1BLXA

P19ink4d/cdk6 complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
305
structure length
305
Chain Sequence
GLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 6
publication title Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (inhibitor protein/kinase)
total genus 88
structure length 305
sequence length 305
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 1998-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1blxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1blxA01
2RGPA 3EKNA 4I92A 4BRXA 3BU6A 3TIZA 1H26A 5IDNA 2YIXA 5M08A 4OT5A 2XK7A 4FTUA 4U3ZA 4FIIA 3QQLA 1ZY4A 4TZRA 5DEWA 5AUTA 4K33A 3R30A 4X2FA 3S2PA 3ZYAA 4DGGA 2DS1A 3BI6A 3CKWA 4HNFA 4QTCA 5E8XA 4TWPA 3COHA 4M0YA 5IG1A 2UW9A 3GOKA 2Z7SA 1W7HA 3AG9A 4GIIA 2W1IA 3COMA 1V0OA 4GYIA 4NFNA 4BDCA 3S1HA 4DFNA 5FUTA 3KXZA 3BELA 3N4VA 3P78A 4DFZE 3F3WA 3H0ZA 1FINA 4QQCA 5DE2A 1DI9A 4I93A 1DM2A 3QZFA 3UDBA 3KXNA 4OTHA 1O6LA 4YO6A 1QPJA 4TYJA 3EIDA 4LMNA 4LYNA 2GSFA 3QALE 4JBOA 2PUNA 2QOKA 3G0FA 5K0KA 4GT3A 2H8HA 2XKEA 2Z8CA 4FYNA 5IMXA 4PPCA 4EOJA 3FLZA 4C59A 5IQIA 1YWVA 3BYVA 4LV8A 4UWCA 5HLPA 3VBTA 4ZLYA 3OXIA 5CAQA 5EHLA 5JZJA 3MB6A 2HWPA 4FVPA 3M42A 3DLSA 5LWNA 3ZFMA 4JG6A 4YUQA 2HW6A 3RNYA 1VZOA 2W5HA 2ITYA 3V5PA 5JN2A 4IACA 5B0XA 5B2LA 3COKA 4BGQA 2EXCX 4F7JA 1CKPA 3FSFA 3QQGA 4JR3A 2RFDA 4L53A 4HVSA 1YWRA 3VS6A 4XP2A 1E9HA 1WVWA 4UWBA 4ASXA 4KNBA 2J51A 4GS6A 3UVRA 4ASEA 4UZDA 1M52A 3JY9A 4G1WA 4M84A 5HEZA 3VF8A 4M67A 3FZOA 3CTQA 3PE2A 4C8BA 2QOLA 4FOBA 5M4CA 3BE2A 2JAMA 5D41A 4B0GA 3A7IA 5HG5A 1Q5KA 4J98A 3BQCA 3LFDA 3S3IA 4YC8A 5IH6A 4X2JA 2WD1A 5DI1A 4W8DA 3NNWA 2ITUA 5AR8A 3GEQA 5FEQA 3RK5A 3PRFA 4FV3A 3EFKA 4K18A 4BCIA 3R9RA 5TOZA 3NCGA 1KE7A 5JQ5A 2JIIA 3MY5A 4GL9A 3FKNA 4EH4A 3POOA 4I4FA 5CF6A 5IQGA 3KGAA 4RWKA 3LFQA 3NGAA 2XZSA 1B6CB 1W82A 3OUNB 4XMOA 5EK7A 4JI9A 2YM3A 3PSBA 4D1XA 4JL9A 4KKEA 1KOAA 3KXXA 3T9TA 4AE6A 4DFLA 2WB8A 3DKGA 2AC3A 5CSXA 2WMSA 3A7GA 5EM8A 4X0MA 5J9LA 2C5NA 4L52A 4X7QA 2PVRA 3NAYA 3AOXA 4JBPA 5BYYA 4ZY6A 1BI7A 4YZCA 2C6MA 4BF2A 4RLLA 4O0RA 3C0GA 5DRBA 4FZ6A 5KHWA 3CBLA 2XVDA 4WBBB 1ZXEA 3T8OA 2C6IA 3R2BA 3AD6A 5M51A 2QG7A 2VX1A 1LR4A 4ITJA 5FTQA 4AOJA 4AZEA 3GQLA 3HDMA 3PWYA 3NMUF 4FICA 2XCKA 1J1CA 1OIUA 5CVFA 3VQUA 5ACKA 4ITHA 1R1WA 5CEIA 4CV9A 5KE0A 3EFJA 5CAUA 5HIEA 5HX6A 4W4VA 2C3IB 2GNIA 1H1RA 2QVSE 1IAJA 2CDZA 5CZHA 4BB4A 1ZARA 3C4EA 3BHUA 4I41A 4YJQA 3HA8A 5AR5A 3R8VA 4YR8A 2F7ZE 3E5AA 4B99A 2NPQA 2PVFA 3DZQA 3GCQA 5FM3A 2X6EA 5JFWA 4YP8A 3E7VA 4YNOA 2XEYA 3CGFA 4FTKA 2WQNA 3ORMA 2OO8X 5HIBA 5IH4A 3KXHA 4GSBA 1J7LA 2VUWA 5M55A 3GBZA 3VBQA 3K2LA 4YZDA 3F7WA 3RP9A 3I4BA 4O96A 4FV2A 4YZ9A 3G9NA 1ZOGA 4ZY5A 3JY0A 3VIDA 3LFSA 3RCJA 3F69A 2RFEA 2JKKA 3E8CA 4YZMA 5GNKA 4PP9A 4KS7A 4J96A 4FG7A 4AOIA 4CFWA 1G8SA 4R78A 3KFAA 2C47A 3ALNA 5EQEA 2QU5A 5AR4A 3I5ZA 1BLXA 4FTJA 1DAYA 4I6QA 2PZ5A 4X3FA 3FDNA 4FTMA 5DWRA 3VBYA 4QYHA 4NFMA 3MI9A 3NNXA 4EH8A 3BEGA 4C4FA 5AV0A 5CEMA 2E2BA 4YHFA 3TZ9A 1H4LA 3BE9A 3HMNA 5A46A 4ERWA 5M57A 3Q04A 5E8TA 3REPA 3ROCA 2X1NA 1BL6A 2YM4A 4BDGA 3BEAA 3Q52A 5E90A 4R77A 4YJOA 2B7AA 3LVPA 3QUEA 4IZ5A 5LMAA 3UMXA 4BDIA 5DT4A 1OVEA 4JT3A 4EH3A 3PXQA 1W84A 3Q4CA 3KVXA 4XLIA 3U8WA 2R3FA 2GDOA 4O82A 4Y73A 4QMSA 4BDDA 5J5SA 2NRYA 4TN6A 4LMUA 5F4NA 5M4FA 3ZO1A 3R1SA 5EQYA 5M4UA 3M11A 4H3PA 5HO8A 5AUXA 2UW5A 3BHVA 3L8VA 3NIEA 3GU6A 2W1FA 2WMUA 4N4SA 4TT7A 5EI6A 3QHRA 2E9VA 3P7CA 1WFCA 1Q61A 3PIZA 3OW3A 5IA4A 2PWLA 4L3JA 5KKRC 4FUYA 3H9FA 5C8MA 4S30A 3ZXZA 4R3RA 4ZSAA 4A9YA 2GNGA 1WBWA 3D5XA 4HVDA 5L6PA 3LW0A 1Q8WA 3OXTA 4PNKA 3QZHA 2V5QA 5AUVA 5CALA 5KMIA 4BTMA 1Y91A 5BVWA 3N4TA 3C5UA 4UBAA 4GKIA 3MIAA 4IHPA 5JQ8A 4JDKA 2A4LA 1U5QA 2NO3A 2Y8OA 3CCNA 3HUCA 3R73A 4ZSGA 4AA0A 4FZAB 2BHHA 2YIWA 3PJ3A 4AGUA 3BKBA 1AQ1A 4K9YA 4RWIA 1KE5A 3SD0A 3RAWA 4W4YA 3PXYA 3QTZA 5AX3A 2Z7RA 4IM2A 4ENYA 3L9LA 3UP2A 4PP7A 2DYLA 3OCTA 3GFWA 2ITNA 1VR2A 3CY2A 5LMKA 5AR7A 1UU3A 3W33A 3S0OA 4ANOA 5C4KA 4MXXA 2O5KA 4L42A 4NUSA 2HZIA 2BZKB 5LVMA 4RJ5A 2W5BA 1CDKA 1OL6A 2OBJA 2Z7QA 2ZM1A 5CZIA 5ANKA 1XHAA 5CU6A 1NY3A 3BYSA 1UA2A 3C9WA 4X2KA 2CNUA 1GY3A 1ERKA 1YHSA 2AYPA 5E1EA 3SXSA 2ZB0A 1SNXA 3QRJA 4GRBA 4C34A 3B2TA 3D2IA 2P0CA 3F61A 4LOOA 2UW3A 4X2NA 4MXYA 5AFVA 4MBLA 3L9MA 3WARA 4KABA 4G3FA 4QO9A 2R3HA 3F2RA 3HYHA 4DFUA 4ARKA 3UQGA 4YJPA 5AAEA 2HOGA 4F0GA 2YWPA 4CLIA 3CD8A 3GCPA 4L01A 3PVWA 4I21A 1SZMA 3IW8A 3CP9A 5D12A 3D94A 3HDNA 2J50A 4OTRA 4CQEA 4EKLA 3IPHA 2JAVA 3UZPA 4WUNA 3V8TA 3UIBA 3FI8A 4O7NA 4Q9ZA 3DAEA 3TNQB 4DH1A 4X3FC 2Q0BA 1UU9A 3F3UA 5HI2A 1FBNA 1RW8A 3WI6A 3HMMA 1QCFA 4O0XA 2UW6A 3L1SA 1TQPA 3ZHPC 4LL5A 4XG2A 3KCKA 3TKIA 4H1JA 5DN3A 5HLNA 3NNUA 5JFXA 3OUKA 1TQMA 2XIZA 1BI8A 3QLFA 2ZDTA 4TPTA 3KU2A 3AT3A 1FPUA 1WBOA 2XK9A 4TWOA 4GUEA 3IG7A 4JS8A 4WNOA 3RPRA 4JOAA 2ETMA 2V55A 2CGWA 3NAXA 3NSZA 5IA0A 5E8SA 2ITOA 4OTQA 3V5LA 4DH3A 3F5PA 3QZIA 4FG8A 3I7BA 4O0WA 4O38A 4GK3A 2C6LA 4FK3A 3MTFA 4TYEA 3EL8A 4KBCA 4RC4A 5LCJA 3I60A 4KKGA 3QCQA 5K3YA 4QYYA 3UTOA 5KHXA 4D4SA 2BCJA 4M8TA 4JIKA 4RC2A 5AV4A 3IDPA 5CAOA 4E4LA 3BHYA 4FC0A 4O6EA 5HBHA 4AF3A 3KKVA 3E8DA 5HE0A 4IVDA 3RPVA 4WRGA 4AGWA 4FA2A 4KUJA 2XM9A 3AD4A 2OZOA 5BYLA 4UY9A 3CKXA 3EQGA 2UZLA 4IX6A 4H3QA 4FSYA 4UEUA 1L3RE 4MF1A 3S00A 3HA6A 1BMKA 3QZGA 3FE3A 1UKIA 3P23A 5FBOA 5AV1A 4P5ZA 4FVQA 3MS9A 1PF8A 1WBTA 2P2HA 3EQHA 3O8PA 4FKOA 3SAYA 3VBXA 3K3IA 3IW7A 1KV2A 4AFJA 3V6SA 3D15A 4QT1A 5A4CA 3TWJA 2ZMDA 1RQQA 2VTNA 1P4FA 5AP5A 3SDJA 1VYWA 5BMMA 2XKFA 4CTBA 4X3FB 4DAWA 2X39A 5D10A 3KULA 3FI4A 5F1ZA 4NYEA 5M07A 3ORZA 2B54A 2G1TA 2EB3A 3AGMA 4I0TA 4CQGA 2OWBA 4EBVA 4EH2A 1SM2A 2HIWA 1P5EA 2P3GX 5IMEA 3QD3A 1H0VA 3PXKA 3F3VA 3R8MA 3R8ZA 4BIEA 3AQVA 3ZUUA 3LCTA 1OZ1A 5J9ZA 4F0FA 4QNAA 4NU1A 2E9OA 3EZVA 3ORKA 4FNXA 3OY1A 4J95A 3NUSA 4QQJA 5CEQA 3UOHA 4BKZA 5KX8A 3QUPA 4BDHA 5CASA 4FT7A 5JZNA 3SXRA 2R3KA 2GCDA 4J71A 3BQRA 3VF9A 4DC2A 4ZEGA 1M14A 2ERKA 2KTYA 1W8CA 1PMNA 3DCVA 3KXGA 4G5PA 5A4TA 4XOYA 5E8UA 4I24A 4C4HA 3N9XA 2PUPA 2F7EE 2YIQA 3PP0A 4QP3A 4RBLA 1M2RA 4B4LA 5IQEA 3A7JA 1YVJA 5T68A 4ZZOA 2WZJA 5HQ0A 4WIHA 5FEEA 3W8LA 3DB6A 5CS6A 2QOQA 4FKJA 3VBVA 4V05A 3PJ2A 2R7BA 2J0IA 5GZ9A 5AAFA 2WHBA 4GV1A 4GEOA 5KMLA 1DS5A 3VS7A 3FQSA 2C0OA 1FVVA 3UG1A 4Y8DA 4HCVA 4GKHA 3H30A 1REJA 3IK3A 3QLGA 4Y72A 4I5MA 2XA4A 3A4PA 4NM0A 4YJNA 2QG5A 2Y6OA 4C36A 4RX5A 3ERKA 3D5UA 2J90A 4FKPA 4E4XA 5KNJA 4KIOA 5HBEA 1MP8A 3NR9A 4FUXA 4N6YA 1JQHA 3AC5A 4HGSA 3PRIA 4L00A 2XNOA 3LFCA 1PRYA 4CCBA 3HV3A 3U54A 1E1XA 3RMFA 2X4ZA 5EOLA 2OXYA 3UIXA 2GQRA 4O0UA 5E91A 3PJ8A 4JXFA 2OK1A 3KB7A 3HAVA 4DF3A 2VO7A 3MH1A 5DVRA 4DEAA 2C30A 3RM7A 4AZTA 4G3DA 4N0SA 5L2TA 5J1VA 4QTAA 5HCZA 4DEIA 5GINE 4ZMEA 5FTOA 3W8QA 4YJVA 5D11A 3ZUTA 3R02A 4Q2AA 2EVAA 3PXRA 4F1TA 5DNRA 4A9TA 4TY1A 2ITPA 5DR2A 3HEGA 4JRVA 1ZYLA 2F2CB 1YI4A 4JQEA 1JSVA 5DGZA 5K9IA 3QRTA 4BHNA 4MH7A 4DEGA 5DG5A 1B38A 3HV7A 3A7FA 2VTLA 2XIKA 2ZYBA 3AT4A 4FE2A 2I0VA 4FEXA 3LZBA 3ZO4A 1UU8A 2EXMA 2X8DA 3OT3A 4GJ2A 2BHEA 4IWQA 4MBJA 4QMXA 4RT7A 4WHZA 3ENMA 4LL0A 4C4IA 5L6OA 1O6KA 5AUZA 3NYOA 4D4YA 1NT2A 5IPJA 4U41A 4O0YA 4G9RA 4M68A 4QP1A 1PMEA 2OJ9A 3AMYA 2OSCA 3ZBFA 3EFLA 3SW4A 4DEEA 4PDYA 4KIPA 2OG8A 2Y4PA 5CY3A 3U9NA 5L6WL 4K11A 3UO4A 4F9WA 3NS9A 3MH0A 2UW7A 5C1QB 3VRYA 3L8XA 3PLAE 4BKJA 3TN8A 4HVIA 2ZV9A 5EYMA 1GZ8A 3HGKA 4J52A 4FSQA 4KWPA 3DV3A 2R3PA 1SVGA 3ODYX 4G3CA 4MD8E 4FKLA 4FIHA 4YTFA 3B8QA 4QOXA 5FXSA 5IKWA 3UNJA 3QAME 4GVJA 4F7SA 3A62A 1GZKA 4XRJA 2J0KA 4JBVA 4L6QA 2XYUA 4CMOA 2JBOA 2XF0A 4E5WA 3LOKA 4GH2A 3FUPA 2WO6A 5DLSA 4ACCA 4FEUA 2B55A 2ZAZA 2VTHA 1GAGA 4JG8A 5CU3A 5I9WA 4EOKA 4MXAA 4UV0A 5CU0A 4DHFA 2PVJA 2WIPA 1V0BA 2H34A 4YJRA 1HCLA 5CU4A 4F08A 5J7HA 4R7BA 3KULB 3FAAA 4GUBA 2W7XA 3GNIB 2PVKA 3MA3A 3LAUA 4FV1A 4PWNA 5AIRA 3F6XA 4ZOGA 4AUAA 3TZMA 1ZAOA 5CTPA 1MUOA 1ZWSA 3E64A 4OBOA 2QR7A 3GCVA 3MY1A 3VNTA 2BDWA 4BIBA 3U51A 4E4MA 2JLDA 2F4JA 3HMOA 4D2RA 2GNJA 1MRYA 3ZO2A 4U42A 4IZAA 4EUTA 5HG9A 3ZLYA 5ACBC 4KSPA 2H9VA 2JDOA 3WZUA 4XV1A 2Z60A 2J2IB 3LM5A 5C9CA 4IM0A 4E6AA 4IDVA 4R7IA 3V5JA 3R28A 4C33A 3Q9ZA 4O7SA 2VTPA 3PA4A 4RVKA 2PMOX 2QHMA 3MPMA 3HRBA 1FVTA 3RK7A 2VTAA 4C58A 3OWJA 1TQIA 4TXCA 3C13A 2VGOA 4FZFB 4NK9A 2ZB1A 3GOPA 4PNIA 3TACA 4QMWA 2G9XA 2W1ZA 4S32A 4E20A 2CLXA 3EQIA 2PMNX 2WTIA 3ZC5A 2PUUA 3VUGA 2VTMA 5EHOA 1K9AA 3HECA 1H1WA 1XR1A 2QONA 4UALA 4DLIA 4EOOA 4QTDA 2PE0A 3PVBA 4BCJA 2YABA 4FV0A 4J8NA 3KN6A 3MJ1A 3TZ8A 1PXMA 2WQBA 3P5KA 4OR5A 3VUKA 5GHVA 3QUDA 1MRUA 4L9IA 3QGWA 5KCVA 3FHRA 4TNDA 2QO2A 3OWKA 2WNTA 1K2PA 1BL7A 2C3KA 3E3PA 3R9NA 4E8AA 2WMWA 2ZV2A 2OJGA 1OPKA 2ZOQA 3SQQA 3OVVA 4NCTC 2I0HA 3W2QA 1NVQA 3MA6A 5BUJA 1NVSA 4D2TA 3QTQA 4O0TA 1YXUA 3F7ZA 3MPTA 4Z7GA 4IX3A 5AADA 1FGIA 2FB8A 2PZYA 3ODZX 3NVKI 3FPMA 5FWKK 5AEPA 3R21A 2F2UA 3NUYA 4RFYA 3FYJX 1H07A 3KF7A 3KMUA 3R6XA 4G31A 2R3IA 2QNJA 4OBQA 4RJ7A 4FL3A 4AW1A 4F09A 3BCEA 1AD5A 3PY1A 4FG9A 3SRVA 4F70A 3SX9A 5CLPA 3ZTXA 3C4FA 5CVHA 2RG6A 4ZJIA 3BYUA 3F82A 3QRIA 4CTCA 5E1SA 4FKGA 3FWQA 3KF4A 3PIYA 4CNHA 4JX3A 2HY0A 3V51A 3QRUA 3VUHA 5LOHA 2JIVA 4ZTMA 2ESMA 1RE8A 4DH8A 3QTRA 4S33A 5HO6A 4ZLOA 3DJ7A 4AN3A 4NW6A 3PDTA 2RG5A 3DOGA 4M14A 2EXEA 2YJRA 5CF8A 5BVFA 2BIKB 2VGPA 2XKCA 5C03A 4G6NA 1X8BA 4FODA 3EZRA 5HU9A 3Q6UA 3OG7A 3MDYA 4D2SA 4DEBA 1IAHA 3IS5A 4I23A 2YM8A 2BAQA 3POZA 4OLIA 4C7TA 3G15A 4XLVA 4RLKA 5IQDA 4PMTA 4BCMA 4O7YA 3NLBA 4FKWA 3I5NA 3KY2A 3AC2A 4KBAA 4RVMA 5H8GA 4DN5A 3QQFA 3BLQA 3FI2A 4E7WA 5KBQA 4O84A 3PVGA 4DTAA 1XBBA 3BZ3A 4IC7A 2CHLA 4QMUA 4GYGA 2VTJA 2BZHB 3BBTB 4O7RA 2BDFA 4YMJA 1Q24A 1YRPA 2IWIA 5AIKA 4R3CA 1K3AA 3DZOA 2YM5A 3PY3A 4CG8A 2CGVA 1SVEA 3NPCA 3TUBA 2J0LA 4KB8A 4IIRA 3EN5A 1F0QA 4L68A 4PMSA 4M3QA 4OTWA 3EB0A 3F5UA 3Q3BA 5KUPA 2FO0A 4EKKA 4Q9SA 5ANJA 1J91A 2HYYA 2Y4IB 2YISA 4FTOA 3SA0A 5M06A 5D9HA 3BHTA 3VW8A 4RPVA 1YKRA 5HZNA 1OIQA 3HRCA 3JVRA 2VWYA 4CGAA 5FXQA 3NX8A 4BDJA 4HYSA 3DJ6A 4F9YA 3F3TA 1UNGA 4PRJA 4CRLA 1CKIA 5JH6A 5DOSA 4P2KA 4AAAA 2GNFA 3ZLXA 3MV5A 4DTBA 4ACGA 4MQ1A 5DIAA 5GZ8A 3RZFA 3T3VA 3RM6A 1ZOHA 4MXOA 5ETFA 4EOMA 3E63A 4I0SA 4GW8A 3O96A 5IEYA 5EW9A 4F6SA 4R7HA 4PDPA 5CSWA 4EH9A 4QMLA 4PTCA 3OFMA 5DMZA 3SGCA 3F66A 4II5A 5F94A 1NXKA 3P86A 4ZTRA 2JDVA 2XIYA 3N4UA 2BPMA 4M69A 3UOJA 5HLWA 3LMHA 1OUKA 4ZP5A 1PHKA 3C0HA 3MJ2A 5AP6A 3AC3A 4DT8A 2QLQA 2HY81 4R6VA 3P79A 4CSVA 4DEDA 2IVUA 4GIHA 3NUXA 3WOWA 5HD7A 4USFA 1ND4A 1GIIA 2YLEA 3A61A 4WO5A 5IQAA 3OCSA 1ZYSA 3C0IA 2W5AA 3V6RA 2JEDA 2WOTA 2O65A 4RQVA 2B1PA 5H9BA 3MVMA 4OTFA 1UNHA 4E93A 4G5JA 3SG9A 1Q41A 2UUEA 3PZEA 2YACA 4E5BA 4FR4A 3OWLA 3Q9XA 5IISA 4UWYA 2A2AA 3MBLA 2CKPA 4TRLA 4JG7A 2OF2A 4CFVA 5A14A 4ZSJA 4HZRA 3FV8A 3E8NA 2W4OA 4HW7A 4MCVA 2A27A 4EONA 4RMZA 1GOLA 5HG8A 3FC2A 4ORKA 4HPTE 4BICA 5AV2A 4K77A 4AQCA 2G2FA 3QQJA 2O3PA 2W1GA 3C50A 4YHTA 2ZV8A 2WMBA 2UZEA 4C57A 4WSQA 4B8MA 3U4UA 4BC6A 4O91A 3QKKA 2GS6A 4KIQA 3FY0A 3R04A 4J99A 2GTNA 5I5ZA 1OBGA 3I1AA 4ZTNA 3GCUA 4YNEA 3MVHA 1MQBA 4MNEA 1H24A 4FV7A 3Q5ZA 4L3PA 1XJDA 2P55A 4IFCA 4BTJA 2REIA 3RPYA 4IZYA 4DE4A 1YHWA 4DINA 1YXSA 3KK9A 4FKUA 2QQ7A 2Z7LA 3DKCA 4OAVB 4C2VA 1IG1A 4X6RA 5AAGA 3IW6A 4LUDA 5IQBA 5KMJA 4OAUC 2R3RA 2FA2A 2ITXA 2PMLX 4O83A 4PF4A 4IAKA 3SRVB 4A06A 2HK5A 1G8AA 4FEQA 4MF0A 4IEBA 4ZSEA 4AG8A 2XK8A 3OOMA 5KZIA 2X7OA 4C02A 4PPAA 4V0GA 4JLCA 4FKTA 4MD9E 1BKXA 3C1XA 4QMOA 4U7ZA 4M7IA 2WEVA 5DHJA 1OL5A 5KMKA 5HCYA 3DB8A 4NSTA 3VC4A 2QKRA 1WBNA 2OZAA 4QYGA 3KRRA 5J79A 3MH2A 4CKIA 3DBDA 2VO6A 4MD7E 4U0IA 5IU2A 2QCSA 3ZRMA 4AE9A 1PKDA 3ZLWA 3G9LX 5IQCA 4W4WA 3CY3A 3Q2MA 4QMPA 5I9UA 3R1NA 4GK4A 2BVAA 5CXZA 4DGLC 2VX3A 1Q3WA 2UZTA 3CXWA 2B9IA 3QQHA 4RJ4A 3GP0A 2SRCA 2UZWE 4U81A 3FEGA 2XNGA 5TKDA 4CMUA 3P08A 3V8WA 4FTIA 4UMRA 5IA2A 5L8KA 3QU0A 3VRZA 4WSYA 4YU2A 5LXMA 3QFVA 4FV5A 3C4WA 4PUZA 3TI1A 3UC4A 2I40A 4G3EA 4IXPA 5KMMA 2WQOA 4J1RA 3HP5A 5HO7A 2JFLA 1KE6A 3DXQA 1G3NA 4BWPA 2YDIA 3FMHA 2R3MA 3FLWA 4LFIA 2UW8A 2B4SB 3ET7A 2OIDA 4FNWA 4FT9A 3R7YA 2BIYA 1OMWA 2FGIA 2IN6A 2WTVA 5B2KA 2HCKA 3UMWA 5HBJA 2C6TA 2WQMA 2OI4X 1H28A 1HCKA 2XJ1A 4CEGA 4EHVA 1W0XC 2XK6A 4K0YA 5EM7A 4G6OA 4FTQA 4FZ7A 3HAMA 3L9PA 1H25A 5FEDA 3NUNA 5K5XA 2Y7JA 3I79A 4FTTA 1FVRA 2ETRA 2PZRA 3W2RA 2CN8A 3MFUA 2V62A 2PZPA 4FK6A 3NWWA 1H8FA 2WMRA 4EOQA 3ORTA 5HNGA 4UXQA 5CSHA 4RJ3A 2NP8A 4ONAA 3A8WA 3WZEA 1XWSA 1LP4A 2EWAA 4JDJA 3R7VA 2R3JA 4EOPA 4JDIA 2UZUE 3P9JA 3E7OA 4D5HA 2VWBA 3GGFA 2VRXA 2UVYA 3P0MA 5EKOA 3ATTA 2IZUA 1CKJA 2WELA 2X9FA 3ANRA 2XMYA 3NIZA 4QP8A 3ID6C 5I0BA 2WMTA 5EH0A 1XO2B 3BGQA 2BUJA 3LE6A 4DFYA 1Q8YA 4M69B 5L8JA 3TG1A 1FMOE 3QTUA 5AWMA 5CNNA 2XM8A 4RGJA 3EN7A 4J97A 2YM6A 3DTWA 1LPUA 4IADA 1M7QA 2VWXA 3SLSA 4PX6A 2IJMA 1W83A 3ZEWA 4C61A 3A7HA 2QR8A 4QD6A 4HGLA 3QGYA 4P90A 4ZS4A 2YFXA 4BYJA 2ZM4A 4Z55A 2GHGA 2WKMA 5AV3A 2F57A 2QKWB 3G2FA 4S31A 4EOSA 4NM3A 2VWWA 4WG3A 2W17A 2IVTA 3SXFA 3SHEA 3DQWA 3BPRA 5BVEA 5HVKA 3HV5A 3Q4TA 4I6HA 4YLKA 4YPDA 4A9RA 5LVOA 3FJQE 2BDJA 1Q8ZA 4WG5A 1OB3A 2X9EA 5HD4A 2Q0NA 3OP5A 1M2PA 1IEPA 3MIYA 5KKRB 4RRVA 3BYMA 4PL3A 4JIAA 3AGLA 4IAIA 3II5A 1XH7A 3QTSA 1Q3DA 5G6VA 4XG6A 4FTLA 4RZVA 4IH8A 3I0QA 4I5PA 3VUMA 4W8EA 2JITA 3D83A 3BWJA 3C51A 3BV2A 5C8NA 1MRVA 3IO7A 4XP0A 2B0QA 4E6DA 4A9UA 4IWDA 3FLYA 5BVNA 3V5QA 1OL7A 4UMUA 2XCHA 4RA4A 2OFVA 4YJTA 3VW6A 2BTRA 4MNEB 5FLFA 4EYJA 3O8TA 4XH6A 1GZOA 2WAJA 2XKDA 3EMGA 5EM5A 4R5YA 1XQZA 4V04A 3RBWA 3VBWA 3V8SA 1ZZ2A 3LXLA 2YAAA 4EZ7A 2R4BA 5JGBA 3E8EA 3QX4A 3FXZA 2W96B 2FYSA 4BCNA 3IGGA 5C01A 3OF0A 5DR6A 3VO3A 3RK9A 1BUHA 3V3VA 3OHTA 4FGBA 2UZDA 4A4XA 4E26A 3LFFA 2PY3A 3HL7A 4XNEA 5H8BA 4D0WA 4ERKA 4BR3A 4W9WA 3NDMA 4FTRA 3ZM4A 3FI3A 1OKYA 3RHKA 4D4VA 4V0GB 2KULA 3WBLA 3R9OA 1U59A 4R1VA 4YBKA 3ACKA 4DCAA 2OZAB 2VAGA 2CNQA 4IVAA 3AC4A 2QC6A 4ALUA 4I3ZA 2BZIB 1OIRA 1QPCA 3BGZA 2R5TA 1T45A 4FIFA 4IE9A 4N57A 5CYIA 5TF9A 3W55A 2C3LA 2GFSA 2OJFE 4F63A 1Y8YA 3QL8A 2X7FA 3BGPA 4EHZA 1Y6BA 5DT3A 5CF5A 4I5CA 4EOIA 2BRBA 4X21A 3OTVA 4G16A 4KKHA 3OEFX 4R8QA 3UPXA 3WF6A 3NW7A 3FMDA 3QQKA 3GENA 5E8VA 3W2SA 4BZNA 5M09A 2YCRA 2BRNA 2UZNA 3C4ZA 5CT7A 1JBPE 1PYXA 2ZM3A 3ZCLA 4ZZNA 3PWDA 5AP3A 2RSVA 2YWVA 2IVSA 1SVHA 3FZTA 1KUTA 3MB7A 4GJ3A 4ACHA 1YOMA 4GK2A 4RX7A 4OTGA 3KRLA 4MEDA 1JOWB 5AUWA 5EM6A 2YM7A 1RDQE 4FYOA 1OL1A 3TV7A 3RWQA 4DLJA 3LIJA 4TKSA 4UXLA 4AZFA 4U79A 4WKQA 5AX9A 2P4IA 1MQ4A 4QP9A 3T9IA 1PXJA 4C37A 4O1PA 5M44A 4IDTA 1WMKA 5AP4A 4FNZA 3QTWA 3F2AA 2I0YA 4U44A 2FSLX 2EU9A 2PVLA 4E5AX 3DTCA 4FT3A 3PG1A 3A4OX 4O27B 1OKVA 4RA5A 2G2HA 3LJ2A 4XOZA 5AA9A 5J87A 4BN1A 4JX7A 2R3OA 2WTCA 5J8IA 2FSTX 2CGXA 3EQCA 4FX3A 5FDXA 5EQPA 3DU8A 5D1JA 4FSTA 2AC5A 3JS2A 2CCIA 5HNBA 4NW5A 3TNHA 1S9IA 4TTHB 2Y9QA 4YJSA 2WMVA 1KE8A 3IDBA 3UIMA 4ZS0A 4AZWA 3K5UA 3OXZA 2VTOA 4J53A 1LEWA 1CTPE 3C7QA 4C38A 2YZLA 3L8PA 4XYFA 4IWOA 5GZAA 3PA5A 3CE3A 4MKCA 3GC9A 5HU3A 1XH9A 1JKSA 3BRBA 2QOIA 4CD0A 3O51A 1H0WA 5F20A 3LKMA 2XB7A 4LOPA 2ZJWA 5CSVA 2VV9A 4YJUA 4NZWB 4IZ7A 4EYMA 5BUEA 4EEVA 3VUIA 3A8XA 3F5GA 3O50A 4H39A 3RAHA 3QTXA 4FI1A 3RNIA 3W32A 2OIQA 4YBJA 3T3UA 5KBRA 1H1SA 4P5QA 1KV1A 5IA1A 4HGTA 2X8IA 3UE4A 3E62A 1YDSE 4C4GA 5CX9A 2J4ZA 1WZYA 1YI6A 3AXWA 1AGWA 4GCJA 4L7SA 4YLLA 4ANNA 4P4CA 2PTKA 1OL2A 4RZWA 3HNGA 4IVCA 5IZFA 5L2SA 3UQCA 2W9FB 3C4CA 3LCKA 3N51A 3EQFA 5AP7A 4BDFA 2VTTA 4BI2A 4PQNA 4EK8A 2WMXA 5LWMA 1H00A 2YDJA 4EL9A 1UNLA 5AP1A 3W2CA 1KOBA 3NUUA 4FTNA 4I4EA 2BKKA 3E93A 4NL0A 4PL4A 3DAKA 4YZNA 4E6QA 5AM7A 4E73A 3VS5A 2XH5A 3W2OA 4LGHA 3ATSA 2XNMA 3TNPC 1A06A 3DQXA 3OZ6A 4I5HA 3NUPA 3Q9YA 4B6LA 1Q97A 3R9HA 5C4LA 4FL1A 4M97A 4NCTA 4Q5EA 4D0XA 5AA8A 5HTBA 3TV6A 3W18A 2FSOX 2HAKA 1PMVA 5ANDA 3FZSA 3ZDIA 2VNYA 4ZTHA 2H6DA 4D9TA 2R2PA 2GPHA 2OGVA 4BKYA 5BVDA 2XYNA 2CJMA 3ACJA 4GG5A 1YOJA 3A99A 3UBDA 1UV5A 3MH3A 5AP2A 4CFUA 1I44A 3AC1A 3Q4UA 3DK6A 5LMBA 2PUIA 3PJ1A 3IOPA 5ITAA 4X3JA 4KINA 4FSNA 5IA3A 3AC8A 4G34A 3O23A 3G90X 1XBAA 3OBGA 4ENXA 3QD0A 2O8YA 3NZ0A 4KD1A 3WF9A 3UJGA 2AUHA 5AR3A 3DAJA 2X7GA 4G3GA 2HENA 2R0IA 4OUCA 3TTIA 1PJKA 4TYIA 5EHYA 3RPSA 3KREA 2VZ6A 4BY9E 2G15A 5FG8A 4BDKA 1YI3A 4EH6A 4YURA 3PG3A 3R00A 5ANIA 4BDBA 5HOAA 4XBUA 3TEIA 4A9SA 3QA8A 2J5FA 3ELJA 4K2RA 5LJJA 3QXOA 3LFBA 2VU3A 3OD6X 1FMKA 3PP1A 2IW9A 3DK7A 5GIPE 3I6WA 4RVTA 4CT1A 4C3FA 3R01A 5HCXA 2DUVA 3PXZA 1JAMA 5HG7A 2HZNA 4JQ8A 4YGAA 4TYGA 2R64A 1E1VA 5FD2A 3ROYA 3DXNA 1DAWA 4FIJA 1R78A 4IBMA 4F99A 4FGRA 3KK8A 5E8YA 3DPKA 4XEYA 3DKOA 4EUUA 5EKNA 1YXXA 3DDPA 3LQ3A 4HYHA 3LFAA 2GTMA 3FYKX 3OROA 5HKMA 3FSKA 5FRIA 5IEXA 4AP7A 4TL0A 5C26A 4CXAA 3WYYA 5HHWA 4ZAUA 5IF1A 5KMOA 3P7BA 3R7UA 3FMKA 3QC4A 5TR6A 4HYIA 3CQEA 4NTTA 5JFSA 3IONA 4EJ7A 4I0RA 4OTDA 4WRSA 4ACMA 4DT9A 4F6WA 2Y0AA 5DEYA 5D7VA 1T46A 4UZHA 4DEHA 3I0OA 3ZLSA 4BCHA 4EOLA 2OFUA 3JUHA 4XCUA 2CCHA 1XH8A 3CSVA 1ZYDA 2A1AB 3R22A 3VS1A 1URCA 4RG0A 5FGKA 3ITZA 3Q6WA 3PYYA 4WNPA 4ZK5A 4EK3A 1JLUE 5JGDA 3CJGA 2WGJA 2PSQA 2JD5A 2W1CA 1LEZA 4NM7A 3KMMA 5KZ0A 3NW5A 3G0EA 4XG4A 2WXVA 5LVLA 4CT2A 4MX9A 2R3NA 2QOOA 2BAKA 3IOKA 3CQWA 3IW5A 3MTLA 4TNBA 4LM5A 3U87A 4BCPA 3UPZA 3PSDA 2GU8A 3D4QA 3U6IA 5EDPA 3OS3A 4QTBA 2GS7A 4IAAA 2B53A 4DFXE 1ZOEA 3KRWA 4D9UA 3Q9WA 3ZONA 2QOHA 3D7TA 3OY3A 3RJCA 3EOCA 4QMNA 3FZPA 2FH9A 4YPSA 4FT5A 2WTKC 3LFEA 3HMIA 4ZMFA 4MXZA 4C4EA 4DH5A 2BRGA 4BCQA 5E8ZA 1JKKA 3O17A 2B52A 2O63A 2BTSA 4EK5A 4NH1A 2ITWA 4NM5A 4XP3A 1I09A 4O81A 5JK3A 2VWUA 3ZU7A 4GFOA 3ZSHA 4C3PA 3MGYA 4QP4A 4WG4A 4XRLA 4QTEA 3P4KA 2WTDA 5C8KA 4LG4A 2YCFA 2NNWB 2QODA 5GJFA 4LUEA 4WA9A 5DYJA 3ZZEA 2X2LA 3HUBA 4EI4A 5EYCA 4QQ5A 3PTGA 4MBIA 3NYVA 5DPVA 5F95A 3U6JA 4AW5A 2XIXA 4QMMA 3DNEA 3EKKA 3LXKA 4G9CA 4H3BA 3R1YA 4QRCA 3MW1A 4EBWA 4ZY4A 3BYOA 4PPBA 1LUFA 1GNGA 3BBWA 4FNYA 3S95A 4CMTA 2JFMA 1Y57A 4AW0A 4IX4A 4FTCA 4IC8A 4YTHA 5AUYA 5DFPA 4Z7HA 3H3CA 4QYFA 4PMMA 3CIKA 5A3XA 3HV4A 1XH4A 5FTGA 2R0UA 4QMZA 3ALOA 3DBFA 4IJPA 4APPA 4HJOA 4ZTSA 2WTJA 3O71A 4DYMA 2XNNA 4N70A 2GQSA 2XNEA 3DK3A 2ZVAA 4QP7A 3TKUA 4BWKA 4FTAA 2ONLA 4X2GA 4CZYB 1NA7A 1XH6A 3QHWA 4JAJA 3KMWA 4DG3E 4YTCA 4XG3A 2XUUA 5F9EA 4Y46A 1UU7A 4NJDA 3ZM9A 3GB2A 4UB7A 4Y85A 5FM2A 3HKOA 4TYHA 2QOBA 4AZVA 5J7BA 1IR3A 1QMZA 1ZYCA 4PTEA 3RAKA 4U3YA 4RWJA 4EK4A 4O7VA 1PYEA 3FC1X 4EZ5A 4WT6A 5KO1A 3EHAA 2W1EA 2BALA 3RALA 2PHKA 3QRKA 4XUFA 3E87A 5I9YA 3B8RA 4IWPA 2W0JA 2IW6A 1A9UA 4EK6A 1M7NA 4ZSLA 4GG7A 5H3QA 1GIJA 1JKLA 1JPAA 3R7GA 5DBXA 2RIOA 1W98A 3FZRA 4WNMA 3WZDA 2UZOA 5L4QA 1H01A 5IEVA 4WOVA 1QPEA 1Z5MA 2F49A 4KIKA 3R71A 5FQDC 1FOTA 2WOUA 3PIXA 3O8UA 3QBNA 3EYHA 4D55A 2J0MB 2X4FA 3HZTA 4LOQA 4CFMA 5CXHA 5BX0A 3Q2JA 4FV8A 3G6GA 2UW0A 3JXWA 4BCOA 4J8MA 5LVPA 4CYJA 5BVKA 4BTKA 4ALVA 4B9DA 2OLCA 3AMBA 2Y6MA 4MNFA 2J9MA 4YLJA 4IQ6A 4BWXA 1JKTA 3K3JA 2YEXA 1R0EA 5CQUA 4E1ZA 4HVHA 3SOAA 3ZZWA 4NT4A 3ZDUA 4AXAA 1Q8TA 2PYWA 2Z02A 3A60A 3DBCA 1SMHA 3I7CA 3RZBA 4DA5A 5HE1A 2PVYA 2ZMCA 3F9NA 4JVGA 3MVJA 4W9XA 5TO8A 5A4EA 3PFQA 4AACA 3GU5A 2OU7A 2GNHA 3DS6A 3FMEA 1A48A 2WMAA 3JR1A 4IB0A 4HCUA 4MWIA 2V0DA 1O9UA 1B39A 3WILA 4LRKA 2GFCA 3PPJA 4U6RA 3VHKA 4DGMA 4A4LA 4PL5A 3DNDA 4IB1A 4EH7A 5CAVA 2J7TA 4TWCA 3V5TA 3FQEA 4HCTA 3SW7A 3UO5A 1YDRE 4YHJA 3RKBA 1OI9A 5G1XA 3RAIA 3K5VA 4D2WA 5K5NA 4Y83A 4UN0C 3FXXA 3OOGA 1PXIA 2A0CX 2C0IA 3PJCA 3QYWA 3BV3A 4FSRA 4DCEA 3ULIA 1P14A 4KS8A 1VYZA 4R3PA 3LFNA 3EYGA 3EL7A 3TNWA 1FQ1B 4EQUA 4PMPA 5HX8A 3LJ0A 2VO0A 2F9GA 4IVBA 3W10A 2ONLC 5FP6A 4AZSA 4I20A 1OITA 3D5VA 3EJ1A 4ZJVA 4FKRA 3UOLA 4ZLZA 4JNWA 2BRHA 4OTIA 3NYXA 3OCGA 4AN2A 2EUFB 2G01A 3SVVA 3D7TB 2QURA 3H9RA 4O0VA 4C0TA 2JGZA 4FOCA 4F9AA 4IAFA 5CENA 2B9HA 3IGOA 3BIZA 4F65A 3ORPA 2YN8A 4IANA 3WF5A 3DT1A 4A4OA 5B7VA 1TVOA 3SC1A 2E9NA 3E92A 2UZVA 2YERA 3MSSA 5AMNA 3UOKA 1WVXA 3MFTA 4I6FA 4L8MA 3GFEA 4RIYA 2QHNA 3W16A 3CD3A 3MPAA 1PXOA 4RWLA 4FBXA 4FSZA 2GQGA 4FMQA 4ZZMA 3ZSGA 3ZEPA 5IQHA 3D5WA 4CVAA 3FLNC 3RVGA 3MVLA 2QI8A 4M0ZA 4RIXA 2WPAA 4G17A 4E6CA 5CF4A 2OXDA 5FBNC 4DGNA 3VULA 1OIYA 2XBJA 3QCYA 4IM3A 5E8WA 4BI0A 4RJ8A 5AR2A 2HXLA 4OW8A 5J5TA 2JKQA 1OKZA 4C4JA 2W1DA 3IDCA 4ITIA 3LXNA 4F64A 4FKSA 3E3BX 1XKKA 4ZIMA 1PXLA 1OPJA 3GC0A 3Q5IA 4O2ZA 4QP6A 2IVVA 2JBPA 3CPBA 3R2YA 2HZ4A 4YSMA 5EOBA 4HZSA 3ZXTA 4CFXA 1F3MC 1U54A 4GFMA 2BROA 4I94A 4KAOA 5IUIA 3UZTA 4BCGA 3VJOA 3U9CA 4TYHB 3GQIA 3TKHA 4H36A 3ZRKA 2JC6A 3QWKA 2V7OA 2Q83A 4EQCA 4IJ9A 3UNKA 2W4JA 3SKCA 4RVLA 4D5KA 2O64A 2R9SA 2VTQA 4I1ZA 2C5VA 4AT3A 2F7XE 3LMGA 2UZBA 3GC7A 3TV4A 4TW9A 2C1AA 5EYKA 2VO3A 3MFSA 3VUDA 3FBVA 4GVAA 3OMVA 4D1SA 4EWHA 5CU2A 5L2WA 3DKFA 2FUMA 2CKOA 4UX9A 2WMQA 2XRUA 4FIEA 5ANEA 1GJOA 5T3QA 4DBXA 3EQDA 4KIKB 3RHXA 2PK9A 4MHAA 4IX5A 2LGCA 4F0IA 3ULZA 3EQPA 1H1PA 2QO7A 4MQ2A 4U9AA 5LCKA 1R39A 3DA6A 2XBAA 5EI2A 1R3CA 5M4IA 2C6DA 4UMQA 5HESA 4L67A 1ATPE 3R1QA 5IA5A 4IW0A 4NIFA 2C6KA 2OH4A 5BVOA 2PL0A 4AA5A 2BFXA 3EWHA 3VVHA 4RIWA 2VWZA 4XBRA 2IZTA 3QX2A 4O2PA 3TTJA 3TXOA 5FXRA 4XX9A 2XJ0A 2J5EA 1YOLA 2OJJA 2RF9A 3UG2A 3DY7A 4PV0A 5T6KA 3TZ7A 4E4NA 2GHLA 4QQTA 1OECA 4IAZA 1R0PA 4DTKA 1NW1A 4AFEA 2CSNA 2BAJA 4K6ZA 5HE2A 4QPAA 4FEVA 2OH0E 4CFFA 3TT0A 4BDEA 3TL8A 3DXPA 3BHHA 5GJGA 3DBQA 3G6HA 4OTPA 5HORA 2OF4A 4CZTA 4GU6A 4L7FA 5L2IA 4U43A 2VX0A 2YCQA 5AP0A 3WZKA 4I6BA 5CVGA 1ZLTA 3LPBA 2RKUA 5M53A 4L3LA 5ETAA 3EH9A 3R7IA 4FV4A 5A6NA 1V0PA 2X6DA 2VTRA 2QO9A 4F7NA 5BUIA 3KA0A 3QKLA 5E92A 5L8LA 3VQHA 2ERZE 3ORIA 4LRMA 2I1MA 3UC3A 2UW4A 3CS9A 2OKRA 3CPCA 4Y5HA 2GNLA 3ZFYA 2X2KA 4BI1A 4F9CA 4UYNA 4MTAA 5I9XA 1H08A 3TUDA 2PULA 4Z9LA 5E9EA 4R5SA 4G6LA 2BFYA 1APME 3ENHA 5BYZA 4BZDA 3LHJA 4L44A 3ANQA 3C4XA 2C6EA 2QOFA 3FZ1A 4FIGA 5EW3A 3NYNA 1P2AA 3BLRA 3CC6A 3NEWA 1IA8A 4KRDA 2WEIA 1NVRA 5CSPA 2R7IA 3HX4A 4J7BA 5JEBA 3E88A 3ZFXA 3NW6A 1HOWA 2C0TA 4ZJJA 4F1OA 4LGDA 2ITTA 3VWAA 2G2IA 4FF8A 4ANSA 4EQMA 3ORLA 3ETAA 5TE0A 3DFAA 4XG8A 2CNVA 3TM0A 5IUGA 4GT5A 3RGFA 2JIUA 4MYGA 4EORA 3O2MA 4EC9A 2HXQA 3KN5A 4JQ7A 5DT0A 1YWNA 3R7EA 3Q60A 3UYTA 4DGOA 1QPDA 1IASA 5I4NA 4RIYB 5ANGA 3WIGA 1Y6AA 2C4GA 4KSQA 3MWUA 4S2ZA 4XS2A 4IB5A 4K8AA 4O21A 3WE8A 5HTIA 1H27A 3LCDA 4U45A 2X8EA 3DFCB 4QPSA 5J1WA 3GU4A 5ETCA 3D0EA 4DFBA 4ANBA 4BGGA 3THBA 2C6OA 1V1KA 3PXFA 5EYDA 2I6LA 4KRCA 1L8TA 4L43A 3BWFA 3IW4A 3OTUA 4RIXB 4X6QC 5J9YA 3TJCA 4BDAA 4KA3A 1J7UA 3FMJA 3F88A 3F3ZA 5JGAA 1ZMVA 3GU7A 3L8SA 2CN5A 3DGKA 2E9PA 5IH5A 1JNKA 2FSMX 3UQFA 4JJRA 1FGKA 1IRKA 4L46A 2XK4A 4ALWA 1WBVA 2QOCA 2X81A 4H1MA 3WF8A 1UWHA 4U97A 5GJDA 5H2UA 5CI7A 3OT8A 4M66A 5A9UA 2ITVA 3ZMMA 4XV3A 2OXXA 1JWHA 3V5WA 3VS3A 2WFYA 4G2FA 3LMIA 3CTHA 5CEPA 5CEOA 5HVJA 4RSSA 1U54B 4D58A 1PW2A 2PVHA 4EH5A 3EN9A 3KQ7A 3LQ5A 2VWIA 5LMKC 4PDOA 3BU3A 3G33A 1PXNA 3DBEA 1VJYA 4QMYA 4R1YA 2XK3A 5AM6A 3TUCA 5E7RA 1BX6A 3QA0A 2W4KA 4DG0E 5FDPA 1PY5A 1YQJA 5KMNA 5K4IA 1JVPP 3VUTA 1KWPA 5LVNA 4K1BA 3EQRA 3G51A 3V01A 1VEBA 5ANOA 2WQEA 4FKIA 2WU7A 3GC8A 3Q32A 2YA9A 3QWJA 3FPQA 4QNYA 2J0JA 4CV8A 3JVSA 3PZHA 4EJNA 1WCCA 3ORXA 2P33A 3H9OA 4DITA 2YLFA 4IB3A 2V22A 3FXWA 5CI6A 2WIHA 3HLLA 3OW4A 5L3AA 5DH3A 2IO6A 3LLTA 4A7CA 5CNOA 3S4QA 4XJ0A 3U55A 2ITQA 4CKJA 4ZTLA 2ZV7A 3UP7A 5AJQA 2C5YA 1UKHA 2EB2A 5E4HA 4YC6A 1WVYA 1ZYJA 4D1ZA 3VS2A 4GU9A 5I9VA 4LRJA 3QYZA 4BBEA 2B9JA 4P7EA 2HELA 2X0GA 5J95A 4H05A 1UWJA 4M12A 2LAVA 4OBPA 3ZC6A 3ZRLA 5BMSA 3UODA 4ZXTA 5CAPA 1U5RA 2RL5A 2CLQA 4NIFB 5JSMA 5IQFA 3V04A 1CMKE 1Q62A 4RX9A 2X2MA 2ZDUA 4GMYA 4BCFA 3ZO3A 4RIWB 3UO6A 3H10A 4QMVA 4ASZA 4AS0A 3WIKA 2YJSA 5HTCA 2OICA 1ZMUA 3PY0A 5EW8A 5CT0A 3R9DA 2WTWA 3TIYA 3QCSA 4LV5A 3PPKA 4MK0A 3P7AA 2BILB 2R3LA 2C5OA 1O6YA 5DR9A 3UIUA 4FEWA 4RFMA 4TWNA 4PDSA 1REKA 2VNWA 3R8LA 4JRNA 3UVQA 4BCKA 5ETIA 4BHZA 5TT7A 4NWMA 2W99B 3D7ZA 4DH7A 4AT5A 3HP2A 3AMAA 2A19B 4O7TA 4C3RA 3F2NA 2CKQA 4IAYA 4CCUA 2VTIA 4MXCA 3C5IA 4ID7A 3QCXA 3JYAA 2QD9A 5CWZA 3L9NA 3O7LD 1M17A 3H0YA 5HIDA 4F7LA 2IG7A 4D2VA 4FZDB 3EN6A 3UGCA 3FY2A 4QYEA 3QQUA 3ORNA 2BRMA 4FL2A 4GT4A 3MESA 3ZS5A 4CLJA 5JRSA 4Z3VA 2PZIA 4FVRA 1PXPA 2JKMA 3SV0A 4WUAA 1STCE 3LM0A 3Q53A 2JDRA 4HYUA 1OBDA 4C35A 3QF9A 3OCBA 4RIOA 2YAKA 1H1QA 4JR7A 3UZRA 4JAIA 5HNIX 4I22A 4NTSA 1KE9A 4RJ6A 4FKVA 5I9ZA 3EQBA 1U4DA 3TJDA 4O7ZA 4YC3A 1CSNA 3M1SA 2XRWA 1OKWA 2PE2A 5DA3A 1DI8A 4D28A 4Z16A 1OUYA 2YDKA 1ZY5A 4O1OA 4AT4A 5L2QA 5JKGA 1YHVA 3Q4ZA 5A54A 2GS2A 4BTFA 3TDVA 3COIA 4RFZA 4ZTQA 3ZBXA 4CG9A 1Q99A 3PPZA 3R7OA 4B7TA 4ACDA 1YW2A 3LQ8A 2HZ0A 5HE3A 4WD5A 3FL4A 4HVGA 1CM8A 1Z57A 3FL5A 3IQ7A 1PKGA 2DWBA 2W05A 3K54A 3R0TA 5EI8A 5I3OA 1Y8GA 3JPVA 3AD5A 3QXPA 2W06A 1XBCA 3FMMA 2JKOA 4BYIA 4EWQA 5HVYA 1Q8UA 3QTIA 3I6UA 3KL8A 2GHMA 2YIRA 3NVMB 2YZAA 3VAPA 4F4PA 2YCSA 4USDA 3IECA 3DDQA 3G5DA 4F6UA 2BZJA 3EN4A 5JFVA 3GCSA 2HW7A 4Y5QA 3VHEA 2I7QA 3BU5A 3GU8A 3QC9A 3BX5A 3GUBA 3KC3A 3KXMA 4U80A 2XEZA 3DJ5A 3UYSA 5CEKA 1JSUA 5D7AA 4RC3A 4H58A 4YSJA 1IA9A 2YIYA 4JBQA 4U40A 4AA4A 2J6MA 1ZZLA 3WE4A 4AX8A 3VS4A 5EFQA 3F5XA 2IPXA 4CYIA 3CLYA 1ZMWA 1S9JA 4U5JA 2BKZA 5M56A 4YO4A 2NRUA 2XNPA 1YDTE 4XV9A 3RPOA 3W1FA 2IZSA 2VTSA 3A2CA 3CQUA 2PE1A 3D9VA 2BMCA 4XG9A 5EDRA 5JMSA 4O7WA 5LQFA 3PSCA 1SYKA 5DRDA 4BBMA 3D2KA 2Z2WA 4DBNA 2C3JA 4XV2A 3NCZA 4EHGA 2WU6A 3FKLA 2VWVA 4USEA 4DG2E 3I81A 5A4LA 2RFSA 3VJNA 2FVDA 3QD4A 4D4RA 3H4JA 3NUAA 3W2PA 4M13A 3UNZA 4PTGA 2E9UA 4IMYA 4OGRA 1JSTA 3OBJA 1P4OA 4B8LA 4F9BA 3SOCA 4W4XA 3QD2B 2CMWA 3PVUA 3QKMA 5GIOE 3KEXA 5LARA 3D14A 4UMTA 1J7IA 2PMIA 3KRXA 2OW3A 2H96A 2JDTA 2PVNA 3IKAA 4BVUA 4ANMA 2XNBA 3M2WA 3MN3A 4OT6A 1OM1A 4V01A 1XH5A 4JDHA 4O7LA 3FMLA 5K4JA 1U46A 1BYGA 1OPLA 1GZNA 3MYGA 5EG3A 4BIDA 3FMNA 4HPUE 3CGOA 4CZUA 3MFRA 3RINA 3O0GA 4FSUA 3ZOSA 3FKOA 4L45A 4FT0A 3HVCA 1URWA 5H8EA 1SNUA 2CPKE 5EDQA 4BFMA 2XJ2A 3KRJA 5IUHA 3O7LB 4QP2A 1G5SA 1YXTA 2UV2A 4FV6A 3SG8A 4AGCA 3HMPA 2OJIA 4XHKB 1Q4LA 1EH4A 4LI5A 3GI3A 3WZJA 4AGDA 5BPYA 4NEUA 1ZRZA 1J3HA 4BBFA 5C27A 4ANQA 3PLSA 3KCFA 4EC8A 3DLZA 3LLAA 5HGIA 2UVZA 3P1AA 5AUUA 5I3RA 3B2WA 4HOKA 3ZSIA 4O6LA 3ZH8A 4A07A 4HNIA 5CANA 2IZRA 4XG7A 2C68A 3R83A 3RWPA 3VS0A 3LJ1A 3WYXA 4Q5HA 4UMPA 3TDWA 3FQHA 3LCOA 4LGGA 3TCPA 4GFGA 4RQKA 3KVWA 2R3QA 3CR0A 3CTJA 3GVUA 2IW8A 4QMQA 5ICPA 3OC1A 4RX8A 3PA3A 2C69A 3OWPA 2OIBA 1YXVA 4C62A 4M15A 4EZ3A 3HV6A 2VN9A 3FHIA 4BL1A 5JRQA 3RTPA 4FKQA 1GIHA 2V7AA 5A6OA 3WF7A 2C1BA 2JDSA 3FLQA 5IDPA 3AT2A 2HWOA 2Y4IC 3PUPA 4EHEA 3ZUVA 4AOTA 4CRSA 2W1HA 4ASDA 3BLHA 3PE1A 4NKAA 4APCA 2C5XA 4F1MA 1WBSA 4AU8A 4BZOA 4IFGA 4AW2A 5A4QA 4WNKA 4S34A 4U8ZA 1TKIA 4E3CA 5K0XA 4O86A 4MVFA 3RI1A 3OEZA 4QPMA 4N6ZA 3NRMA 4FV9A 3TNIA 2XIRA 3R8UA 4LQMA 1J1BA 2ETKA 1WAKA 4ANLA 4BGHA 4CFNA 5B2MA 2RFNA 3EFWA 4HGEA 3RCDA 2QU6A 5FP5A 2PU8A 3LCSA 1F5QA 2R3GA 2UVXA 3NNVA 2PPQA 4YTIA 1PXKA 5BQ0A 3LXPA 2O2UA 4PY1A 3VN9A 4MWHA 3Q96A 3R8PA 4QMTA 1KSWA 2QLUA 5JT2A 5CQWA 3R63A 1Z9XA 2CGUA 2I0EA 3GXLA 3UVPA 5HICA 2O0UA 1UVRA 2VD5A 3MY0A 4MAOA 4Y95A 1RJBA 4UYAA 2P2IA 4FSMA 2ACXA 4O22A 3CEKA 3U4WA 2YHVA 2PVMA 4AWIA 2DQ7X 4CKRA 2WTKB 4AN9A 4C2WA 3FLSA 4YZBA 3U6HA 4D2PA 2XS0A 4WBOA 1WBPA 4O0SA 2B9FA 2W9ZB 3HRFA 2CKEA 4NJ3A 3GT8A 1OGUA 2ITZA 3CJFA 4KBKA 1M2QA 2BR1A 1PMUA 1QL6A 4NKSA 5BNJA 4FSWA 2GMXA 2XP2A 2YITA
chains in the Genus database with same CATH superfamily
2RGPA 3EKNA 4I92A 4BRXA 3BU6A 3TIZA 1H26A 5IDNA 2YIXA 5M08A 4OT5A 2XK7A 4FTUA 4U3ZA 4FIIA 3QQLA 1ZY4A 4TZRA 5DEWA 5AUTA 4K33A 3R30A 4X2FA 3S2PA 3ZYAA 4DGGA 2DS1A 3BI6A 3CKWA 4HNFA 4QTCA 5E8XA 4TWPA 3COHA 4M0YA 5IG1A 2UW9A 3GOKA 1VLRA 2Z7SA 1W7HA 3AG9A 4GIIA 2W1IA 3COMA 1V0OA 4GYIA 4NFNA 4BDCA 3S1HA 4JMQA 4DFNA 5FUTA 3KXZA 3BELA 3N4VA 3P78A 4DFZE 3F3WA 3H0ZA 1FINA 4QQCA 5DE2A 1DI9A 4I93A 1DM2A 1XMMA 3QZFA 3UDBA 3KXNA 4OTHA 1O6LA 4YO6A 1QPJA 2XANA 4TYJA 3EIDA 4LMNA 4LYNA 2GSFA 3QALE 4JBOA 2PUNA 2QOKA 3G0FA 5K0KA 4GT3A 2H8HA 2XKEA 2Z8CA 4FYNA 5IMXA 4PPCA 4EOJA 3FLZA 4C59A 5IQIA 1YWVA 3BYVA 4LV8A 4UWCA 3W0NA 5HLPA 3VBTA 4ZLYA 3OXIA 5CAQA 5EHLA 5JZJA 3MB6A 2HWPA 4FVPA 3M42A 3DLSA 5LWNA 3ZFMA 4JG6A 4YUQA 2HW6A 3RNYA 1VZOA 2W5HA 2ITYA 3V5PA 5JN2A 4IACA 5B0XA 5B2LA 3COKA 4BGQA 2EXCX 4F7JA 1CKPA 3FSFA 3QQGA 4JR3A 2RFDA 4L53A 4HVSA 1YWRA 3VS6A 4QEBA 4XP2A 1E9HA 1WVWA 4UWBA 4ASXA 4KNBA 2J51A 4GS6A 3UVRA 4ASEA 4UZDA 1M52A 3JY9A 4G1WA 4M84A 5HEZA 3VF8A 4M67A 3FZOA 3CTQA 3PE2A 4C8BA 2QOLA 4FOBA 5M4CA 3BE2A 2JAMA 5D41A 4B0GA 3A7IA 5HG5A 1Q5KA 4J98A 3BQCA 3LFDA 4DHZA 3S3IA 4YC8A 5IH6A 4X2JA 2WD1A 5DI1A 4W8DA 3NNWA 2ITUA 5AR8A 3GEQA 5FEQA 3RK5A 3PRFA 4FV3A 3EFKA 4K18A 4BCIA 3R9RA 5TOZA 3NCGA 1KE7A 5JQ5A 2JIIA 3MY5A 4GL9A 3FKNA 4EH4A 3POOA 4I4FA 5CF6A 5IQGA 3KGAA 4RWKA 3LFQA 3NGAA 2XZSA 1B6CB 1W82A 3OUNB 4XMOA 5EK7A 4JI9A 2YM3A 3PSBA 4D1XA 4JL9A 4KKEA 1KOAA 3KXXA 3T9TA 4AE6A 4DFLA 2WB8A 3DKGA 2AC3A 5CSXA 2WMSA 3A7GA 5EM8A 4X0MA 5J9LA 2C5NA 4L52A 4X7QA 2PVRA 3NAYA 3AOXA 4JBPA 5BYYA 4ZY6A 1BI7A 4YZCA 2C6MA 4BF2A 4RLLA 2XAMA 4O0RA 3C0GA 5DRBA 4FZ6A 5KHWA 3CBLA 2XVDA 4WBBB 1ZXEA 3T8OA 2C6IA 3R2BA 3AD6A 5M51A 2NYAA 2QG7A 2VX1A 1LR4A 4ITJA 5FTQA 4AOJA 4AZEA 3GQLA 3HDMA 3PWYA 3NMUF 4FICA 2XCKA 1J1CA 1OIUA 5CVFA 3VQUA 5ACKA 4ITHA 1R1WA 5CEIA 4CV9A 5KE0A 3EFJA 5CAUA 5HIEA 5HX6A 4W4VA 2C3IB 2GNIA 1H1RA 2QVSE 1IAJA 2CDZA 5CZHA 4BB4A 1ZARA 3C4EA 3BHUA 4I41A 4YJQA 3HA8A 5AR5A 3R8VA 4YR8A 2F7ZE 3E5AA 4B99A 2NPQA 2PVFA 3DZQA 3GCQA 5FM3A 2X6EA 5JFWA 4YP8A 3E7VA 4YNOA 2XEYA 3CGFA 4FTKA 2WQNA 3ORMA 2OO8X 5HIBA 5IH4A 3KXHA 4GSBA 1J7LA 2VUWA 5M55A 3GBZA 3VBQA 3K2LA 4YZDA 3F7WA 3RP9A 3I4BA 4O96A 4FV2A 4YZ9A 3G9NA 1ZOGA 4ZY5A 3JY0A 3VIDA 3LFSA 3RCJA 3F69A 2RFEA 2JKKA 3E8CA 4YZMA 5GNKA 4PP9A 4KS7A 4J96A 4FG7A 4AOIA 4CFWA 1G8SA 4R78A 3KFAA 2C47A 3ALNA 3KIOC 3PUFC 5EQEA 2QU5A 5AR4A 3I5ZA 1BLXA 4FTJA 1DAYA 4I6QA 2PZ5A 4X3FA 3FDNA 4FTMA 5DWRA 3VBYA 4QYHA 4NFMA 3MI9A 3NNXA 4EH8A 3BEGA 4C4FA 5AV0A 5CEMA 2E2BA 4YHFA 3TZ9A 1H4LA 3BE9A 3HMNA 5A46A 4ERWA 5M57A 3Q04A 5E8TA 3REPA 3ROCA 2X1NA 1BL6A 2YM4A 4BDGA 3BEAA 3Q52A 5E90A 4R77A 4YJOA 2B7AA 3LVPA 3QUEA 4IZ5A 5LMAA 3UMXA 4BDIA 5DT4A 1OVEA 4JT3A 4EH3A 3PXQA 1W84A 3Q4CA 3KVXA 4XLIA 3U8WA 2R3FA 2GDOA 4O82A 4Y73A 4QMSA 4BDDA 5J5SA 2NRYA 4TN6A 4LMUA 5F4NA 5M4FA 3ZO1A 3R1SA 5EQYA 5M4UA 1ST0A 3M11A 4H3PA 5HO8A 5AUXA 2UW5A 3BHVA 3L8VA 3NIEA 3GU6A 2W1FA 2WMUA 4N4SA 4TT7A 5EI6A 3QHRA 2E9VA 3P7CA 1WFCA 1Q61A 3PIZA 3OW3A 5IA4A 2PWLA 4L3JA 5KKRC 4FUYA 3H9FA 5C8MA 4S30A 3ZXZA 4R3RA 4ZSAA 4A9YA 2GNGA 1WBWA 3D5XA 4HVDA 5L6PA 3LW0A 1Q8WA 3OXTA 4PNKA 3QZHA 2V5QA 5AUVA 5CALA 5KMIA 4BTMA 1Y91A 5BVWA 3N4TA 3C5UA 4UBAA 4GKIA 3MIAA 4IHPA 5JQ8A 4JDKA 2A4LA 1U5QA 2NO3A 2Y8OA 3CCNA 3HUCA 3R73A 4ZSGA 4AA0A 4FZAB 2BHHA 2YIWA 3PJ3A 4AGUA 3BKBA 1AQ1A 4AXFA 4K9YA 4RWIA 1KE5A 3SD0A 3RAWA 4W4YA 3PXYA 3QTZA 5AX3A 2Z7RA 4IM2A 4ENYA 3L9LA 3UP2A 4PP7A 2DYLA 3OCTA 3GFWA 2ITNA 1VR2A 3CY2A 5LMKA 5AR7A 1UU3A 3W33A 3S0OA 3W0QA 4ANOA 5C4KA 4MXXA 2O5KA 4L42A 4NUSA 2HZIA 2BZKB 5LVMA 4RJ5A 2W5BA 1CDKA 1OL6A 2OBJA 2Z7QA 2ZM1A 5CZIA 5ANKA 1XHAA 5CU6A 1NY3A 3BYSA 1UA2A 3C9WA 4X2KA 2CNUA 1GY3A 1ERKA 1YHSA 2AYPA 5E1EA 3SXSA 2ZB0A 1SNXA 3QRJA 4GRBA 4C34A 3B2TA 3D2IA 2P0CA 3F61A 4LOOA 1W2FA 2UW3A 4X2NA 4MXYA 5AFVA 4MBLA 3L9MA 3WARA 4KABA 3AKLA 4G3FA 4QO9A 2R3HA 3F2RA 3HYHA 4DFUA 4ARKA 3UQGA 4YJPA 5AAEA 2HOGA 4F0GA 2YWPA 4CLIA 3CD8A 3GCPA 4MUQA 4L01A 3PVWA 4I21A 1SZMA 3IW8A 3CP9A 5D12A 3D94A 3HDNA 2J50A 4OTRA 4CQEA 4EKLA 3IPHA 2JAVA 3UZPA 4WUNA 3V8TA 3UIBA 3FI8A 4O7NA 4Q9ZA 3DAEA 3TNQB 4DH1A 4X3FC 2Q0BA 1UU9A 3F3UA 5HI2A 1FBNA 1RW8A 3WI6A 3HMMA 1QCFA 4O0XA 2UW6A 3L1SA 1TQPA 3ZHPC 4LL5A 4XG2A 3KCKA 3TKIA 4H1JA 5DN3A 5HLNA 3NNUA 5JFXA 3OUKA 1TQMA 2XIZA 1BI8A 3QLFA 2ZDTA 4TPTA 3KU2A 3AT3A 1FPUA 1WBOA 2XK9A 4TWOA 4GUEA 3IG7A 4JS8A 4WNOA 3RPRA 3NFFB 4JOAA 2ETMA 2V55A 2CGWA 3NAXA 3NSZA 5IA0A 2XARA 5E8SA 2ITOA 4OTQA 3V5LA 4DH3A 3F5PA 3QZIA 4FG8A 3I7BA 4O0WA 4O38A 4GK3A 2C6LA 4FK3A 3MTFA 4TYEA 3EL8A 4KBCA 4RC4A 5LCJA 3I60A 4KKGA 3QCQA 5K3YA 4QYYA 3UTOA 5KHXA 4D4SA 2BCJA 4M8TA 4JIKA 4RC2A 5AV4A 3IDPA 5CAOA 4E4LA 3BHYA 4FC0A 4O6EA 5HBHA 4AF3A 3KKVA 3E8DA 5HE0A 4IVDA 3RPVA 4WRGA 4AGWA 4FA2A 4KUJA 2XM9A 3AD4A 2OZOA 5BYLA 4UY9A 3CKXA 3EQGA 2UZLA 4IX6A 4H3QA 4FSYA 4UEUA 1L3RE 4MF1A 3S00A 3HA6A 1BMKA 3QZGA 3FE3A 1UKIA 3P23A 5FBOA 5AV1A 4P5ZA 4FVQA 3MS9A 1PF8A 1WBTA 2P2HA 3EQHA 3O8PA 4FKOA 3SAYA 3VBXA 3K3IA 3IW7A 1KV2A 4AFJA 3V6SA 3D15A 4QT1A 5A4CA 3TWJA 2ZMDA 1RQQA 2VTNA 1P4FA 5AP5A 3SDJA 1VYWA 5BMMA 2XKFA 4CTBA 4X3FB 4DAWA 2X39A 5D10A 3KULA 3FI4A 5F1ZA 4NYEA 5M07A 3ORZA 4F78A 2B54A 2G1TA 2EB3A 3AGMA 4I0TA 4CQGA 2OWBA 4EBVA 4EH2A 1SM2A 2HIWA 1P5EA 2P3GX 5IMEA 3QD3A 1H0VA 3PXKA 3F3VA 3R8MA 3R8ZA 4BIEA 3AQVA 3ZUUA 3LCTA 1OZ1A 5J9ZA 4F0FA 4QNAA 4NU1A 2E9OA 3EZVA 3ORKA 4FNXA 3OY1A 4J95A 3NUSA 4QQJA 5CEQA 3UOHA 4BKZA 5KX8A 3QUPA 4BDHA 5CASA 4FT7A 5JZNA 3SXRA 2R3KA 2GCDA 4J71A 3BQRA 3VF9A 4DC2A 4ZEGA 1M14A 2ERKA 2KTYA 1W8CA 1PMNA 3DCVA 3KXGA 4G5PA 5A4TA 4XOYA 5E8UA 4I24A 4C4HA 3N9XA 2PUPA 2F7EE 2YIQA 3PP0A 4QP3A 4RBLA 1M2RA 4B4LA 5IQEA 3A7JA 1YVJA 5T68A 4ZZOA 2WZJA 5HQ0A 3AKJA 4WIHA 5FEEA 3W8LA 3DB6A 5CS6A 2QOQA 4FKJA 3VBVA 4V05A 3PJ2A 2R7BA 2J0IA 5GZ9A 5AAFA 2WHBA 4GV1A 4GEOA 5KMLA 1DS5A 3VS7A 3FQSA 2C0OA 3BL7A 1FVVA 3UG1A 4Y8DA 4HCVA 4GKHA 3H30A 1REJA 3IK3A 3QLGA 4Y72A 4I5MA 2XA4A 3A4PA 4NM0A 4YJNA 2QG5A 2Y6OA 4C36A 4RX5A 3ERKA 3D5UA 2J90A 4FKPA 4E4XA 5KNJA 4KIOA 5HBEA 1MP8A 3NR9A 4FUXA 4N6YA 1JQHA 3AC5A 4HGSA 3PRIA 4L00A 2XNOA 3LFCA 1PRYA 4CCBA 3HV3A 3U54A 1E1XA 3W0OA 3RMFA 2X4ZA 5EOLA 2OXYA 3UIXA 2GQRA 4O0UA 5E91A 3PJ8A 4JXFA 2OK1A 3KB7A 3HAVA 4DF3A 2VO7A 3MH1A 5DVRA 4DEAA 2C30A 4DDGA 3RM7A 4AZTA 4G3DA 4N0SA 5L2TA 5J1VA 4QTAA 5HCZA 3W0PA 4DEIA 5GINE 4ZMEA 5FTOA 3W8QA 4YJVA 5D11A 3ZUTA 3R02A 4Q2AA 2EVAA 3PXRA 4F1TA 5DNRA 4A9TA 4TY1A 2ITPA 5DR2A 3HEGA 4JRVA 1ZYLA 2AEGA 2F2CB 1YI4A 4JQEA 1JSVA 5DGZA 5K9IA 3QRTA 4BHNA 4MH7A 4DEGA 5DG5A 1B38A 3HV7A 3A7FA 2VTLA 2XIKA 2ZYBA 3AT4A 4FE2A 2I0VA 4FEXA 3LZBA 3ZO4A 1UU8A 2EXMA 2X8DA 3OT3A 4GJ2A 2BHEA 4IWQA 4MBJA 4QMXA 4RT7A 4WHZA 3ENMA 4LL0A 4C4IA 5L6OA 1O6KA 5AUZA 3NYOA 4D4YA 1NT2A 5IPJA 4U41A 4O0YA 4G9RA 4M68A 4QP1A 1PMEA 2OJ9A 3AMYA 2OSCA 3ZBFA 3EFLA 3SW4A 4DEEA 4PDYA 4KIPA 2OG8A 2Y4PA 5CY3A 3U9NA 5L6WL 4K11A 3UO4A 4F9WA 3NS9A 3MH0A 2UW7A 5C1QB 3VRYA 3L8XA 3PLAE 4BKJA 3TN8A 4HVIA 2ZV9A 5EYMA 1GZ8A 3HGKA 4J52A 4FSQA 4KWPA 3DV3A 2R3PA 1SVGA 3ODYX 4G3CA 4MD8E 4FKLA 4FIHA 4YTFA 3B8QA 4QOXA 5FXSA 5IKWA 3UNJA 3QAME 4GVJA 4F7SA 3A62A 1GZKA 4XRJA 2J0KA 4JBVA 4L6QA 2XYUA 4CMOA 2JBOA 2XF0A 4E5WA 3LOKA 4GH2A 3FUPA 2WO6A 5DLSA 4ACCA 4FEUA 2B55A 2ZAZA 2VTHA 1GAGA 4JG8A 5CU3A 5I9WA 4EOKA 4MXAA 4UV0A 5CU0A 4DHFA 2PVJA 2WIPA 1V0BA 2H34A 4YJRA 1HCLA 5CU4A 4F08A 5J7HA 4R7BA 3KULB 3FAAA 4GUBA 2W7XA 3GNIB 2PVKA 3MA3A 3LAUA 4FV1A 4PWNA 5AIRA 3F6XA 4ZOGA 4AUAA 3TZMA 1ZAOA 5CTPA 1MUOA 1ZWSA 3E64A 4OBOA 4AAYA 2QR7A 3GCVA 3MY1A 3VNTA 2BDWA 4BIBA 3U51A 4E4MA 2JLDA 2F4JA 3HMOA 4D2RA 4QDEA 2GNJA 1MRYA 3ZO2A 4U42A 4IZAA 4EUTA 5HG9A 3ZLYA 5ACBC 4KSPA 2H9VA 2JDOA 3WZUA 4XV1A 2Z60A 2J2IB 3LM5A 5C9CA 4IM0A 4E6AA 4IDVA 4R7IA 3V5JA 3R28A 4C33A 3Q9ZA 4O7SA 2VTPA 3PA4A 3W0MA 4RVKA 2PMOX 2QHMA 3MPMA 3HRBA 1FVTA 3RK7A 2VTAA 4C58A 3OWJA 1TQIA 4TXCA 3VONA 3C13A 2VGOA 4FZFB 4NK9A 2ZB1A 3GOPA 4PNIA 3TACA 2X0OA 4QMWA 2G9XA 2W1ZA 4S32A 4E20A 2CLXA 3EQIA 2PMNX 2WTIA 3ZC5A 2PUUA 3VUGA 2VTMA 5EHOA 1K9AA 3HECA 1H1WA 1XR1A 2QONA 4UALA 4DLIA 4EOOA 4QTDA 2PE0A 3PVBA 4BCJA 2YABA 4FV0A 4J8NA 3KN6A 3MJ1A 3TZ8A 1PXMA 2WQBA 3P5KA 4OR5A 3VUKA 5GHVA 3QUDA 1MRUA 4L9IA 3QGWA 5KCVA 3FHRA 4TNDA 2QO2A 3OWKA 2WNTA 1K2PA 1BL7A 2C3KA 3E3PA 3R9NA 4E8AA 2WMWA 2ZV2A 2OJGA 1OPKA 2ZOQA 3SQQA 3OVVA 4NCTC 2I0HA 3W2QA 1NVQA 3MA6A 5BUJA 1NVSA 4D2TA 3QTQA 4O0TA 1YXUA 3F7ZA 3MPTA 4Z7GA 4IX3A 5AADA 1W2CA 1FGIA 2FB8A 2PZYA 3ODZX 3NVKI 3FPMA 5FWKK 5AEPA 3R21A 2F2UA 3NUYA 4RFYA 3FYJX 1H07A 3KF7A 3KMUA 3R6XA 3BLAA 4G31A 2R3IA 2QNJA 4OBQA 4RJ7A 4FL3A 4AW1A 4F09A 3BCEA 1AD5A 3PY1A 4FG9A 3SRVA 4F70A 3SX9A 5CLPA 3ZTXA 3C4FA 5CVHA 2RG6A 4ZJIA 3BYUA 3F82A 3QRIA 4CTCA 5E1SA 4FKGA 3FWQA 3KF4A 3PIYA 4CNHA 4JX3A 2HY0A 3V51A 3QRUA 3VUHA 5LOHA 2JIVA 4ZTMA 2ESMA 1RE8A 4DH8A 3QTRA 4S33A 5HO6A 4ZLOA 3DJ7A 4AN3A 4NW6A 3PDTA 2RG5A 3DOGA 4M14A 2EXEA 2YJRA 5CF8A 5BVFA 2BIKB 2VGPA 2XKCA 5C03A 4G6NA 1X8BA 4FODA 3EZRA 5HU9A 3Q6UA 3OG7A 3MDYA 4D2SA 4DEBA 1IAHA 3IS5A 4I23A 2YM8A 2BAQA 3POZA 4OLIA 4C7TA 3G15A 4XLVA 4RLKA 5IQDA 4PMTA 4BCMA 4O7YA 3NLBA 4FKWA 3I5NA 3KY2A 3AC2A 4KBAA 4RVMA 5H8GA 4DN5A 3QQFA 3BLQA 3FI2A 4E7WA 5KBQA 4O84A 3PVGA 4DTAA 1XBBA 3BZ3A 4IC7A 2CHLA 4O4DA 4QMUA 4GYGA 2VTJA 2BZHB 3BBTB 4O7RA 2BDFA 4YMJA 1Q24A 1YRPA 2IWIA 5AIKA 4R3CA 1K3AA 3DZOA 2YM5A 3PY3A 4CG8A 2CGVA 1SVEA 3NPCA 3TUBA 2XALA 2J0LA 4KB8A 4IIRA 3EN5A 1F0QA 4L68A 4PMSA 4M3QA 4OTWA 3EB0A 3F5UA 3Q3BA 5KUPA 2FO0A 4EKKA 4Q9SA 5ANJA 1J91A 2HYYA 2Y4IB 2YISA 4FTOA 3SA0A 5M06A 5D9HA 3BHTA 3VW8A 4RPVA 1YKRA 5HZNA 1OIQA 3HRCA 3JVRA 2VWYA 4CGAA 5FXQA 3NX8A 4BDJA 4HYSA 3DJ6A 4F9YA 3F3TA 1UNGA 4PRJA 4CRLA 1CKIA 5JH6A 5DOSA 4P2KA 4AAAA 2GNFA 3ZLXA 3MV5A 4DTBA 4ACGA 4MQ1A 5DIAA 5GZ8A 3RZFA 3T3VA 3RM6A 1ZOHA 4MXOA 5ETFA 4EOMA 3E63A 4I0SA 4GW8A 3O96A 5IEYA 5EW9A 4F6SA 4R7HA 4PDPA 5CSWA 4EH9A 4QMLA 4PTCA 3OFMA 5DMZA 3SGCA 3F66A 4II5A 5F94A 1NXKA 3P86A 4ZTRA 2JDVA 2XIYA 3N4UA 2BPMA 4M69A 3UOJA 5HLWA 3LMHA 1OUKA 4ZP5A 1PHKA 3C0HA 3MJ2A 5AP6A 3AC3A 4DT8A 2QLQA 2HY81 4R6VA 3P79A 4CSVA 4DEDA 2IVUA 4GIHA 3NUXA 3WOWA 5HD7A 4USFA 1ND4A 1GIIA 2YLEA 3A61A 4WO5A 3AKKA 3OCSA 1ZYSA 3C0IA 2W5AA 3V6RA 5IQAA 2JEDA 2WOTA 2O65A 4RQVA 2B1PA 5H9BA 3MVMA 4OTFA 1UNHA 4E93A 4G5JA 3SG9A 1Q41A 2UUEA 3PZEA 2YACA 4E5BA 4FR4A 3OWLA 3Q9XA 5IISA 4UWYA 2A2AA 3MBLA 2CKPA 4TRLA 4JG7A 2OF2A 4CFVA 5A14A 4ZSJA 4HZRA 3FV8A 3E8NA 2W4OA 4HW7A 4MCVA 2A27A 4EONA 4RMZA 1GOLA 5HG8A 3FC2A 4ORKA 4HPTE 4BICA 2A98A 5AV2A 4K77A 4AQCA 2G2FA 3QQJA 2O3PA 2W1GA 3C50A 4YHTA 2ZV8A 2WMBA 2UZEA 4C57A 4WSQA 4B8MA 3U4UA 4BC6A 4O91A 3QKKA 2GS6A 4KIQA 3FY0A 3R04A 4J99A 2GTNA 5I5ZA 1OBGA 4AXDA 3I1AA 4ZTNA 3GCUA 4YNEA 3MVHA 1MQBA 4MNEA 1H24A 4FV7A 3Q5ZA 4L3PA 1XJDA 2P55A 4IFCA 4BTJA 2REIA 3RPYA 4IZYA 3P5JC 4DE4A 1YHWA 4DINA 1YXSA 3KK9A 4FKUA 2QQ7A 2Z7LA 3DKCA 4OAVB 4C2VA 1IG1A 4X6RA 5AAGA 3IW6A 4LUDA 5IQBA 5KMJA 4OAUC 2R3RA 2FA2A 2ITXA 2PMLX 4O83A 4PF4A 4IAKA 3SRVB 4A06A 2HK5A 1G8AA 4FEQA 4MF0A 4IEBA 4ZSEA 4AG8A 2XK8A 3OOMA 5KZIA 2X7OA 4C02A 4PPAA 4V0GA 4JLCA 4FKTA 4MD9E 1BKXA 3C1XA 4QMOA 4U7ZA 4M7IA 2WEVA 5DHJA 1OL5A 5KMKA 5HCYA 3DB8A 4NSTA 3VC4A 2AQXA 2QKRA 1WBNA 2OZAA 4QYGA 3KRRA 5J79A 3MH2A 4CKIA 3DBDA 2VO6A 4MD7E 4U0IA 5IU2A 2QCSA 3ZRMA 4AE9A 1PKDA 3ZLWA 3G9LX 5IQCA 4W4WA 3CY3A 3Q2MA 4QMPA 5I9UA 3R1NA 4GK4A 2BVAA 5CXZA 4DGLC 2VX3A 1Q3WA 2UZTA 3CXWA 2B9IA 3QQHA 4RJ4A 4AQKA 3GP0A 2SRCA 2UZWE 4U81A 3FEGA 2XNGA 5TKDA 4CMUA 1G8JA 3P08A 3V8WA 4FTIA 4UMRA 5IA2A 5L8KA 3QU0A 3VRZA 4WSYA 4YU2A 5LXMA 3QFVA 4FV5A 3C4WA 4PUZA 3TI1A 3UC4A 2I40A 4G3EA 4IXPA 5KMMA 2WQOA 4J1RA 3HP5A 5HO7A 2JFLA 1KE6A 3DXQA 1G3NA 4BWPA 2YDIA 3FMHA 2R3MA 3FLWA 4LFIA 2UW8A 2B4SB 3ET7A 2OIDA 4FNWA 4FT9A 3R7YA 2BIYA 1OMWA 2FGIA 2IN6A 2WTVA 5B2KA 2HCKA 3UMWA 5HBJA 2C6TA 2WQMA 2OI4X 1H28A 1HCKA 2XJ1A 4CEGA 4EHVA 1W0XC 2XK6A 4K0YA 5EM7A 4G6OA 4FTQA 4FZ7A 3HAMA 3L9PA 1H25A 5FEDA 3NUNA 5K5XA 2Y7JA 3I79A 4FTTA 1FVRA 2ETRA 2PZRA 3W2RA 2CN8A 3MFUA 2V62A 2PZPA 4FK6A 3NWWA 1H8FA 2WMRA 4EOQA 3ORTA 5HNGA 4UXQA 5CSHA 4RJ3A 2NP8A 4ONAA 3A8WA 3WZEA 3TYKA 1XWSA 1LP4A 2EWAA 2X0PA 4JDJA 2R3JA 3R7VA 4EOPA 4JDIA 2UZUE 3P9JA 3E7OA 4D5HA 2VWBA 3GGFA 2VRXA 2UVYA 3P0MA 5EKOA 3ATTA 2IZUA 1CKJA 2WELA 2X9FA 3ANRA 2XMYA 3NIZA 4QP8A 3ID6C 5I0BA 2WMTA 5EH0A 1XO2B 3BGQA 2BUJA 3LE6A 4DFYA 1Q8YA 4M69B 5L8JA 3TG1A 1FMOE 3QTUA 5AWMA 5CNNA 4FJVA 2XM8A 4RGJA 3EN7A 4J97A 2YM6A 3DTWA 1LPUA 4IADA 1M7QA 2VWXA 3SLSA 4PX6A 2IJMA 1W83A 3ZEWA 4C61A 3A7HA 2QR8A 4QD6A 4HGLA 3QGYA 4P90A 4ZS4A 2YFXA 4BYJA 2ZM4A 4Z55A 2GHGA 2WKMA 5AV3A 2F57A 2QKWB 3G2FA 3ML1A 4S31A 4EOSA 4NM3A 2VWWA 4WG3A 2W17A 2IVTA 3SXFA 3SHEA 3DQWA 3BPRA 5BVEA 5HVKA 3HV5A 3Q4TA 4I6HA 4YLKA 4YPDA 4A9RA 5LVOA 3FJQE 2BDJA 1Q8ZA 4WG5A 1OB3A 2X9EA 5HD4A 2Q0NA 3OP5A 1M2PA 1IEPA 3MIYA 5KKRB 4RRVA 3BYMA 4PL3A 4JIAA 3AGLA 4IAIA 3II5A 1XH7A 3QTSA 1Q3DA 5G6VA 4XG6A 4FTLA 4RZVA 4IH8A 3I0QA 4I5PA 3VUMA 4W8EA 2JITA 3D83A 3BWJA 3C51A 3BV2A 5C8NA 1MRVA 3IO7A 4XP0A 2B0QA 4E6DA 4A9UA 4IWDA 3FLYA 5BVNA 3V5QA 1OL7A 4UMUA 2XCHA 4RA4A 2OFVA 4YJTA 3VW6A 2BTRA 4MNEB 5FLFA 4EYJA 3O8TA 4XH6A 1GZOA 2WAJA 2XKDA 3EMGA 5EM5A 4R5YA 1XQZA 4V04A 3RBWA 3VBWA 3V8SA 1ZZ2A 3LXLA 2YAAA 4EZ7A 2R4BA 5JGBA 3E8EA 3QX4A 3FXZA 2W96B 2FYSA 4BCNA 3IGGA 5C01A 3OF0A 5DR6A 3VO3A 3RK9A 1BUHA 3V3VA 3OHTA 4FGBA 2UZDA 4A4XA 4E26A 3LFFA 2PY3A 3HL7A 4XNEA 5H8BA 4D0WA 4ERKA 4BR3A 4W9WA 3NDMA 4FTRA 3ZM4A 3FI3A 1OKYA 3RHKA 4D4VA 4V0GB 2KULA 3WBLA 3R9OA 1U59A 4R1VA 4YBKA 3ACKA 4DCAA 2OZAB 2VAGA 2CNQA 4IVAA 3AC4A 2QC6A 4ALUA 4I3ZA 2BZIB 1OIRA 1QPCA 3BGZA 2R5TA 1T45A 4FIFA 4IE9A 4N57A 5CYIA 5TF9A 3W55A 2C3LA 2GFSA 2OJFE 4F63A 1Y8YA 3QL8A 2X7FA 3BGPA 4EHZA 1Y6BA 5DT3A 5CF5A 4I5CA 4EOIA 2BRBA 4X21A 3OTVA 4G16A 4KKHA