 3N9XA 2XJ0A 4ARKA 4UWYA 2X2MA 3LXKA 4FEVA 3A62A 3KMMA 4HCTA 4AX8A 3UBDA 4KBKA 1AGWA 5CVGA 4C4IA 3BKBA 1ERKA 3C4WA 5CS6A 4F1MA 2Y9QA 4FG7A 4ZMFA 4QP4A 3R02A 4C2VA 4DT8A 4ZTLA 4B6LA 3FV8A 5E8ZA 4NWMA 4BKYA 3SDJA 4JDIA 4IBMA 4M0ZA 4MXAA 4Y5QA 4D2SA 3A4PA 2HXQA 4R8QA 4IX6A 3Q53A 3AD6A 4HNIA 4BYIA 1IA8A 2R2PA 3ET7A 3R2YA 3BHHA 4KD1A 5IUGA 2GU8A 2NO3A 4GFMA 1PW2A 3UNJA 3TTIA 1S9JA 4P7EA 3RAHA 5C01A 3FC2A 3R7IA 3HMMA 4DT9A 4TL0A 3ZS5A 3OF0A 4FKTA 3BGPA 4PF4A 4EH9A 2VWZA 3EQBA 2VO6A 3QQJA 3P4KA 3BQCA 4RFYA 5DI1A 5M55A 3JYAA 4M12A 1WVXA 2BDFA 3VS2A 3JY9A 4BKZA 2C5OA 1YXTA 4M97A 4LRJA 3DPKA 3GCQA 2GSFA 5HKMA 3R7UA 1Q8YA 2F9GA 1WBWA 1W98A 2J0KA 4OLIA 2J5EA 4M69B 2IZSA 5M06A 2Y7JA 5HG7A 5C9CA 5KBRA 1BYGA 4UZHA 4PMMA 3SA0A 3F69A 3MFTA 4FTRA 3AGLA 3HMPA 3OG7A 5H8EA 1CTPE 5ANIA 1PMUA 3BE2A 4FBXA 3LFBA 4IFCA 3ZHPC 2HYYA 3OT3A 4JX7A 2ZM1A 2FSTX 4KNBA 4O6EA 5TT7A 2CKQA 4RC2A 4QRCA 2IVVA 1KV1A 3I4BA 2AC5A 3O51A 4EK3A 4O86A 2UW7A 4Y72A 3P78A 4J53A 5DOSA 1OIYA 4U81A 4HVSA 1ZRZA 4Z9LA 5AJQA 1KOBA 4O6LA 3SV0A 4R3PA 5AX3A 2PMOX 2BHHA 4AG8A 4CQEA 3T3UA 5BPYA 4HOKA 5IA1A 3VF8A 1J7UA 4KIKA 4FTIA 5IUIA 2JBOA 4C35A 4CT1A 3OOGA 4OTRA 4R7HA 4UY9A 3TKUA 3U4WA 3DQWA 1JSVA 5H9BA 2H6DA 4IVCA 4Y5HA 3P08A 4NZWB 3OXTA 4MYGA 3MIAA 1TVOA 3F2AA 3UC3A 3CXWA 3KEXA 3MTFA 3GENA 3QUDA 4IX3A 4U97A 1PXKA 1YOJA 4D9UA 2IPXA 2PE2A 3OS3A 3HYHA 3SX9A 5KKRC 1R1WA 3JUHA 1XWSA 3DKOA 4AGDA 4O7TA 4I5CA 2VTQA 4BL1A 2HZ0A 4FL1A 1PXMA 5E1EA 2QR8A 2JAVA 4NTTA 4BKJA 3K3JA 2J7TA 4EI4A 5AV4A 5D41A 3RI1A 3L9PA 5EQYA 3DU8A 3RCDA 3HDMA 5A4QA 1S9IA 3O7LB 3SXFA 5BUJA 1W8CA 4N57A 3HEGA 4TWNA 3EQGA 4FIHA 1STCE 2JDRA 3ZO4A 2AUHA 3VC4A 3LJ2A 3R21A 2R3IA 4YSMA 4ALUA 3HA8A 4C57A 2QG7A 3GU7A 3LMGA 3R63A 4OTDA 4A9YA 4U45A 4A9TA 2JDOA 4M68A 5HTCA 2WFYA 5IA4A 5HD7A 1OL1A 3F2RA 4RG0A 4NL0A 1MQ4A 1GIHA 4RIWB 4E4LA 5J95A 2B1PA 4AT4A 4E6CA 1UKHA 5HORA 5M4IA 3DDQA 2ZM3A 5J5SA 1RE8A 3BE9A 2VD5A 2I0YA 2PWLA 3EQRA 2I7QA 2X2LA 2YLEA 3QRIA 2OW3A 4FV9A 1UU7A 3HA6A 4BDJA 3IOKA 4PP7A 2C6KA 3DS6A 3MN3A 1DS5A 4FKSA 2WTKC 4EOPA 2PE0A 3JXWA 3C50A 3IECA 3IPHA 1KE6A 4HPUE 3GUBA 4BDAA 2NRUA 2IW9A 1M17A 3QGYA 2VTAA 3BYMA 1XH6A 5C1QB 3NAXA 5AP0A 3COIA 2WIPA 3FI8A 3NUNA 4U5JA 4QMNA 1R0EA 4FTMA 2PZRA 3DOGA 4O0TA 3LCTA 4BTKA 5JZJA 3NUAA 3MA3A 2Z8CA 4X2GA 1IAJA 4B99A 3QCQA 4CYIA 2XNEA 3ID6C 4FEWA 2GCDA 4FV8A 4GYGA 1XH8A 3RK7A 5A4EA 4JRVA 3R9OA 3PXFA 1YHSA 3ZSGA 4DGNA 3SC1A 2GQRA 2CJMA 2PVHA 3FZTA 1V0OA 3IW5A 3Q5ZA 3EN4A 5HG5A 3QKKA 4PDSA 5GIPE 4RLKA 4PL4A 3POOA 2C47A 4RRVA 1OPLA 5IDPA 3KK8A 5AV2A 5EQPA 5HGIA 4F99A 4UX9A 4JG7A 4D4RA 3OCTA 4XOYA 2CGXA 3E8CA 5EHLA 2ITXA 4CNHA 3VVHA 5AAGA 1Q61A 3A8XA 4A4XA 4I6HA 4MCVA 1M2QA 4G6NA 4FZ7A 2CNQA 4YZDA 3EKNA 2YFXA 5D7AA 3GC7A 4HVIA 1U46A 4RIYA 3QTUA 5M09A 3IW6A 5FEEA 5I3OA 1UA2A 4KKHA 4QP7A 3HMIA 2JKOA 4MNEB 4ZJVA 2CGVA 4AGUA 3EN7A 3QD3A 2Z02A 3ORMA 3HP2A 3QQFA 4DN5A 4M0YA 4G5PA 4EZ5A 3AOXA 4QMSA 1SMHA 3FHIA 2XK7A 2YLFA 4WNMA 3KULB 3CEKA 3WZKA 2XK3A 4EOLA 4Q9SA 4KRCA 4QPAA 5GJDA 3GT8A 3LXNA 3BZ3A 3NRMA 5HIBA 2B9JA 2UW9A 4QTEA 2QHMA 4I93A 2PL0A 4OAUC 3FDNA 3MPAA 4H39A 3VN9A 5FM3A 4IZ5A 3ZUTA 1UU9A 1MP8A 3H4JA 3EYGA 5CU2A 4NK9A 4M13A 4I3ZA 5CZIA 5AUZA 4EEVA 2VTLA 5J1VA 2J0MB 5HNGA 4YHFA 4BZOA 3Q4UA 5A4LA 1WBVA 3AC4A 2YCFA 5HO6A 2UZUE 2YM6A 3AGMA 4U3YA 3SKCA 2JBPA 4CFFA 5M4CA 4L46A 2XIKA 2XNNA 3MDYA 4FT5A 4LRMA 3BHYA 4HNFA 4AA0A 3OMVA 1TQIA 4GT5A 1K9AA 2CPKE 3QTSA 2IVSA 4HW7A 2WXVA 1YOMA 2HXLA 2B9IA 4IADA 3RGFA 5KNJA 4GKHA 3GB2A 2R7BA 4O91A 4IACA 5EK7A 3EZVA 3BELA 4C2WA 4CTCA 5DWRA 3FL5A 3AMAA 5DN3A 3VS0A 1U5QA 2X7FA 1CDKA 2CHLA 4AE9A 4BC6A 3DJ5A 3SOAA 4XBUA 5CQWA 3DXPA 2OIDA 5FD2A 2J51A 3TT0A 4IM2A 1M7QA 3BLHA 1BX6A 4BCGA 3LW0A 5M53A 2BRNA 4B4LA 3WIGA 3H0YA 5HE1A 5A6NA 4APCA 4C33A 4DTAA 4FYOA 4YPDA 5EKOA 2G2HA 3TZ8A 4FUXA 1U54A 1YOLA 3UYTA 3WARA 2ITYA 3KFAA 3TZMA 4PNKA 4F7JA 4ZY5A 3OT8A 4HYIA 3MSSA 4LV8A 3QUPA 2FVDA 4Y46A 5AIKA 3AMBA 3TIYA 4F6WA 4FEXA 1ZY4A 2PZYA 3L8XA 4B7TA 4I94A 5C8KA 5M51A 3LJ0A 3NUPA 4USEA 2F49A 3AQVA 4V01A 4RVTA 5HTIA 3G5DA 1Q3WA 2Y8OA 5F4NA 4FV1A 5FXQA 5HLPA 4C58A 2FB8A 4XG9A 4QQJA 2PVMA 4K11A 5EW3A 2UVYA 2X8EA 5KZ0A 4EHGA 2VTIA 3AD5A 3CPCA 4U43A 2YISA 4G5JA 1ZMUA 4ZXTA 3SW4A 4BICA 2W5HA 3ZDIA 4DGGA 5HVKA 2QCSA 4PL3A 3N51A 3GC8A 4DGLC 2YITA 3TWJA 5IQHA 2UVXA 3E8NA 1JAMA 3VW8A 3NCZA 2WD1A 3F82A 5BX0A 4NJDA 3TNIA 4CGAA 5CSVA 2QODA 2QKRA 2UZEA 4QMXA 3ULIA 2BIYA 4LGDA 2W4OA 5HE0A 3CQWA 2J2IB 3FY2A 4ZMEA 2ZAZA 4ITHA 3UGCA 1NY3A 4FKJA 2GNFA 2UUEA 3AMYA 4X2NA 4CMTA 3II5A 1IR3A 2R7IA 2RKUA 2BFXA 4O21A 4R3CA 5AP2A 4EK6A 1J1CA 4MXYA 2BPMA 3MVLA 4WG5A 4JDKA 3MH3A 5BVKA 2WU7A 4MHAA 2F2UA 2XNBA 2BAQA 1YI4A 2R3JA 4AAAA 1WBTA 2XNGA 3Q4CA 1R3CA 3B2WA 1O6KA 2Q0NA 3W2OA 1OVEA 2QU6A 1QMZA 4YNOA 4O27B 4AQCA 1H01A 3NNWA 3KRJA 4G9RA 3RKBA 3SVVA 4W8EA 5GHVA 4IWPA 5HO8A 2XIRA 3CGOA 3RNIA 3HECA 3RMFA 4P2KA 2O0UA 5AR5A 4GL9A 2YCSA 4HCUA 3OFMA 4WBOA 1QCFA 4YGAA 5TR6A 5FBOA 2VTNA 2GTNA 2JEDA 3VHKA 2C69A 4PTGA 5CWZA 2ZDUA 3BLQA 5IDNA 3FSKA 4F70A 1GIIA 4PPCA 3DBCA 3GU6A 4C34A 4FSUA 4GV1A 4EYJA 4CG9A 4QP6A 2RFSA 4AN3A 4JAJA 5IQEA 5CF6A 4ITIA 1YDTE 3IQ7A 2Z7RA 4LMUA 1FMOE 5IG1A 4EORA 5HESA 5A54A 3GBZA 1XBBA 4XG6A 2AC3A 5JZNA 4EQMA 2XK6A 2IZUA 3HV4A 4L43A 4NCTC 2Y6OA 2DWBA 4K33A 2VNYA 4MXXA 4A4LA 2O5KA 5AA8A 1G8AA 3F5GA 3KRLA 5G1XA 4FKPA 3S3IA 4F0GA 1Y6BA 4K0YA 5CU0A 5L4QA 5AAFA 4F63A 2QO9A 4CKRA 5DR6A 2PVYA 2Q83A 3AC2A 1OIQA 2R5TA 3NX8A 4IZAA 1Q99A 3VS6A 4YZ9A 4ANSA 4DAWA 5LOHA 4G3FA 1ZARA 3I1AA 3WE4A 2ITQA 4NM0A 3O7LD 3LCSA 2QOKA 1F3MC 2W7XA 1Q24A 3E5AA 3KKVA 2YIYA 5LVMA 3QHRA 1M2RA 5AR3A 2R3KA 4LG4A 2WNTA 4FSNA 4OT5A 2VUWA 4RX7A 3FC1X 4J52A 2R3GA 3R1YA 4ZTHA 4EOQA 1K2PA 2HOGA 2H34A 3MB7A 3KRWA 1KE7A 3NSZA 3PRIA 2RL5A 4W4YA 3WE8A 3HLLA 3L9MA 4MD7E 4LGGA 5IZFA 4NCTA 4K18A 4KINA 5CAQA 4F08A 2PUIA 4P90A 2Y4IB 3NW7A 3UODA 5HIEA 2BAJA 3RINA 4D5KA 2VGPA 3F66A 3M42A 4OUCA 3V8SA 4CTBA 4DH8A 1XR1A 4HYUA 3QCSA 5ANOA 3ZZEA 4QP2A 2GMXA 5CAVA 2VTSA 5EM6A 5CEKA 5M08A 4PQNA 4QMOA 2OO8X 5DIAA 4IWOA 4QQCA 3Q32A 2XK9A 4BGHA 5CU4A 1L8TA 4DF3A 4C3RA 3E93A 2Z60A 3FMMA 3IW8A 4F64A 3VF9A 3PVGA 2VO7A 3LAUA 4P4CA 3ORNA 4GU9A 4XLIA 4M8TA 4X6QC 5ETAA 3ZM4A 4BTFA 2VTHA 4J98A 4M66A 4JNWA 3R9NA 5L2SA 4V05A 5HU9A 1E1VA 2EXMA 5E8XA 2VAGA 2WTWA 3R8UA 5C03A 3TI1A 3S95A 5KMJA 1YXUA 1B6CB 3QLFA 4OTWA 2W4JA 5DVRA 4PMTA 2ZM4A 3BV2A 3UOJA 3R7GA 2W1ZA 3RWQA 4BZNA 3V6SA 4U80A 4YTFA 4QMWA 1IG1A 3LMIA 4O81A 3MA6A 2QLQA 2JKKA 2ZV9A 4NW6A 5EG3A 5FGKA 4ZLOA 2XEYA 4QTAA 4RC4A 1JSUA 3EN5A 4TNBA 5DT4A 2E2BA 2PZ5A 4USFA 1LUFA 5AA9A 5AUTA 4UXLA 3LLTA 4R5SA 3LXLA 4ZP5A 2R3MA 4QYEA 3W2RA 2JIUA 4F9AA 4NEUA 2F57A 3OCBA 4GKIA 4LOOA 3NYOA 5ANJA 3LLAA 3DK3A 3VRZA 5AP7A 4DLIA 2JITA 3ZYAA 4Z55A 3CY3A 2GTMA 3RPYA 3LFFA 2OJIA 4C7TA 1WVWA 2P33A 4U40A 4YJNA 3EFWA 4HZRA 4TYEA 3PJCA 3D15A 4XJ0A 5EDQA 4EONA 2ITVA 3BYUA 4AZWA 3WF5A 4JAIA 1VZOA 1H1PA 1WZYA 3WYYA 5EW8A 3R0TA 1P4OA 3KXNA 4GMYA 2Z7LA 5AAEA 4O7ZA 3V3VA 1OL2A 5ANDA 4RMZA 1BL7A 2WTVA 3QLGA 1XBAA 4YLKA 3ZH8A 4DH5A 2QI8A 3NEWA 3F5PA 2R3HA 4ONAA 2CNUA 1Z9XA 1YW2A 4MD9E 5LMKC 2HENA 4CRLA 2H96A 4PTCA 3PWDA 4ACDA 2VU3A 4GUBA 3EFJA 3IONA 3E7OA 3RTPA 2PVRA 4M3QA 4RA4A 1ZY5A 3BBTB 3QKLA 3D2IA 2PYWA 2ZVAA 1WBSA 2QHNA 4BRXA 3KRXA 4GUEA 1ZYSA 3A61A 4IQ6A 4MH7A 2WMWA 5FWKK 2A27A 4O96A 1B38A 3KC3A 3CSVA 4HGEA 3CBLA 3H9FA 4V0GB 5EHOA 5L2WA 1UVRA 3QAME 2LGCA 3ZLSA 2XZSA 1SVHA 2E9PA 3OWKA 2B9FA 3DFAA 2BRMA 1M7NA 3G33A 3U54A 2PUUA 5KMIA 5GIOE 4D2PA 4PDYA 1VYWA 1YHVA 3DDPA 4IANA 4AGCA 1TKIA 1HOWA 2NPQA 3MPMA 5M07A 3O50A 1REJA 5DGZA 3TZ9A 5CEMA 3LXPA 5LMKA 2OF4A 4YPSA 4ZSEA 2HCKA 1WAKA 1YKRA 5IMXA 2YEXA 4H3BA 1PXLA 3UJGA 3HGKA 1UWHA 1OMWA 2VO3A 5H8BA 1O6LA 3F9NA 3VNTA 2J0LA 2X1NA 2XRUA 3IOPA 3JS2A 3CC6A 4W9XA 1FVVA 3JVRA 4QTDA 2C6DA 3PPZA 4I0SA 1IASA 4R1VA 3VUGA 4ZS4A 1ZXEA 2J0JA 4EOKA 3LFDA 1X8BA 5IH5A 4HCVA 4LOPA 2RFDA 2W5BA 2R9SA 5HBJA 2UW5A 5FDXA 5F20A 5ETFA 4WHZA 1H07A 4H1MA 4FVPA 4OBPA 4GIIA 3HL7A 5FRIA 3E3PA 3GP0A 2OLCA 2WMRA 3OCGA 4QPSA 1O6YA 5HQ0A 5E1SA 2G2IA 5IEVA 2HELA 3MGYA 3ORIA 5AMNA 4RLLA 3KK9A 4ZLZA 4XNEA 5A9UA 4QP1A 4CV8A 2ETRA 3UTOA 3O2MA 4NUSA 5JKGA 4F6UA 4ZTMA 3IDCA 3BQRA 1H1WA 4X0MA 5HE3A 4EOOA 4MAOA 3BHTA 4JIAA 3EH9A 3FLNC 3GCSA 5H2UA 4CMOA 1DI8A 2B55A 3IGGA 2BUJA 3PE2A 2XF0A 4BYJA 2IWIA 3D0EA 4YC3A 3QF9A 5CAOA 3C5UA 1GZ8A 3PXKA 5KE0A 4EOSA 2C4GA 3O8TA 4DH3A 3QCYA 5IEXA 2XBJA 4I20A 4U3ZA 3B8QA 5ICPA 2WPAA 1OL5A 5CSPA 1Q8UA 5JRSA 5HBHA 3NCGA 3PIYA 4YBKA 5EM7A 3TG1A 2BTRA 2OIBA 1ZYJA 4XG3A 4FNZA 3VS5A 4FMQA 3SRVA 4YTCA 2ERKA 1BKXA 4O0SA 2YA9A 4TYIA 5CT7A 4DEBA 5J5TA 4TZRA 3KL8A 4XYFA 1IRKA 3KF7A 2PPQA 4KABA 1JNKA 2IN6A 4IH8A 3L9NA 2WTCA 4PL5A 4ZJJA 4FIJA 4ERKA 4A06A 4FIFA 2BFYA 2BZIB 2HZ4A 1Q97A 3M2WA 5DHJA 4X3FC 4QPMA 3UOKA 4JR3A 3KQ7A 1ZMWA 1SZMA 2QD9A 4H58A 1UNHA 4G6LA 4FTNA 3P5KA 4FF8A 3MYGA 2WMUA 3PXQA 1CMKE 5DEWA 1YQJA 2QU5A 3LM5A 3AD4A 3GQIA 2YWPA 4I0TA 3O23A 3F5UA 2XIYA 3RP9A 3PJ8A 4JL9A 3BGQA 3W18A 1WMKA 5KUPA 1XO2B 1Q8TA 1A06A 3DB6A 4CKJA 5DBXA 3QD4A 3R22A 4A9UA 3TN8A 3E3BX 3W55A 3OZ6A 1XH7A 3QTWA 1P14A 5L6WL 3R2BA 3PYYA 3NR9A 3VUKA 3W2CA 1PMNA 4CRSA 5F94A 4AXAA 3ERKA 5JQ5A 3P79A 3ACJA 3FLZA 3QUEA 1W84A 2C3IB 2W9FB 3P1AA 4MXZA 3ZEPA 5LVOA 4X3FA 3MFRA 3CCNA 3CGFA 4FV6A 4P5QA 4MWIA 1SVEA 2H9VA 5JFSA 4RC3A 3CD3A 3JVSA 5EYCA 4BDFA 4A7CA 2E9VA 1H1SA 4JG6A 3V51A 1H24A 4FUYA 4CFNA 4EHVA 3SGCA 4MK0A 2VN9A 3FLQA 5AUYA 5IA2A 4JG8A 3RJCA 4UYAA 4ZIMA 4U6RA 5CSWA 2UZWE 4FR4A 2X81A 3NIEA 1GAGA 4XS2A 4S34A 1REKA 4Y83A 4Y95A 3GOPA 5AX9A 3Q96A 5B0XA 3UYSA 4BZDA 5IH6A 1Q3DA 5AV1A 3TTJA 3QQHA 4FZAB 2VNWA 2YZAA 5AIRA 3O8PA 4U41A 5CXHA 2G1TA 2X8DA 3DNDA 4RSSA 2X7OA 2O3PA 2PUNA 3U6IA 1XKKA 3QRKA 3NAYA 2XK4A 1OBDA 2WMVA 3PTGA 3OY1A 1PXIA 5CALA 5IU2A 4BY9E 3FXZA 3CQUA 4YJSA 3PDTA 4RT7A 3M1SA 2ITZA 4ANLA 4EOIA 2B4SB 1ZOEA 2HZIA 2VX1A 4HVDA 4FV0A 2WB8A 3S1HA 2OJFE 3MTLA 4O0UA 1OKVA 1PMEA 2ERZE 2IW6A 3EFLA 4HJOA 4NFNA 1OECA 3C51A 5EDRA 4ZTSA 4BDHA 4C4GA 5IISA 1R78A 4E5WA 3A4OX 3FKLA 1UWJA 2ITUA 3BHUA 4PDOA 3DNEA 4U44A 3QFVA 3UIXA 3MH1A 5DYJA 5LVNA 4G3CA 4CMUA 5ACKA 4FZDB 3VS1A 4F9BA 2YABA 3TZ7A 5DR9A 5FLFA 4TYHB 4FTKA 3EN9A 4GVJA 4F9CA 5ANKA 3C9WA 2DS1A 3FMJA 2W96B 5AR2A 1SNXA 2HW6A 3TV6A 4E1ZA 2WHBA 3QRUA 4EHEA 4XG8A 1KV2A 1H4LA 4QP9A 1ATPE 2WIHA 3QX2A 4M69A 4H3QA 5AP4A 3V5TA 4EH3A 5CVFA 5DMZA 3PE1A 4M84A 5A14A 3ANRA 3PJ2A 4OTIA 5L6PA 3PP0A 2ZV2A 4DE4A 4BDKA 1E1XA 4H1JA 2VX0A 3CIKA 3G9NA 3CTHA 4IWQA 3MB6A 3UVPA 2OWBA 4BCJA 3ZO1A 1YWNA 1JSTA 4JBPA 3VQHA 3MI9A 5IQDA 3ZLXA 4NIFB 5IA0A 1WBNA 4ANBA 4FK3A 4BCNA 4II5A 4FIEA 4CFMA 4EK4A 4F1TA 5IQFA 5A4CA 4UB7A 3QTQA 3BV3A 3V5LA 4H05A 4IVDA 5JFXA 3QKMA 3UVRA 3ETAA 2W1FA 1PKDA 3WZDA 5BVFA 4OAVB 2CLQA 2I1MA 2O64A 3KXMA 4ASEA 4D9TA 4DINA 2QURA 3QHWA 1KUTA 3P9JA 3TKHA 1KE8A 4DYMA 3BU6A 5E8SA 3OOMA 3COHA 4IAIA 4PP9A 1PYEA 4D0WA 4KS7A 2Z7SA 3F3VA 4ORKA 2PMNX 4ZOGA 5J9YA 4IAZA 3RWPA 4AOJA 3ZC5A 3BHVA 4IAYA 4UMTA 3K54A 3R73A 3KN6A 4I6BA 1NXKA 1OITA 4FG8A 3LFCA 3Q52A 2HWOA 2BVAA 4JQ8A 2XH5A 4YTHA 4O7YA 2QR7A 4TNDA 3R7EA 3E92A 4TY1A 4IM0A 2R3OA 4BGGA 4KKEA 4C8BA 3DAEA 3NVKI 2GNIA 1H00A 3TNWA 4FL2A 5B2KA 3U9CA 3D4QA 2QOIA 4FKOA 1RQQA 4LQMA 2GS6A 4DC2A 4AE6A 4C59A 3BGZA 2BTSA 2YJSA 4MWHA 3QA8A 2PVNA 1YRPA 2WEVA 3A8WA 3UZTA 2WOTA 3KB7A 2OZAB 5AUUA 4J95A 2ETMA 4DA5A 2JLDA 3E8EA 1OGUA 2PUPA 3MJ1A 2EB2A 3CKXA 3RHXA 2XKDA 1J7IA 4BDEA 2HZNA 2OFVA 1P2AA 4Y73A 3EB0A 4RIWA 5K4JA 1Y6AA 3FJQE 3QQUA 1FQ1B 1SVGA 1ZMVA 4YJTA 4BBMA 4DG3E 2BZHB 1KWPA 3LPBA 4DBXA 3SOCA 5DRBA 4KBAA 4EOJA 2SRCA 5M57A 3FMEA 2HIWA 4FV4A 3MY5A 5HHWA 4DEGA 2VWIA 4L67A 5EYMA 3DBQA 4FV5A 4G16A 4I6QA 4JLCA 4N6ZA 1XH5A 5KMOA 5CEOA 5I9UA 3HUBA 3ITZA 4RJ8A 2DQ7X 2QOHA 3GEQA 4EKLA 3RAWA 1G5SA 3EOCA 3PA4A 4FT9A 2V22A 4IB1A 1E9HA 5EI8A 1FGIA 2GHLA 4L6QA 4FL3A 2YM7A 1IA9A 4RX9A 3PA5A 4MBIA 3DLSA 1YWVA 2UZDA 5D9HA 4BBFA 5ITAA 5LXMA 2XRWA 4EJNA 4F6SA 5D12A 3TKIA 3QTZA 3RM7A 1MRYA 1JKSA 5JFWA 1BUHA 2XM9A 3AT4A 4BHNA 3EQIA 3EJ1A 3PXYA 3D7ZA 4AZFA 5CQUA 2J4ZA 2C68A 3I0QA 3OTUA 3BU3A 4YJVA 3UQCA 5DNRA 4J99A 3C5IA 3A2CA 4E4XA 2C5VA 2HAKA 3T9TA 2P0CA 5B2MA 3N4TA 5CEQA 3POZA 3EQCA 1KSWA 4IW0A 4NM5A 4I5HA 5KO1A 3KCKA 3LFSA 4C36A 3G0EA 4YC8A 3PVBA 3WZJA 3R8ZA 3OEZA 5C4LA 4RJ6A 5LMAA 4B9DA 4XX9A 2FUMA 4BWKA 5FQDC 4E7WA 5L3AA 3U6HA 3BX5A 5AP6A 3MH2A 4YJPA 4FNXA 3A60A 2OG8A 3C4CA 4G9CA 2JD5A 4WNKA 3Q4TA 4M7IA 3UQFA 2PE1A 3VUTA 3NUXA 4EUTA 4ACHA 3Q5IA 4YSJA 4O7WA 5ACBC 4PMPA 3GVUA 3RVGA 3WF9A 1URCA 5L8JA 4YMJA 4JI9A 4F4PA 4TN6A 3OBJA 4FKWA 4MNEA 5IPJA 3LM0A 5FXRA 1I44A 3R1SA 3TUBA 4RWKA 5JFVA 3DTWA 3WZEA 2PZPA 1F5QA 2R3QA 3U9NA 2IVTA 1VYZA 2XMYA 1BLXA 2ZYBA 4IAFA 2XKFA 3KULA 1YI3A 2ZJWA 3KVXA 1YDSE 3QYZA 4XOZA 3ZBFA 4BGQA 4E5AX 1MUOA 5AUXA 3UOHA 3LE6A 3UP7A 4XV2A 2C1AA 4O0YA 3QA0A 4IX5A 4O1PA 2KULA 1GY3A 5I0BA 2ZMCA 5GJFA 2OSCA 3H0ZA 3PG3A 5TKDA 3Q04A 4FI1A 4BDGA 1OBGA 4RJ5A 3TXOA 5F1ZA 4BI1A 5K3YA 4IX4A 5JGAA 3ZC6A 3HZTA 1Y91A 3DV3A 4MXCA 4XLVA 1BI7A 1XQZA 5HX6A 4YBJA 3UO6A 3LZBA 3PZEA 3HV6A 5CANA 5B7VA 1EH4A 3CQEA 3R6XA 3EKKA 3CPBA 5AWMA 4UZDA 4GT4A 5A4TA 5L8LA 5KHWA 4XP0A 4FSZA 4OTHA 1BL6A 2OBJA 4FTTA 2B52A 4G6OA 4RQKA 5EI6A 5FTQA 4LUEA 2EXCX 4PUZA 5AFVA 3OTVA 2VTOA 3MBLA 3LFAA 5AM7A 2JDVA 4EWHA 5HCZA 5LWMA 2FSMX 4W4XA 5IUHA 3UZRA 3V6RA 3ZO2A 2YCRA 3OXZA 4CQGA 2X6DA 2GNHA 5HD4A 3DK6A 3RCJA 2PU8A 3KREA 3F2NA 3SAYA 3DT1A 3MV5A 4G3DA 3DTCA 4QMQA 4WUNA 1SM2A 5BYYA 4XHKB 4S30A 4K8AA 2B0QA 1GZNA 2Y4PA 3UZPA 3OWJA 4ZAUA 1W83A 3PVUA 4KKGA 4RGJA 4G17A 2BRBA 4FK6A 4JXFA 3ZTXA 4C62A 5KZIA 4LL5A 1YXXA 3EL8A 4DTBA 4OTFA 2B9HA 3C4FA 3VRYA 4OR5A 3OW3A 4QP8A 4S32A 1Z5MA 4IWDA 2C3LA 2C0TA 4ZSJA 2W9ZB 1OUKA 4BIBA 5C8NA 3FLWA 4IHPA 4D2RA 4KSPA 3Q9YA 2YIQA 4WIHA 4FGRA 3WI6A 4YJOA 3R7VA 4E4NA 5BVOA 3RPRA 4ANNA 2PMLX 3C4ZA 2WTDA 2BMCA 4HGTA 3W8LA 2VTTA 2GHMA 4RJ4A 4FSQA 4X3JA 3QQLA 2OF2A 3IDBA 4AA5A 4GT3A 2EU9A 2R64A 1FMKA 4A9RA 4I92A 3E7VA 3DGKA 2DYLA 3UG2A
chains in the Genus database with same CATH superfamily
2J0IA 3KU2A 3O8UA 2PY3A 1AQ1A 3FMHA 3HV7A 3QD0A 4YJQA 3GCVA 3JPVA 3P7CA 3NNUA 3CJFA 5K5NA 5IQCA 4ANOA 5AUWA 3V5JA 3PXRA 4NH1A 4WT6A 2V5QA 3QC4A 1J1BA 2YDJA 3DBDA 4MXOA 3I60A 4QMYA 1QPEA 5I9XA 1JPAA 2P2HA 2QONA 4E6QA 4BCOA 2YM8A 2GPHA 3ENMA 3BYVA 2GHGA 4TYJA 2JIVA 4O82A 2OJ9A 2XNPA 3HUCA 3ELJA 4DH1A 4UALA 3RZFA 4FTUA 3UO4A 1UU3A 4DEHA 5FTOA 3LFQA 2XNMA 1UV5A 3ZUVA 4JBOA 2XEZA 3T3VA 4O22A 4FGBA 3U87A 3ULZA 2C6TA 4RZVA 2JGZA 2A2AA 3HMOA 4U79A 2FGIA 3QGWA 2UZNA 4C3PA 4M15A 3ORPA 3SLSA 4OT6A 5K9IA 3HDNA 3MPTA 4CLIA 4U42A 1Q4LA 2UZOA 5HNBA 4L45A 4R6VA 3U6JA 3R9DA 1GIJA 1UU8A 3ODZX 4PWNA 3TNPC 3CTJA 4R78A 4IXPA 5AP1A 2WTJA 2V0DA 4O7SA 4QMPA 4U0IA 1YVJA 2R3NA 3PUPA 1PY5A 4NM3A 1J7LA 2F7XE 4B0GA 4EYMA 3UDBA 3QC9A 4IFGA 2X0PA 3RZBA 4EUUA 4GW8A 4RBLA 5M56A 3DXNA 2UVZA 3RK9A 4ALWA 2CGUA 2QVSE 5M44A 3ATTA 3UOLA 2PVLA 4BTJA 3FWQA 3D7TB 3QYWA 4FG9A 4MUQA 3LHJA 2ZB1A 4FV3A 1OB3A 2NRYA 4Q5HA 2A0CX 1OM1A 2EVAA 4BCIA 4FOCA 5L2IA 2VWUA 3ZRMA 3R71A 4FT7A 3IGOA 3UQGA 4ZJIA 2EWAA 4RWLA 3R00A 3T9IA 4ANQA 1FOTA 4NKAA 3UMWA 4DFXE 3AC8A 3HVCA 5JH6A 3Q9ZA 2CN5A 2BHEA 2A98A 2C1BA 4ID7A 4FTJA 3EYHA 4PNIA 4UEUA 5G6VA 2F2CB 3GCUA 3R8PA 3DAJA 2Y4IC 4G2FA 3BYSA 5T3QA 2XA4A 3LQ5A 3ZONA 5IH4A 3ATSA 5KHXA 2VTMA 4DTKA 2FA2A 4ZK5A 2REIA 4RQVA 5BVWA 3DJ6A 5FEQA 5HTBA 1OPKA 1H1RA 1ZZLA 3VBWA 4O0WA 4JR7A 1JOWB 2A1AB 3D5WA 3C1XA 3GFWA 2WELA 4CFWA 3D83A 5A46A 4QO9A 3BWJA 2QOLA 1B39A 5DPVA 2W06A 3KXXA 4ZZMA 4FTCA 3D5UA 5HCXA 4W9WA 5BMMA 2W1IA 2WAJA 4L7FA 4XUFA 4LUDA 4IM3A 4RJ3A 4D55A 3NUSA 4D4VA 5KCVA 2ESMA 3UIBA 3KMUA 3PLSA 5GZAA 2RSVA 4DCEA 2XBAA 2XUUA 2XYUA 3NLBA 2W1CA 3SHEA 1J3HA 2AEGA 2VX3A 1H28A 4ZZOA 2QQ7A 3BRBA 1NVRA 3GC0A 2BZJA 2UV2A 2W4KA 3LCOA 4OGRA 3AXWA 4DFUA 3H30A 4YR8A 5I9ZA 2ZV7A 2R4BA 3G15A 4L52A 3GU4A 2W05A 1VEBA 3E8DA 2UW0A 3IS5A 2ZB0A 3HV5A 3NMUF 3LOKA 1ZZ2A 5C27A 4MKCA 3DFCB 3UP2A 3KIOC 2ZV8A 2IO6A 2OXXA 3FMLA 4LOQA 4DEDA 4IC7A 2IJMA 1M14A 2NP8A 4QMVA 3PP1A 5AR7A 3ZXTA 5FXSA 2B54A 2PVFA 3FL4A 3RNYA 4E8AA 4BVUA 5JRQA 3FYJX 4CV9A 4OTPA 4ZSAA 4CCBA 5C4KA 3P86A 4ZY4A 3ENHA 2Y6MA 3ANQA 5TOZA 4BWPA 4PTEA 4AU8A 3BIZA 4I0RA 3VUHA 4S2ZA 3W0NA 4NJ3A 4Z16A 1SNUA 3W33A 4BB4A 4JIKA 4MQ2A 4ASXA 4TWCA 2J90A 2XJ1A 1UKIA 3EHAA 4K77A 5H8GA 4BFMA 3AKKA 2HY81 2OXYA 3NUYA 4F9YA 3QZHA 4O84A 2VTPA 1P5EA 3I81A 4U8ZA 5T68A 4DHJA 4AT5A 3TDVA 3CS9A 5IEYA 3L8SA 4ZEGA 4FTAA 4R5YA 3QD2B 1KE9A 5GZ9A 4N0SA 1APME 3FMNA 3G90X 3MIYA 4L3LA 1PXOA 5LARA 3BLRA 2WQOA 3I5NA 4RFZA 4QYGA 3UG1A 4DGOA 2YM5A 3F3TA 2J50A 3EWHA 4AFJA 2YHVA 2P4IA 2GNLA 3DKCA 5DT3A 3W1FA 4WA9A 3TL8A 3UIUA 3ZDUA 4BHZA 3D5VA 1OIUA 4EK5A 1AD5A 4WKQA 2X0OA 4IZYA 3QQKA 3PA3A 4RIXB 3QZFA 4DG0E 4L01A 4MNFA 3FKOA 4ANMA 5D11A 3QTIA 4QYFA 4L7SA 1J91A 3TCPA 4I6FA 1T46A 3TACA 3T8OA 1H26A 4GS6A 3G2FA 2YAAA 1JQHA 4QMZA 3MFUA 4GK3A 4OW8A 2I0HA 2XCKA 3NYXA 4DITA 3I6WA 3NGAA 4FNWA 4JDJA 2VWBA 1PXJA 4AS0A 4F0IA 1OZ1A 3ODYX 1FINA 5J8IA 2F7EE 2JC6A 4QQTA 1CKJA 1LR4A 4QNYA 3EFKA 4IC8A 3C4XA 4JS8A 4QYYA 5J7BA 4O83A 4KB8A 4C4FA 3G6HA 3P7BA 1Y8YA 4AW1A 3I7BA 3C0HA 3W16A 2RGPA 4RZWA 4ZZNA 3R8VA 1FPUA 3FKNA 3HP5A 2XIZA 4KA3A 4MD8E 3W10A 4NT4A 2EB3A 4FEUA 3GFEA 3QRTA 5CEPA 3L8VA 4D58A 4V0GA 4IAAA 4D0XA 1H1QA 2HW7A 4L00A 3TNQB 5BMSA 2ETKA 2BR1A 4QNAA 2F4JA 1PXNA 3SXSA 3GI3A 2G2FA 4QTBA 3FMKA 4AACA 3NYNA 3IW4A 3HAMA 3MJ2A 3ROYA 3D9VA 2X7GA 2WO6A 2ITPA 2YM3A 3ORKA 1H0VA 2YIWA 3EIDA 3F3UA 4GVAA 4MBJA 3S2PA 1G3NA 3ZEWA 4BCKA 3D2KA 5HG8A 3VAPA 4C38A 2HY0A 4RVMA 3NNXA 3TV4A 4AXCA 4WRGA 5BUEA 2ITOA 5C26A 2VV9A 4AQKA 5AV0A 3F6XA 4ASZA 3QZGA 1PF8A 4XG4A 5FP5A 3R9RA 3MVHA 4IB0A 5L2TA 4K1BA 4AOTA 4JJRA 4WUAA 4EK8A 4FKGA 2O2UA 3UVQA 5GNKA 4YZNA 3F3ZA 3Q6UA 5CZHA 1H27A 4YHJA 3MY0A 3N4UA 2OFUA 3FQHA 3NIZA 2G15A 4TRLA 4D2VA 2FSOX 3HAVA 1XH9A 1XHAA 3ZO3A 4BCMA 4JDHA 4CKIA 4QEBA 4JT3A 3EQFA 3FI2A 5JMSA 2QC6A 4XMOA 4CD0A 3CR0A 1DM2A 3FZSA 1H0WA 2X0QA 3PPKA 4K6ZA 4BF2A 1TQMA 5KMKA 5HO7A 2YIXA 3FI3A 2WMQA 2UZTA 4CSVA 3VONA 5TE0A 1JKTA 3EN6A 5CEIA 4DH7A 2IG7A 4KAOA 1RJBA 2WMXA 1T45A 3CP9A 3RALA 3VBYA 3I7CA 2HWPA 4FE2A 4K9YA 2X2KA 4XBRA 4EL9A 1VJYA 4RWIA 2XNOA 5IF1A 4RVLA 4RX8A 3G6GA 4KIPA 1OKWA 3RAKA 4E20A 4E3CA 3LCKA 4A9SA 3THBA 5F95A 3U4UA 2VWYA 2WGJA 3FSFA 3QTXA 2CMWA 1NT2A 1MQBA 4LGHA 2ZMDA 4WG4A 4PRJA 5E8WA 4KIKB 4ACMA 3D94A 4FT0A 5I5ZA 4I22A 1BI8A 2C3JA 5BYLA 3GOKA 4FSWA 5ANEA 3PFQA 4L8MA 5HLNA 1XJDA 3PPJA 2QOOA 4AN2A 3DKFA 4NFMA 1WFCA 1UNGA 4AA4A 2BZKB 4TYGA 4K2RA 4E6AA 3FY0A 3OW4A 4QMMA 4YTIA 3EMGA 4YURA 4NM7A 4GH2A 4GRBA 4IVAA 3VQUA 3AT2A 3DZOA 4EBVA 3TUDA 5LVLA 4KS8A 2YM4A 3OUNB 2E9OA 4BN1A 2P2IA 2WEIA 4LRKA 4WSYA 3I6UA 4PDPA 3ZBXA 4QDEA 5IQAA 3TM0A 4ZSGA 4BWXA 3OHTA 4FKUA 3R30A 4W4VA 3EQPA 2QOBA 2YWVA 4L9IA 4ZTNA 4JRNA 3Q2MA 2RIOA 4FSMA 4FT3A 5AP5A 4C4HA 4CZTA 1Q8WA 3S4QA 3W2PA 2GDOA 3DBEA 4U9AA 4UBAA 3GQLA 4JVGA 3FE3A 2BDJA 5EYDA 1H25A 1YHWA 1IEPA 2QLUA 1YI6A 4DFNA 5HVYA 2UW3A 3GNIB 4BCHA 4D28A 3MS9A 1NW1A 3IW7A 3UDTA 4J97A 4L53A 3A7GA 3PZHA 1ZYCA 2FO0A 3FUPA 3C4EA 3FXWA 4APPA 4FKVA 3GU8A 3WF7A 3R9HA 3K5UA 2BRGA 4J96A 4AXFA 2DUVA 4WNOA 1L3RE 1YWRA 1SYKA 5KKRB 2XARA 5AM6A 5K0XA 2JFMA 2ONLC 1UNLA 4ERWA 2ZFYA 3LQ3A 3RPOA 2Z2WA 1LPUA 3QZIA 3ZSIA 5BUIA 4YNEA 2CKPA 1GZOA 2G9XA 3PY1A 3Q4ZA 3TV7A 5CTPA 3VUDA 4YO4A 5TF9A 4YUQA 5J9ZA 4OBQA 5JQ8A 1IAHA 1KOAA 1PKGA 3PY3A 3R01A 4MF0A 3P7AA 2X0GA 3VWAA 3I5ZA 4EWQA 5E9EA 1W7HA 3BI6A 5CSHA 1V1KA 2ACXA 3SD0A 5HLWA 4L42A 4FC0A 4I41A 4GFOA 5E91A 4FV2A 3NS9A 1ZYLA 3OWPA 4Z7GA 3FAAA 4YU2A 1PMVA 5FP6A 2RF9A 3FQSA 3KY2A 5CXZA 3WOWA 2ONLA 4BTMA 2ZOQA 2GQGA 2WTKB 3KXGA 5EOBA 4ALVA 2E9NA 3Q2JA 3PY0A 5E8UA 1NVQA 4ENXA 2WU6A 2UW6A 4I5MA 3UMXA 3K2LA 3OVVA 5K5XA 4PPBA 3PWYA 2W1DA 2IF8A 3F5XA 4CLJA 4G3EA 3D5XA 2EUFB 3KF4A 4FX3A 1GJOA 1R0PA 2XJ2A 2C6IA 4G34A 3PJ1A 4MEDA 5EFQA 2WMBA 5EQEA 2C6LA 3IG7A 3MW1A 4MF1A 3UO5A 4O4EA 3K5VA 4AZTA 4Z7HA 4ZTQA 3W0MA 5JN2A 3W8QA 2QOFA 3E87A 1VR2A 2WMTA 2VWXA 2YN8A 3QRJA 4R7BA 3S00A 3WBLA 1ZYDA 4NTSA 2WTIA 3JY0A 4RIYB 4LYNA 3REPA 2C0IA 3H10A 2OGVA 4DFLA 5FTGA 3V5PA 3CTQA 4TYHA 1Z57A 3KA0A 4FOBA 3C0GA 3N4VA 4L68A 4I1ZA 2EXEA 2W1GA 5FUTA 4IJPA 4FVQA 2VGOA 3AC3A 5IA5A 1CM8A 2V7AA 3ZFXA 3F7WA 1HCKA 3OBGA 4GK4A 4GJ3A 3NZ0A 1NVSA 2A4LA 4D1ZA 4F09A 2X6EA 3DA6A 2I6LA 2BALA 4YLJA 3U8WA 4E73A 2XYNA 4EZ3A 4ITJA 4IJ9A 2C6MA 3FZ1A 4NIFA 2QNJA 1OKZA 3ACKA 2XAOA 4F65A 2V62A 4WBBB 3TEIA 2UW4A 2GS2A 4WNPA 1Y8GA 3B8RA 3H9RA 4GCJA 5HE2A 3QXOA 3HRBA 2RG6A 3HV3A 2E9UA 4O38A 5CI6A 3UNKA 1U59A 3CD8A 4BR3A 4KWPA 3VBXA 2OIQA 4GEOA 2IW8A 3VBQA 3VHEA 4ASDA 4FZFB 4EQCA 4O4DA 2W1EA 2O65A 3IK3A 2UZVA 3ALOA 5E92A 4WRSA 4FTLA 4AZEA 4X6RA 2XM8A 4L3JA 3VS4A 2RG5A 4MBLA 3L8PA 4YP8A 4QMLA 3R7YA 5ETCA 5CF5A 5EOLA 3V5QA 5LJJA 4XRLA 4USDA 4TW9A 3M11A 1Q62A 4XP2A 5LMBA 3ZU7A 1TZDA 2OJJA 5FDPA 3ZCLA 1A48A 4R7IA 4FA2A 3O71A 1YXSA 3QWKA 4OTGA 4F7NA 3NYVA 3KMWA 1GZKA 2WQNA 2X9FA 5EI2A 1CKIA 4N4SA 2VRXA 4UN0C 4JQEA 2P55A 1ZAOA 3LJ1A 5CY3A 3BCEA 3TJCA 3GU5A 4H3PA 4YHTA 4B8MA 5I9WA 2W99B 5HI2A 3PFYA 3DLZA 3W0QA 4C37A 1JLUE 3B2TA 1JWHA 4TT7A 5IKWA 3LKMA 3FQEA 2GNGA 4FZ6A 4IB3A 4XV3A 5A6OA 5J9LA 3BBWA 4JOAA 1U54B 2C0OA 3SW7A 4IB5A 3ORTA 3BLAA 1JKKA 3GGFA 4L3PA 3BWFA 5J1WA 2FH9A 2OZAA 5K4IA 3V5WA 5DR2A 4BDDA 4NW5A 3FEGA 3K3IA 4NYEA 2JFLA 5ANGA 1V0BA 1QPJA 1PXPA 4BCPA 3GC9A 5CI7A 1HCLA 3ORZA 3VJOA 3W0PA 3MY1A 3FPQA 5EH0A 1FBNA 3DKGA 4WSQA 4O7VA 4XRJA 2XS0A 5J87A 1CSNA 4MVFA 5A3XA 4O0XA 2XKCA 2V55A 3KCFA 2VWWA 3PSCA 2XB7A 2YERA 3E63A 3OD6X 5I9VA 4F0FA 1A9UA 4IE9A 4PY1A 3F88A 4Q2AA 3V8WA 4HPTE 3SG8A 3F61A 1WVYA 2IEWA 5CVHA 5BNJA 4DEIA 3D14A 2I40A 3EL7A 2YCQA 3LIJA 1G8SA 4CG8A 1Q41A 2YJRA 4BJJA 2ITNA 1U4DA 2NYAA 2A19B 5LWNA 1FVRA 2WMAA 1ZOHA 3OWLA 2C30A 5HU3A 4AN9A 5HZNA 5LVPA 1W0XC 3V04A 5CT0A 3EZRA 2P3GX 2YAKA 3R28A 5AP3A 2OJGA 4BDCA 1LP4A 4YC6A 4EC9A 2W17A 2CSNA 2WKMA 1V0PA 5CAPA 4KBCA 5I4NA 5KMNA 3H3CA 3HRCA 4EKKA 4GFGA 5E7RA 3PXZA 3Q3BA 2UW8A 3KVWA 4DFBA 5F9EA 3FPMA 4FIGA 2WQEA 3HKOA 4O2ZA 4UWCA 4BIEA 4D1XA 4EC8A 2AYPA 2CGWA 5AR4A 3KXZA 4C02A 1F0QA 3FYKX 5M4FA 2CCIA 4MX9A 5J79A 5JGDA 2R3FA 4NSTA 4XEYA 3DBFA 4XV9A 5FG8A 2VTRA 3FMDA 5D1JA 1RW8A 4FRFA 5CF8A 2PVKA 4RFMA 4Q9ZA 4Q5EA 2YIRA 3JR1A 4NKSA 2CCHA 3ZRKA 5DLSA 3UPZA 3EQDA 5FEDA 3ROCA 3L9LA 3DQXA 5DRDA 3MVMA 4JX3A 5EM5A 3QBNA 4CZYB 3QTRA 5LCJA 5FBNC 2FYSA 3QALE 4EH4A 4XCUA 4IDTA 4UXQA 5FM2A 3HX4A 3WF6A 4BBEA 1OIRA 2VZ6A 3FHRA 5KX8A 5KBQA 5EW9A 4HGLA 4X2KA 3IO7A 3R1NA 3MVJA 3CJGA 4ZLYA 5DE2A 4IMYA 3LCDA 2CKOA 3FZPA 4AOIA 2R0UA 2QOCA 1JBPE 5M4UA 4YZMA 3FLYA 1MRVA 2UZLA 3PLAE 1O9UA 4G3GA 4J8NA 3MFSA 2OU7A 2RFEA 3LFNA 4Y8DA 3OC1A 3VBTA 2X9EA 4BDBA 4FKLA 4IEBA 4QD6A 2C6EA 2WQMA 2ITWA 1OL7A 2GFSA 3HRFA 5C8MA 5CENA 1ND4A 4Y85A 3E88A 4KIQA 4HVGA 5AUVA 2CN8A 2X39A 3Q9WA 4BIDA 4FICA 5GINE 5JK3A 5E8TA 5HG9A 4XH6A 4N6YA 4I4FA 2QKWB 4UMPA 3ORXA 1WBPA 4WG3A 1LEWA 3NNVA 1ZOGA 4ACGA 3PSDA 2J5FA 5IMEA 5E8YA 1PRYA 4OBOA 1XBCA 4LMNA 2QG5A 2OH4A 1PHKA 3BEAA 2PTKA 3ZFYA 2I0VA 2QOQA 2BROA 5DFPA 4AFEA 5CSXA 4XG2A 3GCPA 2OXDA 1QPCA 4PX6A 4ACCA 1ZLTA 4PPAA 4DHZA 3I0OA 4KUJA 3BEGA 3QCXA 4HVHA 1OPJA 4EHZA 1GOLA 3C0IA 4HZSA 1WBOA 4AUAA 5LQFA 4GIHA 2O8YA 3FZRA 4I24A 3V8TA 4H36A 3G0FA 4L44A 1W2CA 4MTAA 3R83A 2J9MA 4C4EA 1KE5A 4TXCA 4IAKA 5ETIA 3RHKA 2J6MA 3RPVA 2LAVA 3RBWA 3VW6A 3ZRLA 2VTJA 1PJKA 4IVBA 4E93A 4CFVA 4OTQA 4AW5A 3DAKA 3DK7A 2Q0BA 3VBVA 1DAWA 2WOUA 2CLXA 4DEAA 2X4FA 1M52A 4BCQA 5JT2A 4JQ7A 4E4MA 4DDIA 4CT2A 3NPCA 5HX8A 4X2FA 3U55A 3ALNA 2OK1A 2XKEA 5CNOA 3Q6WA 4W8DA 5JEBA 5AR8A 3UNZA 4D5HA 2PZIA 4O1OA 4O7LA 4FSTA 3PVWA 5HICA 3UC4A 4TKSA 3WZUA 3AC1A 4E26A 2WMSA 1RDQE 4D2TA 2I0EA 2XK8A 4X21A 3ZFMA 4DFYA 2B7AA 2R3PA 3P23A 2BKKA 3KN5A 4GG7A 4DGMA 4Z3VA 3A7HA 3TDWA 4FNYA 4HGSA 5KMMA 3BPRA 4S33A 3DJ7A 3COMA 3E62A 3LVPA 5JSMA 3VUMA 4O7NA 4EJ7A 1XH4A 4D4SA 1PYXA 4FVRA 2H8HA 3QU0A 4FYNA 4HYSA 4S31A 3ZOSA 4C3FA 4EH7A 4FSRA 4FTOA 5HVJA 3A7FA 4GU6A 3NDMA 3G51A 2OH0E 4O0RA 5CLPA 4YJUA 2W1HA 5HCYA 1OUYA 4TTHB 3SQQA 4R1YA 1I09A 3ORLA 2C5XA 4CXAA 3QQGA 3MESA 4NU1A 4ZY6A 3UE4A 3NWWA 3VJNA 3VUIA 5CF4A 4FODA 5I9YA 3CE3A 2GFCA 4FEQA 3KXHA 5DA3A 3MWUA 5E8VA 5EYKA 5K0KA 4F7LA 1URWA 5LCKA 2YACA 3Q60A 5CU6A 5HOAA 4FIIA 4KRDA 4CEGA 2X4ZA 4I23A 2RFNA 4GG5A 1CKPA 1TQPA 4M14A 3BU5A 5EDPA 3RPSA 4J7BA 4G1WA 4KIOA 4O0VA 4TWPA 3ZUUA 4I4EA 3VS3A 4V04A 4QMTA 3E64A 2R3RA 4CFXA 2B53A 4EH8A 3DB8A 4P5ZA 3ZLWA 2Y0AA 3LQ8A 4QT1A 4RA5A 4C4JA 4CVAA 4IZ7A 4PMSA 2PMIA 4TWOA 4FV7A 3U51A 3DY7A 4RWJA 1G8KA 3O17A 3ZMMA 4BI0A 3A99A 2JKQA 3VO3A 3OUKA 4LI5A 4AGWA 3COKA 5CX9A 1QPDA 3D7TA 1Y57A 4AWIA 1W2DA 2C3KA 4DBNA 2V7OA 2PSQA 2BDWA 5CNNA 5HEZA 3QWJA 2GS7A 5BQ0A 4UWBA 5I3RA 4FKQA 4LDTA 4QOXA 4HYHA 5CU3A 4BDIA 2Z7QA 4WOVA 4AZSA 2C6OA 5E4HA 4QYHA 2OKRA 1H8FA 4CZUA 2XP2A 4GK2A 4DFZE 5KMLA 3AT3A 3CY2A 3ZXZA 2OZOA 5E90A 2BAKA 4RJ7A 2JDSA 3HMNA 2JIIA 3G9LX 4MQ1A 1W82A 3WYXA 5H3QA 5B2LA 2HK5A 4QQ5A 5DH3A 3PSBA 2QO7A 3CLYA 3KGAA 2CNVA 4EH6A 3WIKA 5DG5A 2BKZA 1JKLA 4ZTRA 3ZSHA 5DEYA 4WO5A 3UIMA 2C5YA 4YZBA 3NW5A 2YDKA 3OROA 4TPTA 4XG7A 4IIRA 4DLJA 2PVJA 2R0IA 4LL0A 4GJ2A 3Q9XA 2YZLA 4D1SA 4A4OA 4CCUA 3FBVA 3IDPA 2OICA 1H08A 5IA3A 5HIDA 4X7QA 1OGYA 3WF8A 4RVKA 2BILB 3F3WA 2QO2A 4AW0A 2KTYA 3QX4A 2JAMA 4E6DA 2VO0A 5IQBA 3QXPA 3VULA 2JKMA 3OY3A 2NNWB 4BCFA 4AP7A 4KSQA 4FTQA 4E5BA 1Q5KA 3KRRA 4EQUA 5EHYA 3NUUA 3SXRA 5BVDA 4LFIA 4W4WA 2CDZA 4FKRA 2C5NA 1JVPP 3O96A 4DEEA 2PHKA 3PIXA 4FSYA 3AKJA 3HNGA 4J8MA 3OP5A 2UZBA 1ZWSA 1M2PA 4EZ7A 2BRHA 2YDIA 2GQSA 2WZJA 4UYNA 4AZVA 1U5RA 1YDRE 5TO8A 3OEFX 4R77A 2IZRA 1GNGA 2CKEA 4GSBA 4O2PA 5L2QA 1QL6A 3O0GA 2R3LA 3OCSA 4D2WA 2W0JA 4ZS0A 4I5PA 2F7ZE 4UMQA 4DG2E 3F7ZA 3RM6A 4J1RA 3FXXA 3IKAA 5CYIA 3SRVB 4YLLA 4AF3A 3AC5A 3LMHA 3NW6A 4F7SA 4X2JA 4DCAA 4B8LA 1OI9A 3NVMB 3ZLYA 2X8IA 3A7JA 4F9WA 4G31A 4N70A 4YO6A 3W2QA 4BI2A 4QP3A 3UPXA 4UMRA 2O63A 1P4FA 2ITTA 1BMKA 5J7HA 4D4YA 2W5AA 5AADA 1DI9A 3CKWA 4LV5A 3AG9A 3FI4A 2IVUA 4R3RA 2PK9A 3SG9A 3MH0A 3R1QA 3R04A 1OL6A 4IDVA 4M67A 3S0OA 1YXVA 4I21A 4RIOA 4XV1A 3ZM9A 4FKIA 3OXIA 5T6KA 1NA7A 2XIXA 3DCVA 3BYOA 1K3AA 3VS7A 3PJ3A 4WD5A 3R7OA 4CFUA 4UMUA 2FSLX 4EBWA 3DZQA 3P0MA 5JGBA 4JBVA 3H9OA 5CAUA 3R8MA 4F1OA 5GZ8A 5BVEA 1DAYA 3DXQA 3VIDA 5AEPA 5EKNA 3I79A 4YZCA 4PV0A 3GXLA 5BVNA 4O7RA 5CASA 5L8KA 5D7VA 5HBEA 2XVDA 4LM5A 3W32A 4U7ZA 2OI4X 2ZDTA 2GNJA 3EQHA 3W2SA 3TIZA 3V01A 1Q8ZA 2JDTA 5EM8A 4ENYA 3A7IA 3FLSA 4DHFA 3TUCA 3ZZWA 5IQIA 4EH5A 5AV3A 3PRFA 4X3FB 4UV0A 4YJRA 2XCHA 5BYZA 4QTCA 3C7QA 3QL8A 4C0TA 2WQBA 4RIXA 3RK5A 4J71A 4GYIA 4RPVA 1LEZA 5L6OA 5DT0A 4LV7A 3RAIA 1OKYA 3FZOA 2BIKB 1MRUA 4CYJA 1FVTA 4JBQA 4C61A 2PULA 3L1SA 4QMUA 4XP3A 3TJDA 2BCJA 1FGKA 1WCCA 4A07A 3C13A 3R8LA 4EH2A 4EOMA 4RX5A 5HNIX 4AT3A 3LFEA 5GJGA 2G01A 5IQGA 4AW2A 2IZTA 3PG1A 4ZSLA 3TNHA 1R39A 3WILA 3PIZA 5D10A 2VWVA 3N9XA 2XJ0A 4ARKA 3O5AA 4UWYA 2X2MA 3LXKA 4FEVA 3A62A 3KMMA 4HCTA 4AX8A 3UBDA 4KBKA 1AGWA 5CVGA 4C4IA 3BKBA 1ERKA 3C4WA 5CS6A 4F1MA 2Y9QA 4FG7A 4ZMFA 4QP4A 3R02A 4C2VA 4DT8A 4ZTLA 4B6LA 3FV8A 5E8ZA 4NWMA 4BKYA 3SDJA 4JDIA 4IBMA 3P5JC 4M0ZA 4MXAA 4Y5QA 4D2SA 3A4PA 2HXQA 4O4FA 4IX6A 4R8QA 3Q53A 3AD6A 4HNIA 4BYIA 1IA8A 2R2PA 3ET7A 3R2YA 3BHHA 4KD1A 5IUGA 2GU8A 2NO3A 4GFMA 1PW2A 3UNJA 3TTIA 1S9JA 4P7EA 3RAHA 5C01A 3FC2A 3R7IA 3HMMA 4DT9A 4TL0A 3ZS5A 3OF0A 4FKTA 3BGPA 4PF4A 4EH9A 2VWZA 3EQBA 2VO6A 3QQJA 3P4KA 3BQCA 4RFYA 5DI1A 5M55A 3JYAA 4M12A 1WVXA 2BDFA 3VS2A 3JY9A 4BKZA 2C5OA 1YXTA 4M97A 4LRJA 3DPKA 3GCQA 2GSFA 5HKMA 3R7UA 1Q8YA 2F9GA 1WBWA 1W98A 2J0KA 4OLIA 2J5EA 4M69B 2IZSA 5M06A 2Y7JA 5HG7A 5C9CA 5KBRA 1BYGA 4UZHA 4PMMA 3SA0A 3F69A 3MFTA 4FTRA 3AGLA 3HMPA 3OG7A 5H8EA 1CTPE 5ANIA 1PMUA 3BE2A 4FBXA 3LFBA 4IFCA 3ZHPC 2HYYA 3OT3A 4JX7A 2ZM1A 2FSTX 4KNBA 4O6EA 5TT7A 2CKQA 4RC2A 4QRCA 2IVVA 1KV1A </