1BLXA

P19ink4d/cdk6 complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
305
structure length
305
Chain Sequence
GLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (inhibitor protein/kinase)
molecule keywords CYCLIN-DEPENDENT KINASE 6
publication title Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 305
sequence length 305
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 1998-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1blxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1blxA01
1GIJA 3QD0A 3QWKA 5HD4A 4IB1A 4F1MA 5BVDA 4B9DA 4O0RA 4RIWB 4BDAA 2XM8A 3PVBA 3TM0A 1YOLA 1H27A 5KMLA 3ZSHA 2QODA 3PY3A 1YI3A 3V3VA 1VEBA 1XKKA 2WKMA 2YABA 4DBNA 3TV6A 3F2RA 4QQCA 5AX9A 1TQPA 4E4NA 2W1FA 4QMSA 3UGCA 2C1BA 4K9YA 3FMDA 3TT0A 1JQHA 4O0SA 3R8MA 4BGGA 1NA7A 4XLVA 3MVMA 3KRWA 1YDTE 4WBOA 2Y4IC 3I7CA 4JIKA 4MXXA 2P4IA 3QRIA 3MBLA 2R3FA 1PYXA 3E62A 4JI9A 2IZTA 2XBJA 3NX8A 3HMNA 5ICPA 2CDZA 1Q8TA 3PJ8A 3PJ2A 1UKHA 4NCTC 4PTEA 3PXQA 4QYHA 1WBPA 4BIDA 2VWWA 3O8UA 4XG3A 4DINA 4IAZA 4AZSA 2ZYBA 3IW6A 4LOQA 1JBPE 4RJ4A 3E7VA 2UZOA 4JBVA 3TTJA 3E8EA 4FTLA 2CKQA 1U46A 3PDTA 1PMEA 4KAOA 2UZLA 2FA2A 3KXHA 1OL6A 4WSQA 5JT2A 2XEZA 2VN9A 4XLIA 4LRKA 4DH3A 3V8WA 1P4OA 3FHIA 3OWKA 3QL8A 4DEAA 4B7TA 1WVYA 4GL9A 3SLSA 4NIFB 3P79A 2OF4A 2BHEA 2Y4IB 2BDJA 3CE3A 3Q2MA 3QLFA 4TYGA 4UWCA 4YZBA 5DIAA 4ZK5A 3BWJA 5HVKA 1H00A 5HX6A 4LL0A 5FXSA 3QWJA 5TF9A 5ANEA 2YHVA 3ROYA 5D1JA 3P86A 4UYNA 2J6MA 3EQGA 5HO8A 5L6WL 1K2PA 1VYZA 3EQPA 3PUPA 4ZS4A 3WE4A 4IAYA 4DEIA 4BC6A 5AP5A 4R1VA 2OKRA 5AP0A 4BDJA 4BB4A 3NPCA 4CSVA 3VHKA 2XM9A 4QP2A 4RZVA 4RX7A 2ITNA 4ZLZA 1XBBA 1ZOGA 4BDBA 3MH2A 1WVWA 1YWVA 4X6RA 3ZBXA 2C5VA 3PVGA 4P90A 1YDRE 1YKRA 3DLSA 3SVVA 3DNDA 4FV4A 4UEUA 4NEUA 3IPHA 4FV9A 3IG7A 4FSYA 4YBKA 4AN9A 4DEHA 1GZNA 3QD3A 4YTCA 4ZTRA 2PU8A 1H25A 2O2UA 3GCQA 3A60A 1AD5A 2RG6A 3FXXA 3ORXA 3W10A 1XHAA 3PPKA 4O91A 1M17A 1Q97A 3ZLSA 4DBXA 3N9XA 1PXJA 4BDKA 2CLQA 4EOOA 4F6UA 2Q83A 3PLAE 4IXPA 3PXZA 4OTWA 2JAMA 3AG9A 4J52A 2F7XE 2XK9A 3HVCA 4RZWA 5AP6A 3TN8A 4BCFA 4ZSAA 5K5NA 1K3AA 1YOMA 3PVUA 5CENA 4AAAA 3LQ3A 3KMMA 3DXNA 3V5TA 3DBQA 4HYIA 1UU7A 4YJVA 4AGCA 2PUPA 3F66A 4FVQA 4XRJA 5FQDC 4L6QA 2B9IA 5EW3A 1ZARA 1YXVA 2EXCX 1OUYA 3ETAA 3R1NA 4RIYB 4TKSA 4ENXA 2RFSA 5LMBA 4UZHA 2JFLA 2PYWA 5IEXA 4EBVA 2B53A 2GNGA 4GK3A 1IR3A 3R02A 4CNHA 3WF9A 1R3CA 3C7QA 5LVMA 4QNYA 2C6DA 2V7OA 1FGIA 4BBFA 4M13A 3HRBA 3I4BA 4H1JA 2PVRA 2YCFA 3F88A 5GZ9A 4D4YA 2GNIA 5I9XA 2W1ZA 4L3LA 5IDNA 4U40A 4X2FA 4CVAA 3NUXA 4WUAA 3TZMA 3QUDA 2A1AB 3WIGA 3QHWA 1JKTA 3TUCA 4V0GA 3O50A 2IZRA 2YJRA 5GIOE 3SHEA 4MF0A 4BY9E 4I93A 2FB8A 4J7BA 3BI6A 4IMYA 4E6AA 2GHMA 4KBAA 3BHYA 3NSZA 1DI8A 5FEDA 2O5KA 1OBDA 5LVOA 3LCOA 2X4FA 4BTMA 1JNKA 3FMHA 3QGWA 2WD1A 5C8MA 3FAAA 2XUUA 3BE9A 5J1WA 4UN0C 4NJ3A 5GINE 5ETAA 4A9SA 4AN2A 5LQFA 3TUDA 4CLIA 2YIXA 2GNFA 3KCKA 4H05A 4ZMFA 3OC1A 3RNIA 3NAXA 2OI4X 2GHLA 4I23A 1U54B 1H1RA 3F9NA 1PXOA 1W8CA 4U0IA 5L2WA 1SVHA 2XVDA 3EOCA 1OPKA 3OG7A 4FZ6A 4GFOA 2ITOA 3VN9A 4ZY5A 5IQGA 4PNIA 2J5FA 4NZWB 1A48A 3C5IA 2QQ7A 3VQUA 2CLXA 2OICA 3VS0A 3Q9WA 4L44A 4KRDA 4BCHA 3EB0A 4L7SA 4W4WA 4I5PA 5KMMA 2XK8A 4E93A 3ZM9A 4L8MA 3EL8A 3O7LB 3I60A 4WNMA 4YLJA 4FX3A 4YJQA 2KTYA 2O0UA 4NM3A 2XKDA 5IA5A 3F5PA 4HVGA 5EFQA 1PXNA 3R7UA 1T45A 2W9FB 3KXNA 1KV1A 4QTBA 4GEOA 4D28A 3PIZA 1UNHA 5CVGA 4X0MA 3P08A 1WCCA 5CI7A 4WO5A 4D5KA 5BYZA 4AG8A 5LCKA 3DCVA 5BPYA 3MYGA 3LCTA 4A9YA 5AR5A 2GHGA 4PY1A 5EYDA 3VRYA 4YC3A 2I40A 3BZ3A 1H1QA 3R2BA 3MN3A 2B54A 1MQBA 2VTNA 4WT6A 3IDCA 4O38A 2UW9A 3PSCA 2C0OA 4BBEA 5HLNA 4PNKA 2H6DA 4RPVA 4GRBA 5DRDA 2UV2A 4UXQA 4E6QA 3EQFA 3ZU7A 2BROA 1NVQA 1SVEA 3BQRA 3Q4TA 2OXYA 5IA2A 3TNIA 2HIWA 4L42A 1V0BA 4YNEA 4JNWA 2BKKA 3TKUA 3BWFA 2Z7SA 1PF8A 3RBWA 2ITVA 2Y9QA 3O0GA 3ORLA 5CAPA 2BHHA 4XH6A 3ENHA 2W96B 3CCNA 5TOZA 4FTUA 4Z16A 1NVSA 2P55A 2YWPA 3B8QA 4X2GA 5CNOA 4EOKA 4ZY6A 5IQBA 3GEQA 4H1MA 2C6OA 3V6RA 4ZJVA 2H8HA 4YP8A 2XA4A 4C58A 2WOUA 2XNEA 5IG1A 2F4JA 4EYMA 4O1PA 3MH1A 5IQEA 3EL7A 3RAHA 5TO8A 2JC6A 5HG5A 3ZOSA 2EUFB 2W0JA 4EKKA 2HXQA 2P2HA 3SD0A 4BF2A 4O83A 1ZMUA 4YZMA 3CSVA 5BYLA 3GB2A 3A62A 3FI2A 4F63A 4S30A 2R7BA 3ZDIA 2R3MA 3VBVA 3PLSA 4E73A 5K4IA 4E1ZA 2C5XA 5AJQA 2RKUA 4MQ2A 4X2JA 2JEDA 2WTKC 3QKMA 5M09A 4CRLA 2NNWB 4I41A 3GENA 3ZM4A 4I20A 4DGGA 4DH1A 4ALWA 5I4NA 5KMNA 3CC6A 3TIZA 4EH9A 1ZYSA 3H30A 5IKWA 4HGLA 3RAIA 3R9OA 4AACA 4TWOA 3LE6A 1JKSA 4KSQA 5KNJA 3PFQA 3EFJA 3UDBA 4A9RA 4FSZA 2PUIA 3IW4A 3FL5A 3R0TA 4U45A 2JLDA 5HNBA 5C03A 4FNXA 1MUOA 4KNBA 4C0TA 4CFXA 2WZJA 4ZSGA 2PMOX 3GCPA 2Z7LA 3BHUA 4EOJA 3FL4A 2Z7QA 3CTHA 2VWUA 3OXTA 2UW0A 5EI2A 4AFEA 5HIEA 1CDKA 5KBRA 2HW6A 2VWIA 4CZYB 3LJ0A 2HCKA 4OT5A 3TWJA 4IM2A 5IA4A 3L8XA 5EW8A 1GJOA 3A8XA 3OW3A 3VHEA 4A4LA 4YC6A 4ITJA 2XKEA 2QVSE 4KSPA 4ACGA 2CSNA 2OW3A 5CSPA 3U6HA 2WTKB 4DFXE 3EQRA 4IAFA 4FZAB 5B7VA 5K9IA 3GOPA 5J87A 2JDTA 2JDOA 2OIBA 2CGUA 4ZSJA 2VWXA 5B2LA 3KF4A 4LGDA 4WOVA 1YI6A 4I6FA 4KKGA 1G5SA 4BDFA 3BGQA 5DT3A 4I4EA 2IZUA 4UMQA 5DT4A 2F49A 3UBDA 3LIJA 5G1XA 3BU5A 2JBOA 4JAIA 4PMTA 1UV5A 4JOAA 4RT7A 2WU6A 3C50A 3PE2A 5CU0A 3UQCA 4MCVA 2QC6A 3S00A 2ZOQA 3RGFA 3UQGA 2HY81 4IZ5A 5GZ8A 4U3ZA 5DWRA 5LOHA 4GSBA 4IACA 3EFWA 4K77A 4Z3VA 2GS7A 3F5GA 4G5PA 1JPAA 4NM5A 2WQEA 3WE8A 4NTSA 4YPSA 4DA5A 4UX9A 5FP5A 3CQEA 1PRYA 1XH6A 4GT3A 3COMA 3MH0A 3OVVA 2YM4A 4K33A 4HCVA 4I5HA 3S95A 3OOMA 4HVHA 3BPRA 4M69A 3AT4A 3QRTA 4WD5A 4IFCA 4CLJA 4D4RA 4IAAA 2YIYA 3M11A 4RWJA 3SRVA 3VNTA 3H3CA 5IMXA 3R7VA 4BWXA 3TJCA 1RJBA 2WXVA 4MXAA 4YZ9A 4RC3A 3KB7A 1VZOA 4O21A 2UW3A 3WZEA 4TWPA 4K1BA 5I0BA 5H2UA 4UMRA 5FTQA 3FZPA 4K8AA 4YZCA 3ZFYA 4R7IA 5HICA 3LPBA 2YAAA 2PWLA 2C30A 4LM5A 2BRGA 3UODA 3O71A 1SZMA 5DFPA 4ZAUA 1RQQA 4FC0A 4C36A 3WBLA 2QOCA 4AW0A 3QQKA 1PXPA 2UVYA 3O51A 3VBWA 3QU0A 3QTWA 5CF5A 4CKJA 3V5JA 3UNKA 1FBNA 3FKLA 1MP8A 3M1SA 4GJ2A 3KVWA 3ULIA 3ACJA 3QC4A 3S4QA 3RPVA 3KF7A 3MY5A 2ONLA 5IEYA 4Z55A 4P5ZA 4PRJA 2EXEA 2QOBA 5M55A 3LQ5A 3BLRA 2VTIA 4E5AX 4O0YA 2QOFA 2SRCA 3RM7A 4FKIA 5M51A 3JVSA 5CZHA 1PHKA 1CKPA 3QLGA 4JBOA 1M7QA 3O2MA 2H96A 4GMYA 4FV0A 2VTHA 3PG3A 4XP3A 3GOKA 1OKZA 3AC8A 1M7NA 4I6BA 3F69A 3P23A 2R3GA 3F2AA 3QXOA 2CMWA 2CJMA 5H8EA 4ASZA 4FKLA 2WIPA 2YFXA 4KKHA 2G1TA 3FI3A 1Q8ZA 3LZBA 4IAIA 3A61A 4MQ1A 3DQXA 5HO7A 5HEZA 2LGCA 4AX8A 3EH9A 3KRJA 4KIQA 4AW5A 1W7HA 3K54A 3VBTA 2R3IA 1BI8A 3ZLYA 4BGQA 2VTRA 5HD7A 5JGBA 2UZBA 5CSVA 5I3OA 4ANQA 4JQ7A 2WU7A 3QZFA 4TZRA 4BYJA 4R6VA 1XH8A 5JFXA 4FYNA 1OL1A 1KWPA 2OBJA 2YM5A 4XNEA 1YW2A 3ZO4A 3R21A 5DRBA 4H58A 3VF8A 3GNIB 4L53A 1J7UA 1WVXA 3MPMA 3UPZA 2WMAA 1Q61A 1LPUA 4U43A 4IVAA 1ZMWA 3PXFA 4KS8A 1M52A 3UNJA 3ZDUA 5CU6A 1LEZA 3HECA 5L8KA 5J7HA 3R2YA 4BRXA 2IW9A 2PUNA 5FUTA 3WOWA 2O63A 3ZTXA 2EU9A 2REIA 5ETIA 4USDA 4AFJA 4ANMA 4W4XA 3LM0A 3V8SA 5BNJA 3MESA 4FGRA 4EQUA 4QT1A 5D9HA 2OXXA 4AGDA 4IX5A 4UBAA 4M69B 4G9RA 4QYEA 4XG9A 2W7XA 4YC8A 3OF0A 1BL6A 3D5VA 2VZ6A 3LW0A 3QCSA 3OFMA 3SOAA 5I3RA 3SRVB 4BI1A 4GYGA 3PY0A 2E9OA 5AV2A 4RRVA 4QMZA 3ZC6A 4RJ8A 2B7AA 4YTIA 4KWPA 2FSTX 2ONLC 3QD4A 4J1RA 3RM6A 3FUPA 4WG4A 1ZY5A 4FIHA 4B6LA 3EYHA 4IX3A 1TVOA 3HA6A 4CMTA 3HYHA 5E8SA 4H36A 4R5SA 5F20A 2X2LA 4RWLA 4V04A 5E8VA 3VUGA 2VTPA 3KGAA 3OROA 2OSCA 3EN7A 5FTOA 3TIYA 4AP7A 1GZOA 2BILB 4BCOA 4OBPA 1Y6AA 2C6TA 1FQ1B 5L2IA 3NUAA 1OPLA 3DZOA 3F5XA 4FZFB 4Z9LA 4LV5A 3LJ1A 2W1GA 3TNQB 5CVFA 4M15A 3OUKA 4YLLA 1ATPE 4AZVA 4U5JA 5TT7A 2BDWA 4JL9A 5E90A 1Z5MA 4NFMA 3DY7A 3LFAA 4FKSA 3NW7A 3C4FA 4O0TA 3Q9ZA 5HU3A 3H10A 3ZXZA 1W83A 2CNUA 3R22A 5D10A 3MPAA 5ANOA 3VQHA 4D1SA 3FSFA 3CY2A 3DS6A 3TACA 4GT4A 5AAEA 3GU8A 5AV4A 1FMOE 2PVMA 2BR1A 3ZHPC 4JAJA 1FVVA 4EOMA 5CEPA 3UP2A 3V5QA 4IX6A 4OTGA 4A4XA 2HYYA 4MYGA 1PW2A 3U4UA 5BYYA 5J5SA 2G2IA 3MH3A 3ZMMA 3GCVA 5HVYA 3VUMA 4ACHA 5HE0A 2CGXA 3E64A 4OAUC 4AW2A 3TG1A 2XBAA 5JEBA 5AP2A 3EYGA 2Y6MA 2R3NA 4FL2A 2PY3A 4YGAA 3E7OA 4IZAA 3VW8A 4FTOA 4CFVA 3I5NA 2XP2A 2YWVA 4FIEA 2J0IA 3I0QA 2WMXA 2UZTA 2J0KA 3T8OA 1PXIA 2F9GA 4RX8A 1H28A 5EDRA 4Q9ZA 2C3LA 2YCRA 4QMVA 3AT2A 1DM2A 3CXWA 2OGVA 3P0MA 3ZUVA 1BUHA 3OY1A 4V05A 4O22A 4N4SA 5BUIA 2VUWA 5DR6A 2OU7A 2BUJA 4AA5A 2BMCA 2GQGA 4U97A 2W1HA 3O8PA 3CTJA 1R39A 2OJIA 4FSQA 4IDTA 5D7VA 4YTFA 4AN3A 4KIPA 5FXQA 3LFSA 4DFYA 3PE1A 4YR8A 3LM5A 4HNIA 2Y6OA 2YCQA 2ZVAA 3G9LX 4L68A 4RX5A 5KMKA 4GG7A 4I94A 4FA2A 2VTTA 2R9SA 3VS6A 5BUEA 2ZDUA 4MD8E 5E8XA 1REJA 1Y6BA 3RPRA 4I5CA 4PQNA 2ERZE 3FQHA 3FLSA 3S1HA 3G0FA 3E8NA 3LVPA 3DK3A 5HE1A 3B8RA 4CYIA 1FOTA 1GZ8A 2QOKA 3M42A 3D2IA 5E8UA 2C3IB 3AMYA 3RJCA 4CTBA 3UO5A 1ZWSA 2YIRA 3FI8A 2G9XA 4DTBA 4EK4A 5A6OA 4UMPA 5J8IA 4RFMA 3CR0A 4E6CA 4O7TA 3GU6A 2JKMA 2VAGA 3I7BA 5EQPA 3DFAA 3GFWA 2BTSA 4UB7A 2IPXA 2XNGA 1UNGA 2QOLA 3GBZA 3I6UA 2YEXA 3P4KA 3RK5A 3DLZA 3DFCB 5HNGA 2YM3A 3U8WA 5IPJA 3G9NA 2PZ5A 3W55A 4HPTE 2IJMA 3BYSA 3MSSA 3L8PA 4YZDA 5CQUA 5FEQA 4EOIA 2ZV8A 4A9TA 4HJOA 3OCSA 2PVNA 3UYTA 4F9BA 2IVVA 5JFWA 3NR9A 4Y83A 1R0EA 3ZO3A 3QTXA 2G2HA 3OT8A 2R3HA 2WPAA 4RIYA 4DHFA 4FSRA 3MJ2A 2W1DA 3LLTA 1JVPP 5JGAA 5DYJA 3U55A 3R1QA 2E9UA 4G34A 3HMIA 4PMMA 4WIHA 3AT3A 5M4FA 3DJ6A 3Q53A 4EZ3A 4MD9E 4LRMA 4MH7A 1XO2B 3K3JA 5AUWA 1K9AA 2X9EA 3W33A 3TZ7A 4F7SA 3NS9A 3IGOA 4ITHA 3TNHA 1Y8YA 5I9WA 2HZIA 3S3IA 2OIQA 4MF1A 1ZXEA 2B4SB 3EKNA 5CSHA 2ZAZA 4IH8A 4FG9A 4RC2A 4FTNA 2W05A 4FIGA 3OTUA 4F64A 5I5ZA 4BVUA 4RLKA 1H1PA 2RFDA 4QTCA 3ZZEA 3PZEA 3NMUF 2BDFA 4AZTA 3FWQA 4DFZE 2QD9A 4EWHA 3FJQE 5E7RA 3TV4A 2NO3A 2VNWA 4ZZOA 5L8LA 2CPKE 3W2QA 3E8CA 2C3KA 4I24A 4M7IA 4DLJA 2QU5A 2HW7A 1JSVA 3BYUA 3MJ1A 3KCFA 3KREA 4L46A 1FVTA 1WBOA 4CFNA 4I0SA 4QTEA 1Q62A 4GU9A 3SC1A 2ZV2A 4ITIA 3MTLA 4IADA 5A9UA 2R0IA 4YO4A 1YDSE 5K4JA 5TKDA 1U54A 5AP4A 4FSMA 4FTJA 2FUMA 3GGFA 1QPEA 1J3HA 5IZFA 2X7FA 4MKCA 4GKHA 2HWOA 3VW6A 2ACXA 4RIXA 5CX9A 1W98A 3ZONA 1YXTA 2XK3A 5L2TA 2QHNA 3WZKA 3LFCA 4NWMA 4S31A 3Q4UA 4FKQA 2WMWA 4Y85A 3WZUA 4BICA 4FV5A 2VTJA 1ZY4A 3K2LA 4IW0A 3MW1A 4R1YA 3BGZA 3ZXTA 3Q2JA 4AOTA 4EHVA 4HVDA 2J9MA 2UW5A 3COKA 4I4FA 3SG9A 3AMBA 1SNXA 5E92A 3UOHA 4PL5A 1OZ1A 4CEGA 5HCYA 4LGGA 4FV1A 3Q5ZA 4D2WA 3CP9A 2VWYA 4UMUA 4EJ7A 5EK7A 4MBLA 1OB3A 1O6KA 5IUIA 4PL4A 5IUGA 4IJ9A 4OR5A 4RA4A 3KXXA 1S9IA 3BEAA 1QPCA 4EJNA 2OLCA 1IA9A 2QONA 1R0PA 2I0HA 4O0VA 4U44A 3M2WA 3KMUA 4U42A 5JH6A 3KQ7A 2EWAA 4XV3A 3NRMA 2IVTA 3DAKA 3HKOA 3QUPA 4IVDA 3U6JA 2OFUA 3LLAA 1JKLA 3UVQA 3VBQA 4BBMA 3I6WA 3KN5A 4NTTA 4BDDA 1JLUE 3E63A 5AMNA 2GQSA 4JR7A 3LFDA 3FLQA 4I6QA 3MDYA 1H1SA 4FVRA 5ETCA 1OBGA 2ITZA 2XNPA 2R5TA 3CIKA 3UC4A 3ORMA 2VTQA 3JY0A 1UA2A 2XNBA 4FK6A 4ZSLA 4BTFA 5I9ZA 4NT4A 4KKEA 4JDHA 1E1XA 4JVGA 4Q2AA 4DG3E 3UIUA 2OH4A 3KMWA 2QNJA 5HVJA 4R5YA 1F5QA 3NNVA 5M08A 4FV6A 5IH6A 1KE8A 3PSDA 5DEWA 4F65A 5AR4A 2W9ZB 2J7TA 3HEGA 3HP2A 4IB0A 5CS6A 3UIXA 1ZYDA 3UTOA 2H9VA 2PVYA 5CT0A 3UIBA 3W2CA 3DBCA 1U5QA 3DPKA 2WTDA 1G8AA 5LVPA 5EI8A 2WQBA 2FYSA 3ORKA 1X8BA 4FOCA 2BRHA 5BMMA 4EH6A 4ASEA 1H08A 1M2RA 5A46A 3QQLA 3OBJA 3TKHA 4DFNA 5IQDA 4I0RA 3IW8A 4CV9A 2GNJA 2CNQA 4BKJA 1OIRA 4G6OA 4NUSA 3LFQA 4Z7HA 3F82A 3SOCA 2RFNA 2WMUA 1XBCA 2OWBA 4W4YA 3THBA 4F6SA 4DH5A 1DAWA 2WGJA 4C35A 4EK6A 3NNUA 2R3RA 3D5XA 3NYXA 4B0GA 4IWDA 2V7AA 2PL0A 3FMKA 4BCIA 3W2RA 3JUHA 3V6SA 2JD5A 5HG9A 3U4WA 4D55A 1BI7A 4EH5A 2ITYA 5AR2A 4RLLA 4FBXA 2R4BA 4BCGA 3PWYA 4QO9A 4GIIA 2GFCA 2R3KA 3K5VA 5EKOA 5H3QA 1PKGA 4FKJA 4QPSA 5C26A 2R3JA 3D7TA 4OUCA 2PE0A 5CNNA 3FBVA 4D5HA 3EQBA 3DQWA 3NCZA 2B52A 2X0GA 5FRIA 3TZ8A 4L67A 4EI4A 5AUZA 5DR9A 1LP4A 5IQIA 1ZLTA 3OWJA 3KK9A 4RIXB 3K5UA 4E6DA 4QP6A 5KO1A 4AT5A 3C0GA 3O23A 4F0FA 3QFVA 4EBWA 4E4XA 2ITPA 3JYAA 4R7HA 4XG2A 2WMSA 3DKOA 4TWCA 4DEDA 4ENYA 3KY2A 3PP0A 1ZZLA 3KC3A 2V22A 5DE2A 3DB6A 5EM6A 2X6EA 3W2SA 5M4CA 3ORZA 4JDJA 4RG0A 3CTQA 3ZEPA 4YZNA 1ND4A 4ZEGA 4D2RA 2I1MA 5D11A 3FZRA 5DPVA 2C6KA 4O6EA 4E20A 2XF0A 5IQFA 3DT1A 4H3BA 1O9UA 3MIYA 3W8LA 2VTSA 4CFWA 4APPA 3D14A 2GMXA 5E8YA 3L9PA 5JGDA 3UPXA 3V04A 3AMAA 1DAYA 4CG8A 3CEKA 2Y4PA 5CAVA 3NW6A 4JRVA 3UIMA 5C1QB 1P4FA 3ORPA 5CYIA 3VULA 4IBMA 2XK7A 2BFYA 4LRJA 3UVRA 4QNAA 4MXYA 3KKVA 2X8IA 2Z8CA 1OPJA 4TYJA 2FO0A 5L6OA 4RJ7A 4WBBB 1E9HA 5LVNA 1OKYA 4O6LA 5I9UA 3ID6C 2PVKA 4U41A 2CN8A 2Y8OA 3GP0A 3A7HA 3OOGA 1TQIA 3RZFA 3A8WA 4FL3A 4IAKA 3NAYA 2EB2A 3QRUA 1H8FA 4GYIA 4BWPA 1ZOHA 2NRYA 4YHTA 4G6LA 2QOQA 3FC2A 4FGBA 4XG6A 4L45A 1E1VA 3GC0A 5M4IA 4EEVA 3FZOA 2BKZA 4EONA 4BKYA 3VUHA 2WEIA 3WILA 2R7IA 3C9WA 4IM0A 4RJ3A 3BEGA 2OZOA 1WBVA 2BRMA 4AE6A 3Q32A 4O86A 2XRUA 2RL5A 2ZM3A 4PV0A 2C5NA 4NW6A 1CSNA 5EHOA 4TL0A 3QUEA 4FUXA 4ZXTA 4C57A 5HZNA 4AZEA 3CQWA 1M2QA 4EQCA 3QTRA 5HCZA 2W99B 4ALUA 2XS0A 4Q5HA 2FGIA 4D1XA 3DDQA 4XG7A 4QMTA 3ZLWA 4YMJA 4EZ7A 1ZZ2A 2VNYA 4F9YA 2GS6A 4QTDA 5T3QA 2VX1A 3CKXA 2J0MB 1KOBA 1WBNA 3P1AA 4Y8DA 3E3BX 3LKMA 4Y95A 1KE7A 3KVXA 1O6LA 5T6KA 4II5A 2YZAA 3UQFA 4WG3A 3MFTA 3G6GA 5CXHA 3C4CA 3PXKA 4P2KA 5CASA 1PXLA 4CYJA 2W4OA 3AC3A 4EHEA 5JSMA 4QYGA 3RINA 4C4FA 4ZLYA 4U80A 3BHVA 2AC5A 2Q0BA 5M57A 2E9NA 4JS8A 5AP7A 3FMEA 4D4SA 1NXKA 2IW6A 5FBOA 4XP2A 3OXZA 1URCA 1P14A 1KSWA 2YM6A 2GSFA 4YHJA 3R7EA 4R78A 3G90X 4FKRA 4M0YA 3RNYA 3HZTA 4FF8A 3D7TB 5AM7A 1CKIA 3KRXA 5DGZA 4PMSA 1UWHA 1KE9A 1Q41A 3D7ZA 1NVRA 4AS0A 4YJRA 3MFRA 1CKJA 4IZYA 2VV9A 3TDWA 2XYUA 3ZFXA 3H0YA 3PRIA 4RIOA 3MA3A 5DT0A 3R83A 2GTMA 4FE2A 2PMLX 4IE9A 1ZYCA 4MBJA 4EK3A 5BVEA 4FT3A 2W1IA 2ITQA 2NP8A 2KULA 1H26A 4FTMA 2ZB1A 1JAMA 1DS5A 2O3PA 3BHHA 5CU4A 1Q8YA 2GU8A 4CMOA 5GIPE 1W84A 2JKOA 3DTWA 4KBCA 2XIYA 3MVLA 1QL6A 3MY0A 2YJSA 2CGVA 4PTGA 3UZTA 4CXAA 4Y73A 4HPUE 4FKVA 3TNPC 1VR2A 3QYWA 5E8ZA 1A06A 5A3XA 4O0XA 5K5XA 2Q0NA 2Z2WA 4EC9A 4J53A 3QKKA 3DKCA 3MB7A 3FY2A 4DEEA 1S9JA 4CTCA 4D2PA 4D0WA 3RI1A 2WQMA 2ZV7A 4I3ZA 4QQJA 2YITA 3KRRA 4RVTA 2R64A 3DNEA 3PXRA 3QAME 1V0OA 2ITXA 4A9UA 3EFLA 4W8EA 4ARKA 2GQRA 3NZ0A 5FWKK 3II5A 4WNOA 4MX9A 4XCUA 4FEXA 4HGTA 4EOPA 3UG2A 3NLBA 3DBEA 4GFMA 1IAHA 4I0TA 2CN5A 3BHTA 1Q5KA 3P78A 4EC8A 5IH4A 4YJPA 2YZLA 2ITTA 5EG3A 2AC3A 3F3WA 2ETKA 3Q96A 2IN6A 3PRFA 4RWKA 4L7FA 4CFFA 5E9EA 2I6LA 1BL7A 3P5KA 3EKKA 2ITWA 4RMZA 3AXWA 5EDQA 2A0CX 4YHFA 2FSMX 2UVZA 4CFMA 5H8BA 5HTCA 3C0HA 4ZP5A 4C7TA 4U79A 4USEA 3VIDA 1KUTA 2JKQA 3VS3A 1H1WA 3JVRA 4IWPA 4JG8A 4RBLA 4AE9A 4D2SA 4E5WA 3BX5A 4XYFA 5JMSA 5JN2A 1UKIA 2EVAA 2YISA 3QTSA 4GK2A 4BL1A 2F2CB 4W9WA 2QOIA 3DB8A 2XZSA 3ENMA 3NUPA 3N51A 3GC8A 4L00A 4RFZA 4V01A 4ANSA 4IB5A 4QRCA 1BLXA 5DR2A 4YO6A 1OGUA 3HP5A 4FTIA 5EDPA 4IM3A 5AUVA 3GI3A 4QQTA 5IH5A 4CMUA 3PA5A 4YJUA 3H9RA 2PE2A 2PHKA 3BGPA 3CY3A 2GNLA 2GPHA 4KS7A 5HCXA 2PVHA 2G01A 1I09A 1LEWA 1J1CA 4M84A 4Y46A 1HCLA 3C4EA 3QF9A 5BQ0A 4G3GA 3IONA 5AA8A 5I9YA 2VX3A 3VUDA 4JLCA 4OTIA 5HI2A 4YNOA 5KCVA 4U7ZA 3PJ3A 4OBOA 2WMVA 3CPBA 4RQKA 5ANGA 4ZZNA 4MK0A 3HLLA 4HGEA 4KD1A 5LMKC 1ZMVA 1H01A 2WOTA 5E91A 1WFCA 3I79A 4QMUA 2VU3A 3CGOA 3OP5A 3I1AA 3Q52A 1LUFA 5L2SA 5KZIA 1B39A 4GG5A 2OO8X 3TI1A 3SXRA 4AF3A 2GCDA 3LXNA 4F70A 3MFSA 4MEDA 4WSYA 4EUUA 2QKWB 4G5JA 4EZ5A 1PMNA 2O64A 3O8TA 1W82A 3C13A 4FIFA 3QGYA 5EM5A 5KHXA 3MV5A 4FZ7A 3LFFA 3R9HA 4U81A 3HA8A 4FG8A 3HNGA 5M4UA 4NYEA 2QHMA 5ANKA 3OS3A 5CVHA 4YU2A 2XJ1A 2ETRA 2OJGA 4DC2A 4KBKA 4GV1A 3NIEA 4FIJA 3AD6A 4DH8A 2X7OA 2BAKA 3WYXA 4C4GA 4M67A 2BALA 5DMZA 3Q5IA 5KMOA 3NGAA 1DI9A 3HGKA 4QPMA 1YXSA 3MS9A 3IDBA 5IF1A 3HAMA 3NVKI 4JDIA 4FR4A 4XS2A 3WF5A 5AM6A 3U51A 5CEIA 4A07A 3ORIA 4DITA 1BMKA 3PSBA 4LOOA 5AX3A 2WTCA 2RFEA 4C62A 5HIDA 5JKGA 2WEVA 2B9JA 4NM0A 4XRLA 5AUTA 4C3PA 4QMWA 4TNBA 2F57A 3PJ1A 5T68A 3WZJA 4AU8A 4AXAA 4ZTMA 4E5BA 3H4JA 4IANA 4CGAA 3DU8A 4PTCA 1OL7A 1VYWA 4RX9A 4BDIA 3ZRLA 4ZSEA 2ZM1A 2PK9A 5ACBC 1JWHA 2VWZA 1XH7A 4F9WA 4DT8A 1V0PA 5AIKA 3BYOA 3HMOA 4AUAA 3L8VA 4R3PA 3G0EA 3U9CA 5L6PA 2PTKA 3BV3A 4LQMA 4RSSA 3W2OA 5LWNA 2BZHB 3UE4A 3GU7A 3PZHA 1AGWA 1URWA 1GNGA 2W1CA 3COIA 4ZIMA 4CT2A 5AFVA 2VO6A 3SAYA 1L3RE 4AZWA 2FVDA 5B2MA 3TNWA 5KBQA 2OF2A 4QOXA 3UO4A 2XJ0A 3L9LA 4NFNA 4X6QC 5TE0A 3R9DA 4GVAA 3P9JA 3DAEA 4TN6A 1SNUA 4WHZA 4C61A 3R63A 1J1BA 4RWIA 4D0XA 3FV8A 2HK5A 2BZIB 1BKXA 2C1AA 4HW7A 2GFSA 3C1XA 4FEUA 3EN5A 5C4KA 4JX3A 2PZYA 4TRLA 4UXLA 3V51A 2HWPA 1OM1A 4FIIA 4U3YA 5EHYA 3WI6A 4CZTA 1WBWA 3AD4A 4I22A 4G17A 3ZRMA 3QC9A 3D0EA 4BCNA 3OT3A 4DEBA 4WG5A 5FDXA 4IB3A 4LL5A 4MWHA 3RK7A 1B6CB 3PJCA 5JFVA 1J91A 3CGFA 2JAVA 4BDEA 3QA8A 4G9CA 3ZLXA 4F6WA 2OZAA 4WKQA 1GAGA 4TYEA 1T46A 5L2QA 4FI1A 5EYCA 3SW4A 2BAQA 3Q60A 4BHNA 3Q9YA 4G2FA 4O27B 4GH2A 4AWIA 3DV3A 3TKIA 4QD6A 3F61A 3R7OA 2BCJA 2Y0AA 3FXWA 4M68A 3QTUA 2VWVA 4BYIA 1JOWB 2YACA 3W18A 3MI9A 4F9CA 5HG7A 4IVBA 3FYJX 5CAUA 3PIXA 2QURA 4QMOA 1ZRZA 2HZ0A 4QP7A 5HLWA 5C9CA 3VS7A 1XH5A 1P5EA 1Q4LA 4PPAA 3GU5A 4JR3A 3R1YA 4TXCA 1SM2A 4PDYA 4CV8A 4W4VA 2WNTA 1PMVA 3FKOA 1YI4A 1JKKA 5DVRA 3ZEWA 4ANOA 3FPQA 1MRUA 4PP9A 5BUJA 5KX8A 3SKCA 1GIIA 3CS9A 5FBNC 1XQZA 3MA6A 3PYYA 4L9IA 1Y57A 1XH9A 1J7IA 4MVFA 3R04A 3SW7A 3UG1A 4IFGA 1ERKA 2YLEA 5LXMA 3HV6A 1BYGA 4BFMA 4D58A 1B38A 4YSMA 3NIZA 1FINA 2BIYA 5CXZA 3RPYA 4EUTA 2QO7A 2YLFA 5J9ZA 3FQSA 4WNPA 3F5UA 5D7AA 2J90A 4ZTNA 4EOQA 1PYEA 3FPMA 2I0EA 4BDCA 3IO7A 4XOZA 3FLNC 3DXQA 4O81A 4N70A 5CF6A 1NW1A 3CJGA 4C4HA 4FK3A 3VBYA 2HZNA 3KK8A 1MRYA 4EOLA 3SG8A 4NL0A 1GOLA 3D15A 1RDQE 3F7WA 2WQNA 2E9PA 3Q3BA 4G16A 4B8MA 3I81A 2YIWA 5A4QA 2JFMA 2WMQA 3P7BA 3JXWA 5AP1A 2XKCA 5M06A 3QCYA 3OEZA 4IZ7A 5C27A 4QP9A 3OEFX 3PVWA 4MAOA 3R6XA 5BVNA 1F0QA 1OMWA 3QYZA 1Q24A 3OCBA 5DN3A 3W32A 1Q3WA 3LMHA 1IG1A 1R78A 4P4CA 3G6HA 2RG5A 4MHAA 2GTNA 4EH7A 3RHXA 1CMKE 2C47A 4QMPA 4S2ZA 5HO6A 4ZMEA 4M8TA 3EWHA 4L52A 4F0IA 5IU2A 1YQJA 4DGOA 3V5WA 3Q9XA 3LFBA 4ANNA 3OUNB 4I92A 4BN1A 4BDHA 3WARA 3AOXA 3OWPA 5KZ0A 1J7LA 3BKBA 5EYKA 4TYHB 5HHWA 5ACKA 3GT8A 1VJYA 4HYHA 3WF7A 3SA0A 4N0SA 4HVSA 4UV0A 2X2MA 3L8SA 3R8ZA 3Q4CA 4FEVA 4KABA 4PX6A 4FV3A 2P0CA 4TPTA 5EW9A 3QQJA 4FTKA 3D9VA 4FSTA 1QPDA 5HKMA 4ORKA 1YHSA 3ZSIA 1YWNA 2PZRA 4L01A 3OXIA 4DFLA 2C69A 5HE2A 3RCDA 4F1OA 4O7RA 2OZAB 2X8DA 3HX4A 3R7GA 4O96A 4EHGA 5LVLA 3VF9A 1MRVA 1EH4A 3F2NA 3IS5A 3GCUA 4DN5A 5CZIA 4DLIA 4TNDA 3ZS5A 5GJFA 5AR3A 5CWZA 2NPQA 3L1SA 3E3PA 4O0UA 3TCPA 4D2VA 4DAWA 3W8QA 1MQ4A 5CSXA 3B2WA 2IG7A 2J0LA 1V1KA 2ZM4A 4P7EA 3A7GA 2GS2A 4Z7GA 2W5AA 4IJPA 4DF3A 5FTGA 3PG1A 3EIDA 5L8JA 3W1FA 4FTQA 2RF9A 4FKGA 2W4KA 4ZJIA 3O17A 1GIHA 3FSKA 3KXMA 3ULZA 5CAQA 3D4QA 5DLSA 4C2WA 1NT2A 3VBXA 2W5BA 2C6MA 2Z7RA 5DA3A 3C0IA 3KA0A 3TEIA 4F9AA 4LFIA 3I5ZA 2VX0A 3OMVA 4EK8A 3Q6WA 3NUNA 4KIKB 4BZDA 5IQCA 5JQ8A 2G15A 3EQCA 3RKBA 4QTAA 2XKFA 3DOGA 3LQ8A 3UO6A 4UY9A 4RFYA 3V01A 3KXGA 3K3IA 3DXPA 4OTPA 2OH0E 4XG4A 3FYKX 4EK5A 2ZJWA 4DFUA 3LFEA 2QG7A 1H4LA 2X6DA 3VS4A 4E4MA 2XNMA 3DTCA 5KKRC 3BYVA 5FP6A 4BCPA 4FT5A 1RE8A 4UWBA 4IDVA 4X3FC 3ATTA 3RVGA 2QG5A 2XNOA 4LUEA 5HBEA 3V5PA 5HX8A 3ERKA 3E92A 5CY3A 5ANDA 4WUNA 2QCSA 5CLPA 5KE0A 3DZQA 3T9IA 3O96A 3QXPA 3ZBFA 3A7FA 2X39A 4J99A 3UP7A 5DOSA 2CKOA 4OT6A 4Q9SA 4C4IA 3KFAA 1GY3A 4JJRA 1PXMA 3FQEA 4FMQA 4XEYA 1IAJA 3WF6A 3S0OA 4OTRA 3GCSA 3PA3A 5AR8A 4EWQA 5HBHA 2B1PA 1UU9A 3AGLA 4PL3A 5EYMA 2PMIA 2R3PA 3JY9A 4ERKA 5L3AA 2JDRA 2WHBA 2JDSA 2JGZA 3TZ9A 4EQMA 2BZJA 5E1SA 3DGKA 4S32A 5F95A 4RJ5A 4C34A 4X3FB 2B9FA 4R8QA 2UVXA 4K11A 4NW5A 5E1EA 3RWPA 2A4LA 1JSUA 4PP7A 5JFSA 5KMIA 4C33A 5CEQA 2YAKA 3AQVA 4UYAA 1U4DA 3QCXA 4F7LA 4PPCA 4HOKA 2JBPA 3A7JA 3ZCLA 2R3QA 2YDJA 3LJ2A 1Q99A 4FZDB 2J4ZA 2XJ2A 3BLQA 3R8LA 5HESA 4BR3A 4G3CA 1SYKA 3SX9A 1A9UA 3E8DA 2YM7A 3FE3A 4FV2A 4S33A 1WAKA 3HMPA 4AT3A 3ORNA 2H34A 3ANQA 3QD2B 3S2PA 5F1ZA 2RSVA 5FEEA 3T3VA 1M14A 3SDJA 5HU9A 1XR1A 2B9HA 2C4GA 1YHWA 4G31A 4JDKA 4EL9A 1ZAOA 4HZRA 3KN6A 4N6ZA 3FZ1A 3ROCA 2C5YA 3C51A 3ODZX 1H07A 3BIZA 3FC1X 4FSNA 3OD6X 2YIQA 1UU8A 3R1SA 5EHLA 3KL8A 4FEQA 3BE2A 3QQFA 2BVAA 3CQUA 4GCJA 3DK6A 4DG2E 5J1VA 4WRSA 5BVOA 4FNWA 4FTCA 4FKUA 2XB7A 5KMJA 2C68A 3FY0A 1WMKA 1OKVA 1FPUA 2Y7JA 4FV8A 3DA6A 3ELJA 3QQHA 4J97A 4QMQA 2DUVA 4O84A 2X2KA 1IRKA 2QKRA 4JQ8A 1L8TA 3G15A 4O82A 1YOJA 2WO6A 2WMBA 5CEKA 2VWBA 3QZGA 4GIHA 4FUYA 5K3YA 4BZOA 4G3DA 5J95A 3PXYA 3SXFA 2X81A 3ACKA 4A7CA 2QOOA 4J8MA 3VWAA 2QR8A 3BBTB 4WNKA 4XJ0A 5CTPA 2HAKA 2UW8A 3MWUA 3LMIA 4NM7A 3QTZA 2R2PA 4JXFA 4NU1A 5AP3A 4ZZMA 2BAJA 5AUUA 5EM8A 3TUBA 2UW4A 3OTVA 4F99A 4E7WA 3G5DA 4JRNA 5B0XA 4AA0A 4X2KA 2VGPA 3IOPA 3P7AA 4LOPA 5M56A 4GT5A 3T3UA 2F2UA 4FTTA 4HYUA 2X9FA 4QYFA 3QX4A 3QBNA 3A7IA 4LV8A 4AQCA 1XH4A 5CSWA 4UMTA 5GHVA 2WTWA 5CAOA 3LOKA 3AC4A 4C3RA 5HGIA 3TTIA 5AEPA 2HOGA 2OFVA 3DBDA 3P7CA 4FTAA 4M12A 4G3FA 4GVJA 5F4NA 3TV7A 5AADA 5IA0A 4DT9A 1U59A 4ZS0A 4YURA 4U8ZA 2V0DA 3NDMA 3QRJA 4TYIA 2XCHA 4ZTLA 3VO3A 3LFNA 4MXZA 3UZRA 5CEOA 4O7LA 2VTMA 4XMOA 3VUIA 3CJFA 5HTBA 4N6YA 5HIBA 3UVPA 3V5LA 4KIOA 2VGOA 5HORA 3G2FA 4BWKA 3EMGA 5DG5A 3QHRA 5EOBA 3QZHA 3ZRKA 4FKOA 3ZZWA 1YXUA 3HDNA 2QO9A 2UZDA 2ZDTA 3ITZA 4C38A 2WQOA 4BCKA 4MWIA 3B2TA 5CT7A 2VD5A 1WZYA 2V62A 4CRSA 3U6IA 3N4VA 3OCGA 4J8NA 4RVKA 3L9NA 2F7ZE 4FODA 3HAVA 4PMPA 3BYMA 4MTAA 2C0IA 5IUHA 4X2NA 2XIXA 2UZWE 4C59A 4HGSA 4TTHB 4WA9A 4CCBA 3GUBA 3AC1A 2OK1A 3NUUA 2VO3A 3CD3A 4EKLA 2PVFA 4O2ZA 3F6XA 4OTDA 3GQLA 4FEWA 4K2RA 3R8PA 3VUTA 1Z9XA 1ZOEA 3C4WA 3GC7A 3UMXA 4D9UA 5BVFA 2OJJA 3RWQA 2YDKA 2O8YA 2X7GA 1PXKA 3ZH8A 2F7EE 2VRXA 2HZ4A 2JIUA 3QZIA 4ZOGA 4AA4A 4BDGA 2WTJA 4BI0A 3LXLA 2W4JA 4FV7A 3EQDA 4HCUA 2RGPA 4D1ZA 4O7WA 3IK3A 4GKIA 4OLIA 5AR7A 3EQIA 4ASXA 4XBUA 5KKRB 3D5UA 5HNIX 4MXOA 2ERKA 4KA3A 2ITUA 3G33A 4LYNA 2PVLA 3U9NA 3FI4A 4I1ZA 2R3LA 3FZSA 3MVJA 5DHJA 1FVRA 3ZYAA 4EH3A 5EKNA 3NVMB 5AAFA 2DS1A 3OW4A 5AIRA 4O7ZA 2BFXA 3BLHA 5EQYA 2PZIA 3MFUA 2P33A 1I44A 2QO2A 2YA9A 2ZB0A 3E5AA 4FKTA 3NNXA 5DBXA 1OECA 2CGWA 3D83A 3FMMA 2WTVA 3VS2A 4BKZA 5IEVA 1XBAA 3VS5A 3ZO2A 4TY1A 2JITA 4PWNA 3D2KA 1YWRA 1IASA 3G51A 2FSLX 4OTQA 3BELA 4PUZA 2DWBA 2W06A 5M07A 3UNZA 1JSTA 4QP4A 3W2PA 4ALVA 2PZPA 3MVHA 4JG6A 3D5WA 4G6NA 4RVLA 4V0GB 4Y5QA 2QLUA 3RK9A 4O7SA 4RC4A 5A4CA 5JK3A 4ACCA 2UZNA 4JX7A 3A4PA 2AYPA 2C3JA 2XYNA 3LHJA 4K18A 5IA1A 5IQHA 3OBGA 3UZPA 5C8KA 2OIDA 3OY3A 4BCQA 3LXPA 5ITAA 5E4HA 1QCFA 2VO0A 3MY1A 4NKSA 2C6IA 3UMWA 1TKIA 2X1NA 5FM2A 2UZEA 2A19B 4Y72A 4W9XA 1H0VA 1Y91A 2CHLA 4H3QA 4IEBA 4YSJA 5A6NA 3DJ5A 4HVIA 2OXDA 3R01A 2WELA 5CU2A 1ZYJA 3GC9A 3KRLA 3DDPA 3WYYA 3HV5A 5LMKA 5FGKA 4CKRA 2JKKA 4O7NA 2QLQA 4E8AA 4OTHA 1IA8A 1PY5A 4J71A 5LCJA 1Y8GA 3KXZA 3FXZA 1G8SA 4F7JA 2G2FA 1FMKA 3FHRA 4H39A 1FGKA 5CI6A 3ZUTA 3WZDA 4H3PA 3EFKA 5EH0A 3NEWA 3TL8A 4XHKB 2YCSA 3RALA 5IISA 4QMXA 1OI9A 1W0XC 3QQUA 2CCIA 4GUBA 5D41A 4F08A 4TWNA 3HL7A 5M53A 3VJNA 4CQEA 5AV0A 3HRCA 2HXLA 4K0YA 2CKEA 4K6ZA 3DKFA 3CLYA 3Q4ZA 2RIOA 3R00A 3RAKA 5AAGA 4OBQA 3A99A 2J2IB 3PY1A 5H9BA 3RAWA 5FG8A 4GFGA 1WBSA 5A4LA 3GVUA 4CZUA 4DTAA 3R7IA 2YERA 3MTFA 3H0ZA 2BTRA 3GU4A 4U6RA 3POZA 1APME 4YTHA 3ATSA 3R9RA 2JDVA 3QQGA 3AC5A 3HMMA 3NUSA 3HV4A 4BHZA 3O7LD 2XRWA 4QP8A 5DNRA 5J5TA 3H9OA 3QTQA 4E4LA 4Y5HA 3EJ1A 4AW1A 1XJDA 3EN6A 2X8EA 4PF4A 5HLPA 4CCUA 3BRBA 4FSWA 4F4PA 5JRQA 2IVSA 4BI2A 4N57A 2XK6A 3FMNA 1F3MC 3EN4A 3FZTA 4JBQA 4IWQA 4ASDA 5FLFA 5CALA 3FLWA 1XWSA 3R8VA 4BCJA 3BCEA 4D9TA 2PMNX 3IDPA 5DI1A 3GXLA 4EOSA 3LMGA 2PULA 5HBJA 1KOAA 3MB6A 4JG7A 4NSTA 5J79A 5LWMA 3CBLA 2UW6A 4BIEA 3QX2A 4OTFA 3R30A 4DCEA 4EH8A 1QMZA 1OUKA 4MBIA 5GNKA 3UJGA 4CQGA 3EHAA 1PMUA 2X4ZA 4XV2A 5GJGA 5IQAA 4HYSA 4BIBA 3N4TA 4IVCA 3QKLA 3VC4A 2BZKB 4ONAA 3EZRA 2VTOA 1PJKA 3SQQA 3UYSA 2HY0A 4AZFA 1R1WA 3BV2A 4GUEA 3LXKA 3SXSA 5AUYA 2W5HA 2C5OA 4LGHA 4LMUA 5JQ5A 2PUUA 3ZFMA 4M14A 4NJDA 5ETFA 2PPQA 1HCKA 5ANJA 4C02A 4EORA 4NH1A 4R77A 1NY3A 4FNYA 4YJTA 3HRFA 3NYVA 4QP3A 4YPDA 4DEGA 3LCKA 4ID7A 2XNNA 3GQIA 3HUBA 3KULA 4IWOA 2XIZA 3CKWA 4A4OA 5AWMA 4EHZA 3T9TA 5BMSA 3FLYA 2YM8A 4USFA 3I0OA 5GZAA 2QU6A 3FEGA 4M3QA 3PWDA 3VRZA 4AOIA 1Z57A 4E3CA 2P3GX 1ZYLA 2VO7A 2CCHA 3OCTA 4W8DA 4ERWA 2XIRA 2VTAA 2ESMA 4FKPA 5LMAA 4S34A 3BU3A 4ACDA 1QPJA 5EOLA 4NKAA 5F94A 3IOKA 2C0TA 4JT3A 4F1TA 1OL5A 2Z60A 3ODYX 3TDVA 2C6EA 4E26A 4R3RA 2A2AA 2W1EA 3L9MA 4RQVA 5BVWA 4RA5A 4XV9A 4HNFA 3IQ7A 4MXCA 3QA0A 2I0YA 3RCJA 3JPVA 3ZC5A 3W16A 4B99A 5FD2A 5LJJA 2ZMCA 3SGCA 4ZTHA 4QP1A 2WB8A 3ANRA 3R28A 3RPSA 4EH2A 3PA4A 3FLZA 5AV3A 5AA9A 1H0WA 4MD7E 3F3VA 4IQ6A 2I7QA 4AOJA 5A4TA 3AGMA 3IKAA 4YUQA 1AQ1A 4FG7A 3CD8A 3KU2A 1OIYA 4QPAA 4ANLA 3R71A 2UW7A 4I6HA 5IA3A 4UZDA 2J51A 4D4VA 4A06A 2CNVA 4LUDA 3F3TA 3AC2A 3NCGA 4IC8A 4PDSA 4ZLOA 3Q6UA 4LG4A 3VUKA 3DK7A 4GW8A 4JBPA 4KINA 3ZO1A 1Q8UA 4AGUA 5C4LA 4DGNA 4FTRA 3R73A 4IIRA 3PP1A 1YRPA 2XK4A 3R7YA 4FKWA 3DAJA 2IZSA 2R3OA 2V5QA 3HV3A 3R9NA 2DYLA 4BTKA 4F7NA 4ZTSA 3NW5A 4DG0E 2BIKB 2JIIA 3DJ7A 5J9YA 4TYHA 3FKNA 3ZUUA 3F3UA 4X21A 2PE1A 4P5QA 1UNLA 2J5EA 4DE4A 2QI8A 4ZJJA 2IVUA 4QYYA 4GU6A 1YHVA 2IW8A 5C8NA 4QQ5A 3JR1A 3UOLA 4KUJA 4O1OA 4HZSA 3TXOA 2V55A 2EXMA 2B0QA 4FOBA 3BU6A 4O2PA 4F0GA 4ACMA 3LCSA 5A54A 3MPTA 2A27A 3HUCA 4KB8A 3E87A 3EN9A 2E9VA 1BX6A 2WAJA 4M97A 5CEMA 4FT7A 1M2PA 2GNHA 4JQEA 1OITA 5AUXA 4MNEA 2C6LA 1P2AA 1WBTA 3HV7A 3GFEA 5JZJA 3ALOA 5GJDA 5DEYA 4C8BA 4ZTQA 4XUFA 5H8GA 4BCMA 4O7VA 4XX9A 3RPOA 1G3NA 3DBFA 3C4ZA 3REPA 3ORTA 5KUPA 3OZ6A 4J95A 4R7BA 2OJ9A 4J98A 2HELA 4HCTA 3FMLA 5EQEA 4DFBA 3R8UA 5ANIA 1YVJA 2FH9A 3E88A 3NUYA 1STCE 1YXXA 5G6VA 1H24A 2QOHA 3RMFA 4QMNA 4DTKA 3HDMA 4XBRA 3ET7A 3C4XA 4I21A 3KULB 1OKWA 3WF8A 2WMTA 5AV1A 5BX0A 2XMYA 2ZMDA 4GJ3A 4TT7A 4YBJA 2WFYA 5EM7A 2ETMA 4L3PA 2NRUA 5LARA 2W17A 1KE5A 1RW8A 5E8WA 4O7YA 4CG9A 4G1WA 3NNWA 4G3EA 4NK9A 4RIWA 5L4QA 2WTIA 4MNFA 4CKIA 1U5RA 4KIKA 4KRCA 4AGWA 3F7ZA 4YJOA 4EH4A 4L43A 2YN8A 4BTJA 4PDPA 4YLKA 4F09A 2XH5A 3NWWA 4JIAA 2E2BA 5JZNA 3EZVA 2CKPA 4FT0A 1SMHA 2J50A 4I5MA 4DGLC 4X3JA 4B4LA 4FYOA 2DQ7X 3FDNA 5FXRA 2UZVA 1REKA 5KHWA 3Q04A 5BVKA 4C2VA 4OGRA 2BRNA 4D2TA 4UALA 5CQWA 4C3FA 4XG8A 3ALNA 4FNZA 2HENA 2ZV9A 4AT4A 4RJ6A 4CFUA 5TR6A 5IDPA 3N4UA 1CM8A 3VVHA 3QALE 4PPBA 4XOYA 2VTLA 4C4JA 5K0KA 4O0WA 4CT1A 4DH7A 2WIHA 1UU3A 4RGJA 4FVPA 3BQCA 5HQ0A 4WRGA 5K0XA 2PSQA 4FL1A 5CF4A 3SV0A 5CF8A 5B2KA 2IO6A 3COHA 1PKDA 4IX4A 2O65A 4B8LA 2J0JA 3OHTA 1SVGA 4UWYA 4DCAA 4NIFA 4Q5EA 5EI6A 5A4EA 1CTPE 3IW5A 4DYMA 1UWJA 2YDIA 3MIAA 3F3ZA 5HG8A 4X3FA 4QMLA 3RTPA 2PVJA 4L3JA 4ZY4A 3A2CA 4YJSA 3V8TA 3PPJA 3PPZA 5HE3A 3D94A 3POOA 3RP9A 1O6YA 5J9LA 2I0VA 4FT9A 2AUHA 4NCTA 3IGGA 3ZSGA 2XEYA 4FSUA 4OW8A 5HTIA 3UOJA 3RZBA 5E8TA 2WMRA 4EYJA 2BRBA 4IC7A 3U87A 3EQHA 4X7QA 4TW9A 3UC3A 3VS1A 3AD5A 2XIKA 4IHPA 3U54A 1OVEA 3H9FA 3PTGA 1Q8WA 2BPMA 4QMMA 3WIKA 2XCKA 3PIYA 4BGHA 3RHKA 3CPCA 1OIQA 2EB3A 3C5UA 4XP0A 2P2IA 1UVRA 1GZKA 2JIVA 3QRKA 4RVMA 5F9EA 4PDOA 5IMEA 3TJDA 5M44A 1OL2A 5JRSA 2R0UA 5FM3A 3FMJA 3IW7A 3MGYA 5CANA 2OG8A 3UOKA 4YJNA 2B55A 3KEXA 1TQMA 2IWIA 1KV2A 2OJFE 4BZNA 1Q3DA 4MNEB 3LCDA 2QR7A 4GS6A 4OAVB 4XV1A 3E93A 3NYNA 1OIUA 4FICA 1HOWA 2GDOA 3DKGA 2FSOX 3LAUA 4U9AA 4ANBA 5I9VA 3JS2A 3VJOA 2UUEA 4C37A 3VAPA 3BBWA 4C4EA 5J7BA 5FDPA 4J96A 4LMNA 4QMYA 3NYOA 4M66A 2LAVA 2Z02A 2UZUE 4APCA 4CD0A 1LR4A 3IECA 5DH3A 4M0ZA 1IEPA 5A14A 4LI5A 3QCQA 4GK4A 4R3CA 3QTIA 5CU3A 5HOAA 5C01A 1KE6A 3OWLA 4DGMA 5D12A 3A4OX
chains in the Genus database with same CATH superfamily
1GIJA 3QD0A 3QWKA 5HD4A 4IB1A 4F1MA 5BVDA 4B9DA 4O0RA 4RIWB 4BDAA 2XM8A 3PVBA 3TM0A 1YOLA 1H27A 5KMLA 3ZSHA 2QODA 3PY3A 1YI3A 3V3VA 1VEBA 1XKKA 2WKMA 2YABA 4DBNA 3TV6A 3F2RA 4QQCA 5AX9A 1TQPA 4E4NA 2W1FA 4QMSA 3UGCA 2C1BA 4K9YA 3FMDA 3TT0A 1JQHA 4O0SA 3R8MA 4BGGA 1NA7A 4XLVA 3MVMA 3KRWA 1YDTE 4WBOA 3W0OA 2Y4IC 3I7CA 4JIKA 4MXXA 2P4IA 3QRIA 3UDZA 3MBLA 2R3FA 1PYXA 3E62A 4JI9A 2IZTA 2XBJA 3NX8A 3HMNA 5ICPA 2CDZA 1Q8TA 3PJ8A 3PJ2A 1UKHA 4NCTC 4PTEA 3PXQA 4QYHA 1WBPA 4BIDA 2VWWA 3O8UA 4XG3A 4DINA 4IAZA 1G8KA 4AZSA 2ZYBA 3IW6A 4LOQA 1JBPE 4RJ4A 3E7VA 2UZOA 4JBVA 3TTJA 3E8EA 4FTLA 2CKQA 1U46A 3PDTA 1PMEA 4KAOA 2UZLA 2FA2A 3KXHA 1OL6A 4WSQA 2NYAA 5JT2A 2XEZA 2VN9A 4XLIA 4LRKA 4DH3A 3V8WA 1P4OA 3FHIA 3OWKA 3QL8A 4DEAA 4B7TA 1WVYA 4GL9A 3SLSA 4NIFB 3P79A 2OF4A 2BHEA 2Y4IB 2BDJA 3CE3A 3Q2MA 3QLFA 4TYGA 4UWCA 4YZBA 5DIAA 4ZK5A 3BWJA 5HVKA 1H00A 4FRFA 5HX6A 4LL0A 5FXSA 3QWJA 5TF9A 5ANEA 2YHVA 3ROYA 5D1JA 3P86A 4UYNA 2J6MA 3EQGA 5HO8A 5L6WL 1K2PA 1VYZA 3EQPA 3PUPA 4ZS4A 3WE4A 4IAYA 4DEIA 4BC6A 5AP5A 4R1VA 2OKRA 5AP0A 4BDJA 4BB4A 3NPCA 4CSVA 3VHKA 2XM9A 4QP2A 4RZVA 4RX7A 2ITNA 4ZLZA 1XBBA 1ZOGA 4BDBA 3MH2A 1WVWA 1YWVA 4X6RA 3ZBXA 1W2FA 2C5VA 3PVGA 4P90A 1YDRE 1YKRA 3DLSA 3SVVA 4QDEA 3DNDA 4FV4A 4UEUA 4NEUA 3IPHA 4FV9A 3IG7A 4FSYA 4YBKA 4AN9A 4DEHA 1GZNA 3QD3A 4YTCA 4ZTRA 2PU8A 1H25A 2O2UA 3GCQA 3A60A 1AD5A 2RG6A 3FXXA 3ORXA 3W10A 1XHAA 3PPKA 4O91A 1M17A 1Q97A 3ZLSA 4DBXA 3N9XA 1PXJA 4BDKA 2CLQA 4EOOA 4F6UA 2Q83A 3PLAE 4IXPA 3PXZA 4OTWA 2JAMA 3AG9A 4J52A 2F7XE 2XK9A 3HVCA 4RZWA 5AP6A 3TN8A 4BCFA 4ZSAA 5K5NA 1K3AA 1YOMA 3PVUA 5CENA 4AAAA 3LQ3A 3KMMA 3DXNA 3V5TA 3DBQA 4HYIA 1UU7A 4YJVA 4AGCA 2PUPA 3F66A 4FVQA 4XRJA 5FQDC 4L6QA 2B9IA 5EW3A 1ZARA 1YXVA 2EXCX 1OUYA 3ETAA 3R1NA 4RIYB 4TKSA 4ENXA 2RFSA 5LMBA 4UZHA 2JFLA 2PYWA 5IEXA 4EBVA 2B53A 2GNGA 4GK3A 1IR3A 3R02A 4CNHA 3WF9A 1R3CA 3C7QA 5LVMA 4QNYA 2C6DA 2V7OA 1FGIA 4BBFA 4M13A 3HRBA 3I4BA 4H1JA 2PVRA 2YCFA 3F88A 5GZ9A 4D4YA 2GNIA 5I9XA 2W1ZA 1TFFA 4L3LA 5IDNA 4U40A 4X2FA 4CVAA 3NUXA 4WUAA 3TZMA 3QUDA 2A1AB 3WIGA 3QHWA 1JKTA 3TUCA 4BJJA 4V0GA 3O50A 2IZRA 2YJRA 5GIOE 3SHEA 4MF0A 4BY9E 4I93A 2FB8A 4J7BA 3BI6A 4IMYA 4E6AA 2GHMA 4KBAA 3BHYA 3NSZA 1DI8A 5FEDA 2O5KA 1OBDA 5LVOA 4DHZA 3LCOA 2X4FA 4BTMA 1JNKA 3FMHA 3QGWA 2WD1A 5C8MA 3FAAA 2XUUA 3BE9A 3ML1A 5J1WA 4UN0C 4NJ3A 5GINE 5ETAA 4A9SA 4AN2A 5LQFA 3TUDA 4CLIA 2YIXA 2GNFA 3KCKA 4H05A 4ZMFA 3OC1A 3RNIA 3NAXA 2OI4X 2GHLA 4I23A 1U54B 1H1RA 3F9NA 1PXOA 1W8CA 4U0IA 5L2WA 1SVHA 2XVDA 3EOCA 1OPKA 3OG7A 4FZ6A 4GFOA 2ITOA 3VN9A 4ZY5A 5IQGA 4PNIA 2J5FA 4NZWB 1A48A 3C5IA 2QQ7A 3VQUA 2CLXA 2OICA 3VS0A 3Q9WA 4L44A 4KRDA 4BCHA 3EB0A 4L7SA 4W4WA 3TYKA 4I5PA 5KMMA 2XK8A 4E93A 3ZM9A 4L8MA 3EL8A 3O7LB 3PUFC 3I60A 4WNMA 4YLJA 4FX3A 4YJQA 2KTYA 2O0UA 4NM3A 2XKDA 5IA5A 3F5PA 4HVGA 5EFQA 1PXNA 3R7UA 1T45A 2W9FB 3KXNA 1KV1A 4QTBA 4GEOA 4D28A 3PIZA 1UNHA 5CVGA 4X0MA 3P08A 1WCCA 5CI7A 4WO5A 4D5KA 5BYZA 4AG8A 5LCKA 3DCVA 5BPYA 3NFFB 3MYGA 3LCTA 4A9YA 5AR5A 2GHGA 4PY1A 5EYDA 3VRYA 4YC3A 2I40A 3BZ3A 1H1QA 3R2BA 3MN3A 2B54A 1MQBA 2VTNA 4WT6A 3IDCA 4O38A 2UW9A 3PSCA 2C0OA 4BBEA 5HLNA 2A98A 4PNKA 2H6DA 4RPVA 4GRBA 5DRDA 2UV2A 4UXQA 4E6QA 4AXEA 3EQFA 3ZU7A 2BROA 1NVQA 1SVEA 3BQRA 3Q4TA 2OXYA 5IA2A 3TNIA 2HIWA 4L42A 1V0BA 4YNEA 4JNWA 2BKKA 3TKUA 3BWFA 2Z7SA 1PF8A 3RBWA 2ITVA 2Y9QA 3O0GA 3ORLA 5CAPA 2BHHA 4XH6A 3ENHA 2W96B 3CCNA 5TOZA 4FTUA 4Z16A 1NVSA 2P55A 2YWPA 3B8QA 4X2GA 5CNOA 4EOKA 4ZY6A 5IQBA 3GEQA 4H1MA 2C6OA 3V6RA 4ZJVA 2H8HA 4YP8A 2XA4A 4C58A 2WOUA 2XNEA 5IG1A 2F4JA 4EYMA 4O1PA 3MH1A 5IQEA 3EL7A 3RAHA 5TO8A 4BJJB 2JC6A 5HG5A 3ZOSA 2EUFB 2W0JA 4EKKA 2HXQA 2P2HA 3SD0A 4BF2A 4O83A 1ZMUA 4YZMA 3CSVA 5BYLA 3GB2A 3A62A 3FI2A 4F63A 4S30A 2R7BA 3ZDIA 2R3MA 3VBVA 3PLSA 4E73A 5K4IA 4E1ZA 2C5XA 5AJQA 2RKUA 4MQ2A 4X2JA 2JEDA 2WTKC 3QKMA 5M09A 4CRLA 2NNWB 4I41A 3GENA 3ZM4A 4I20A 4DGGA 4DH1A 4ALWA 5I4NA 5KMNA 3CC6A 3TIZA 4EH9A 1ZYSA 3H30A 5IKWA 4HGLA 3RAIA 3R9OA 4AACA 4TWOA 3LE6A 1JKSA 4KSQA 5KNJA 3PFQA 3EFJA 3UDBA 3BL7A 4A9RA 4FSZA 2PUIA 3IW4A 3FL5A 3R0TA 4U45A 2JLDA 5HNBA 5C03A 4FNXA 1MUOA 4KNBA 4C0TA 4CFXA 2WZJA 4ZSGA 2PMOX 3GCPA 2Z7LA 3BHUA 4EOJA 3FL4A 2Z7QA 3CTHA 2VWUA 3OXTA 2UW0A 5EI2A 4AFEA 5HIEA 1CDKA 5KBRA 2HW6A 2VWIA 4CZYB 3LJ0A 2HCKA 4OT5A 3TWJA 4IM2A 5IA4A 3L8XA 5EW8A 1GJOA 3A8XA 3OW3A 3VHEA 4A4LA 4YC6A 4ITJA 2XKEA 2QVSE 4KSPA 4ACGA 2CSNA 2OW3A 5CSPA 3U6HA 2WTKB 4DFXE 3EQRA 4IAFA 4FZAB 5B7VA 5K9IA 3GOPA 5J87A 2JDTA 2JDOA 2OIBA 2CGUA 4ZSJA 2VWXA 5B2LA 3KF4A 4LGDA 4WOVA 1YI6A 4I6FA 4KKGA 1G5SA 4BDFA 3BGQA 5DT3A 4I4EA 2IZUA 4UMQA 5DT4A 2F49A 3UBDA 3LIJA 5G1XA 3BU5A 2JBOA 4JAIA 4PMTA 1UV5A 4JOAA 4RT7A 2WU6A 3C50A 3PE2A 5CU0A 3UQCA 4MCVA 2QC6A 3S00A 2ZOQA 3RGFA 3UQGA 2HY81 4IZ5A 5GZ8A 4U3ZA 5DWRA 5LOHA 4GSBA 4IACA 3EFWA 4K77A 4Z3VA 2GS7A 3F5GA 4G5PA 1JPAA 4NM5A 2WQEA 3WE8A 4NTSA 4YPSA 4DA5A 4UX9A 5FP5A 3CQEA 1PRYA 1XH6A 4GT3A 3COMA 3MH0A 3OVVA 2YM4A 4K33A 4HCVA 4I5HA 3S95A 3OOMA 4HVHA 3BPRA 4M69A 3AT4A 3QRTA 4WD5A 4IFCA 4CLJA 4D4RA 4IAAA 2YIYA 3M11A 4RWJA 3SRVA 3VNTA 3H3CA 5IMXA 3R7VA 4BWXA 3TJCA 1RJBA 2WXVA 4MXAA 4YZ9A 4RC3A 3KB7A 1VZOA 4O21A 2UW3A 3WZEA 4TWPA 4K1BA 5I0BA 5H2UA 4UMRA 5FTQA 3FZPA 4K8AA 4YZCA 3ZFYA 4R7IA 5HICA 3LPBA 2YAAA 1XMMA 2PWLA 2C30A 4LM5A 2BRGA 3UODA 3O71A 1VLRA 1SZMA 5DFPA 4ZAUA 1RQQA 4FC0A 4C36A 3AKKA 3WBLA 2QOCA 4AW0A 3QQKA 1PXPA 2UVYA 3O51A 3VBWA 3QU0A 3QTWA 5CF5A 4CKJA 3V5JA 3UNKA 1FBNA 3FKLA 1MP8A 3M1SA 4GJ2A 3KVWA 3ULIA 3ACJA 3QC4A 3S4QA 4DDIA 3RPVA 3KF7A 3MY5A 2ONLA 5IEYA 4Z55A 4P5ZA 4PRJA 2EXEA 2QOBA 5M55A 3LQ5A 3BLRA 2VTIA 4E5AX 4O0YA 2QOFA 3W0PA 2SRCA 3RM7A 4FKIA 5M51A 3JVSA 5CZHA 1PHKA 1CKPA 3QLGA 4JBOA 1M7QA 3O2MA 2H96A 4GMYA 4FV0A 2VTHA 3PG3A 4XP3A 3GOKA 1OKZA 3AC8A 1M7NA 4I6BA 3F69A 3P23A 2R3GA 3F2AA 3QXOA 2CMWA 4JMQA 2CJMA 5H8EA 4ASZA 4FKLA 2WIPA 2YFXA 4KKHA 2G1TA 3FI3A 1Q8ZA 3LZBA 4IAIA 3A61A 4MQ1A 3DQXA 5HO7A 5HEZA 2LGCA 4AX8A 3EH9A 3KRJA 4KIQA 4AW5A 1W7HA 3K54A 3VBTA 2R3IA 1BI8A 3ZLYA 4BGQA 2VTRA 5HD7A 5JGBA 4MUQA 2UZBA 5CSVA 5I3OA 4ANQA 4JQ7A 2WU7A 3QZFA 4TZRA 4BYJA 4R6VA 1XH8A 5JFXA 4FYNA 1OL1A 1KWPA 2OBJA 2YM5A 4XNEA 1YW2A 3ZO4A 3R21A 4AXDA 5DRBA 4H58A 3VF8A 3GNIB 4L53A 1W2DA 1J7UA 1WVXA 3MPMA 3UPZA 2WMAA 1Q61A 1LPUA 4U43A 1G8JA 4DHIB 4IVAA 1ZMWA 3PXFA 4KS8A 1M52A 3UNJA 3ZDUA 5CU6A 1LEZA 3HECA 5L8KA 5J7HA 3R2YA 4BRXA 2IW9A 2PUNA 5FUTA 3WOWA 2O63A 3ZTXA 2EU9A 2REIA 5ETIA 4USDA 4AFJA 4ANMA 4W4XA 3LM0A 3V8SA 5BNJA 3MESA 4FGRA 4EQUA 4QT1A 5D9HA 2OXXA 4AGDA 4IX5A 4UBAA 4M69B 4G9RA 4QYEA 4XG9A 2W7XA 4YC8A 3OF0A 1BL6A 3D5VA 2VZ6A 3LW0A 3QCSA 3OFMA 3SOAA 5I3RA 3SRVB 4BI1A 4GYGA 3PY0A 2E9OA 5AV2A 4RRVA 4QMZA 3ZC6A 4RJ8A 2B7AA 4YTIA 4AXCA 4KWPA 2FSTX 2ONLC 3QD4A 4J1RA 3RM6A 3FUPA 4WG4A 1ZY5A 4FIHA 4B6LA 3EYHA 4IX3A 1TVOA 3HA6A 4CMTA 3HYHA 5E8SA 4H36A 4R5SA 5F20A 2X2LA 4RWLA 4V04A 5E8VA 3VUGA 2VTPA 3KGAA 3OROA 2OSCA 3EN7A 5FTOA 3TIYA 4AP7A 1GZOA 2BILB 4BCOA 4OBPA 1Y6AA 2C6TA 1FQ1B 5L2IA 3NUAA 1OPLA 3DZOA 3F5XA 4FZFB 4Z9LA 4LV5A 3LJ1A 2W1GA 3TNQB 5CVFA 4M15A 3OUKA 4YLLA 1ATPE 4AZVA 4U5JA 5TT7A 2BDWA 4JL9A 5E90A 1Z5MA 4NFMA 3DY7A 3LFAA 4FKSA 3NW7A 3C4FA 4O0TA 3Q9ZA 5HU3A 3H10A 3ZXZA 1W83A 2CNUA 3R22A 5D10A 3MPAA 5ANOA 3VQHA 4D1SA 3FSFA 3CY2A 3DS6A 3TACA 4GT4A 5AAEA 3GU8A 5AV4A 1FMOE 2PVMA 2BR1A 3ZHPC 4JAJA 1FVVA 4EOMA 5CEPA 4QEBA 3UP2A 3V5QA 4IX6A 4OTGA 4A4XA 2HYYA 4MYGA 1PW2A 3U4UA 5BYYA 5J5SA 2G2IA 3MH3A 3ZMMA 3BLAA 3GCVA 5HVYA 3VUMA 4ACHA 5HE0A 2CGXA 3E64A 4OAUC 4AW2A 4AXFA 3TG1A 2XBAA 5JEBA 5AP2A 3EYGA 2Y6MA 2R3NA 4FL2A 2PY3A 4YGAA 3E7OA 4IZAA 3VW8A 4FTOA 4CFVA 3I5NA 2XP2A 2YWVA 4FIEA 2J0IA 3I0QA 2WMXA 2UZTA 2J0KA 3T8OA 1PXIA 2F9GA 4RX8A 1H28A 5EDRA 4Q9ZA 2C3LA 2YCRA 4QMVA 3AT2A 1DM2A 3CXWA 2OGVA 3P0MA 3ZUVA 1BUHA 3OY1A 4V05A 4O22A 4N4SA 5BUIA 2VUWA 5DR6A 2OU7A 2BUJA 4AA5A 2BMCA 2GQGA 4U97A 2W1HA 3O8PA 3CTJA 1R39A 2OJIA 4FSQA 4IDTA 5D7VA 4YTFA 4AN3A 4KIPA 5FXQA 3LFSA 4DFYA 3PE1A 4YR8A 3LM5A 4HNIA 2Y6OA 2YCQA 2ZVAA 3G9LX 4L68A 4RX5A 5KMKA 4GG7A 4I94A 4FA2A 2VTTA 2R9SA 3VS6A 5BUEA 2ZDUA 4MD8E 5E8XA 1REJA 1Y6BA 3RPRA 4I5CA 4PQNA 2ERZE 3FQHA 3FLSA 3S1HA 3G0FA 3E8NA 3LVPA 3DK3A 5HE1A 3B8RA 4CYIA 1FOTA 1GZ8A 2QOKA 3M42A 3D2IA 5E8UA 2C3IB 3AMYA 3RJCA 4CTBA 3UO5A 1ZWSA 2YIRA 3FI8A 2G9XA 4DTBA 4EK4A 5A6OA 4UMPA 5J8IA 4RFMA 3CR0A 4E6CA 4O7TA 3GU6A 2JKMA 2VAGA 3I7BA 5EQPA 3DFAA 3GFWA 2BTSA 4UB7A 2IPXA 2XNGA 1UNGA 2QOLA 3GBZA 3I6UA 2YEXA 3P4KA 3RK5A 3DLZA 3DFCB 5HNGA 2YM3A 3U8WA 5IPJA 3G9NA 2PZ5A 3W55A 4HPTE 2XAMA 2IJMA 3BYSA 3MSSA 3L8PA 4YZDA 5CQUA 5FEQA 4EOIA 2ZV8A 4A9TA 4HJOA 3OCSA 2PVNA 3UYTA 4F9BA 2IVVA 5JFWA 3NR9A 4Y83A 1R0EA 3ZO3A 3QTXA 2G2HA 3OT8A 2R3HA 2WPAA 4RIYA 4DHFA 4FSRA 3MJ2A 2W1DA 3LLTA 1JVPP 5JGAA 5DYJA 3U55A 3R1QA 2E9UA 1TZDA 4G34A 3HMIA 4PMMA 4WIHA 3AT3A 5M4FA 3DJ6A 3Q53A 4EZ3A 4MD9E 4LRMA 3W0QA 4MH7A 1XO2B 3K3JA 5AUWA 5BV3A 1K9AA 2X9EA 3W33A 3TZ7A 4F7SA 3NS9A 3IGOA 4ITHA 3TNHA 1Y8YA 5I9WA 2HZIA 3S3IA 2OIQA 4MF1A 1ZXEA 2B4SB 3EKNA 5CSHA 2ZAZA 4IH8A 4FG9A 4RC2A 4FTNA 2W05A 4FIGA 3OTUA 4F64A 1OGYA 5I5ZA 4BVUA 4RLKA 1H1PA 2RFDA 4QTCA 3ZZEA 3PZEA 3NMUF 2BDFA 4AZTA 3FWQA 4DFZE 2QD9A 4EWHA 3FJQE 5E7RA 3TV4A 2NO3A 2VNWA 4ZZOA 5L8LA 2CPKE 3W2QA 3E8CA 2C3KA 4I24A 4M7IA 4DLJA 2QU5A 2HW7A 1JSVA 3BYUA 3MJ1A 3KCFA 3KREA 4L46A 1FVTA 1WBOA 4CFNA 4I0SA 4QTEA 1Q62A 4GU9A 3SC1A 2ZV2A 4ITIA 3MTLA 4IADA 5A9UA 2R0IA 4YO4A 1YDSE 5K4JA 5TKDA 1U54A 5AP4A 4FSMA 4FTJA 2FUMA 3GGFA 1QPEA 1J3HA 5IZFA 2X7FA 4MKCA 4GKHA 2HWOA 3VW6A 2ACXA 4RIXA 5CX9A 1W98A 3ZONA 1YXTA 2IF8A 2XK3A 5L2TA 2QHNA 3WZKA 3LFCA 4NWMA 4S31A 3Q4UA 4FKQA 2WMWA 4Y85A 3WZUA 4BICA 4FV5A 2VTJA 1ZY4A 3K2LA 4IW0A 3MW1A 4R1YA 3BGZA 3ZXTA 3Q2JA 4AOTA 4EHVA 4HVDA 2J9MA 2UW5A 3COKA 4I4FA 3SG9A 3AMBA 1SNXA 5E92A 3UOHA 4PL5A 1OZ1A 4CEGA 5HCYA 4LGGA 4FV1A 3Q5ZA 4D2WA 3CP9A 2VWYA 4UMUA 4EJ7A 5EK7A 4MBLA 1OB3A 1O6KA 5IUIA 4PL4A 5IUGA 4IJ9A 4OR5A 4RA4A 3KXXA 1S9IA 3BEAA 1QPCA 4EJNA 2OLCA 1IA9A 2QONA 1R0PA 2I0HA 4O0VA 4U44A 3M2WA 3KMUA 4U42A 5JH6A 3KQ7A 2EWAA 4XV3A 3BL9A 3NRMA 2IVTA 3DAKA 3HKOA 3QUPA 4IVDA 3U6JA 2OFUA 3LLAA 1JKLA 3UVQA 3VBQA 4BBMA 3I6WA 3KN5A 4NTTA 4BDDA 1JLUE 3E63A 5AMNA 2GQSA 4JR7A 3LFDA 3FLQA 4I6QA 3MDYA 1H1SA 4FVRA 5ETCA 1OBGA 2ITZA 2XNPA 2R5TA 3CIKA 3UC4A 3ORMA 3W0NA 2VTQA 3JY0A 1UA2A 2XNBA 4FK6A 4ZSLA 4BTFA 5I9ZA 4NT4A 4KKEA 4JDHA 1E1XA 4JVGA 4Q2AA 4DG3E 3UIUA 2OH4A 3KMWA 2QNJA 5HVJA 4R5YA 1F5QA 3NNVA 5M08A 4FV6A 5IH6A 1KE8A 3PSDA 5DEWA 4F65A 5AR4A 2W9ZB 2J7TA 3HEGA 3HP2A 4IB0A 5CS6A 3UIXA 1ZYDA 3UTOA 2H9VA 2PVYA 5CT0A 3UIBA 3W2CA 3DBCA 1U5QA 3DPKA 2WTDA 1G8AA 5LVPA 5EI8A 2WQBA 2FYSA 3ORKA 4AQKA 1X8BA 4FOCA 3UDSA 2BRHA 5BMMA 4EH6A 4ASEA 1H08A 1M2RA 5A46A 3QQLA 3OBJA 3TKHA 4DFNA 5IQDA 4I0RA 3IW8A 4CV9A 2GNJA 2CNQA 4BKJA 1OIRA 4G6OA 4NUSA 3LFQA 4Z7HA 3F82A 3SOCA 2RFNA 2WMUA 1XBCA 2OWBA 4W4YA 3THBA 4F6SA 4DH5A 1DAWA 2WGJA 4C35A 4EK6A 3NNUA 2R3RA 3D5XA 3NYXA 4B0GA 4IWDA 2V7AA 2PL0A 3FMKA 4BCIA 3W2RA 3JUHA 3V6SA 2JD5A 5HG9A 3U4WA 4D55A 1BI7A 4EH5A 2ITYA 5AR2A 4RLLA 4FBXA 2R4BA 4BCGA 3PWYA 4QO9A 4GIIA 2GFCA 2R3KA 3K5VA 5EKOA 5H3QA 1PKGA 4FKJA 4QPSA 5C26A 2R3JA 3D7TA 4OUCA 2PE0A 5CNNA 3FBVA 4D5HA 3EQBA 3DQWA 3NCZA 2B52A 2X0GA 5FRIA 3TZ8A 4L67A 4EI4A 4DDGA 5AUZA 5DR9A 1LP4A 5IQIA 1ZLTA 3OWJA 3KK9A 4RIXB 3K5UA 4E6DA 4QP6A 5KO1A 3AKJA 4AT5A 3C0GA 3O23A 4F0FA 3QFVA 4EBWA 4E4XA 2ITPA 3JYAA 4R7HA 4XG2A 2WMSA 3DKOA 4TWCA 4DEDA 4ENYA 3KY2A 3PP0A 1ZZLA 3KC3A 2V22A 5DE2A 3DB6A 5EM6A 2X6EA 3W2SA 5M4CA 3ORZA 4JDJA 4RG0A 3CTQA 3ZEPA 4YZNA 1ND4A 4ZEGA 4D2RA 2I1MA 5D11A 3FZRA 5DPVA 2C6KA 4O6EA 4E20A 2XF0A 5IQFA 3DT1A 4H3BA 1O9UA 3MIYA 3W8LA 2VTSA 4CFWA 4APPA 3D14A 2GMXA 5E8YA 3L9PA 5JGDA 3UPXA 3V04A 3AMAA 1DAYA 4CG8A 3CEKA 2Y4PA 5CAVA 3NW6A 4JRVA 3UIMA 5C1QB 1P4FA 3ORPA 5CYIA 3VULA 4IBMA 2XK7A 2BFYA 4LRJA 3UVRA 4QNAA 4MXYA 3KKVA 2X8IA 2Z8CA 1OPJA 3NFGB 4TYJA 2FO0A 5L6OA 4RJ7A 4WBBB 1E9HA 5LVNA 1OKYA 4O6LA 5I9UA 3ID6C 2PVKA 4U41A 2CN8A 2Y8OA 3GP0A 3A7HA 3OOGA 1TQIA 3RZFA 3A8WA 4FL3A 4IAKA 3NAYA 2EB2A 3QRUA 1H8FA 4GYIA 4BWPA 1ZOHA 2NRYA 4YHTA 4G6LA 2QOQA 3FC2A 4FGBA 4XG6A 4L45A 1E1VA 3GC0A 5M4IA 4EEVA 3FZOA 2BKZA 4EONA 4BKYA 3VUHA 2WEIA 3WILA 2R7IA 3C9WA 4IM0A 4RJ3A 3BEGA 2OZOA 1WBVA 2BRMA 4AE6A 3Q32A 4O86A 2XRUA 2RL5A 2ZM3A 4PV0A 2C5NA 4NW6A 1CSNA 5EHOA 4TL0A 3QUEA 4FUXA 4ZXTA 4C57A 5HZNA 4AZEA 3CQWA 1M2QA 4EQCA 3QTRA 5HCZA 2W99B 4ALUA 2XS0A 4Q5HA 2FGIA 4D1XA 3DDQA 4XG7A 4QMTA 3ZLWA 4YMJA 4EZ7A 1ZZ2A 2VNYA 4F9YA 2GS6A 2X0QA 4QTDA 3CKXA 2VX1A 2J0MB 5T3QA 1KOBA 1WBNA 3P1AA 4Y8DA 3E3BX 3LKMA 4Y95A 1KE7A 3KVXA 1O6LA 5T6KA 4II5A 2YZAA 3UQFA 4WG3A 3MFTA 3G6GA 5CXHA 3C4CA 3PXKA 4P2KA 5CASA 1PXLA 4CYJA 2W4OA 3AC3A 4EHEA 5JSMA 4QYGA 3RINA 4C4FA 4ZLYA 4U80A 3BHVA 2AC5A 2Q0BA 5M57A 2E9NA 4JS8A 5AP7A 3FMEA 4D4SA 1NXKA 2IW6A 5FBOA 4XP2A 3OXZA 1URCA 1P14A 1KSWA 2YM6A 2GSFA 4YHJA 3R7EA 4R78A 3G90X 4FKRA 4M0YA 3RNYA 3HZTA 4FF8A 3D7TB 5AM7A 4FJVA 1CKIA 3KRXA 5DGZA 4PMSA 1UWHA 1KE9A 1Q41A 3D7ZA 1NVRA 4AS0A 4YJRA 3MFRA 1CKJA 4IZYA 2VV9A 3TDWA 2XYUA 3ZFXA 3H0YA 3PRIA 4RIOA 3MA3A 5DT0A 3R83A 2GTMA 4FE2A 2PMLX 4IE9A 1ZYCA 4MBJA 4EK3A 5BVEA 4FT3A 2W1IA 2ITQA 2NP8A 2KULA 1H26A 4FTMA 2ZB1A 1JAMA 1DS5A 2O3PA 3BHHA 5CU4A 1Q8YA 2GU8A 4CMOA 5GIPE 1W84A 2JKOA 3DTWA 4KBCA 2XIYA 3MVLA 1QL6A 3MY0A 2YJSA 2CGVA 4PTGA 3UZTA 4CXAA 4Y73A 4HPUE 4FKVA 3TNPC 1VR2A 3QYWA 5E8ZA 1A06A 5A3XA 4O0XA 5K5XA 2Q0NA 2Z2WA 4EC9A 4J53A 3QKKA 3DKCA 3MB7A 3FY2A 4DEEA 1S9JA 4CTCA 4D2PA 4D0WA 3RI1A 2WQMA 2ZV7A 4I3ZA 4QQJA 2YITA 3KRRA 4RVTA 2R64A 3DNEA 3PXRA 3QAME 1V0OA 2ITXA 4A9UA 3EFLA 4W8EA 4ARKA 2GQRA 3NZ0A 5FWKK 3II5A 4WNOA 4MX9A 4XCUA 4FEXA 4HGTA 4EOPA 3UG2A 3NLBA 3DBEA 4GFMA 1IAHA 4I0TA 2CN5A 3BHTA 1Q5KA 3P78A 4EC8A 5IH4A 4YJPA 2YZLA 2ITTA 5EG3A