3MIAA

Crystal structure of hiv-1 tat complexed with atp-bound human p-tefb
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
333
structure length
324
Chain Sequence
b'VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HIV-1 Tat complexed with human P-TEFb.
pubmed doi rcsb
molecule keywords Cell division protein kinase 9
source organism Homo sapiens
molecule tags Protein binding
total genus 98
structure length 324
sequence length 333
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2010-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3miaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3miaA01
3K5VA 2PSQA 1SNXA 2V22A 2BIYA 3WYXA 4U8ZA 4AZFA 4QYHA 3B2WA 4RT7A 5E8VA 2PVKA 3BQCA 4APCA 3I5ZA 3FMKA 1H00A 3NIEA 1KE7A 2WIHA 3QTRA 4FIHA 3CQWA 2W5HA 3H9RA 1Q8TA 2J0JA 3C51A 1JKKA 1UA2A 4QTCA 5AP6A 4YBKA 3JY9A 3V5QA 3O2MA 2QO7A 2C5NA 3NCGA 3IO7A 4JDKA 4X21A 5HNGA 2CGWA 3TEIA 3W18A 3EQGA 4AW0A 4X6QC 5KHWA 4ZLOA 2IZTA 4NZWB 5FUTA 4GIHA 2JAVA 2YAAA 2NRYA 3HDMA 4EH2A 3D7TB 4FA2A 1F5QA 3RWQA 2OFVA 4LGGA 4WSQA 2ITQA 3ORIA 4ID7A 4DA5A 4D1XA 5CAOA 4UZDA 4ZIMA 2ETRA 3VF9A 5IPJA 1BI7A 3FMHA 2W0JA 5AUTA 2F2CB 1H01A 3ZFMA 4X3FA 2W05A 4IZYA 5AV2A 3QZIA 4ZTMA 5FGKA 4FL2A 1Q5KA 4PF4A 2QU5A 5ETFA 5A4LA 2QCSA 4BCIA 1KV2A 4C59A 4HYIA 4P5ZA 5E8TA 5CU0A 4R3CA 1CTPE 4E3CA 4BYJA 5E8SA 4U81A 3ZUUA 4G9RA 3GEQA 4WT6A 5DMZA 2UW6A 2Y4IB 3AC2A 4GVAA 4Z9LA 3NLBA 3OF0A 4ACHA 1PHKA 3UODA 3QX4A 4RVTA 4XV1A 2R3NA 4KKHA 4ZOGA 1J7UA 3ATSA 4DE4A 4WSYA 1T46A 3H9FA 2YIRA 3GCUA 4HYSA 4GFGA 1FVVA 4DH1A 5F94A 3AG9A 4MHAA 4EHVA 3Q32A 1TQMA 3P79A 3I5NA 1PW2A 4FEQA 5AUXA 4I92A 2ZMCA 2J5EA 3O51A 5ACKA 3VNTA 1YKRA 4DFXE 4O0VA 4FG9A 2ZJWA 3R28A 5EW8A 4DHFA 1R0EA 2O65A 2BZHB 4RG0A 1M2QA 2C0TA 1WBSA 4FKIA 1WAKA 4D2PA 3CY2A 4OR5A 2PMNX 3Q9ZA 2O3PA 4BI0A 3BHYA 2RFSA 5FP6A 4W8EA 5CX9A 3BLRA 2IZRA 3PY3A 1J3HA 4R7HA 5LOHA 4ZTQA 3R83A 5E91A 5CEKA 5ANJA 1JKSA 2VWWA 4GK2A 3B2TA 3NAYA 4MD7E 4L00A 1LUFA 2B7AA 4RIWB 1F3MC 1MP8A 3GOKA 4MWIA 4FTJA 4ONAA 4TWPA 5GZ9A 4CYJA 4J71A 4CMOA 2XZSA 2O2UA 4AZSA 4OTFA 4FTLA 1CKPA 1U59A 2CLXA 2WOTA 2OBJA 2J0KA 4A07A 2BR1A 1IR3A 4ZSLA 1OBGA 2Z02A 4Z3VA 4WG5A 4HVDA 5TKDA 3RP9A 5IA2A 2V62A 3Q4ZA 3H0ZA 4FUXA 1LEZA 4IC8A 4QOXA 3D9VA 5K5NA 4RFMA 3DTCA 4XG8A 3ULIA 4AS0A 4DH5A 5AFVA 2HYYA 5IDNA 5I3OA 4EI4A 3VS3A 3VS0A 2Q0NA 4CNHA 3WOWA 5EM7A 2IW8A 3WF8A 3GU5A 4YZCA 4ARKA 2OI4X 3PZEA 4KNBA 4XCUA 3FZRA 3LFDA 3PE1A 4JX3A 4AWIA 4MH7A 1IEPA 3UO6A 2PUNA 4FTCA 3VO3A 5HTIA 4GEOA 1A06A 5F20A 1YXTA 2WQBA 3UOHA 4DT9A 4E1ZA 3EIDA 3NUXA 4ZXTA 4D2RA 5J7HA 5EDQA 2GFCA 4RZWA 4XHKB 4HW7A 2UW5A 3FUPA 3F61A 4FZ6A 3RHKA 3HV7A 4EQUA 5EKNA 4FIFA 1GZ8A 3R9OA 4YJUA 5IDPA 4I24A 3BHUA 4IM0A 4HCUA 4CZTA 5IA0A 3ZU7A 4WNPA 3R21A 4IM2A 3MH1A 5CI6A 3EFJA 4MD8E 3TZMA 4FEVA 3MFTA 3VBWA 3ZTXA 4C35A 4CTBA 3HDNA 4FYOA 4KAOA 4QP9A 2O8YA 2R3GA 1GAGA 2VTMA 5FLFA 3UOKA 4RJ6A 4L52A 3ERKA 4DT8A 3NVKI 1WBVA 2X9EA 4FI1A 5DA3A 4LRJA 4FZDB 5HVKA 2XNBA 5DPVA 5IMEA 3QTWA 3KCFA 4E4XA 4X3JA 3LFEA 3QAME 4FTQA 4RQVA 4S31A 4IJPA 1PXMA 3C4EA 2P33A 3EFKA 5CF6A 4C4GA 4DLIA 3S3IA 1YI6A 3F6XA 3KVXA 2CNUA 4AUAA 4IAAA 4I20A 2UW4A 4A4LA 3QBNA 5DR6A 1OL5A 2A4LA 3FBVA 5AUYA 4I6BA 4AP7A 2GDOA 2BDFA 2OJGA 2YM5A 3LCDA 3RPSA 3BQRA 3D5UA 4XG2A 5D41A 4I93A 1RE8A 2XA4A 3I0OA 2VWZA 3FZSA 5T68A 4P7EA 3RK7A 2WMRA 3F7ZA 3M42A 4X6RA 3R9NA 1ZRZA 3MB7A 4BN1A 4GRBA 1OL1A 1XHAA 2C5VA 5HG5A 1ATPE 5DT4A 3ACKA 1XH9A 2VGPA 3LMHA 1FVRA 2QR8A 2NRUA 3VJOA 2JIVA 2XKDA 3ZLWA 2VX1A 3EQRA 3UNZA 1YDRE 5EQEA 1Q62A 1CKIA 3LQ3A 3K3JA 3RPOA 4O7YA 4PMMA 5I3RA 2C6LA 3PRIA 3WI6A 3PSDA 1GIHA 3PIYA 3TL8A 4D4VA 4R1YA 5BYZA 4RJ4A 5IQEA 5IG1A 1EH4A 5GNKA 3D5WA 3ZXZA 5ANDA 1ZZLA 5HG8A 4YLLA 4O0UA 2HWPA 4BWKA 4AFJA 2UZLA 3QZHA 1IG1A 1ND4A 3G9NA 4MTAA 3DZOA 3FZ1A 4N57A 2QOFA 2FUMA 4GU6A 3WIGA 1AD5A 3QXPA 2XYUA 4B8LA 4EL9A 4O7SA 3EQHA 4FZ7A 2HY0A 2O5KA 4UXQA 3T3VA 4UN0C 4FT7A 4TYHA 4BDHA 2WU6A 3UQFA 5HTBA 1Y91A 3OXZA 2F7ZE 1B38A 2VNWA 3TJDA 4HGSA 3KRLA 4ASDA 4AF3A 3JVSA 5CU2A 4QRCA 4R6VA 5L2QA 4BCOA 4O7NA 2QOLA 3GOPA 4G3GA 2NPQA 1IA9A 4RFYA 3ANRA 4IB0A 2VWUA 4DG3E 3CS9A 3LLTA 4M97A 3O23A 1WBOA 2WQOA 5JZJA 2BPMA 5HLNA 4CEGA 2NO3A 2YACA 2HAKA 1W0XC 4QMZA 4AW1A 2WKMA 3R8ZA 4Q5EA 4EH7A 4EOLA 4CCUA 5A46A 1U4DA 3F69A 4RWKA 3EB0A 3UBDA 3DXPA 4S2ZA 3LLAA 3R7YA 3QTXA 2AUHA 4P5QA 4PY1A 2CKQA 4FYNA 3IQ7A 3GU8A 3DK6A 5AR2A 2VTSA 3BBWA 4ZZOA 2HW7A 5LXMA 2J90A 5J1WA 5E8WA 2YHVA 2J50A 3HZTA 2ZVAA 4D5KA 3QX2A 2ONLA 4FK6A 4PTGA 4TRLA 1PMUA 5EM8A 4QP3A 4F6SA 4LL5A 2BMCA 5CI7A 3QWKA 2AYPA 1U54B 3D5VA 2XBJA 4GJ2A 3DJ7A 3ZO1A 3UNKA 3W2SA 4X2KA 2WQNA 2W4KA 4O22A 3PY1A 4DG2E 5EYCA 4O84A 2R3OA 3DNEA 4BDJA 3BYSA 4FSNA 3WF9A 5GZ8A 4YJPA 2WMSA 4I5CA 1Q8UA 2FSTX 2Z7QA 5E7RA 5E92A 3ZO2A 3C4ZA 2PZ5A 1YXXA 3OS3A 3NUNA 3IOKA 4M0ZA 3FKNA 1YXVA 2X6DA 3V6RA 1AQ1A 3L1SA 3PTGA 5I4NA 4FEWA 3ZRKA 3VQUA 3HMIA 1GZOA 3CP9A 4BDGA 1KOBA 3CD3A 1H1QA 3Q2MA 3GQIA 3DQXA 2RG6A 3QRJA 4W4WA 4AA0A 3TDWA 4PDSA 2QI8A 1OL2A 2CKEA 4FL3A 1BMKA 2VTOA 2OH4A 4BYIA 4EOSA 4USEA 2HOGA 2UW7A 4HYHA 4QP4A 2OXYA 4EZ5A 3IG7A 3PWYA 4AQCA 5HX6A 4X2GA 3C7QA 4BRXA 3OY3A 1UU7A 4ERKA 4TT7A 4YC8A 3C13A 3W2QA 4L3LA 3QUEA 1GY3A 2BHHA 4ZSEA 2GCDA 4CQGA 2WMWA 1UNLA 3AD4A 5IISA 5M4UA 3SAYA 2ZM4A 2XK3A 4FV3A 1DAWA 3DS6A 4OT6A 4TNDA 4YTHA 3HUBA 4G31A 3GP0A 1XH4A 2XJ1A 4TNBA 3Q4UA 4EBVA 2PULA 2V7OA 3FSKA 3QFVA 4FV6A 4OBOA 3UNJA 5ITAA 4O86A 4CG9A 2GTMA 2ITOA 3BGZA 3HUCA 2R3LA 4GG7A 3BCEA 4XP2A 2QOOA 4JDIA 4CRSA 2YZLA 4KRDA 3MW1A 1YRPA 4O83A 5IH5A 2ZB1A 5HESA 5LVOA 1NW1A 4CYIA 2W99B 4RRVA 5IUIA 1HCLA 4Q2AA 3TV6A 1Y6AA 2JIIA 2R64A 1MRVA 5A4CA 4OTWA 4QYYA 5CAQA 2YWVA 3MYGA 3ZLSA 3KK9A 4UMQA 4AN2A 3G90X 3KMMA 2BIKB 2XNPA 2XK9A 1LEWA 3ZONA 4NJDA 1W8CA 3ORXA 4X7QA 5C4LA 4DG0E 3IW6A 4PP9A 2W5BA 4GT4A 3UMXA 4QP7A 3QCXA 4BGHA 4C36A 5CF8A 5CTPA 5CEPA 1JVPP 3LHJA 5EDPA 4A9UA 1I09A 4ASXA 3QTIA 4I4EA 4ZTNA 3E62A 2PPQA 2KTYA 4NJ3A 3BI6A 3E63A 2XP2A 3AC4A 3HEGA 2PY3A 4L8MA 2A27A 2WMTA 2B1PA 5B7VA 1H0WA 3R22A 4K6ZA 4DAWA 3NCZA 4BVUA 4F7SA 4IACA 2WTKB 3EOCA 3W2PA 4KIKB 4F99A 4XP3A 1A9UA 2XUUA 4I0RA 2VTRA 5M4CA 3MTFA 3G9LX 3UYTA 2XIZA 3OXIA 4BBMA 3LPBA 2LGCA 4LGDA 5TO8A 4O0WA 3BHTA 4G17A 4XLVA 4O7LA 4CSVA 1KE6A 2PVJA 2W1FA 5LJJA 5A54A 3CLYA 1YI4A 2C6EA 1PMEA 5AWMA 1RDQE 4LMNA 2ERKA 2G01A 2QO9A 5HO6A 2XBAA 2PYWA 2WTCA 2UVYA 3GQLA 2WFYA 3PZHA 4RBLA 5IH4A 3LCSA 4M66A 1GJOA 3F9NA 3LE6A 4OTIA 5AAGA 3P0MA 2CLQA 4UYAA 3AMAA 3V8SA 4ZJVA 2PMLX 1FOTA 3COMA 1YHVA 2WMUA 4DEDA 3NUUA 4Z16A 3DGKA 4UXLA 3A8WA 3GT8A 4R78A 5DGZA 3ZZWA 2B0QA 2W1CA 3LXPA 2BVAA 4RZVA 2BFYA 3BV3A 1VEBA 3AXWA 4IHPA 2JBOA 5K9IA 1DAYA 1H1WA 1J1BA 2XKEA 4XLIA 4AZWA 2R3FA 3GCQA 4ZZNA 2XIKA 4R7IA 4YR8A 3MFSA 4PPCA 5HO7A 2XJ0A 4JOAA 3KEXA 1J7IA 1GZKA 4LFIA 3E93A 3RGFA 3FYJX 2OWBA 4H1JA 4TY1A 2XRWA 3S1HA 1NVSA 4JAIA 3R9HA 3G15A 4NFMA 5M09A 4NU1A 3QQJA 2NP8A 2QKWB 3D83A 2OIDA 3Q53A 5AX9A 3DFCB 2VTTA 5CS6A 5L4QA 3CKWA 4DEBA 3K3IA 4OBQA 3RCJA 2RF9A 2YZAA 3UVPA 4FTOA 4PDPA 1ZXEA 1O9UA 1DI8A 1P5EA 2V5QA 3H30A 3L9NA 3NMUF 1XQZA 5JFXA 4J52A 5AP0A 3NYXA 3OFMA 2GHGA 2R9SA 3VUKA 3PSBA 4FNYA 3KXXA 4D5HA 2PUUA 3BU3A 2YEXA 1ZOHA 4G34A 4E4MA 1WBNA 3B8QA 4BDCA 4HVGA 3KGAA 5L6PA 1DM2A 2P2IA 3NNWA 4FZAB 5LVLA 5IF1A 5DYJA 4TW9A 5AP7A 3D2KA 3GFWA 3KB7A 3TXOA 4BDDA 2HZ4A 4RC3A 2AC3A 1MRYA 4J99A 5BUIA 5CXZA 4YLKA 3U9CA 3UE4A 2R4BA 3PFQA 4EYMA 5FXRA 3TNPC 1R3CA 3PLSA 4LI5A 3SA0A 4FV8A 2UZVA 2BDWA 2XS0A 4EWHA 4HVSA 3QUDA 3QKLA 5BYYA 4C4EA 1KSWA 3TACA 4DTBA 4HJOA 3S2PA 3VBTA 4AX8A 4D28A 3OY1A 5HI2A 4FKSA 2G15A 2Y4IC 2WEIA 4O0TA 5HE0A 4EZ7A 3PXRA 3DLSA 3LM5A 4IMYA 1UV5A 4OTHA 4A4XA 3C5IA 5BUJA 4R7BA 4MXOA 3N4VA 3TUCA 4IAFA 5KX8A 1Z9XA 2OJFE 4XP0A 4JIKA 4EOOA 4FNZA 3TKUA 5ANKA 1UNGA 3D0EA 2C3KA 4JG8A 4CCBA 4EH6A 3VC4A 2HZIA 1YXUA 2ZDUA 1FMOE 1SM2A 3D15A 4IAZA 3VW8A 3ZM4A 4ANQA 4CXAA 3Q5ZA 2Z7RA 1J91A 1W98A 3E5AA 1ZYCA 1CMKE 3L8PA 3SXRA 5KUPA 5DT0A 1VYZA 5CLPA 3GVUA 3QU0A 1FQ1B 3W2RA 4O7WA 5JZNA 3MH0A 4AU8A 2OG8A 4U42A 1NT2A 4PRJA 2BAQA 2W1GA 4FSTA 5H9BA 2QLQA 5DI1A 3SXFA 4UMRA 3ZOSA 1H1PA 1GIIA 4PMTA 4FIIA 5HEZA 2ITPA 5A4QA 3DT1A 4L42A 5IQBA 3ZXTA 4HGEA 1P4FA 3A7JA 1W83A 1OIQA 3TV7A 2YABA 4XUFA 4ZSGA 4QP1A 2X7GA 3VVHA 5FD2A 3SG8A 4U7ZA 4KABA 3HMOA 4ITJA 5HU3A 4BCKA 2BTSA 2YIWA 1KE5A 1JKTA 5HIBA 5EQYA 3FL5A 4FV5A 3A4OX 3W33A 2OJ9A 3FLQA 3QRUA 4OAUC 2REIA 4C02A 3P23A 5KMJA 4IZAA 4D4YA 2X1NA 4M13A 1H26A 3TM0A 3LFCA 2Y0AA 3MPMA 4U44A 3WBLA 2OSCA 2YM8A 3TN8A 3V6SA 4AZVA 3SRVA 5IA4A 3RJCA 3AQVA 2X8DA 4L67A 2YJSA 2XK8A 1H1SA 2ITNA 1IAJA 4PTEA 2C5XA 3QGYA 1OECA 5TT7A 5CVHA 3VAPA 1XH8A 4BGGA 4IFCA 3GC7A 4JXFA 2BCJA 4PV0A 3PPKA 3LW0A 4RPVA 2IO6A 4YUQA 3FPMA 4RIOA 2PE0A 5LWMA 2ERZE 4U43A 2IPXA 3LKMA 1W82A 1V0OA 2YJRA 1PMVA 3DKGA 3PVWA 5IQIA 5CZHA 3A99A 4H58A 4S33A 1RW8A 5EK7A 3LVPA 2XEZA 4Q9SA 1QPJA 4TXCA 2JBPA 3IOPA 2BZIB 5EHYA 4BCHA 5J9ZA 3C4XA 5IZFA 2O0UA 5CEQA 3CE3A 1H4LA 4I5HA 4B0GA 2WTDA 2WTWA 3NUSA 3R2YA 2GFSA 4O2ZA 3FC2A 1HOWA 3LJ0A 3QTUA 2JFLA 3R8UA 4F9CA 3FE3A 3P7AA 4F0FA 2CCHA 4Z7GA 4Y83A 5C8NA 5LVPA 2AC5A 3EMGA 2W9FB 4M12A 3AD5A 4AZEA 2I6LA 4O7RA 2Z7LA 2E9OA 3NNVA 5H8GA 4H1MA 4D2VA 3UG2A 3OTVA 4IB3A 3EYHA 3C0GA 1IA8A 4TWOA 5CALA 4FSQA 3LFAA 3PXKA 2ITXA 5ANOA 2OZAB 4QMPA 5CF4A 3DBDA 4BKZA 3BGPA 5L3AA 2H96A 5EFQA 4A9TA 4AA5A 5BUEA 5LWNA 3LIJA 3MH2A 5JH6A 3UO5A 3TDVA 2XIYA 4NM0A 2YWPA 2Z2WA 3Q9YA 2X4ZA 4YPSA 4GFOA 3FJQE 5E90A 4EKKA 5CXHA 3ZSHA 4FKTA 4JAJA 4ENXA 2WGJA 4FF8A 3CY3A 3C0IA 5FP5A 4FKLA 4FSMA 3HP5A 5HORA 5IA3A 3O7LB 4K11A 4DFZE 3EN7A 4YNEA 4ENYA 3W1FA 3EQDA 5B2LA 4RJ3A 2YITA 3EQBA 3POZA 3TT0A 2X81A 2OKRA 2I0HA 2YM4A 3FY0A 3VBYA 4BHZA 4XJ0A 2VTHA 4ZSJA 4BI2A 3FXXA 2RG5A 3IDPA 3KRXA 3LFNA 5TF9A 2XIXA 3TZ7A 2VAGA 4WG4A 3HL7A 4MEDA 4JBPA 1Q97A 4CFWA 4WUAA 5A9UA 3QD0A 1FMKA 3PJ8A 3PJCA 2XB7A 3U4UA 5BYLA 1MQ4A 1JKLA 5HOAA 3EKKA 3PIXA 4UB7A 3IKAA 5AP4A 2B9JA 2C0IA 4L44A 4FKRA 3A4PA 3OROA 3SC1A 4C4HA 4QTEA 3ITZA 4G5PA 3MIYA 5HE3A 5LMKA 4EUTA 4I4FA 5ETIA 3C4CA 3CJGA 4O1OA 2C6DA 4PUZA 3CJFA 3TG1A 2QD9A 3W8LA 3WE4A 2BHEA 2RSVA 4C3RA 1YWRA 4GT3A 2XYNA 4PL3A 4RJ5A 5FWKK 5IA1A 2QHMA 4GIIA 4DTKA 4DYMA 4NUSA 4GVJA 4XRLA 3FLSA 4EC8A 1DS5A 4MAOA 4PDYA 2YCFA 4EK5A 4BF2A 4LOPA 5HNBA 3F2RA 3EZVA 1OPLA 4KS7A 4GSBA 5AIRA 5EYMA 1IAHA 4S34A 4FGRA 2IVTA 4UWBA 2PVFA 1JBPE 5JK3A 1E9HA 3NW6A 2R7IA 4GFMA 1RJBA 2PVHA 1W7HA 4IX6A 5CT7A 3SOCA 2WO6A 2JDRA 2XH5A 2GMXA 4BZDA 2SRCA 4JL9A 4FMQA 4J7BA 4I1ZA 3HA6A 5LMAA 2VTLA 2X2MA 3QLGA 4O91A 3ROCA 4IBMA 3U6HA 3PPZA 4BTMA 4GL9A 2R7BA 2Y8OA 2OH0E 5FBOA 3UQCA 1OL7A 4U45A 4XRJA 2O64A 5D7AA 4DC2A 4QTAA 4E5BA 2OLCA 5E8XA 4FG7A 5JFWA 4E6DA 3PPJA 1OIUA 4G9CA 3NYVA 3OVVA 4N6ZA 5L2SA 3BEAA 4U5JA 3BX5A 5HQ0A 4KS8A 4BCJA 3UZPA 4NW5A 4QMYA 2F9GA 5ACBC 5LMKC 4MBLA 2V0DA 3FZOA 5I9UA 5I9WA 3GU4A 5CENA 1ZOEA 4NK9A 4V0GB 1M52A 3KXZA 3R01A 1JSVA 2X2KA 2W1EA 3QL8A 4XV2A 1ZARA 5CU3A 5AUVA 3QCYA 3R7UA 4RX5A 3K5UA 3DKCA 5F1ZA 2WELA 5CF5A 4FL1A 4F63A 2IN6A 4ZTHA 4JJRA 1YQJA 4D9UA 3R8LA 3QQGA 3VRZA 4UMUA 4ZY5A 4I94A 2WHBA 2XNOA 4LL0A 4M69B 3I7CA 4RX9A 1QCFA 1O6YA 2ITWA 4HCTA 3FXZA 4D4SA 3ETAA 3DY7A 4QNYA 4YBJA 4KSQA 1JAMA 3QD2B 3KXHA 2VX0A 4MX9A 3R7OA 5CSVA 5JRQA 3OBJA 1MRUA 3RPRA 1ZZ2A 3IGOA 3LJ1A 4UALA 1Y8YA 3TZ8A 3QD3A 4IZ7A 2CHLA 4HGLA 4JG6A 1OKZA 3Q9WA 5CU4A 3UVRA 5AADA 5I5ZA 4FEUA 4D55A 2PU8A 4FT3A 5J7BA 3RVGA 4WO5A 4CKJA 4R77A 5LQFA 5M07A 2CGXA 2WMVA 3H4JA 4L6QA 3MJ2A 3AT2A 3NUPA 5I9VA 1R1WA 1BKXA 1NA7A 5ANGA 1YVJA 4AAAA 4F7NA 4JLCA 4O7ZA 3MSSA 5H8EA 3FQSA 4FSYA 2G2HA 3TNQB 2BZJA 4APPA 4CFXA 2BKKA 1Y57A 4O6EA 3HECA 4GUBA 2C3IB 3E8CA 4L45A 2E9UA 5KBRA 2B55A 4HPTE 4KIKA 2UZBA 3ZRLA 1URCA 3E3PA 4PPBA 4UYNA 1UU3A 3TI1A 1OMWA 4CV8A 4GKIA 4RWLA 5H3QA 5G6VA 3IONA 3LOKA 2XMYA 1L8TA 3HKOA 4AE6A 1OKYA 4XOZA 5GIPE 2W1IA 4M14A 4ITIA 3DXNA 1G3NA 4C4FA 1KOAA 2P4IA 5J9LA 1H8FA 2PK9A 1YW2A 2VTPA 3E7OA 3FI4A 4BIBA 3F5XA 4IDTA 2HK5A 4L53A 2BILB 4GT5A 5K5XA 3MY1A 4C3PA 3WIKA 2YIQA 2WMBA 1XBBA 3QRTA 1WBTA 4U6RA 4U9AA 2XNNA 1BL6A 2QG5A 4FR4A 4FEXA 2FVDA 2VO6A 2Y7JA 4DH7A 4FGBA 4FSZA 3QZGA 4QMOA 4YSJA 1O6LA 4ZS0A 1CM8A 3MVJA 5AUZA 4FKQA 3G0EA 2VU3A 2BUJA 2YIXA 2UVZA 3UP2A 2DQ7X 2GHMA 4EQCA 3ORKA 4KRCA 4XS2A 1M7NA 2QOBA 4YTIA 3IW4A 3DKFA 4FTUA 4IANA 4IX4A 1K9AA 2WTKC 5DIAA 2Q83A 3LFQA 3VBQA 3QKKA 3H0YA 4GV1A 4DN5A 5KKRB 2A19B 3B8RA 3NX8A 4K1BA 3NSZA 2G2FA 4X0MA 3CKXA 5CQUA 2P2HA 1UKHA 3FDNA 4C34A 5F9EA 4I5PA 3NIZA 5M08A 2ZYBA 4FTRA 2X4FA 4EHGA 4CKRA 3T9IA 3HLLA 3ORZA 3R73A 4M84A 2RFEA 3FXWA 3PWDA 4FKUA 3TIZA 4YJSA 4RJ7A 2R3KA 4CFMA 4DBXA 3GC0A 3A7IA 3ZC5A 4BDFA 2H8HA 3ZLYA 2HELA 2C47A 4MXYA 4PX6A 4IQ6A 2UW9A 1IASA 1LP4A 1J7LA 1ZMVA 4PL4A 2IVUA 5J5TA 4FV0A 4NW6A 3VS6A 5KBQA 1JSTA 3OMVA 3TNHA 3R7EA 5BVFA 2BAKA 5DRDA 2VD5A 3WZDA 3P7BA 3V8TA 4G3CA 3QALE 4Y5HA 3U8WA 4C3FA 3ZLXA 2W4JA 5DFPA 2WNTA 3DV3A 3AT3A 4O0XA 4QMSA 4AOIA 2GTNA 4MF1A 4FIGA 4AGUA 3NR9A 4F64A 5CAUA 4QP8A 3CBLA 2WTJA 4PL5A 3UZTA 3I6WA 3CC6A 3VS7A 5BVWA 3LZBA 4U79A 1QMZA 4HVIA 3CIKA 3E8DA 3IDBA 4PTCA 4BB4A 4O6LA 4LM5A 4DEGA 3AD6A 2EB2A 4PWNA 2JIUA 3QTQA 3CPCA 3WF6A 1WZYA 3VS1A 3EH9A 4O38A 5HZNA 4TTHB 1BL7A 1JSUA 3NRMA 3HRFA 4FTAA 2EVAA 4QT1A 1PXKA 4W4YA 4E93A 4UEUA 4F09A 4YZ9A 4D9TA 5KZIA 4J95A 4FT5A 4KKEA 2W1HA 4G6NA 3EN5A 4USDA 4ZLYA 4E5WA 3D94A 2GNLA 2FSMX 2J2IB 3UMWA 4GKHA 4GK4A 3IDCA 5GJDA 4IADA 4J98A 2W9ZB 2BTRA 4I22A 4QP6A 5HE2A 3SW4A 3RMFA 3BEGA 3KULA 4F1OA 3BBTB 5HD4A 2C30A 3MV5A 5A4TA 2XNMA 5JFSA 4XG4A 5AM7A 4IH8A 4XBRA 3V8WA 4CMTA 5AV4A 1JNKA 1H1RA 1KE9A 1WVYA 2ITVA 3GC8A 1S9JA 3PP0A 4MCVA 2UZOA 4JRNA 3TKHA 2XM9A 3SKCA 3EJ1A 3W2OA 2QOKA 3GFEA 1YWVA 2PE1A 3QLFA 3BKBA 5GJGA 4X3FB 2WMAA 5AR7A 5BMSA 3KK8A 3HP2A 2HWOA 2PZIA 4ZEGA 4ACDA 4GMYA 3RAIA 2PUIA 2PZRA 5L8KA 4F1MA 2W5AA 3ORNA 3FY2A 2GPHA 4LUEA 1Q41A 4MQ2A 3KA0A 3R8VA 4NFNA 4GW8A 1G5SA 2J51A 2R3MA 5EYKA 2ZM1A 2OXXA 4YSMA 3IPHA 2F2UA 3QHRA 3NNXA 2VTIA 4C2WA 5AAEA 2C6OA 2OF4A 5EM5A 1ZYDA 5EI6A 3VF8A 4L3PA 3NGAA 2FB8A 5BQ0A 4H05A 3U55A 3Q6WA 3WZEA 1VZOA 2ITUA 1OM1A 4GS6A 3ORPA 2VWBA 4LOQA 3SXSA 4BZNA 4IJ9A 5HCZA 4NIFA 2HIWA 5AJQA 4ZMFA 4YURA 1PKGA 4CGAA 4HOKA 2J5FA 3P86A 3U54A 4CLJA 2PVNA 1NXKA 4EC9A 4IEBA 4RFZA 2RL5A 2WXVA 3EN9A 4XV9A 4S30A 4MQ1A 2CKPA 5E1EA 3PIZA 3CPBA 5KE0A 3COHA 3MI9A 1E1VA 4R8QA 1QPEA 2BZKB 2YCSA 1I44A 3MN3A 2JKOA 5HG9A 3KXGA 4AW2A 4NL0A 1OB3A 3TCPA 4BR3A 3EN6A 2CNQA 3ET7A 2YLFA 3ZFXA 3E64A 3GC9A 3O0GA 2X8IA 2OF2A 4YJQA 5E8ZA 1M2RA 1NVRA 2VWYA 2WIPA 4DGLC 4OUCA 2OGVA 2W4OA 5HD7A 1S9IA 2YDKA 5FEDA 2XCKA 5LMBA 2YLEA 2UV2A 2ETKA 5CT0A 4DEEA 3DAEA 4I23A 3DBQA 5D11A 3OTUA 3N9XA 3RZBA 4LRMA 5L6OA 4XBUA 5M55A 3EKNA 4CFNA 5HLPA 3O8TA 1JPAA 3BYMA 3QRIA 4EH4A 2VUWA 2C4GA 4HNFA 3UGCA 3RPVA 5K4IA 3OG7A 4FV9A 3PVUA 3DAKA 3BWJA 3R02A 4UMPA 5I0BA 2Z7SA 3V04A 3LAUA 5A3XA 2OJIA 1GIJA 4J8MA 2C1AA 3HYHA 3LM0A 4FSRA 4Y46A 3BHVA 2CDZA 4GH2A 4GYIA 4H36A 3A7FA 4JDHA 2B9FA 5JT2A 5JGAA 4J1RA 4O2PA 4AOJA 5GINE 1BLXA 3OCGA 3P9JA 4RVKA 3KFAA 5TE0A 2ITYA 3T9TA 3E92A 5BMMA 2QQ7A 5A6NA 2IVSA 4ORKA 3U9NA 5HTCA 2G9XA 3LCKA 3OC1A 4ZTLA 5EI8A 5HBJA 3JS2A 1ZWSA 4FV7A 4EKLA 4BKJA 5CEIA 4Z55A 3OP5A 2WEVA 1YWNA 4NM7A 4AA4A 1RQQA 2GNGA 2W17A 2Q0BA 3QA8A 3OOGA 4L7SA 2IJMA 3SOAA 4C33A 3ZEWA 3EN4A 4PNIA 3D7TA 4Y85A 4EOKA 4LYNA 4FV1A 4B8MA 5E9EA 5I9ZA 3PXYA 4HYUA 5CNNA 4EJ7A 3KXNA 3OXTA 3Q4TA 3ZM9A 5CANA 3OCTA 5DEWA 4ZTRA 5HKMA 4CFUA 4JRVA 4QMXA 4W8DA 4GU9A 4OTQA 4RGJA 4UBAA 3ROYA 2EB3A 3I1AA 3HGKA 3UC4A 4FUYA 4NCTC 2OK1A 4HNIA 4IVDA 4FOBA 3D4QA 5L6WL 3Q5IA 4BTKA 3EYGA 4CFVA 2CNVA 2QR7A 1BUHA 3VWAA 2R5TA 3VS4A 4IWPA 5FDXA 4CT1A 3F66A 5J1VA 1XJDA 3E8EA 1FGKA 4K0YA 3CR0A 3K54A 5HLWA 2QVSE 4DCAA 3QQKA 1KE8A 4RLKA 5K4JA 4IFGA 3F7WA 4X2JA 5DHJA 1WFCA 2GNHA 4R1VA 4ANBA 3ULZA 3NVMB 3R7IA 2FGIA 3NWWA 2YDIA 5DOSA 5KMNA 1PMNA 2Y9QA 5CASA 5CU6A 2XNEA 3MFUA 3ZO3A 4FVPA 4KIQA 1PXNA 2VV9A 3HVCA 3V5TA 4EUUA 1ZLTA 3P4KA 3G2FA 3ZMMA 1CDKA 4ANLA 4LUDA 1Y8GA 3FAAA 2QO2A 4TYEA 4KA3A 4KIOA 1STCE 2WMXA 2ZV7A 3AOXA 3OUKA 4O82A 4G3FA 4QQCA 2C68A 1V1KA 1YHWA 5M4IA 3CQEA 3G6GA 3F3ZA 4IIRA 2ZM3A 5AR8A 5FXQA 1ZY4A 3F82A 4WBOA 3RBWA 1YDSE 3T8OA 4EONA 5E1SA 2HZNA 1LR4A 1PXIA 3LQ5A 2VTNA 3ZRMA 4DGNA 1ERKA 3MIAA 1M2PA 4RIWA 2WZJA 3U6IA 3TV4A 4C2VA 3C9WA 4TYIA 5M44A 2IG7A 4W9WA 2F7XE 3JUHA 4QMLA 3N51A 3KMUA 5FTOA 3N4UA 2W1DA 3V3VA 2C69A 3BYOA 4LV8A 1Y6BA 3MY5A 4D2WA 3UPZA 1PXLA 4TZRA 4IAKA 3F3UA 4RVLA 1UVRA 5DE2A 1V0BA 3SVVA 4K8AA 3VUHA 4TYHB 2JDVA 4CFFA 2PMOX 4WD5A 3DBCA 3RCDA 3RKBA 1TQIA 1A48A 3FKOA 3FMLA 4XG9A 5HIDA 4YGAA 3G5DA 3V5LA 5ANIA 2QONA 2XK4A 3K2LA 3FI2A 4BCMA 4UZHA 3C5UA 3JPVA 4QP2A 3P08A 2WTVA 3PA5A 5BNJA 3ZO4A 2Y4PA 3OZ6A 2XKCA 1Q24A 3LXKA 4O96A 4JG7A 4I6HA 4L01A 5B0XA 3A7HA 5HE1A 2HXQA 1ZMWA 2B53A 4Q5HA 4D2TA 2XJ2A 1OITA 1H0VA 2ZDTA 2OFUA 3JY0A 3RINA 4YTFA 3RWPA 4RIYB 2HY81 5IA5A 3RM6A 1Q8YA 5IQGA 4DTAA 3KN6A 4YHFA 4EK3A 2VGOA 2H6DA 2F57A 1VJYA 4KUJA 5AMNA 4IX5A 4JI9A 3KRJA 4NWMA 3SDJA 3MGYA 4QMQA 5ETCA 3TNWA 3HRBA 2X2LA 3G51A 3OOMA 3PJ1A 2B54A 3HV5A 4U80A 4J97A 5BPYA 4E73A 3S00A 3MS9A 2XK7A 4UMTA 4N6YA 4YJOA 5FRIA 3VN9A 5KO1A 3UVQA 1XO2B 3QXOA 3TUBA 1WMKA 5IQFA 4BI1A 4MXZA 3UC3A 4QMWA 3ELJA 1FINA 4PMPA 3UDBA 4AE9A 4F6UA 5AR5A 4PNKA 5AA9A 4G16A 1PYXA 2W1ZA 4IX3A 2PWLA 4XYFA 5DH3A 5CSHA 2X9FA 3FMMA 2YCRA 3A2CA 3MY0A 4RA4A 3FV8A 4JDJA 5AV1A 4B99A 1O6KA 3KF4A 2GU8A 3DKOA 2YM7A 1HCKA 3UPXA 1OPJA 2IZUA 2YCQA 3F3TA 4FODA 3GUBA 4QQTA 3KREA 4RJ8A 5FEQA 1Q8ZA 2ZV9A 3VULA 1TVOA 2GSFA 2G2IA 3KXMA 1M14A 3L9PA 3VW6A 4TN6A 3IW5A 1Q4LA 3Q60A 4XG6A 5AP3A 4F7JA 4Y5QA 2VWXA 5L2IA 3M2WA 4ALUA 3SGCA 4M8TA 3F5PA 3R9DA 3BRBA 4P4CA 3VS5A 4FKPA 3R8MA 2BROA 5CSPA 3HV6A 3EL8A 5LCJA 3HX4A 3R63A 4FK3A 4O7VA 1OBDA 2JD5A 2QOQA 2IZSA 4WRGA 3NAXA 1JLUE 1UWJA 4WNOA 2R0IA 3EQCA 2OICA 2XF0A 5K3YA 1XKKA 4EOQA 5HU9A 3H3CA 3ZS5A 2UZWE 1JOWB 2GNIA 3COIA 1B39A 4KKGA 4WNMA 5CWZA 4KIPA 3UO4A 3C50A 5LVMA 1GOLA 1ZOGA 4ALWA 3QHWA 4RWIA 3PJ3A 3VBVA 2VN9A 2J6MA 2W96B 3SLSA 2JITA 4XOYA 1OIRA 5FTQA 3D2IA 4TYGA 4X2NA 2OW3A 3WF5A 3UQGA 3DJ5A 1BYGA 1JQHA 3U4WA 3OW3A 3QQFA 1CKJA 2OJJA 1KUTA 1XH6A 5T6KA 3U6JA 2GS2A 5AP2A 3OWPA 5HCXA 1YOMA 3CSVA 4W4VA 3V5PA 5HHWA 3PXZA 4EEVA 4ANOA 4F9YA 4JBQA 4DFBA 3OUNB 1XH7A 3CGFA 4YC3A 3PA4A 5TOZA 2UZUE 4EYJA 3ZSGA 1H07A 3ENHA 4TWCA 3ZEPA 4XG7A 5JQ8A 4BIDA 1YI3A 5AX3A 2ITTA 3L9MA 5CZIA 2CCIA 4AOTA 3DB6A 4IDVA 3COKA 3DOGA 2GQGA 2XNGA 5CY3A 2B9HA 3QCQA 4QPSA 4ASEA 4C7TA 4DEIA 4JVGA 1URWA 4EJNA 1XBAA 4F0GA 3SX9A 1FGIA 3ZCLA 5B2KA 4B4LA 4FSUA 2WU7A 5KMLA 4QQJA 5K0KA 2OIBA 2DWBA 4J8NA 5DG5A 2CN5A 5EI2A 4OAVB 4CZYB 4EK8A 1H08A 4MXAA 4NTSA 4YU2A 2XEYA 4I3ZA 3RHXA 3BYVA 3PXFA 4GYGA 4OTDA 2R3IA 5M4FA 1YOJA 3VUIA 3FI8A 3FL4A 3R7VA 4FKGA 3EFWA 3CXWA 5BVOA 3TUDA 4K9YA 4ACCA 3LFFA 4QPMA 1H24A 4QMUA 5F95A 2CJMA 3L9LA 3ZBXA 3DK7A 4ZLZA 3G0FA 4E6QA 4JQ8A 3RK5A 5HGIA 4DCEA 3VJNA 4FNWA 4V01A 1U54A 5ANEA 3FWQA 4IWQA 2YM6A 3VHKA 4ZS4A 3VBXA 2VNYA 3POOA 5IQCA 4DFUA 3CCNA 4YPDA 4CMUA 4BTJA 3AC5A 3FI3A 3RZFA 2WMQA 3RPYA 3HA8A 4FBXA 2KULA 4FTMA 3ORTA 4MKCA 4Z7HA 5FDPA 4H3PA 2W7XA 4XEYA 4E8AA 2OIQA 5IU2A 1QPCA 2ITZA 4LOOA 3W32A 4TYJA 2JKQA 4QNAA 5T3QA 1JWHA 1PXOA 5ICPA 3PJ2A 4DEAA 1FBNA 4DH3A 1CSNA 2ZV2A 3LMGA 2I1MA 4KBAA 4EWQA 4JBVA 2VTAA 5EG3A 5M53A 2R3QA 2J0IA 4DINA 4JT3A 2GNFA 3L8XA 3MESA 5C8MA 1E1XA 3JXWA 4JNWA 3HV3A 2C6IA 4EH5A 3JYAA 3DPKA 4O1PA 4AW5A 1R39A 2E2BA 2QLUA 3FLZA 4E7WA 2B52A 3FQEA 4YJVA 4BL1A 2OXDA 5HO8A 4FTNA 3DBEA 4I6QA 2JFMA 3OT3A 4AG8A 3D14A 2H9VA 1M17A 4JR3A 4OT5A 3THBA 3QF9A 1WVWA 2FSOX 3ZZEA 4FE2A 4BIEA 5F4NA 5HX8A 3AGMA 4NH1A 4F08A 2F4JA 3NS9A 2JC6A 5FBNC 3II5A 5LCKA 3GXLA 3E88A 4II5A 1PRYA 4C0TA 4IC7A 3HMPA 5AIKA 1MQBA 1VR2A 4DGMA 4BY9E 2QURA 2QHNA 4G3EA 3QD4A 1REKA 2J9MA 5AP5A 4A7CA 5AP1A 4YC6A 2EXEA 4J96A 2G1TA 3E7VA 3Q52A 4X3FC 4EH9A 5CEOA 3GCSA 4MXXA 1PY5A 3GU7A 3NUAA 5IQAA 3UIMA 3O8UA 3A62A 5KZ0A 2GQRA 5JEBA 3DTWA 3KRWA 2VWVA 4HPUE 4FTTA 4QMVA 2GS7A 2PVMA 2J0MB 4QPAA 3GU6A 4A9SA 1OKVA 1P14A 3UIXA 2R2PA 3ANQA 5C26A 4CZUA 3KC3A 4YZMA 1Q61A 4FIJA 4OBPA 1G8SA 1PKDA 2UZTA 2GHLA 4FT0A 4USFA 4OTPA 3PRFA 3QYZA 3ZBFA 2WD1A 5B2MA 5DR9A 2BRBA 3OD6X 1UNHA 3TZ9A 4YTCA 1G8AA 2VO3A 1WBPA 3F2NA 4MF0A 3KMWA 3O17A 2BFXA 3QKMA 4L43A 4IZ5A 5D1JA 1OUYA 5HG7A 5CVFA 3I60A 4Q9ZA 4MNEB 2R3HA 5EW9A 4QO9A 4B7TA 4XV3A 4IWOA 3FC1X 3DCVA 2Z8CA 2BRHA 4CVAA 2IW6A 4LV5A 2X8EA 4NYEA 3OHTA 3Q04A 3NW7A 4UWCA 3EL7A 5J95A 4IAIA 1GZNA 1H27A 3EZRA 4GG5A 5IQHA 3AC8A 3RAKA 2J7TA 4UV0A 2QG7A 2C6MA 3SD0A 4NM3A 4AACA 5AV0A 4JX7A 3QCSA 1AGWA 1BI8A 5J5SA 4KINA 4O0SA 5C8KA 4DLJA 2PMIA 1ZYSA 1IRKA 3MTLA 3NYOA 4PQNA 5IQDA 3DB8A 4EOJA 3DQWA 1NVQA 5AUWA 4OLIA 2JAMA 4RC4A 4XH6A 4F9AA 3RM7A 3MVHA 4ZZMA 4CQEA 2UW3A 4WHZA 3R30A 2B9IA 2E9NA 3PSCA 4A9YA 3DXQA 2P55A 2UZNA 4FV4A 2OO8X 3SRVB 5JMSA 3R04A 4N4SA 4OTRA 5CSXA 2UZEA 4A9RA 5KMIA 3GGFA 5DR2A 4FICA 5DRBA 3MJ1A 4ASZA 4RC2A 4C38A 3R9RA 4C57A 1BX6A 4W4XA 5AM6A 3EWHA 1K3AA 1YXSA 2WQMA 3F88A 2HXLA 4EHEA 5M56A 2F49A 4LRKA 3IW7A 3HMNA 4BDEA 4RX8A 2VX3A 4NSTA 4UY9A 4K2RA 5E8UA 5FM3A 3TNIA 4U3YA 4DITA 5JKGA 1L3RE 5JFVA 2IW9A 2YFXA 5EOLA 5EKOA 4U3ZA 5FEEA 1VYWA 3KVWA 5BVDA 1PJKA 3R7GA 4L7FA 1ZY5A 5JN2A 4MWHA 4RIXB 3PE2A 5E8YA 4HGTA 3PP1A 4JR7A 4WG3A 5EM6A 5EH0A 2Z60A 2C6KA 4MXCA 5J9YA 3S0OA 4O81A 3GB2A 5CYIA 4QQ5A 3V01A 2BDJA 4CV9A 1SZMA 4YZDA 3NW5A 4FKWA 4ZY4A 3LCTA 3R8PA 4C4IA 4ACMA 2DUVA 3DA6A 3WZKA 5JSMA 3R0TA 4CLIA 2C5YA 2WAJA 4WUNA 2XRUA 1QPDA 1X8BA 3UOJA 2XIRA 3O7LD 4HZRA 3HV4A 3R2BA 3QYWA 3QA0A 4BICA 3U87A 1Z57A 1LPUA 1ZYJA 4L3JA 3E8NA 3SHEA 3NZ0A 4AN3A 4BCGA 4KB8A 3M1SA 2BALA 3Q96A 3QRKA 2WQEA 3VHEA 3WF7A 3PG3A 2X0GA 4G2FA 2ACXA 4V04A 3M11A 4V05A 2PZYA 4BTFA 3RAHA 1DI9A 3ZYAA 5BVKA 4YP8A 2BRMA 2JDSA 4F9BA 5JQ5A 5FTGA 5KCVA 3LQ8A 3O96A 4H3BA 2YA9A 4OW8A 3SG9A 3BV2A 2CGUA 5DVRA 2V55A 3BIZA 3NPCA 5D12A 4O27B 1P2AA 4RQKA 2EUFB 4R3RA 3ID6C 4EZ3A 5J8IA 5EW3A 3T3UA 4CTCA 4FKOA 2OU7A 1Q3DA 1MUOA 2UUEA 3TIYA 5DBXA 4QYFA 3O8PA 3DAJA 4HCVA 3KU2A 5J87A 4E26A 3I6UA 3FLWA 4IWDA 3CGOA 4AT4A 3ORLA 4YMJA 4H3QA 3OBGA 4I41A 5ETAA 3HAMA 3BYUA 3P1AA 1OI9A 1TKIA 5LARA 4XX9A 4M0YA 1XH5A 2HENA 4MK0A 1XBCA 2I0YA 2RKUA 2VZ6A 3C4WA 3FMDA 4RIYA 2F7EE 1PXJA 4GJ3A 5DWRA 4DH8A 3UIUA 4ALVA 4FSWA 4M68A 5HICA 5D7VA 1FVTA 4IVAA 4RMZA 3DLZA 2NNWB 2UW8A 3KY2A 3NEWA 1SVGA 2C3LA 3LJ2A 4EH8A 2X7OA 4U41A 2PHKA 3A7GA 4BFMA 1YDTE 3V5WA 2ZAZA 2JGZA 3HNGA 3SW7A 4FG8A 4BHNA 3BE9A 4KSPA 3NNUA 4WA9A 3Q4CA 3UIBA 3ODYX 2A0CX 1H28A 2QOCA 3DU8A 3W2CA 3HRCA 1UU8A 1XWSA 4EQMA 2I0VA 2O63A 3G33A 4BDBA 4TL0A 1OGUA 3MH3A 5C01A 4H39A 3CEKA 3QGWA 4J53A 3OWJA 4YZNA 3BLHA 3TWJA 4D58A 4EOMA 3F3VA 2GS6A 4G6LA 2YIYA 2VO7A 3FZTA 3VUDA 3MA3A 3MB6A 4L46A 1UU9A 3L8VA 1K2PA 3BGQA 2W06A 3AGLA 3IGGA 3OT8A 5FXSA 5JGDA 1Q3WA 1OPKA 3BWFA 1OKWA 5LVNA 4ZJJA 1YOLA 2PE2A 3BU5A 5C27A 2R3RA 5CSWA 4IB1A 4O21A 3D5XA 5FM2A 3ODZX 3LXLA 4C58A 2XK6A 4WOVA 2FH9A 4BCNA 5DT3A 2WB8A 4DEHA 5HBHA 3RK9A 4DBNA 3KKVA 4K18A 3OW4A 3ZH8A 1OVEA 1W84A 1QL6A 3BU6A 4AFEA 3FLNC 1F0QA 2V7AA 3FSFA 4ITHA 3A60A 4S32A 2VTQA 1WBWA 4AXAA 5IMXA 3N4TA 5M51A 4I0TA 3FMEA 4C8BA 2ONLC 3P7CA 3HAVA 1ZYLA 2BRGA 2CSNA 3S95A 3BZ3A 3A61A 4LG4A 1PYEA 1B6CB 3HMMA 2I7QA 2OZOA 4ZK5A 3REPA 3R71A 2YAKA 2FYSA 4FIEA 3VRYA 3MFRA 2EU9A 3GI3A 4K77A 4QMNA 4I5MA 4IVBA 4QMTA 4RX7A 5EHOA 3PVBA 4D2SA 1OL6A 2ZB0A 2OZAA 2J0LA 5JRSA 4WIHA 3RNIA 4E20A 1GNGA 3MVLA 3WE8A 2YERA 5E4HA 4Y72A 1J1CA 4I0SA 4U97A 5DN3A 4M67A 4MBJA 2RFNA 3TKIA 3NYNA 4FTKA 4NCTA 5CVGA 3U51A 3W16A 3WZUA 3ACJA 3FMNA 3CQUA 4Y95A 5HVYA 4CG8A 5HVJA 4IVCA 4DGOA 2XKFA 3PXQA 4FOCA 4HZSA 5K0XA 2I0EA 1M7QA 1U5QA 3LCOA 4MYGA 4AT3A 5CNOA 3O71A 2CMWA 3DZQA 3IECA 3P78A 3PY0A 4IE9A 4JQ7A 4PDOA 4U40A 4QTDA 4RA5A 1PXPA 3AT4A 4G3DA 3S4QA 3TTJA 4YO6A 3V5JA 3ZDUA 3F3WA 4DFNA 5HNIX 2H34A 4EOPA 1UKIA 5L8LA 3QTZA 4GCJA 4N70A 1SMHA 4FKVA 4F4PA 3ZUTA 3MPAA 3AC1A 4IM3A 5GZAA 1U5RA 1APME 2R3PA 5GHVA 3LFBA 5IEXA 2PVYA 2QOIA 3OEFX 5C4KA 3ZC6A 2VWIA 4GK3A 3UG1A 3IW8A 5A14A 1OUKA 4B9DA 5BX0A 2C6TA 4YLJA 3FHRA 1SYKA 2PL0A 4BWXA 3I79A 1UWHA 2RGPA 3D7ZA 4L9IA 4AN9A 4D1ZA 4NT4A 4F9WA 5M06A 3PA3A 2BAJA 2HCKA 4EORA 2X7FA 4W9XA 5H8BA 4G6OA 3TTIA 3DK3A 4XMOA 4YZBA 3Q6UA 5HCYA 4Y73A 3C4FA 1PF8A 1WCCA 4NKAA 1ZMUA 2ZMDA 3IS5A 4I21A 4XNEA 2UZDA 3MBLA 4F6WA 3FMJA 3OWLA 4JIAA 4TPTA 3WZJA 3ATTA 5IEYA 5AR3A 4IB5A 1SNUA 3EQFA 4N0SA 5KMMA 2ZV8A 2A2AA 1H25A 4NEUA 5FQDC 4F1TA 2X6EA 3OCSA 2LAVA 5JGBA 3BELA 2GNJA 2BRNA 4OTGA 3JR1A 5H2UA 5L2WA 5CAPA 2GQSA 2CN8A 4F7LA 3GCPA 1Q99A 3ENMA 2Y6MA 3RNYA 3ZDIA 2PVRA 4QTBA 3FPQA 4KWPA 4B6LA 3UZRA 1OZ1A 2Y6OA 1XR1A 5IEVA 3QQUA 4M15A 4R3PA 3VIDA 3ZUVA 4LMUA 5IUHA 1V0PA 3R1SA 3AMYA 4CD0A 5L2TA 3FQHA 4JBOA 4WRSA 2JDOA 2VO0A 3AC3A 3O50A 2WOUA 5EYDA 4AGWA 3EFLA 2J4ZA 4FNXA 3MA6A 4DFYA 3KQ7A 2RFDA 5EDRA 2FO0A 4RLLA 2FSLX 3C0HA 4TKSA 3GBZA 5AV3A 3ALOA 4QYGA 3L8SA 3VUMA 2XM8A 3F5GA 3DBFA 1FPUA 3GENA 3UP7A 3P5KA 4R5SA 1TQPA 4V0GA 3I4BA 4OGRA 5BVNA 4K33A 1U46A 4X2FA 4HVHA 3F2AA 5I9XA 3NDMA 2YISA 4YJRA 4I6FA 3EQPA 4BBFA 3BLQA 3DNDA 4NM5A 2UW0A 3QC9A 4UX9A 4YJTA 3EQIA 4M69A 5D10A 4ZSAA 4RSSA 1WVXA 3Q3BA 2E9PA 4DFLA 2ESMA 4E6CA 5M57A 3E87A 3H10A 2P3GX 3NUYA 4QYEA 4EK6A 3RAWA 4E4NA 4Y8DA 4ZP5A 3KL8A 5DLSA 3FEGA 3OWKA 4YHTA 2X39A 5KNJA 4D1SA 4MVFA 5HIEA 3FKLA 3R1NA 2DYLA 3IK3A 4MD9E 5AUUA 3MDYA 3BHHA 3R1YA 3SV0A 4CKIA 2WPAA 3I0QA 2QNJA 2C3JA 3QUPA 5C03A 4ACGA 2QOHA 4JQEA 2ETMA 4PPAA 5D9HA 1SVEA 4C62A 3PYYA 2CGVA 2JKKA 4BBEA 4BKYA 5IUGA 5AR4A 4E6AA 5EHLA 4U0IA 4MBIA 2CKOA 3RI1A 4FX3A 3C1XA 5AA8A 4ANSA 4BGQA 4KBCA 4E5AX 2C0OA 4F70A 1YHSA 2C5OA 4MNEA 4YJNA 2UVXA 4FV2A 4JS8A 5KMOA 5GJFA 5C1QB 4DF3A 3R1QA 3CTJA 4R5YA 4EBWA 3FHIA 2JLDA 1Z5MA 3KN5A 4FTIA 4YHJA 4BCFA 3E3BX 3G6HA 1Q8WA 3QTSA 3PUPA 3KULB 2C1BA 3QWJA 3WARA 4ERWA 5J79A 3UTOA 3R6XA 2HZ0A 3KF7A 3TJCA 3CTQA 3VQHA 3FYKX 4IAYA 3R00A 5CQWA 1ZAOA 4BDIA 4WKQA 2XCHA 2JDTA 4QMMA 1KV1A 3A8XA 3DDQA 3I7BA 5TR6A 4AGDA 2B4SB 4CRLA 5IH6A 4BDKA 4D0XA 3WYYA 3FZPA 3LFSA 3UJGA 4BWPA 3PG1A 2EXMA 3DDPA 4BC6A 1KWPA 4XG3A 2P0CA 4EH3A 3OEZA 1R78A 3FLYA 4FC0A 4FZFB 4RVMA 5C9CA 3VUTA 3QZFA 4YO4A 4A4OA 2QKRA 1SVHA 2YM3A 3MVMA 2QC6A 3EHAA 1NY3A 2YN8A 2XVDA 4FT9A 3I81A 3UOLA 4M3QA 4C61A 3ZHPC 3QQLA 3KRRA 4NTTA 4EK4A 3ORMA 3LMIA 4F0IA 2FA2A 4G1WA 5KMKA 4C4JA 5L8JA 1P4OA 3H9OA 2RIOA 5BVEA 4PP7A 2VRXA 3OCBA 3RALA 4ZJIA 4BZOA 5IKWA 4BDAA 4AZTA 4NIFB 3RTPA 3PLAE 5I9YA 3Q9XA 4LQMA 4IXPA 5KHXA 2BKZA 4L68A 4EOIA 5EOBA 4O7TA 3MWUA 3W10A 4ZMEA 4AGCA 2IWIA 4YNOA 2JEDA 3CD8A 4BCPA 3AMBA 3BE2A 4KBKA 2CPKE 4A06A 4ANNA 4BCQA 2I40A 2IVVA 1R0PA 4RIXA 5FG8A 3CTHA 2ZOQA 4RWJA 4FKJA 4MNFA 2EWAA 3ALNA 3GCVA 3PVGA 3ZSIA 4AT5A 5HBEA 1OIYA 2JKMA 3MPTA 5A6OA 5CEMA 4FVQA 2EXCX 2VTJA 4ANMA 4C37A 4QD6A 4O0RA 3VS2A 3JVRA 2A1AB 5A4EA 2R3JA 4KD1A 4LGHA 4ZAUA 2WTIA 4F65A 3DJ6A 4O0YA 4ZY6A 2QU6A 5GIOE 4P2KA 2HW6A 5G1XA 3W55A 5CAVA 4DGGA 3BPRA 1T45A 3QQHA 5DNRA 3LXNA 1REJA 3GNIB 3ZFYA 2E9VA 4D4RA 3PDTA 4IW0A 3UYSA 4E4LA 2PUPA 4UWYA 2PTKA 3DFAA 4TWNA 4ZTSA 3VUGA 5AEPA 3F5UA 4WNKA 3QC4A 5DEYA 5AAFA 3W8QA 4GUEA 4NKSA 3SQQA 3WILA 5EQPA 2QODA 4EHZA 3Q2JA 2PVLA 4WBBB 3KCKA 2PZPA 4CT2A 4D0WA 4FVRA 2DS1A 4PMSA 3V51A 4P90A 4M7IA 5KKRC 2YDJA 2R0UA 4G5JA
chains in the Genus database with same CATH superfamily
3K5VA 2PSQA 1SNXA 2V22A 2BIYA 3WYXA 4U8ZA 4AZFA 4QYHA 3B2WA 4RT7A 5E8VA 2PVKA 3BQCA 4APCA 3I5ZA 3FMKA 1H00A 3NIEA 1KE7A 2WIHA 3QTRA 4FIHA 3CQWA 4DDGA 2W5HA 3H9RA 1Q8TA 2J0JA 3C51A 1JKKA 1UA2A 4QTCA 5AP6A 4YBKA 3JY9A 3V5QA 3O2MA 2QO7A 2C5NA 2NYAA 3NCGA 3IO7A 4JDKA 4X21A 5HNGA 2CGWA 3TEIA 3W18A 3EQGA 4AW0A 4X6QC 5KHWA 4ZLOA 2IZTA 4NZWB 5FUTA 4GIHA 2JAVA 2YAAA 2NRYA 3HDMA 4EH2A 3D7TB 4FA2A 1F5QA 3RWQA 2OFVA 4LGGA 4WSQA 2ITQA 3ORIA 4ID7A 4DA5A 4D1XA 5CAOA 4UZDA 4ZIMA 2ETRA 3VF9A 5IPJA 1BI7A 3FMHA 2W0JA 5AUTA 2F2CB 1H01A 3ZFMA 4X3FA 2W05A 4IZYA 5AV2A 3QZIA 4ZTMA 5FGKA 4FL2A 1Q5KA 4PF4A 2QU5A 3AKKA 5ETFA 5A4LA 2QCSA 4BCIA 1KV2A 4C59A 4HYIA 4P5ZA 5E8TA 5CU0A 4R3CA 5BV3A 1CTPE 4E3CA 4BYJA 5E8SA 4U81A 3ZUUA 4G9RA 3GEQA 4WT6A 5DMZA 2UW6A 2Y4IB 3AC2A 4GVAA 4Z9LA 3NLBA 3OF0A 4ACHA 1PHKA 3UODA 3QX4A 4RVTA 4XV1A 2R3NA 4KKHA 4ZOGA 1J7UA 3ATSA 4DE4A 4WSYA 1T46A 3H9FA 2YIRA 3GCUA 4HYSA 4GFGA 1FVVA 4DH1A 5F94A 3AG9A 4MHAA 4EHVA 3Q32A 1TQMA 3P79A 3I5NA 1PW2A 4FEQA 5AUXA 4I92A 2ZMCA 2J5EA 3O51A 5ACKA 3VNTA 1YKRA 4DFXE 4O0VA 4FG9A 2ZJWA 3R28A 5EW8A 4DHFA 1R0EA 2O65A 2BZHB 4RG0A 1M2QA 2C0TA 1WBSA 4FKIA 1WAKA 4D2PA 3CY2A 4OR5A 2PMNX 3Q9ZA 2O3PA 4BI0A 3BHYA 2RFSA 5FP6A 4W8EA 5CX9A 3BLRA 2IZRA 3PY3A 1J3HA 4R7HA 5LOHA 4ZTQA 3R83A 5E91A 5CEKA 5ANJA 1JKSA 2VWWA 4GK2A 3B2TA 3NAYA 4MD7E 4L00A 1LUFA 2B7AA 4RIWB 1F3MC 1MP8A 3GOKA 4MWIA 4FTJA 4ONAA 4TWPA 5GZ9A 4CYJA 4J71A 4MUQA 4CMOA 2XZSA 2O2UA 4AZSA 4OTFA 4FTLA 1CKPA 1U59A 2CLXA 2WOTA 2OBJA 2J0KA 4A07A 2BR1A 1IR3A 4ZSLA 1OBGA 2Z02A 4Z3VA 4WG5A 4HVDA 5TKDA 3RP9A 5IA2A 2V62A 3Q4ZA 3H0ZA 4FUXA 1LEZA 4IC8A 4QOXA 3D9VA 5K5NA 4RFMA 3DTCA 4XG8A 3ULIA 4AS0A 4DH5A 5AFVA 4LV7A 2HYYA 5IDNA 5I3OA 4EI4A 3VS3A 3VS0A 2Q0NA 4CNHA 3WOWA 5EM7A 2IW8A 3WF8A 3GU5A 4YZCA 4ARKA 2OI4X 3PZEA 4KNBA 4XCUA 3FZRA 3LFDA 3PE1A 4JX3A 4AWIA 4MH7A 1IEPA 3UO6A 2PUNA 4FTCA 3VO3A 5HTIA 4GEOA 1A06A 5F20A 1YXTA 2WQBA 3UOHA 4DT9A 4E1ZA 3EIDA 3NUXA 4ZXTA 4D2RA 5J7HA 5EDQA 2GFCA 4RZWA 4XHKB 4HW7A 2UW5A 3FUPA 3F61A 4FZ6A 3RHKA 3HV7A 4EQUA 5EKNA 4FIFA 1GZ8A 3R9OA 4YJUA 4AXFA 5IDPA 4I24A 3BHUA 4IM0A 4HCUA 4CZTA 5IA0A 3ZU7A 4WNPA 3R21A 4IM2A 3MH1A 5CI6A 2A98A 3EFJA 4MD8E 3TZMA 4FEVA 3MFTA 3VBWA 3ZTXA 4C35A 4CTBA 3HDNA 4FYOA 4KAOA 4QP9A 2O8YA 2R3GA 1GAGA 2VTMA 5FLFA 3UOKA 4RJ6A 4L52A 3ERKA 4DT8A 3NVKI 1WBVA 2X9EA 4FI1A 5DA3A 4LRJA 4FZDB 5HVKA 2XNBA 5DPVA 5IMEA 3TYKA 3QTWA 3KCFA 4E4XA 4X3JA 3LFEA 3QAME 4FTQA 4RQVA 4S31A 4IJPA 1PXMA 3C4EA 2P33A 3EFKA 4QDVA 5CF6A 4C4GA 4DLIA 3S3IA 1YI6A 3F6XA 3KVXA 2CNUA 4AUAA 4IAAA 4I20A 2UW4A 4A4LA 3QBNA 5DR6A 1OL5A 2A4LA 3FBVA 5AUYA 4I6BA 4AP7A 2GDOA 2BDFA 2OJGA 2YM5A 3LCDA 1XMLA 4AXDA 3RPSA 3BQRA 3D5UA 4XG2A 5D41A 4I93A 1RE8A 2XA4A 3I0OA 2VWZA 3FZSA 5T68A 4P7EA 3RK7A 2WMRA 3F7ZA 3M42A 4X6RA 3R9NA 1ZRZA 3MB7A 4BN1A 4DHZA 4GRBA 1OL1A 1XHAA 2C5VA 5HG5A 1ATPE 5DT4A 3ACKA 1XH9A 2VGPA 3LMHA 1FVRA 2QR8A 2NRUA 3VJOA 2JIVA 2XKDA 3ZLWA 2VX1A 3EQRA 3UNZA 1YDRE 5EQEA 1Q62A 1CKIA 3LQ3A 3K3JA 3RPOA 4O7YA 4PMMA 5I3RA 2C6LA 3PRIA 3WI6A 3PSDA 1GIHA 3PIYA 3TL8A 4D4VA 4R1YA 5BYZA 4RJ4A 5IQEA 5IG1A 1EH4A 5GNKA 3D5WA 3ZXZA 5ANDA 1ZZLA 5HG8A 4YLLA 4O0UA 2HWPA 4BWKA 4AFJA 2UZLA 3QZHA 1IG1A 1ND4A 3G9NA 4MTAA 3DZOA 3FZ1A 4N57A 2QOFA 2FUMA 4GU6A 3WIGA 3BL7A 1AD5A 3QXPA 2XYUA 4B8LA 4EL9A 4O7SA 3EQHA 4FZ7A 2HY0A 2O5KA 4UXQA 3T3VA 4UN0C 4FT7A 4TYHA 4BDHA 2WU6A 3UQFA 5HTBA 1Y91A 3OXZA 2F7ZE 1B38A 2VNWA 3TJDA 4HGSA 3KRLA 4ASDA 4AF3A 3JVSA 5CU2A 4QRCA 4R6VA 5L2QA 4BCOA 4O7NA 2QOLA 3GOPA 4G3GA 2NPQA 1IA9A 4RFYA 3ANRA 4IB0A 2VWUA 4DG3E 3CS9A 3LLTA 4M97A 3O23A 1WBOA 2WQOA 5JZJA 2BPMA 5HLNA 4CEGA 2NO3A 2YACA 2HAKA 1W0XC 4QMZA 4AW1A 2WKMA 3R8ZA 4Q5EA 4EH7A 4EOLA 4CCUA 5A46A 1U4DA 3F69A 4RWKA 3EB0A 3UBDA 3DXPA 3O5AA 4S2ZA 3LLAA 3R7YA 3QTXA 2AUHA 4P5QA 4PY1A 2CKQA 4FYNA 3IQ7A 3GU8A 3DK6A 5AR2A 2VTSA 3BBWA 4ZZOA 2HW7A 5LXMA 2J90A 5J1WA 5E8WA 2YHVA 2J50A 3HZTA 2ZVAA 4D5KA 3QX2A 2ONLA 4FK6A 4PTGA 4TRLA 1PMUA 5EM8A 4QP3A 4F6SA 4LL5A 2BMCA 5CI7A 1TFFA 3QWKA 2AYPA 1U54B 3D5VA 2XBJA 4GJ2A 3DJ7A 3ZO1A 3UNKA 3W2SA 4X2KA 2WQNA 2W4KA 4O22A 3PY1A 4DG2E 5EYCA 4O84A 2R3OA 3DNEA 4BDJA 3BYSA 4FSNA 3WF9A 5GZ8A 4YJPA 2WMSA 4I5CA 1Q8UA 2FSTX 2Z7QA 5E7RA 5E92A 3ZO2A 3C4ZA 2PZ5A 1YXXA 3OS3A 3NUNA 3IOKA 4M0ZA 3FKNA 1YXVA 2X6DA 3V6RA 1AQ1A 3L1SA 3PTGA 5I4NA 4FEWA 3ZRKA 3VQUA 3HMIA 1GZOA 3CP9A 4BDGA 1KOBA 3CD3A 1H1QA 3Q2MA 3GQIA 3DQXA 2RG6A 3QRJA 4W4WA 4AA0A 3TDWA 4PDSA 3PFYA 2QI8A 1OL2A 2CKEA 4FL3A 1BMKA 2VTOA 2OH4A 4BYIA 4EOSA 4USEA 2HOGA 2UW7A 4HYHA 4QP4A 2OXYA 4EZ5A 3IG7A 3PWYA 4AQCA 5HX6A 4X2GA 3C7QA 4BRXA 3OY3A 1UU7A 4ERKA 4TT7A 4YC8A 3C13A 3W2QA 4L3LA 3QUEA 1GY3A 2BHHA 4ZSEA 2GCDA 4CQGA 2WMWA 1UNLA 3AD4A 5IISA 5M4UA 3SAYA 2ZM4A 2XK3A 4FV3A 1DAWA 3DS6A 4OT6A 4TNDA 4YTHA 3HUBA 4G31A 3GP0A 1XH4A 2XJ1A 4TNBA 3Q4UA 4EBVA 2PULA 2V7OA 3FSKA 3QFVA 4FV6A 4OBOA 3UNJA 5ITAA 4O86A 4CG9A 2GTMA 2ITOA 3BGZA 3HUCA 2R3LA 4GG7A 3BCEA 4XP2A 2QOOA 4JDIA 4CRSA 2YZLA 4KRDA 3MW1A 1YRPA 4O83A 5IH5A 2ZB1A 5HESA 5LVOA 1NW1A 4CYIA 2W99B 4RRVA 5IUIA 1HCLA 4Q2AA 3TV6A 1Y6AA 2JIIA 2R64A 1MRVA 5A4CA 4OTWA 4QYYA 5CAQA 2YWVA 3W0PA 3MYGA 3ZLSA 3KK9A 4UMQA 4AN2A 4O4FA 3G90X 3KMMA 2BIKB 2XNPA 2XK9A 1LEWA 3ZONA 4NJDA 1W8CA 3ORXA 4X7QA 5C4LA 4DG0E 3IW6A 4PP9A 2W5BA 4GT4A 3UMXA 4QP7A 3QCXA 4BGHA 4C36A 5CF8A 5CTPA 5CEPA 1JVPP 3LHJA 5EDPA 4A9UA 2AEGA 1I09A 4ASXA 3QTIA 4I4EA 4ZTNA 3E62A 2PPQA 2KTYA 4NJ3A 3BI6A 3E63A 2XP2A 3AC4A 3HEGA 2PY3A 4L8MA 2A27A 2WMTA 2B1PA 5B7VA 1H0WA 3R22A 4K6ZA 4DAWA 3NCZA 4BVUA 4F7SA 4IACA 2WTKB 3EOCA 3W2PA 4KIKB 4F99A 4XP3A 1A9UA 2XUUA 4I0RA 2VTRA 5M4CA 3MTFA 3G9LX 3UYTA 2XIZA 3OXIA 4BBMA 3LPBA 2LGCA 4LGDA 5TO8A 4O0WA 3BHTA 4G17A 4XLVA 4O7LA 4CSVA 1KE6A 2PVJA 2W1FA 5LJJA 5A54A 3CLYA 1YI4A 2C6EA 1PMEA 5AWMA 1RDQE 4LMNA 2ERKA 2G01A 2QO9A 5HO6A 2XBAA 2PYWA 2WTCA 2UVYA 3GQLA 2WFYA 3PZHA 4RBLA 5IH4A 3LCSA 1G8KA 4M66A 1GJOA 3F9NA 3LE6A 4OTIA 5AAGA 3P0MA 2CLQA 4UYAA 3AMAA 3V8SA 4ZJVA 2PMLX 1FOTA 3COMA 1YHVA 2WMUA 4DEDA 3NUUA 4Z16A 3DGKA 4UXLA 3A8WA 3GT8A 4R78A 5DGZA 3ZZWA 2B0QA 2W1CA 3LXPA 2BVAA 4RZVA 2BFYA 3BV3A 2IEWA 1VEBA 3AXWA 4IHPA 2JBOA 5K9IA 1DAYA 1H1WA 1J1BA 2XKEA 4XLIA 4AZWA 2R3FA 3GCQA 4ZZNA 2XIKA 4R7IA 4YR8A 3MFSA 4PPCA 5HO7A 2XJ0A 4JOAA 3KEXA 1J7IA 1GZKA 4LFIA 3E93A 3RGFA 3FYJX 2OWBA 4H1JA 4TY1A 2XRWA 3S1HA 1NVSA 4JAIA 3R9HA 3G15A 4NFMA 5M09A 4NU1A 3QQJA 2NP8A 2QKWB 3D83A 2OIDA 3Q53A 5AX9A 3DFCB 2VTTA 5CS6A 5L4QA 3CKWA 4DEBA 3K3IA 4OBQA 3RCJA 2RF9A 2YZAA 3UVPA 4FTOA 4PDPA 1ZXEA 1O9UA 1DI8A 1P5EA 2V5QA 3H30A 3L9NA 3NMUF 1XQZA 5JFXA 4J52A 5AP0A 3NYXA 3OFMA 2GHGA 2R9SA 3VUKA 3PSBA 4FNYA 3KXXA 4D5HA 2PUUA 3BU3A 2YEXA 1ZOHA 4G34A 4E4MA 1WBNA 3B8QA 4BDCA 4HVGA 3KGAA 5L6PA 3UDZA 1DM2A 2P2IA 3NNWA 4FZAB 5LVLA 5IF1A 5DYJA 4TW9A 5AP7A 3D2KA 3GFWA 3KB7A 3TXOA 4BDDA 2HZ4A 4RC3A 2AC3A 1MRYA 4J99A 5BUIA 5CXZA 4YLKA 3U9CA 3UE4A 2R4BA 3PFQA 4EYMA 5FXRA 3TNPC 1R3CA 3PLSA 4LI5A 3SA0A 4FV8A 2UZVA 2BDWA 2XS0A 4EWHA 4HVSA 3QUDA 3QKLA 5BYYA 2X0OA 4C4EA 1KSWA 3TACA 4DTBA 4HJOA 3S2PA 3VBTA 4AX8A 4D28A 3OY1A 2ZFYA 5HI2A 4FKSA 2G15A 2Y4IC 2WEIA 4O0TA 5HE0A 4EZ7A 4AXEA 3PXRA 3DLSA 3LM5A 4IMYA 1UV5A 4OTHA 4A4XA 3C5IA 5BUJA 4R7BA 4MXOA 3N4VA 3TUCA 4IAFA 5KX8A 1Z9XA 2OJFE 4XP0A 4JIKA 4EOOA 4FNZA 3TKUA 5ANKA 1UNGA 3D0EA 2C3KA 4JG8A 4CCBA 4EH6A 3VC4A 2HZIA 1YXUA 2ZDUA 1FMOE 1SM2A 3D15A 4IAZA 3VW8A 3ZM4A 4ANQA 4CXAA 3Q5ZA 2Z7RA 1J91A 1W98A 3E5AA 1ZYCA 1CMKE 3L8PA 3SXRA 5KUPA 5DT0A 1VYZA 5CLPA 3GVUA 3QU0A 1FQ1B 3W2RA 4O7WA 5JZNA 3MH0A 4AU8A 2OG8A 4U42A 1NT2A 4PRJA 2BAQA 2W1GA 4FSTA 5H9BA 2QLQA 5DI1A 3SXFA 2XARA 4UMRA 3ZOSA 1H1PA 1GIIA 4PMTA 4FIIA 5HEZA 2ITPA 5A4QA 3DT1A 4L42A 5IQBA 3ZXTA 4HGEA 1P4FA 3A7JA 1W83A 1OIQA 3TV7A 2YABA 4XUFA 4ZSGA 4QP1A 2X7GA 3VVHA 5FD2A 3SG8A 4U7ZA 4KABA 3HMOA 4ITJA 5HU3A 4BCKA 2BTSA 2YIWA 1KE5A 1JKTA 5HIBA 5EQYA 3FL5A 4FV5A 3A4OX 3W33A 2OJ9A 3FLQA 3QRUA 4OAUC 2REIA 4C02A 3P23A 5KMJA 4IZAA 4D4YA 2X1NA 4M13A 1H26A 3TM0A 3LFCA 2Y0AA 3MPMA 4U44A 3WBLA 2OSCA 2YM8A 3TN8A 3V6SA 4AZVA 3SRVA 5IA4A 3RJCA 3AQVA 2X8DA 4L67A 2YJSA 2XK8A 1H1SA 2ITNA 1IAJA 4PTEA 2C5XA 3QGYA 1OECA 5TT7A 5CVHA 3VAPA 1XH8A 4BGGA 4IFCA 3GC7A 4JXFA 2BCJA 4PV0A 3PPKA 3LW0A 4RPVA 2IO6A 4YUQA 3FPMA 4RIOA 2PE0A 5LWMA 2ERZE 4U43A 2IPXA 3LKMA 1W82A 1V0OA 2YJRA 1PMVA 3DKGA 3PVWA 5IQIA 5CZHA 3A99A 4H58A 4S33A 1RW8A 5EK7A 3LVPA 2XEZA 4Q9SA 1QPJA 4TXCA 2JBPA 3IOPA 2BZIB 5EHYA 4BCHA 5J9ZA 3C4XA 5IZFA 2O0UA 5CEQA 3CE3A 1H4LA 4I5HA 4B0GA 2WTDA 2WTWA 3NUSA 3R2YA 2GFSA 4O2ZA 3FC2A 1HOWA 3LJ0A 3QTUA 2JFLA 3R8UA 4F9CA 3FE3A 3P7AA 4F0FA 2CCHA 4Z7GA 4Y83A 5C8NA 5LVPA 2AC5A 3EMGA 2W9FB 4M12A 3AD5A 4AZEA 2I6LA 4O7RA 2Z7LA 2E9OA 3NNVA 5H8GA 4H1MA 4D2VA 3UG2A 3OTVA 4IB3A 3EYHA 3C0GA 1IA8A 4TWOA 5CALA 4FSQA 3LFAA 3PXKA 2ITXA 5ANOA 2OZAB 4QMPA 5CF4A 3DBDA 4BKZA 3BGPA 5L3AA 2H96A 5EFQA 4A9TA 4AA5A 5BUEA 5LWNA 3LIJA 3MH2A 5JH6A 3UO5A 3TDVA 2XIYA 4NM0A 2YWPA 2Z2WA 3Q9YA 2X4ZA 4YPSA 4GFOA 3FJQE 5E90A 4EKKA 5CXHA 3ZSHA 4FKTA 4JAJA 4ENXA 2WGJA 4FF8A 3CY3A 3C0IA 5FP5A 4FKLA 4FSMA 3HP5A 5HORA 5IA3A 3O7LB 4K11A 4DFZE 3EN7A 4YNEA 4ENYA 3W1FA 3EQDA 5B2LA 4RJ3A 2YITA 3EQBA 3POZA 3TT0A 2X81A 3P5JC 2OKRA 2I0HA 2YM4A 3FY0A 3VBYA 4BHZA 4XJ0A 2VTHA 4ZSJA 4BI2A 3FXXA 2RG5A 3IDPA 3KRXA 3LFNA 5TF9A 2XIXA 3TZ7A 2VAGA 4WG4A 3HL7A 4MEDA 4JBPA 1Q97A 4CFWA 4WUAA 5A9UA 3QD0A 1FMKA 3PJ8A 3PJCA 2XB7A 3U4UA 5BYLA 1MQ4A 1JKLA 5HOAA 3EKKA 3PIXA 4UB7A 3IKAA 5AP4A 2B9JA 2C0IA 4L44A 4FKRA 3A4PA 3OROA 3SC1A 4C4HA 4QTEA 3ITZA 4G5PA 3MIYA 5HE3A 5LMKA 4EUTA 4I4FA 5ETIA 3C4CA 3CJGA 4O1OA 2C6DA 4PUZA 3CJFA 3TG1A 2QD9A 3W8LA 3WE4A 2BHEA 2RSVA 4C3RA 1YWRA 4GT3A 2XYNA 4PL3A 4RJ5A 5FWKK 5IA1A 2QHMA 4GIIA 4DTKA 4DYMA 4NUSA 4GVJA 4XRLA 3FLSA 4EC8A 1DS5A 4MAOA 4PDYA 2YCFA 4EK5A 4BF2A 4LOPA 5HNBA 3F2RA 3EZVA 1OPLA 4KS7A 4GSBA 5AIRA 3W0NA 5EYMA 1IAHA 4S34A 4FGRA 3UDSA 2IVTA 4UWBA 2PVFA 1JBPE 5JK3A 1E9HA 3NW6A 2R7IA 4GFMA 1RJBA 2PVHA 1W7HA 4IX6A 5CT7A 3SOCA 2WO6A 2JDRA 2XH5A 2GMXA 4BZDA 2SRCA 4JL9A 4FMQA 4J7BA 4I1ZA 3HA6A 5LMAA 2VTLA 2X2MA 3QLGA 4O91A 3ROCA 4IBMA 3U6HA 3PPZA 4BTMA 4GL9A 2R7BA 2Y8OA 2OH0E 5FBOA 3UQCA 1OL7A 4U45A 4XRJA 2O64A 5D7AA 4DC2A 4QTAA 4E5BA 2OLCA 5E8XA 4FG7A 5JFWA 4E6DA 3PPJA 1OIUA 4G9CA 3NYVA 3OVVA 4N6ZA 5L2SA 3BEAA 4U5JA 3BX5A 5HQ0A 4KS8A 4BCJA 3UZPA 4NW5A 4QMYA 2F9GA 5ACBC 5LMKC 4MBLA 2V0DA 3FZOA 5I9UA 5I9WA 3GU4A 4QDEA 5CENA 1ZOEA 4NK9A 4O4DA 4V0GB 1M52A 3KXZA 3R01A 1JSVA 2X2KA 2W1EA 3QL8A 4XV2A 1ZARA 5CU3A 5AUVA 3QCYA 3R7UA 4RX5A 3K5UA 3DKCA 5F1ZA 2WELA 5CF5A 4FL1A 4F63A 2IN6A 4ZTHA 4JJRA 1YQJA 4D9UA 3R8LA 3QQGA 3VRZA 4UMUA 4ZY5A 4I94A 2WHBA 2XNOA 4LL0A 4M69B 3I7CA 4RX9A 1QCFA 1O6YA 2ITWA 4HCTA 3FXZA 4D4SA 3ETAA 3DY7A 4QNYA 4YBJA 4KSQA 1JAMA 3QD2B 3KXHA 2VX0A 4MX9A 3R7OA 5CSVA 5JRQA 3OBJA 1MRUA 3RPRA 1ZZ2A 3IGOA 3LJ1A 4UALA 1Y8YA 3TZ8A 3QD3A 4IZ7A 2CHLA 4HGLA 4JG6A 4O4EA 1OKZA 3Q9WA 5CU4A 3UVRA 5AADA 5I5ZA 4FEUA 4D55A 2PU8A 4FT3A 5J7BA 3RVGA 3NFGB 4WO5A 4CKJA 4R77A 5LQFA 5M07A 2CGXA 2WMVA 3H4JA 4L6QA 3MJ2A 3AT2A 3NUPA 5I9VA 1R1WA 1BKXA 1NA7A 5ANGA 1YVJA 4AAAA 4F7NA 4JLCA 4O7ZA 3MSSA 5H8EA 3FQSA 4FSYA 2G2HA 3TNQB 2BZJA 4APPA 4CFXA 4DDIA 4BJJA 2BKKA 1Y57A 4O6EA 3HECA 4GUBA 2C3IB 3E8CA 4L45A 4QEBA 2E9UA 5KBRA 2B55A 4HPTE 4KIKA 2UZBA 4O4BB 1URCA 3E3PA 4PPBA 4UYNA 1UU3A 3TI1A 1OMWA 3ZRLA 4CV8A 4GKIA 4RWLA 5H3QA 5G6VA 3IONA 3LOKA 2XMYA 1L8TA 3HKOA 4AE6A 1OKYA 4XOZA 5GIPE 2W1IA 4M14A 4ITIA 3DXNA 1G3NA 4C4FA 1KOAA 2P4IA 5J9LA 1H8FA 1W2FA 2PK9A 1YW2A 2VTPA 3E7OA 3FI4A 4BIBA 3F5XA 4IDTA 2HK5A 4L53A 2BILB 4GT5A 2XALA 5K5XA 3MY1A 4C3PA 3WIKA 2YIQA 2WMBA 1XBBA 3QRTA 1WBTA 4U6RA 4U9AA 2XNNA 1BL6A 2QG5A 4FR4A 4FEXA 2FVDA 2VO6A 2Y7JA 4DH7A 3VONA 4FGBA 4FSZA 3QZGA 4QMOA 4YSJA 1O6LA 4ZS0A 1CM8A 3MVJA 5AUZA 4FKQA 3G0EA 2VU3A 2BUJA 2YIXA 2UVZA 3UP2A 2DQ7X 2GHMA 4EQCA 3ORKA 4KRCA 4XS2A 1M7NA 2QOBA 4YTIA 3IW4A 3DKFA 3PUFC 4FTUA 4IANA 4IX4A 1K9AA 2WTKC 5DIAA 2Q83A 3LFQA 3VBQA 3QKKA 3H0YA 4GV1A 4DN5A 5KKRB 2A19B 3B8RA 3NX8A 4K1BA 3NSZA 2G2FA 4X0MA 3CKXA 5CQUA 2P2HA 1OGYA 1UKHA 3FDNA 4C34A 5F9EA 4I5PA 3NIZA 5M08A 2ZYBA 4FTRA 2X4FA 4EHGA 4CKRA 3T9IA 3HLLA 3ORZA 3R73A 4M84A 2RFEA 3FXWA 3PWDA 4FKUA 3TIZA 4YJSA 4RJ7A 2R3KA 4CFMA 4DBXA 3GC0A 3A7IA 2XAOA 3ZC5A 4BDFA 2H8HA 3ZLYA 2HELA 2C47A 4MXYA 4PX6A 4IQ6A 2UW9A 1IASA 1LP4A 1J7LA 1ZMVA 4PL4A 2IVUA 5J5TA 4FV0A 4NW6A 3VS6A 5KBQA 1JSTA 3OMVA 3TNHA 3R7EA 5BVFA 2BAKA 5DRDA 4I6LA 2VD5A 3WZDA 3P7BA 3V8TA 4G3CA 3QALE 4Y5HA 3U8WA 4C3FA 3ZLXA 2W4JA 5DFPA 2WNTA 3DV3A 3AT3A 4O0XA 4QMSA 4AOIA 2GTNA 4MF1A 4FIGA 4AGUA 3NR9A 4F64A 5CAUA 4QP8A 3CBLA 2WTJA 4PL5A 3UZTA 3I6WA 3CC6A 3VS7A 5BVWA 3LZBA 4U79A 1QMZA 4HVIA 3CIKA 3E8DA 3IDBA 4PTCA 4BB4A 4O6LA 4LM5A 4DEGA 3AD6A 2EB2A 4PWNA 2JIUA 1W2DA 3QTQA 3CPCA 3WF6A 1WZYA 3VS1A 3EH9A 4O38A 5HZNA 4TTHB 1BL7A 1JSUA 3NRMA 3HRFA 4FTAA 2EVAA 4QT1A 1PXKA 4W4YA 4E93A 4UEUA 4F09A 4YZ9A 4D9TA 5KZIA 4J95A 4FT5A 4KKEA 2W1HA 4G6NA 3EN5A 4USDA 4ZLYA 4E5WA 3D94A 2GNLA 2FSMX 2J2IB 3UMWA 4GKHA 4GK4A 3IDCA 5GJDA 4IADA 4J98A 3W0OA 2W9ZB 2BTRA 4I22A 4QP6A 5HE2A 3SW4A 3RMFA 3BEGA 3KULA 4F1OA 3BBTB 5HD4A 2C30A 3MV5A 5A4TA 2XNMA 5JFSA 4XG4A 5AM7A 4DHIB 4IH8A 4XBRA 3V8WA 4CMTA 5AV4A 1JNKA 1H1RA 1KE9A 1WVYA 2ITVA 3GC8A 1S9JA 3PP0A 4MCVA 2UZOA 4JRNA 3TKHA 2XM9A 3SKCA 3EJ1A 3W2OA 2QOKA 3GFEA 1YWVA 2PE1A 3QLFA 3BKBA 5GJGA 4X3FB 2WMAA 5AR7A 5BMSA 3KK8A 3HP2A 2HWOA 2PZIA 4ZEGA 4ACDA 3W0QA 4GMYA 3RAIA 2PUIA 2PZRA 5L8KA 4F1MA 2W5AA 3ORNA 3FY2A 2GPHA 4LUEA 1Q41A 4MQ2A 3KA0A 3R8VA 4NFNA 4GW8A 1G5SA 2J51A 2R3MA 5EYKA 2ZM1A 2OXXA 4YSMA 3IPHA 2F2UA 3QHRA 3NNXA 2VTIA 4C2WA 5AAEA 2C6OA 2OF4A 5EM5A 1ZYDA 5EI6A 3VF8A 4L3PA 3NGAA 2FB8A 5BQ0A 4H05A 3U55A 3Q6WA 3WZEA 1VZOA 2ITUA 1OM1A 4GS6A 3ORPA 2VWBA 4LOQA 3SXSA 4BZNA 3W0MA 4IJ9A 5HCZA 4NIFA 2HIWA