3NW5A

Crystal structure of insulin-like growth factor 1 receptor (igf-1r-wt) complex with a carbon-linked proline isostere inhibitor (11b)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
302
structure length
302
Chain Sequence
DVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Insulin-like growth factor 1 receptor
publication title Proline isosteres in a series of 2,4-disubstituted pyrrolo[1,2-f][1,2,4]triazine inhibitors of IGF-1R kinase and IR kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 302
sequence length 302
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nw5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nw5A01
3REPA 3AC5A 3FMLA 4KIQA 3R9OA 4AGWA 3QAME 2J2IB 2RG6A 1OITA 3FXXA 4YJTA 2W1EA 5CSHA 4U43A 2XRUA 3F3WA 4RX9A 4S34A 4YHFA 3UOLA 1PYEA 4GVAA 4QPSA 4ANNA 2HZ4A 2VNYA 3PE1A 4U41A 5A3XA 3TTIA 2O0UA 4BL1A 4DH5A 3KEXA 1E1VA 4NT4A 4QTAA 3G0FA 1XBAA 5CU4A 4XS2A 3PA3A 4YLLA 3PRIA 4PMSA 3FLNC 4U8ZA 4UXQA 5GJDA 4USFA 4CCUA 1IA9A 4L01A 2YM6A 3EIDA 4ANOA 3P4KA 1TKIA 3ZEWA 4QQ5A 2YA9A 4F9AA 4EQCA 1M2PA 4ANLA 2Q0NA 4EUUA 2ZDUA 4FKRA 3WYXA 2YCRA 3CTJA 2XVDA 2I6LA 3EKKA 4YZBA 4BRXA 4E26A 5A4TA 3OW3A 3BQRA 2SRCA 4O21A 3QKMA 4FBXA 3KREA 5JRSA 4HVDA 1OIQA 5F20A 2WNTA 4AP7A 2UUEA 4B6LA 4DFXE 5EKNA 4PP9A 1J1BA 2PZIA 4X7QA 3RZBA 4MBJA 5IQIA 5IA3A 5KMKA 3QQLA 4IE9A 4YGAA 5FGKA 2CGVA 5AV0A 5IQFA 3UYTA 3NNVA 4MKCA 2FO0A 5HE1A 3MESA 4RJ6A 1H28A 3F9NA 4FT7A 5LMAA 4R7BA 3Q04A 3DZOA 4QMZA 5DRDA 3PLSA 3WF6A 1KE6A 5IQDA 2PYWA 2VTQA 2YAKA 3MB7A 3P5KA 4FUXA 3CJFA 4JI9A 1KOAA 4EK8A 1E1XA 1XJDA 3W10A 2YITA 4O7RA 1JQHA 4E6QA 3ULZA 3EQGA 5J7BA 3TT0A 1A06A 5JSMA 4C57A 5HZNA 3HNGA 4PPCA 4AT5A 4BYJA 1PF8A 4CQEA 2JDOA 3IGGA 4QP8A 3ET7A 1UWJA 4ZSLA 3SRVB 3V8SA 4FKOA 5A4QA 3AGMA 2WQNA 4L00A 2XKDA 3P7CA 2XIXA 5L2IA 3QBNA 5BVKA 3LIJA 3U9CA 3OVVA 4I93A 2QNJA 4G6LA 4FG9A 5DR9A 3W2OA 5ICPA 4FC0A 2O8YA 4TZRA 4EH8A 1PMVA 3PPZA 3W2PA 4JNWA 1YVJA 2BKZA 5AP0A 4YP8A 3BE2A 1YOMA 2QO9A 4DA5A 3W55A 3NVKI 4HYUA 4LGHA 3ZBXA 2EVAA 2WOTA 4HGSA 4P4CA 3KULA 4HYSA 3DAKA 5DH3A 5CAQA 4FZAB 4O82A 4JL9A 4JDKA 4FZDB 2IZTA 1OPKA 4FSTA 3DT1A 3R00A 1SNXA 2X9EA 2I0VA 3PY0A 3VUHA 4S31A 5AUVA 2Y7JA 1Z9XA 4RIYA 3TI1A 2CCIA 4D1XA 4A9UA 5F9EA 5CANA 5ANIA 5D11A 4J7BA 4CLIA 5BQ0A 4L46A 3D5VA 2XUUA 4FTTA 4F64A 5CF5A 3TG1A 4CZUA 1GIIA 4NEUA 4AXAA 3L1SA 4XYFA 3RP9A 1OKVA 3FMDA 2Y4IB 4RJ5A 1M2RA 3LCSA 4FNWA 4J8MA 4L44A 3ZUUA 2YM3A 4IVDA 4II5A 2HWPA 3GOPA 3LQ3A 3H30A 2VTOA 3Q4UA 1XH9A 4KSPA 4I92A 2ZM1A 1MUOA 3FL5A 4FSMA 2RG5A 3QQUA 4F6SA 3LMIA 4G6NA 4R3PA 3KCKA 3DXPA 5AUYA 3BELA 5IA0A 5GIPE 2RKUA 3ZUVA 3COMA 5CZHA 3BEGA 5H3QA 1YDTE 1PXMA 3HDMA 2BTRA 3KK9A 3W16A 4B8LA 4K8AA 2YERA 3DBQA 4G5PA 4LYNA 4GYIA 5EI6A 3LXKA 3UC4A 4B99A 4EKKA 4KKEA 3RK9A 4L7FA 3R01A 2R0UA 4GIIA 4CMOA 2C6TA 3DXQA 3QU0A 4GH2A 4QMLA 2J51A 2QI8A 4JBQA 4JDJA 4ZTLA 3ZLYA 1UU7A 1CMKE 2ZJWA 4QTCA 3TUBA 2HZ0A 4DEAA 4YJVA 3FMKA 1CKIA 4O0TA 4CV8A 3Q52A 3TTJA 4OTDA 3FUPA 3GNIB 2CLQA 4MXZA 2VTTA 4LGDA 3UJGA 5AP6A 3PZHA 3SC1A 3L9NA 4D58A 2X81A 3HMIA 3DNEA 3ORTA 4C38A 4OBOA 2YWPA 4ZK5A 4DH3A 2C5YA 4M7IA 2XJ0A 5HD7A 4ENXA 4PL4A 1QPJA 3IK3A 4FV1A 3Q2MA 2C6IA 4FTKA 4N0SA 4B7TA 4FV6A 3UQCA 3MVMA 1O9UA 2YDKA 4RVLA 4FEUA 4UMUA 3DJ6A 5IH6A 1W82A 2QLQA 4KSQA 1XH5A 3M11A 4GVJA 3NYOA 5AAEA 2VAGA 2XYNA 4I0SA 3RCJA 3I6UA 1FBNA 3MVHA 4DLJA 2QODA 4I21A 5AR8A 4ACCA 4UMPA 1L3RE 4ZJVA 2X7FA 2C0IA 4GSBA 2YAAA 4QD6A 4QYGA 4WG3A 2PU8A 5BYLA 4LOQA 3IW7A 2OJFE 5HD4A 4D4VA 3TIZA 3NLBA 4NTSA 4JG7A 3VULA 4ZY4A 5HHWA 4R7HA 4TYEA 4RGJA 3O8PA 1HCLA 1REKA 1UVRA 2XS0A 5C26A 4QYFA 4RQVA 1UKIA 3OCGA 3NWWA 3CIKA 3ZFXA 4AGDA 3TUCA 4QQCA 2QKWB 4FSRA 3PPJA 1JBPE 2B9IA 2Y4PA 3ORXA 2UW3A 2P4IA 4KAOA 5HE0A 4BZNA 2R3PA 5JKGA 1DM2A 3BIZA 3ITZA 4FMQA 4KINA 5AP4A 1Q99A 5IEXA 5K4IA 1YW2A 3B2WA 2UZDA 1M2QA 4NSTA 3GFWA 4BCMA 3BHUA 3HA6A 3U9NA 4C2WA 5A4EA 4AA0A 1GAGA 3G6GA 2F7ZE 3FZTA 3QC9A 3ZXZA 4DINA 3HMOA 4C4GA 4EZ5A 3BBWA 4Z3VA 1OI9A 5C4KA 3MJ1A 4R77A 2B55A 5FBOA 3C4XA 3NNXA 3L8SA 3V5JA 4UN0C 1KE5A 2GS7A 3A62A 4ZZOA 2WQOA 2AC3A 2JDSA 4IVBA 4UEUA 1O6LA 4FR4A 3LAUA 4TWOA 3R0TA 4DEHA 4TTHB 2QQ7A 3FMMA 3DJ5A 1U59A 2PWLA 2OJGA 4MF1A 3A7IA 2J0LA 3E87A 5EKOA 2W9ZB 2Z7QA 2QHMA 2WTVA 4Q2AA 4U44A 2YCSA 4PPAA 3F7WA 4ACHA 3W2RA 3FLWA 2ZYBA 3OZ6A 4TWCA 4JJRA 1BUHA 3GCVA 2CKQA 4QP4A 1YHWA 5CZIA 4N4SA 4O86A 3FY0A 3KQ7A 4QNYA 5E1EA 3ORLA 4QP9A 4EYJA 4PDSA 4FE2A 5TF9A 2C1AA 3LLAA 3RNYA 4F08A 3TDWA 4IZ7A 3U6IA 2G1TA 4IM2A 2X9FA 4MF0A 5DNRA 4CRLA 4X3FA 2JFLA 2OIDA 4D0XA 4FSWA 5EW8A 5CF6A 3LFSA 3H4JA 5I9YA 3LJ2A 4GIHA 5DT3A 3ORKA 4RWLA 4AU8A 2WELA 3F61A 4GYGA 1H01A 3CS9A 5F95A 5LVOA 5E8WA 1DS5A 3CGOA 3VIDA 2RFEA 1IAHA 5IQBA 3CPCA 3BYVA 3HECA 5HX6A 2G9XA 5FXSA 4FIIA 2V7AA 4G9CA 4N57A 4FI1A 5K5NA 3LHJA 3ENMA 4ANBA 3D9VA 4I6QA 4LOOA 4HVIA 4NFMA 3QTXA 1WVYA 5LVNA 1AGWA 4QYEA 4UWYA 5A46A 2CNUA 3PP0A 3E8DA 1YXUA 3GUBA 4APPA 3AMYA 4CKRA 2XK7A 4AZVA 2W9FB 3VAPA 3GU6A 1BYGA 1Y57A 4FIFA 4WNOA 3ZZEA 4BCNA 4HZSA 2ZMCA 3HEGA 4F1MA 4CGAA 2OZAB 3OP5A 1YI6A 3DLZA 2WQBA 4IXPA 3PA5A 4K2RA 1O6KA 3ZU7A 4GRBA 2B4SB 3EMGA 4ERKA 3UNZA 1YI4A 2UVYA 4NWMA 5H8GA 3E8NA 1BL7A 1YDRE 2QD9A 2WXVA 2VTHA 4FT5A 2ITNA 4PQNA 2BR1A 2ITWA 4RWKA 4NL0A 4CG9A 5T6KA 4N70A 2CKPA 1B6CB 4MNFA 3QRIA 3U6JA 3B8QA 4PX6A 3CD8A 2CCHA 4JQEA 4FTNA 5DOSA 3IPHA 4F70A 4UX9A 2QG7A 2V62A 3UODA 3R7UA 1WBOA 1H27A 2X4FA 3EHAA 4FG7A 2R5TA 4IM0A 2VZ6A 2W4KA 3VC4A 4RWJA 2YLEA 4WG5A 4IAYA 4AF3A 4FYOA 4RFMA 5FEDA 2FH9A 4NM3A 4DGOA 5HNBA 2PMNX 3Q60A 1PXPA 1KE9A 3F82A 4QMWA 4IW0A 5M55A 1GNGA 5TOZA 3DJ7A 4CMUA 3OY3A 3MY1A 2C5XA 2QO2A 3SHEA 1MQBA 1RJBA 2NO3A 4OTGA 4UMQA 4TRLA 5CENA 4IC8A 3QD4A 4TPTA 5E8SA 4ZZMA 3T3VA 3QZFA 2R2PA 2XNGA 2QG5A 2JEDA 3NNUA 3P08A 3CBLA 1UV5A 4A4LA 4C3PA 1RQQA 4FEVA 5EQYA 4FKJA 3P7BA 1OB3A 1Q3DA 3PPKA 3FZ1A 3WARA 4BGQA 2GNGA 2PVYA 3F3VA 3FV8A 3IS5A 2WFYA 2Y0AA 2R3NA 3OUNB 3IG7A 1QPEA 1U5RA 4TYIA 1UWHA 5KMMA 4AW0A 1NT2A 4EH2A 4RBLA 3HV7A 2V5QA 3IECA 1UNLA 1J7LA 3LM5A 1OM1A 5DPVA 3OTVA 5CVHA 5FD2A 3EQRA 2CN5A 2P55A 3OXIA 1R0PA 2F9GA 3IGOA 2C6KA 4O38A 2YM4A 3OMVA 1IAJA 4XG2A 2JFMA 4FX3A 2W99B 2VWIA 4U42A 1PXNA 4CZYB 3NYVA 4BDBA 3QRUA 4U45A 1PY5A 5AADA 1JVPP 4BN1A 4CXAA 2KTYA 2VV9A 4ITJA 4C36A 3DZQA 4EZ7A 2PPQA 3WZEA 3R1QA 2VTAA 5DHJA 4CTBA 4BDKA 2QOBA 2XNPA 3S95A 5TO8A 3EQIA 3P23A 4EWQA 3V8WA 5J5TA 4O0WA 2W17A 4JG6A 3UO4A 1BI8A 2YCFA 3FQEA 5AV3A 4BTJA 5JH6A 5FUTA 3O7LB 3KN6A 5AX3A 4WNKA 1PXIA 4AW2A 3A2CA 4CZTA 4ZLZA 3VNTA 5AV1A 3ULIA 3C0HA 4DT8A 2OFUA 3EZVA 3MFSA 5EYMA 4X3JA 4RX5A 4E5AX 4LI5A 3W33A 2YLFA 2AC5A 5LVLA 4PL3A 1H00A 5GIOE 4RFYA 1WBWA 4QP3A 5GNKA 2J5FA 4YZDA 4IADA 4AFEA 3BYMA 3I4BA 4TYHA 4KIKB 3VW8A 4R1VA 2GQGA 5M4FA 2FB8A 3W18A 2HENA 4BTKA 3NYXA 5LVPA 5GHVA 4XRJA 1PXOA 5E1SA 4ASDA 4EHZA 4QTDA 1Y6AA 2PVHA 2W1HA 4RJ7A 1Y6BA 3WE4A 1SVGA 3ID6C 3O2MA 2RIOA 3MA3A 3NUNA 4NIFB 4ZTQA 2XNOA 2ZDTA 4FOCA 1UKHA 4OT6A 3DTCA 4NKAA 3TZ9A 2VO7A 3CPBA 4FUYA 1NVQA 2C0TA 1GZOA 5M53A 4XG7A 3LXNA 3Q5IA 4FV7A 3R7GA 3W8LA 2Z7SA 3LMHA 1Q97A 3DS6A 1OVEA 5KCVA 3DA6A 5AAFA 3TV4A 1H08A 2IWIA 3NYNA 5HG9A 5HEZA 4DFLA 2QURA 4O0XA 4EBWA 3MS9A 2IPXA 1QMZA 4A4XA 5IISA 5E92A 1W98A 5CTPA 4DTKA 4YJPA 4CYJA 3IDCA 3PXFA 3V5QA 2XJ2A 2G2HA 3ZTXA 4NW5A 3MIYA 4ZZNA 5CEPA 3HDNA 3Q3BA 3QXPA 5A14A 4AA5A 2ZM3A 2DQ7X 4BCFA 5D7AA 4O7LA 4K77A 4O0VA 5EW9A 2B9JA 1JKSA 3PYYA 4J53A 4JBPA 4LM5A 4MEDA 4Y5HA 4BDFA 2WQMA 3FYKX 3QKLA 2YIYA 3HX4A 3KXXA 3LFQA 4QT1A 4CFVA 4U3YA 4MH7A 3FMJA 4V05A 4IWPA 3EQFA 5FBNC 3UOKA 5FM2A 2PUIA 3PXKA 2I7QA 4F65A 3M42A 4I3ZA 3OY1A 4Y85A 1ZARA 2WMWA 3OBGA 3OWPA 2OGVA 3MH1A 3QTZA 2X2LA 3R1YA 3HV3A 4GMYA 4BIBA 5J9YA 1GIHA 2RFSA 2XK9A 3R28A 2BMCA 5IDPA 3R2YA 1WBPA 4C62A 4O22A 3N9XA 4IAFA 3KCFA 5E8ZA 3SKCA 4DYMA 4PMPA 3MPTA 1IG1A 2WD1A 4ZTHA 3DKGA 3F69A 3NUPA 3WF9A 4N6YA 3T8OA 2VTMA 2XIRA 3UP7A 5CT0A 2GNFA 4Z16A 4AACA 3NW6A 5EDPA 4XG8A 4OTIA 3UIMA 3TNHA 4QQJA 4NU1A 5GZAA 4UMTA 4IZ5A 3F3UA 3MWUA 4ID7A 4IB1A 1U54A 3RPSA 1IASA 3C4CA 3P0MA 2R3JA 4WUNA 3VBVA 5H9BA 4G3DA 3VHEA 4C4FA 5CF8A 5JGBA 1OIYA 1OL6A 2F57A 3U87A 4O7ZA 1GIJA 2OH4A 4V04A 1FINA 5CVGA 3GI3A 4AT4A 5E4HA 3EYHA 4F7LA 3E8CA 3E3BX 3MIAA 4FKVA 3IW8A 3I5NA 3MPMA 4RX8A 3D5UA 3MBLA 3NW5A 4QP6A 5HG8A 5F1ZA 4XP0A 3AGLA 5IUHA 2WO6A 2E9VA 5AV2A 3R8UA 5HQ0A 5AUWA 2JAMA 3TKIA 1REJA 2B7AA 4M14A 2FGIA 3S2PA 2BFYA 4JAJA 5HTCA 5IPJA 5ITAA 5BMMA 2HOGA 3G9NA 1Q8ZA 3VUTA 5I9UA 4PRJA 1OL7A 4RJ3A 5HTBA 3D4QA 4WSQA 4F6UA 3C1XA 3EFLA 2R7BA 5EG3A 4F7NA 1B38A 2VTNA 3LFEA 3R04A 3KA0A 4GUBA 5E8YA 4WHZA 3QTIA 2PE2A 4UB7A 3M1SA 5HE3A 1ATPE 2GTNA 1WVWA 3R8PA 3KULB 4BCPA 5IA1A 4UXLA 3BHYA 4NCTA 4BDHA 3VRYA 3VQHA 4JR3A 4BFMA 4H3BA 4WIHA 2X8IA 4FZFB 4ARKA 5HTIA 2Y9QA 3BHHA 4PTGA 3FZOA 4RIYB 4H05A 3GT8A 2GHMA 1W7HA 2XM8A 3A4OX 4L6QA 4PUZA 5EYDA 2EXCX 4G31A 3NEWA 4NW6A 3EKNA 1GZKA 2QC6A 4MXYA 5HIDA 4BICA 4ZIMA 3WBLA 3PXQA 3QRJA 1VYWA 3T3UA 5BYYA 1ND4A 3ROCA 5EM7A 2J5EA 2ITXA 2C5VA 5KO1A 3L8VA 4BKZA 2ERZE 2UZOA 5AP1A 5IEVA 5KHXA 4ZY6A 5HI2A 2WMTA 4EOSA 3VS1A 4EOIA 2W1ZA 2OI4X 2WEVA 3N4TA 1M17A 4CFUA 2BDWA 4DG0E 3LCKA 5LMKC 2XH5A 3OROA 3PVBA 4U81A 5CQWA 4APCA 2X1NA 4YZNA 4XHKB 2E2BA 4PV0A 5L6PA 1YXXA 2G2FA 4YPSA 4BIEA 2G15A 2GNHA 3COKA 4ANSA 4ZMEA 5IZFA 4AA4A 2C3KA 5AR2A 5C27A 1YXSA 5KZ0A 4BCGA 4HGEA 4NUSA 3PG1A 2PMLX 2GCDA 1Q41A 5CYIA 4FTCA 4DFZE 2ESMA 2W4OA 4RLKA 5AR7A 5AX9A 2XF0A 3H0YA 4I41A 3NIEA 5HE2A 2PUNA 2BALA 3F5GA 3FPQA 4W4XA 2X8EA 3HYHA 2BAKA 4NK9A 3TCPA 4J95A 4Y5QA 3NX8A 5I9XA 4NJDA 2YABA 5I5ZA 2PZYA 5KE0A 5M51A 2J9MA 2UZTA 3FLSA 3HAMA 3MH3A 5M57A 4FVQA 4MHAA 2J0JA 3EN6A 2F7XE 4PDOA 5CEIA 5B7VA 3O96A 4PWNA 5D9HA 3F7ZA 3FKLA 2W7XA 2GHGA 5HG5A 4PP7A 3DB8A 3MVLA 3QA8A 4IDTA 2IW9A 4UY9A 2X2KA 3KRXA 3SXSA 5M4IA 2XKEA 2W1GA 1XKKA 3BBTB 5K9IA 3W2SA 3VN9A 3AMAA 3QQFA 3ZO2A 4TW9A 4I6HA 5DN3A 4D2PA 4EOLA 3AC4A 5EHYA 3L8XA 4DF3A 3SD0A 4CV9A 2R3HA 3WZDA 2VTIA 1G3NA 5BVOA 3V3VA 2HYYA 1JLUE 4TXCA 4B8MA 5JFVA 1YWVA 4LMUA 3IONA 2YDIA 3O8TA 4FT0A 4CFFA 1L8TA 3AQVA 5JMSA 4M13A 2FVDA 4RVMA 2YIWA 1FVRA 4EONA 4FZ6A 2BRHA 2RFNA 2YM8A 2WU6A 3C51A 3NCZA 4Z9LA 2QLUA 5J9LA 1F5QA 1ZY4A 3QCXA 4KA3A 5DT0A 2GU8A 1OBGA 3CCNA 2B52A 4QMMA 3FHRA 3L9PA 3Q9XA 5BUJA 3R22A 2WTKB 2ITUA 1UNGA 3LFNA 1URCA 2UW6A 2A19B 3UQGA 4C4JA 2YISA 1FVVA 3PZEA 5EH0A 4FTUA 4USDA 4FV5A 3UZTA 4IX4A 4YU2A 4YURA 3WF5A 3R9RA 4EHGA 3IW5A 3R7OA 4YO4A 4WUAA 4AG8A 1NVSA 2XK8A 1QPCA 2HWOA 2BUJA 1QCFA 5CVFA 4U3ZA 1Q8UA 4E1ZA 3A8XA 1PXKA 1VEBA 3PWYA 4BHZA 3GB2A 2WPAA 2XCKA 1M52A 4CLJA 4BY9E 3O71A 2JDVA 4DGMA 2ZVAA 3KRWA 3K5UA 2PMOX 4RT7A 3NUAA 1R78A 4J99A 3VUKA 4KIPA 4H1MA 5KUPA 2X2MA 3D7TA 1JSVA 1ZYJA 3IOPA 2BIKB 5KKRB 4Q9SA 4ERWA 4R78A 4XMOA 4YTCA 3GBZA 2IW6A 3ATSA 2IW8A 3S3IA 2CNVA 4BHNA 3QD3A 3OOGA 4EK6A 3QKKA 4I24A 3MYGA 4ZEGA 5K5XA 5L8KA 3PJ2A 1B39A 5AR3A 4RMZA 5L8LA 3LFAA 4IACA 2E9NA 4G34A 5IUGA 5IA2A 3F66A 5ETCA 3BGZA 4GKIA 1HOWA 2NPQA 2XA4A 4C58A 4M8TA 5LCKA 2W1DA 4K11A 3K2LA 2HXLA 3GU8A 1YOJA 2Z02A 4QNAA 1KE7A 3E8EA 1LP4A 4RSSA 1VJYA 3FWQA 3F6XA 2GFCA 3ALOA 1T46A 2BRBA 2WKMA 4J98A 4NJ3A 5M4UA 3TXOA 2BFXA 3I60A 3Q4CA 3ZFYA 2V0DA 3TWJA 4LMNA 5HOAA 4EOKA 3QGWA 3SV0A 5IH5A 3QZHA 4X3FB 3GC8A 2BHHA 3PE2A 3EJ1A 2ITZA 4KBCA 1OL5A 4U7ZA 4MTAA 4EBVA 4A9RA 4O91A 5CSVA 2WTJA 4AOTA 4AGUA 4X2JA 4O6LA 4I5HA 1PW2A 1LUFA 1FVTA 4MNEA 2VNWA 2HCKA 4O7NA 1JSTA 3EL7A 3PSCA 4QOXA 5EOLA 4BC6A 4DEDA 2P2HA 4FEQA 3GCUA 3THBA 3OCTA 3EFJA 3QQJA 2XNMA 4GT5A 4OTWA 4MCVA 3NW7A 1AD5A 3TJCA 3FMHA 3FSFA 4DBXA 2P33A 2ZV2A 4FVRA 1VR2A 5AR5A 3ZLSA 3IW6A 3JVRA 1WZYA 3MPAA 3UVRA 5E8UA 5HVJA 4FVPA 3OW4A 4XUFA 3F5XA 3RAWA 4NYEA 3C0GA 5ETAA 5EHOA 4D9UA 4EI4A 3OHTA 4AN9A 5ANOA 4M0YA 3VF8A 1S9IA 2IG7A 4E5BA 4E73A 1YXVA 3HUCA 3LJ1A 4OBPA 5AIRA 4M66A 4UWBA 3D7ZA 4X2KA 2QKRA 4CNHA 4XV1A 2YCQA 3CD3A 3D2KA 4ALVA 2JGZA 2OWBA 3PLAE 4M84A 4M0ZA 4IZYA 5LARA 4MQ2A 3O7LD 3PFQA 2OW3A 3FC1X 2H34A 5HO8A 3EQHA 3FBVA 4I0TA 2FSLX 2W05A 2B9HA 2WGJA 2WMAA 3EN9A 4ZS0A 4EH3A 3D5WA 3LW0A 3DDQA 3V8TA 3FKOA 1KOBA 3CTHA 3H9OA 4FT9A 4PL5A 4GFMA 3GCQA 4FG8A 2IZRA 3FC2A 1U4DA 2WMVA 2G01A 2G2IA 4EH6A 1UA2A 3HKOA 4KIOA 5AEPA 1MRYA 4P90A 5E8XA 4PDYA 3DU8A 4E3CA 2WEIA 3AD5A 4TKSA 4RFZA 3HRCA 3E62A 4G9RA 2X8DA 1OGUA 4IVCA 2BRGA 2XRWA 4EYMA 3IDPA 3RK5A 5GZ9A 3GC0A 4JG8A 5BMSA 4IHPA 4WA9A 3ERKA 5DLSA 3RINA 4QMVA 4D0WA 2Y4IC 3RM6A 4IAAA 1UU9A 4HNIA 4JDHA 4HCVA 4HZRA 3CLYA 5J87A 3I1AA 4K33A 2JAVA 4WG4A 5DIAA 4DGLC 1P2AA 2VRXA 3KFAA 1NY3A 4G17A 4IAKA 2XIYA 5FWKK 4FTRA 1XWSA 4U80A 3KY2A 3SOCA 2HXQA 1VZOA 3LCOA 2UZNA 1R39A 5DE2A 5HNGA 4YTHA 3R73A 3GXLA 2BIYA 5M07A 3VJOA 5ANKA 4TYGA 3SLSA 3UO5A 5HLPA 4F9CA 4V01A 2JKQA 3TACA 2YN8A 3G5DA 3WYYA 1TQIA 2WTDA 4GK4A 4N6ZA 1YWNA 4EZ3A 4YJUA 3O0GA 1OUYA 3ZC5A 2XM9A 5HO6A 4I5PA 4EOPA 1Y8GA 3AT3A 4AGCA 2WMQA 3S1HA 5CAUA 2Z7LA 2FA2A 3BV3A 3KGAA 3PJ1A 3Q9ZA 5J8IA 3VJNA 4BZDA 3DKCA 2F49A 3K3JA 4QQTA 2BZHB 3BGQA 4XH6A 4XOYA 5M06A 5FTQA 4OTRA 4U79A 5BVWA 3UVPA 4IBMA 5DR2A 2ZMDA 3R30A 5C8NA 1XH7A 4G16A 3I0OA 4F7SA 2A4LA 1PHKA 5TE0A 5EYKA 5KMNA 4BDCA 3FSKA 3SG8A 3C4ZA 4ASXA 3FE3A 3EZRA 3BLHA 2A2AA 4E20A 4EC8A 4K18A 5DBXA 4HOKA 5CXHA 4RQKA 3V5WA 1XBBA 3A60A 5EW3A 1BX6A 2V55A 5FM3A 4XRLA 4C59A 2XBAA 3D83A 2P2IA 3KMMA 4ZSJA 4ENYA 4LRJA 4DLIA 3PIXA 4YPDA 4MAOA 1JKKA 2UW8A 3QYWA 2CKOA 3U4WA 1MRUA 5AP7A 3NR9A 5CEOA 3S0OA 1DAYA 4PPBA 1I09A 3TV7A 4QYYA 5AM6A 3OEZA 3VS0A 4F9YA 4TYHB 3W2QA 4BI2A 5J5SA 1XO2B 3Q53A 4K6ZA 1Q5KA 4XG6A 4EUTA 3O51A 4CFMA 5J7HA 3A61A 3NZ0A 3D15A 4FTMA 3G51A 3LXLA 3KXGA 4YHJA 5LOHA 5M09A 4PNKA 2HK5A 2XBJA 5CX9A 3ZS5A 1EH4A 2PVNA 3WF7A 2OF4A 3OWKA 3QZGA 4BVUA 2RF9A 2YM5A 3OS3A 3QQHA 5TKDA 2GSFA 3ZCLA 4TYJA 2R3OA 2XJ1A 4WRSA 3TDVA 5ANDA 4AUAA 1P4FA 4OR5A 5HVYA 4FICA 3ZSGA 3BYOA 3FLZA 4FF8A 2J0KA 5HLNA 4LFIA 4EH5A 3R8VA 3OWLA 4EORA 3LCDA 2YJSA 2OIBA 2W06A 4BKYA 5HBJA 4EH4A 3GEQA 3LCTA 2WIPA 3TZ8A 4OLIA 3UMWA 1J91A 4BIDA 4O84A 4U5JA 3T9IA 3V6SA 3PG3A 4ONAA 4WT6A 1RDQE 4IFCA 2OG8A 3MY5A 4ZMFA 2Z60A 1P4OA 3DK6A 2VWBA 4K1BA 4BGGA 2R3FA 4OGRA 1WBVA 2BVAA 4WNPA 4YBJA 2QR7A 4XV2A 4XV3A 3HAVA 3DKFA 4EK4A 2C6MA 4FV8A 4WSYA 2ZV8A 4YLJA 4O96A 3LPBA 4AT3A 4S2ZA 5T68A 3UBDA 2XKCA 4AW1A 3JYAA 2R3QA 4K9YA 3OT3A 4RRVA 4H1JA 3FQSA 3DBCA 2F2UA 4H36A 2XK6A 3TNWA 3BV2A 2R3IA 3CQUA 3ORZA 5FP6A 4OAUC 3WOWA 3VS5A 4I4EA 2PUUA 3FLYA 3TIYA 4JBOA 3UO6A 4CTCA 4OBQA 2YZAA 2WAJA 4FTQA 4PDPA 1E9HA 4E4XA 4EH7A 4EH9A 5M56A 2PUPA 2VWUA 2ITTA 5JGDA 4AAAA 4DN5A 3KVXA 3ANQA 3UPZA 2XEYA 3VUDA 4AZWA 3NUSA 4H3PA 5HCYA 5HBHA 4BZOA 2BRNA 4IAIA 4AZTA 5BNJA 3JUHA 2C68A 5EM6A 1R3CA 3PJ3A 1KV2A 4GK2A 4UV0A 3RCDA 4JDIA 2C6DA 4C33A 2XMYA 3ATTA 3VUIA 3TJDA 4MX9A 1ZZLA 1OZ1A 4ACGA 4E8AA 4W4VA 4C02A 2VN9A 4HGTA 4IB0A 1CSNA 2EU9A 4O7WA 3BGPA 4FEWA 2FYSA 3LE6A 2REIA 5LXMA 2GPHA 4LQMA 1IRKA 4WBOA 2HY0A 3E3PA 4CG8A 2XYUA 4O1PA 2BAJA 3GC7A 4ZY5A 4IDVA 4JX7A 3PJCA 5D12A 3OXTA 3E7OA 4BBEA 3F2NA 4DFBA 4FKLA 2R64A 1SNUA 1PYXA 4B0GA 2EXEA 2Y6MA 3CKWA 3FYJX 4H58A 1U54B 5CSPA 2YFXA 3G6HA 2RGPA 3KMWA 4DCAA 3HGKA 5B2LA 4JS8A 2BKKA 1M7QA 4TNDA 4OTQA 4Q9ZA 3G15A 4L7SA 3MTLA 2CDZA 2YHVA 3QLGA 4FKUA 1KUTA 3QD0A 1OKWA 1OL1A 3CY2A 1H1QA 5AWMA 3DKOA 2PVLA 4GU6A 4HJOA 3WZJA 4O81A 4FKTA 4L3PA 2R3LA 3GGFA 4E6CA 5CAVA 1ZY5A 3SGCA 2OK1A 5JFXA 3U8WA 5BVNA 3UNJA 2IZUA 4V0GA 4O0SA 3POZA 5B0XA 4BCHA 4JQ7A 3BU5A 3GFEA 1IEPA 5M08A 4XP3A 3TKUA 1ZAOA 4OTFA 3AD6A 4BB4A 4F63A 3ZLXA 3QTQA 4QYHA 5EI8A 4BCKA 2QOLA 2VTPA 3SW4A 4IEBA 2W96B 4L43A 3RKBA 4EHEA 4GFOA 2ZOQA 3QD2B 3UDBA 4YLKA 4RC4A 2YEXA 4A4OA 4L52A 4YTIA 4FK6A 1WBNA 1Z57A 3AC8A 2C0OA 2YIQA 4J97A 4D2VA 5L6WL 4R1YA 5ANEA 5IQEA 4KBAA 5HGIA 3W32A 3UOHA 5LMBA 2XK4A 3QHRA 5FQDC 1SVEA 2NRUA 3LFCA 3LFBA 2ONLC 4FGBA 4LL0A 4G1WA 4MXAA 5EDRA 5ETIA 3NSZA 4CQGA 3R7IA 3WI6A 2HELA 3OXZA 4TNBA 4YJRA 3PXYA 1JKLA 5BX0A 2PVJA 3Q9YA 4QMOA 3ACKA 2H6DA 3G0EA 3ANRA 5FTGA 2F2CB 2UW9A 3EQBA 4F7JA 4OTPA 4XG3A 4ZSEA 4BDJA 5IQAA 2WMRA 3SXFA 4PMMA 3VS6A 3CE3A 3BX5A 4JAIA 4RC2A 4BTFA 2GQSA 1JNKA 3DGKA 4FV3A 2GMXA 2VWWA 3FKNA 4WO5A 4DC2A 3SDJA 3LXPA 4ASZA 5JZJA 4X0MA 3TL8A 1QL6A 2IN6A 2XK3A 3QALE 3Q5ZA 3IDBA 2C6EA 2WTWA 4IM3A 4LUEA 4I0RA 4BWKA 5C01A 1YHSA 2I0YA 2V22A 1Q61A 1G8AA 4RZVA 4QMXA 3PVWA 3FI2A 1YHVA 5DWRA 4PNIA 4XV9A 5DG5A 4DE4A 4O83A 5J79A 5A6OA 4YMJA 1DI8A 1Q8TA 3RHXA 5EDQA 4D2RA 4IWDA 4RA4A 1UU3A 5CSWA 3CXWA 3P79A 2QOOA 3U6HA 4IWQA 4Y95A 4FA2A 2O5KA 1Q3WA 3VVHA 5C8KA 5JT2A 3A4PA 1YKRA 3BKBA 4YJSA 5BVEA 2Z2WA 5FXQA 5AIKA 1IA8A 4GEOA 1VYZA 1GZNA 2JIIA 4I6FA 5G1XA 3UIXA 5FXRA 5I9VA 4M97A 3IOKA 3QQKA 4BCOA 3R7EA 4C4IA 3MSSA 4YJQA 4AOIA 4Z7GA 3TNPC 2B53A 4ITIA 3R8MA 4F0GA 4GG7A 4H39A 3ZSHA 1LPUA 4JIAA 3UE4A 2X4ZA 4PY1A 2C3LA 4FV4A 3PSBA 4FNZA 1YI3A 4BKJA 4CEGA 3LFFA 3KXMA 4FSNA 4IX5A 1OPJA 4FKQA 5JFWA 2Y6OA 4O1OA 4GW8A 3C5UA 3MH2A 1G8SA 3RWQA 3CC6A 3QWKA 3R8ZA 2VGPA 2X39A 2CGWA 3FZRA 2BDFA 2QOCA 3CJGA 2J90A 4WOVA 1JPAA 2NP8A 1SMHA 5C1QB 4GT3A 5JQ8A 5CY3A 1FGIA 4YJOA 2UZBA 3FHIA 4UBAA 2C30A 2GDOA 1FMKA 1YDSE 4Y83A 5T3QA 3RGFA 4W9XA 3DB6A 5L8JA 1V0PA 3HMPA 1PXLA 1YWRA 3JS2A 4KKGA 5TR6A 3ZEPA 3TN8A 5K0XA 4GFGA 3V5LA 4XG4A 3R7VA 3CSVA 2FUMA 3U4UA 1H0WA 2PSQA 3LQ5A 3O50A 4GT4A 4QO9A 4UZHA 3WE8A 2XCHA 1XR1A 1BMKA 5AJQA 5C03A 4L9IA 4Q5EA 4BGHA 3R2BA 3V01A 3FZSA 3HP2A 3ZDUA 1TVOA 1M14A 3F5PA 3LM0A 4FYNA 4F09A 4L8MA 2E9OA 3EQDA 5A4CA 5CAPA 1BI7A 1Q8WA 2CHLA 3DDPA 4W4YA 4L3JA 3A7HA 4WRGA 4DAWA 4FTOA 4RG0A 4L68A 4U97A 4AW5A 4UYAA 2HZNA 2ZAZA 4X2FA 4XP2A 2W5AA 3AXWA 3QRKA 3FXZA 4FEXA 4DEIA 2Y8OA 3BU3A 1PKGA 3O23A 4F1TA 5D7VA 1ZLTA 4YZ9A 3ETAA 3OT8A 5KMIA 3K3IA 2HIWA 2IVVA 4GV1A 4MK0A 3VBXA 1Q24A 4C2VA 4LV5A 5M44A 3LKMA 3KVWA 2Q83A 4MBLA 1T45A 2OJ9A 4RIWA 5JZNA 3AC1A 2ZM4A 2A1AB 4O2ZA 2PZ5A 2EB3A 3FL4A 4GUEA 5EHLA 4ANQA 4C3FA 1ZMVA 4KIKA 4IVAA 2DWBA 3T9TA 3WILA 2BZIB 1OIUA 3AD4A 4RIXA 3TNQB 2R3RA 2C6OA 4AOJA 3OUKA 4IJPA 1MP8A 4FT3A 4FKWA 4FTAA 4HW7A 5IMXA 1KWPA 3V5TA 2IO6A 3PA4A 3EQCA 4X2NA 3RALA 5AAGA 5E91A 4JRNA 5EQEA 4FKSA 3MV5A 3RI1A 4BWXA 5CAOA 5J1WA 4NZWB 2OIQA 3PIZA 4XBRA 2PMIA 1ZOGA 1FPUA 2CJMA 4FOBA 2VTJA 3FI3A 4DG2E 1V0BA 5A6NA 2DYLA 1KSWA 4O7VA 4AZSA 4W9WA 3D2IA 4JQ8A 3NPCA 3NS9A 1BLXA 4M67A 3TZ7A 4JRVA 4QMUA 4C35A 5KHWA 3P1AA 3ORNA 3QC4A 4U40A 3VQUA 3R63A 3RPRA 4UMRA 1P14A 2GHLA 3F5UA 2XP2A 5CU2A 5HU3A 5AP3A 1URWA 4AZEA 2WMXA 4RJ4A 3ZUTA 4QTEA 3PY1A 1W0XC 2B1PA 3E5AA 3HMNA 4FL2A 3ZRLA 3MB6A 4M69A 3RNIA 3B2TA 4E6AA 4DBNA 3CGFA 1PXJA 3H0ZA 4PTCA 4D2SA 2W1FA 4DTAA 2HY81 3FPMA 3JY0A 2C4GA 2YJRA 1J1CA 1ZRZA 4QMNA 5CF4A 2C69A 2XIKA 3EL8A 3VS2A 4ZJIA 3ZRMA 4O6EA 5JN2A 3SVVA 1RE8A 5LMKA 3KN5A 4MWIA 3G33A 1XH8A 4X6RA 4C0TA 3ZYAA 2ZV7A 1FGKA 1YOLA 4A9TA 2H8HA 4LOPA 2QO7A 4FSQA 3RK7A 1ZWSA 3KRJA 2VD5A 2C5NA 4MNEB 3RZFA 1J7UA 4EJNA 3GQLA 5BYZA 5EYCA 2JLDA 4D5HA 5E9EA 2BAQA 5HVKA 2O64A 2XEZA 3QLFA 1DAWA 4DTBA 1XBCA 1YXTA 4UALA 1ZOEA 2VX0A 4KABA 3BRBA 2C1BA 4JVGA 2UW4A 4O7TA 3RTPA 4IIRA 4KBKA 1M7NA 2NRYA 3BHVA 5E8TA 3KXNA 4WBBB 3AMBA 4FK3A 1WMKA 3W8QA 2ITVA 3DBDA 2GQRA 5FDXA 3PY3A 5CWZA 5IH4A 4NM5A 3VF9A 4GJ2A 2YDJA 3C50A 4D1ZA 5KBQA 5J9ZA 4KB8A 3OCSA 5HO7A 1O6YA 4WKQA 5HCZA 4HVHA 4UWCA 1BL6A 1J7IA 3QX4A 3IW4A 1KE8A 4OUCA 1YRPA 4QRCA 2R9SA 3E63A 4C4HA 3V51A 3SW7A 5CEKA 4YC3A 1H1SA 4AS0A 4O27B 2VTRA 3RBWA 3ZLWA 4NKSA 3DV3A 2R3GA 4DGGA 4EC9A 3C13A 2IVSA 3CR0A 4YUQA 5JK3A 2BZJA 4DEBA 1CKPA 3R1SA 1V0OA 2HAKA 4FV0A 4FSZA 3MVJA 4JIKA 3MW1A 3DK7A 3R7YA 3OC1A 1X8BA 2CGUA 4USEA 3TUDA 4P5QA 4TWNA 2OH0E 3DQWA 5HORA 1XQZA 1A48A 3ZHPC 4J8NA 4RVTA 5HIEA 3EB0A 2OXXA 4A9YA 3A7JA 2OICA 3CQEA 2F7EE 2RFDA 4DHFA 5K0KA 3IQ7A 2UZLA 4MD9E 4AZFA 3L9LA 4A06A 4E4NA 1GOLA 3ORMA 3A8WA 3QX2A 4M3QA 5CU3A 3I7CA 3O17A 3AT4A 3TZMA 5AUUA 5JQ5A 3QGYA 4YNOA 5CALA 3M2WA 2UW5A 4MXOA 1MRVA 4F9WA 5EM5A 2RL5A 3OG7A 4C37A 2ETKA 3A7GA 3C4EA 4U6RA 5J1VA 2JIVA 2V7OA 1AQ1A 4RZWA 2QOHA 4BR3A 4ZAUA 3I5ZA 3SOAA 5EOBA 3WF8A 4HCUA 4RPVA 3ZO1A 3BWJA 4I5CA 3ODZX 3II5A 4CD0A 5LWMA 3EYGA 5IUIA 3QWJA 4R3RA 3UVQA 2ACXA 3BLQA 5JGAA 4DT9A 2UZVA 3UIBA 1STCE 2QU6A 2JD5A 3GQIA 3DAJA 4J1RA 2OBJA 4FSUA 4KS8A 4X2GA 2OXYA 2PULA 4YSMA 3QZIA 1FOTA 5ANGA 4L53A 2JKKA 4F1OA 1R0EA 2LAVA 3HZTA 4L45A 3WZKA 4CFNA 4OAVB 3ODYX 3OOMA 2X6EA 2JKMA 4MVFA 3VBTA 3UMXA 1H25A 3ZBFA 2IVUA 5EI2A 4IFGA 5DRBA 2OLCA 3DFAA 2X7OA 3QUPA 4R3CA 3ZDIA 4F99A 3EWHA 2UZUE 4QPMA 2ERKA 4FNYA 2YIRA 5JFSA 2EB2A 1PJKA 4I6BA 4S33A 3ZFMA 4ZXTA 2HW6A 4EOOA 5FEQA 3UGCA 1SYKA 3SX9A 3FY2A 3F3TA 5IQCA 5K3YA 5BUIA 1K2PA 3DBEA 3VS4A 3ZONA 2J0IA 5IA4A 4G3EA 5DYJA 4O0RA 2VX3A 5L3AA 4EHVA 2UZEA 3GCSA 3HMMA 1Y8YA 5G6VA 4C34A 2WQEA 4I20A 4S32A 3A7FA 2I40A 2VTSA 2VWVA 4KNBA 4ZOGA 3R83A 3VBWA 4BCQA 2XIZA 3SQQA 1FQ1B 1OKYA 4HYHA 4AN2A 1Q4LA 2PE0A 3BE9A 4ZSAA 3KXHA 4NFNA 4QPAA 2C5OA 4XBUA 4ACMA 4ACDA 4KRCA 5LJJA 3AC3A 2J0MB 4X21A 4XOZA 4EOJA 5GZ8A 2HW7A 5ACBC 3FAAA 2BRMA 3ENHA 3C4WA 4E4LA 4F0IA 4D4SA 1ZYLA 1V1KA 5CU6A 5HG7A 5KMOA 3RHKA 3GVUA 4CKIA 3G90X 4DFYA 3P78A 4FTLA 3WIGA 4EEVA 5CU0A 4G3FA 5L2SA 2GS2A 4A7CA 1ZXEA 3R21A 3V6RA 3Q4TA 3JY9A 4I94A 5AFVA 4BDAA 2OSCA 4EJ7A 5LWNA 2FSTX 4EQUA 2XZSA 2B54A 5AUXA 2BZKB 1PRYA 4A07A 1PKDA 2WTKC 4O7SA 3LOKA 3EH9A 5BPYA 4L67A 2R4BA 5HKMA 3KRRA 2VWXA 2B0QA 4BCIA 1U46A 5CT7A 2QOQA 3CY3A 4I4FA 3PXRA 4YC6A 4AX8A 4I1ZA 2JIUA 3ZSIA 3GOKA 5AMNA 4D9TA 1GY3A 4Z55A 5IMEA 5L4QA 1OBDA 4D2WA 4XG9A 3WIKA 3AT2A 4TT7A 3A99A 2UW0A 1I44A 2Z7RA 2FSMX 4XNEA 5F94A 1ZMWA 2QOKA 4W8DA 3R1NA 5DT4A 5E8VA 3SRVA 4IWOA 4XEYA 2XNNA 4OT5A 3GC9A 4WNMA 3VUMA 2C3IB 4QTBA 3HA8A 2WMSA 3BEAA 4AWIA 4DITA 3UPXA 2GNJA 3HV5A 2ITOA 3Q96A 1H26A 1OMWA 4QMYA 5AA8A 4FIHA 1SVHA 3EFWA 2Z8CA 2CPKE 3I81A 3OD6X 4G6OA 3LZBA 2CGXA 4FTIA 5KZIA 3RPVA 4QP2A 3MA6A 5L6OA 5HBEA 3KC3A 5FRIA 3D94A 3ZMMA 5HX8A 3V5PA 4I5MA 3EQPA 5KKRC 3GU5A 2AUHA 3HUBA 3D5XA 3GP0A 4CT1A 1A9UA 4Y8DA 3IO7A 3FXWA 4FKGA 4I23A 5D10A 5L2WA 1LEWA 3PUPA 4P5ZA 5JEBA 2PVRA 3AC2A 4YC8A 3QUDA 3P9JA 4Z7HA 4GCJA 2WU7A 2H9VA 4BF2A 3AOXA 4BI1A 2JDTA 3EN5A 3MH0A 3KF7A 2J50A 3RWPA 3CEKA 5CXZA 2OFVA 4C7TA 3D14A 4HPTE 4E93A 3E93A 5FTOA 4DEEA 4JBVA 1TQPA 4FV9A 2AYPA 4GG5A 2IZSA 3H3CA 2BDJA 2GNIA 2H96A 4KS7A 3FMNA 4DH7A 5IQGA 4AFJA 3OTUA 3BLRA 3PRFA 4LRMA 5KMLA 4P7EA 3HLLA 3LVPA 3QXOA 3VRZA 4BDGA 3UIUA 1F0QA 3DQXA 3DXNA 4YR8A 1CKJA 2WOUA 3D0EA 3NRMA 5A54A 5A4LA 4ZTSA 3C9WA 3PP1A 3QTUA 2ZV9A 4K0YA 3H10A 4YSJA 4HNFA 3PIYA 4AN3A 2CN8A 4IC7A 4FKIA 4X3FC 1OPLA 3UC3A 4R6VA 4KKHA 3DY7A 3ORIA 3BU6A 5AM7A 3K54A 2VO0A 2R0IA 3FMEA 3MFTA 1G5SA 2PZPA 5A9UA 3UZPA 4HGLA 3NVMB 3IKAA 4EL9A 2W4JA 4J71A 4LV8A 5LCJA 2QR8A 1XH6A 4E7WA 1DI9A 2QU5A 2EWAA 3R6XA 1XHAA 4LG4A 5I4NA 3R9HA 4RJ8A 1H4LA 4HVSA 4YTFA 4ALWA 5CEMA 4V0GB 3L8PA 4OTHA 3VWAA 4GL9A 2A27A 5IDNA 5J95A 3UQFA 2F4JA 3F3ZA 2WTIA 4FL1A 3FLQA 1ZYDA 3Q2JA 3Q32A 1QPDA 5EK7A 3KMUA 3SXRA 5E7RA 4CSVA 1UNHA 2OKRA 2P0CA 3CTQA 3HV6A 3E7VA 2J4ZA 3FI8A 4Y73A 2EUFB 3U54A 4KWPA 3G9LX 2BCJA 3R71A 4G3GA 2UVXA 1ZMUA 1BKXA 2QCSA 3LMGA 4EQMA 5H8EA 3POOA 3ZOSA 4BBMA 4DEGA 3C4FA 1WAKA 4JR7A 3BYUA 5ANJA 4MD7E 3I0QA 4HCTA 5DR6A 4R8QA 2XNEA 3OBJA 4FSYA 3BI6A 5D1JA 3RMFA 5I9ZA 2OU7A 3FQHA 3UZRA 5CSXA 4YHTA 3SA0A 3COIA 3C5IA 5H2UA 3N4UA 3ZO4A 2QHNA 3DBFA 2OXDA 3ZH8A 5DEYA 2YM7A 2VUWA 5FP5A 1NVRA 4MXXA 4G5JA 2UVZA 4RC3A 5IF1A 4AQCA 2DUVA 3E88A 1WBTA 2XNBA 3TKHA 1P5EA 2ITQA 3DTWA 1NXKA 2ITYA 2R7IA 3NUXA 5EM8A 4KD1A 3NUUA 5AP2A 3TEIA 1W84A 3DNDA 5BVDA 1JSUA 2VU3A 2X0GA 3S00A 1ZZ2A 3PVGA 4ZJJA 3Q6UA 4ITHA 4J96A 2NNWB 2PVKA 4M12A 3G2FA 2P3GX 4EWHA 4AE6A 4PTEA 3I6WA 4D28A 3PWDA 4BCJA 4D1SA 4H3QA 2ETMA 2YWVA 4DFUA 4ZTRA 4DFNA 2J7TA 3TV6A 2O2UA 4JLCA 1CTPE 4CRSA 4FIGA 5C4LA 4XCUA 3GENA 2VX1A 5ACKA 4G2FA 5DI1A 3MJ2A 5DFPA 3W1FA 2W5HA 3B8RA 5IA5A 3UNKA 2UW7A 4GU9A 4MYGA 1OECA 5HCXA 2BROA 4R7IA 1H24A 5CEQA 4CVAA 3NNWA 3HRBA 3DAEA 3RJCA 5HNIX 3QCSA 4TN6A 4CCBA 5CNNA 5HLWA 1NW1A 4RWIA 3MGYA 1ZOHA 4X6QC 4OW8A 5CI6A 2VGOA 4QP1A 5BUEA 3QTRA 1OUKA 1XH4A 4UYNA 4XLVA 5AUTA 3BHTA 2JITA 4DH8A 2EXMA 1W83A 3ELJA 5KBRA 2WMBA 3NAYA 5L2QA 3KK8A 2BPMA 3ZZWA 1LEZA 4E4MA 5E90A 3TM0A 1H1RA 2X6DA 2CSNA 3F88A 5DVRA 3LQ8A 3EN4A 4KRDA 4I22A 5DEWA 2X7GA 4D5KA 3U55A 4LUDA 3EOCA 3QTSA 5IKWA 4YJNA 4QMSA 2HZIA 3HP5A 2PTKA 4U0IA 4GS6A 3DLSA 3P7AA 4MD8E 5IU2A 1LR4A 1PMEA 1RW8A 2VWZA 3QYZA 5CI7A 3C0IA 5ETFA 2WHBA 3DCVA 4BDEA 5KMJA 4HPUE 3R8LA 4BBFA 1WCCA 5L2TA 1IR3A 5EFQA 1CM8A 2GS6A 3DPKA 4RLLA 5GJGA 4F9BA 1PMUA 3JR1A 4NM7A 4HYIA 1F3MC 3GCPA 4IH8A 4F4PA 5K4JA 5KNJA 3U51A 4IQ6A 5HIBA 2WZJA 1ZYCA 2OZOA 3CP9A 1TQMA 1H8FA 3RPYA 5LVMA 2YACA 3C7QA 4C8BA 1OKZA 3RPOA 4O0YA 4B9DA 4D2TA 4YNEA 3FJQE 5CLPA 3QTWA 3OF0A 3MFUA 3BZ3A 3VBYA 4DCEA 4YO6A 1MQ4A 2VWYA 4MBIA 4AE9A 3V04A 3UYSA 2GTMA 3QQGA 3ZM9A 5I0BA 4C3RA 2PHKA 4Y46A 3I79A 3FI4A 4R5YA 3N4VA 3W2CA 3Q4ZA 5FG8A 1FMOE 2JC6A 3PJ8A 4XLIA 2WTCA 2JDRA 4RIWB 4RA5A 3P86A 4M68A 2R3MA 4UZDA 5FLFA 4C61A 5H8BA 2WIHA 5FDPA 2UZWE 4U9AA 4RIOA 4HVGA 2OO8X 4ORKA 3NMUF 3GU7A 3OEFX 3QFVA 4RIXB 4D4YA 4IMYA 4QMPA 3QF9A 1J3HA 2W5BA 2I0HA 5B2MA 1CDKA 2LGCA 5C8MA 4KUJA 1ERKA 2OZAA 3KKVA 4ZLOA 4L42A 3H9RA 5AA9A 5AV4A 3QRTA 4NM0A 5GINE 2VO6A 5I3OA 1K3AA 1JAMA 3DFCB 2GFSA 3QCYA 3PDTA 1UU8A 2E9PA 3LLTA 4EOQA 2I0EA 4JXFA 2PL0A 3HV4A 2BHEA 3NIZA 2ONLA 4G3CA 3ACJA 4B4LA 4NH1A 4DH1A 4CKJA 3I7BA 2ZB1A 3CQWA 4O0UA 1WFCA 1ZYSA 3PVUA 1JWHA 5AR4A 2ITPA 2VTLA 3H9FA 4ALUA 3F2AA 3PTGA 4PMTA 5F4NA 4C4EA 2PY3A 4IAZA 3DOGA 5BVFA 4BDIA 4PF4A 2XKFA 4ZTNA 2A0CX 4M69B 3ZC6A 1SM2A 4QMTA 4FIEA 3VO3A 2OJJA 2PK9A 2W1IA 4MQ1A 2XB7A 4FNXA 2CKEA 4FV2A 4LL5A 1H1WA 2UV2A 5C9CA 3QUEA 2I1MA 4JX3A 5HU9A 1APME 4XX9A 1GZ8A 4FL3A 1H1PA 2CMWA 4EK3A 4TWPA 4P2KA 5M4CA 1H07A 3GU4A 3KU2A 4FIJA 4ZLYA 1GJOA 3ZM4A 4ASEA 3UG1A 4TY1A 4ANMA 3PXZA 4JOAA 3E92A 4QP7A 2W1CA 5EQPA 3BQCA 1R1WA 3KF4A 3WZUA 3VW6A 4EK5A 2QOFA 2ZB0A 5IEYA 4IANA 5GJFA 4LGGA 2YZLA 3MFRA 4WD5A 5CNOA 2IJMA 1S9JA 4RVKA 5HESA 3NDMA 3VS7A 3DK3A 3BWFA 3R9NA 2O3PA 3KXZA 5I9WA 3HRFA 3R02A 4YZCA 5CQUA 2IVTA 2WMUA 3CKXA 1NA7A 5IQHA 4S30A 1Z5MA 2O65A 2YIXA 3NUYA 4MWHA 5AUZA 3L9MA 4FTJA 3JXWA 4YBKA 4A9SA 2Q0BA 5D41A 5DGZA 3UTOA 3RAKA 2C47A 2CNQA 4XJ0A 3RAHA 4CMTA 5CASA 2O63A 3QHWA 4J52A 2PZRA 2KULA 2C6LA 2DS1A 3OWJA 4DG3E 3FDNA 3EN7A 2C3JA 3F2RA 4L3LA 2CLXA 1WBSA 2FSOX 3MY0A 4D55A 4M15A 2QOIA 1OIRA 4BTMA 4MXCA 1HCKA 5I3RA 3MN3A 3O8UA 3ORPA 1W8CA 4GKHA 3NAXA 3LFDA 4IX3A 3PSDA 4IJ9A 5HICA 2PVMA 3Q9WA 3RAIA 4O7YA 2JKOA 4TL0A 3HVCA 4BYIA 5JRQA 1JOWB 1KV1A 1H0VA 3TNIA 2QONA 2QVSE 4CFWA 5DMZA 1SZMA 3MI9A 2J6MA 3K5VA 3S4QA 3ZO3A 4GJ3A 4RX7A 4BWPA 2PE1A 2R3KA 3RM7A 3ROYA 4F6WA 5IG1A 4ZS4A 2BTSA 3FZPA 3MDYA 4BI0A 1Q8YA 3KB7A 2OF2A 3FEGA 3QA0A 4NCTC 3SAYA 4E6DA 3SG9A 3BCEA 4D4RA 1JKTA 5B2KA 3BPRA 4FKPA 3ALNA 4EKLA 4IZAA 1U5QA 2VO3A 5KX8A 1PMNA 3LJ0A 3HL7A 4NTTA 4W4WA 4Y72A 4IB3A 2GNLA 3OCBA 4IB5A 4IX6A 3KRLA 5CS6A 3VBQA 3NCGA 3BYSA 4O2PA 2JBPA 2B9FA 1K9AA 2RSVA 5FEEA 3D7TB 4DGNA 4CFXA 3ZXTA 4ZTMA 4R5SA 3R9DA 1YQJA 5AP5A 3QCQA 4EOMA 3Q6WA 3QL8A 4LRKA 3MTFA 5LQFA 2W0JA 4E5WA 4QMQA 5TT7A 3COHA 4ZSGA 3RVGA 2PVFA 4NIFA 4ZP5A 3UG2A 4JT3A 3VUGA 1WVXA 3AG9A 3JPVA 4FGRA 1Q62A 4BDDA 3KL8A 3OFMA 5DA3A 3N51A 3UP2A 3JVSA 3UOJA 2ETRA 3EFKA 1OL2A 2JBOA 3VS3A 3E64A 3ZRKA 4CYIA 4CT2A 3NGAA 2WB8A 4FODA 4FZ7A 2BILB 4W8EA 1Y91A 2OJIA 4F0FA 3VHKA 4GK3A 4YZMA 2E9UA 4Q5HA
chains in the Genus database with same CATH superfamily
3REPA 3AC5A 3FMLA 4KIQA 3R9OA 4AGWA 3QAME 2J2IB 2RG6A 1OITA 3FXXA 4YJTA 2W1EA 5CSHA 4U43A 2XRUA 3F3WA 4RX9A 4S34A 4YHFA 3UOLA 1PYEA 4GVAA 4QPSA 4ANNA 2HZ4A 2VNYA 3PE1A 4U41A 5A3XA 3TTIA 2O0UA 4BL1A 4DH5A 3KEXA 3W0SA 1E1VA 4NT4A 4QTAA 3G0FA 1XBAA 5CU4A 4XS2A 3PA3A 4YLLA 3PRIA 4PMSA 3FLNC 4U8ZA 4UXQA 5GJDA 4USFA 4CCUA 1IA9A 4L01A 2YM6A 3EIDA 4ANOA 3P4KA 1TKIA 3ZEWA 4QQ5A 2YA9A 4F9AA 4EQCA 1M2PA 4ANLA 2Q0NA 4EUUA 2ZDUA 4FKRA 3WYXA 2YCRA 3CTJA 2XVDA 2I6LA 3EKKA 4YZBA 4BRXA 4E26A 5A4TA 3OW3A 3BQRA 2SRCA 4O21A 3QKMA 4FBXA 3KREA 5JRSA 4HVDA 1OIQA 5F20A 2WNTA 4AP7A 2UUEA 4B6LA 4DFXE 5EKNA 4PP9A 1J1BA 2PZIA 4X7QA 3RZBA 4MBJA 5IQIA 5IA3A 5KMKA 3QQLA 4IE9A 4YGAA 5FGKA 2CGVA 5AV0A 5IQFA 3W0OA 3UYTA 3NNVA 4MKCA 2FO0A 5HE1A 3MESA 4RJ6A 1H28A 3F9NA 4FT7A 5LMAA 4R7BA 3Q04A 3DZOA 4QMZA 5DRDA 3PLSA 3WF6A 1KE6A 5IQDA 2PYWA 2VTQA 2YAKA 3MB7A 3P5KA 4FUXA 3CJFA 4JI9A 1KOAA 4EK8A 1E1XA 1XJDA 3W10A 2YITA 4O7RA 1JQHA 4E6QA 3ULZA 3EQGA 5J7BA 3TT0A 1A06A 5JSMA 4C57A 5HZNA 3HNGA 4PPCA 4AT5A 4BYJA 3AKJA 1PF8A 4CQEA 2JDOA 3IGGA 4QP8A 3ET7A 1UWJA 4ZSLA 3SRVB 3V8SA 4FKOA 5A4QA 3AGMA 2WQNA 4L00A 2XKDA 3P7CA 2XIXA 5L2IA 3QBNA 5BVKA 3LIJA 3U9CA 3OVVA 4I93A 2QNJA 4G6LA 4FG9A 5DR9A 3W2OA 5ICPA 4FC0A 2O8YA 4TZRA 4EH8A 1PMVA 3PPZA 3W2PA 4JNWA 1YVJA 2BKZA 5AP0A 4YP8A 3BE2A 1YOMA 2QO9A 4DA5A 3W55A 3NVKI 4HYUA 4LGHA 3ZBXA 2EVAA 2WOTA 4HGSA 4P4CA 3KULA 4HYSA 3DAKA 5DH3A 5CAQA 4FZAB 4O82A 4JL9A 4JDKA 4FZDB 2IZTA 1OPKA 4FSTA 3DT1A 3R00A 1SNXA 2X9EA 2I0VA 3PY0A 3VUHA 4S31A 5AUVA 2Y7JA 1Z9XA 4RIYA 3TI1A 2CCIA 4D1XA 4A9UA 5F9EA 5CANA 5ANIA 5D11A 4J7BA 4CLIA 5BQ0A 4L46A 3D5VA 2XUUA 4FTTA 4F64A 5CF5A 3TG1A 4CZUA 1GIIA 4NEUA 4AXAA 3L1SA 4XYFA 3RP9A 1OKVA 3FMDA 2Y4IB 4RJ5A 1M2RA 3LCSA 4FNWA 4J8MA 4L44A 3ZUUA 2YM3A 4IVDA 4II5A 2HWPA 3GOPA 3LQ3A 3H30A 2VTOA 3Q4UA 1XH9A 4KSPA 4I92A 2ZM1A 1MUOA 3FL5A 4FSMA 2RG5A 3QQUA 4F6SA 3LMIA 4G6NA 4R3PA 3KCKA 3DXPA 5AUYA 3BELA 5IA0A 5GIPE 2RKUA 3ZUVA 3COMA 5CZHA 3BEGA 5H3QA 1YDTE 1PXMA 3HDMA 2BTRA 3KK9A 3W16A 4B8LA 4K8AA 2YERA 3DBQA 4G5PA 4LYNA 4GYIA 5EI6A 3LXKA 3UC4A 4B99A 4EKKA 4KKEA 3RK9A 4L7FA 3R01A 2R0UA 4GIIA 4CMOA 2C6TA 3DXQA 3QU0A 4GH2A 4QMLA 2J51A 2QI8A 4JBQA 4JDJA 4ZTLA 3ZLYA 1UU7A 1CMKE 2ZJWA 4QTCA 3TUBA 2HZ0A 4DEAA 4YJVA 3FMKA 1CKIA 4O0TA 4CV8A 3Q52A 3TTJA 4OTDA 3FUPA 3GNIB 3W0MA 2CLQA 4MXZA 1G8JA 2VTTA 4LGDA 3UJGA 5AP6A 3PZHA 3SC1A 3L9NA 4D58A 2X81A 3HMIA 3DNEA 3ORTA 4C38A 4OBOA 2YWPA 4ZK5A 4DH3A 2C5YA 4M7IA 2XJ0A 5HD7A 4ENXA 4PL4A 1QPJA 3IK3A 4FV1A 3Q2MA 2C6IA 4FTKA 4N0SA 4B7TA 4FV6A 3UQCA 2IF8A 3MVMA 1O9UA 2YDKA 4RVLA 4FEUA 4UMUA 3DJ6A 5IH6A 1W82A 2QLQA 4KSQA 1XH5A 3M11A 4GVJA 3NYOA 5AAEA 2VAGA 2XYNA 4I0SA 3RCJA 3I6UA 1FBNA 3MVHA 4DLJA 2QODA 4I21A 5AR8A 4ACCA 4UMPA 2AEGA 1L3RE 4ZJVA 2X7FA 2C0IA 4GSBA 2YAAA 4QD6A 4QYGA 4WG3A 2PU8A 5BYLA 4LOQA 3IW7A 2OJFE 5HD4A 4D4VA 3TIZA 3NLBA 4NTSA 4JG7A 3VULA 4ZY4A 5HHWA 4R7HA 4TYEA 4RGJA 3O8PA 1HCLA 1REKA 1UVRA 2XS0A 5C26A 4QYFA 4RQVA 1UKIA 3OCGA 4O4CA 3NWWA 3CIKA 3ZFXA 4AGDA 3TUCA 4QQCA 2QKWB 4FSRA 3PPJA 1W2FA 1JBPE 2B9IA 2Y4PA 3ORXA 2UW3A 2P4IA 4KAOA 5HE0A 4BZNA 2R3PA 5JKGA 1DM2A 3BIZA 3ITZA 4FMQA 4KINA 5AP4A 1Q99A 5IEXA 5K4IA 1YW2A 3B2WA 2UZDA 1M2QA 4NSTA 3GFWA 4BCMA 3BHUA 3HA6A 3U9NA 4C2WA 5A4EA 4AA0A 4O4FA 4DHIB 1GAGA 3G6GA 2F7ZE 3FZTA 3QC9A 3ZXZA 4DINA 3HMOA 4C4GA 4EZ5A 3BBWA 4Z3VA 1OI9A 5C4KA 3MJ1A 4R77A 2B55A 5FBOA 3C4XA 3NNXA 3L8SA 3V5JA 4UN0C 3VONA 1KE5A 2GS7A 3A62A 4ZZOA 2WQOA 2AC3A 2JDSA 4IVBA 4UEUA 3TMOA 1O6LA 4FR4A 3LAUA 4O4EA 4TWOA 3R0TA 4DEHA 4TTHB 2QQ7A 3FMMA 4BJJB 3DJ5A 1U59A 2PWLA 2OJGA 4MF1A 4O4BB 3A7IA 2J0LA 3E87A 5EKOA 2W9ZB 2Z7QA 2QHMA 2WTVA 4Q2AA 2NYAA 4U44A 2YCSA 4PPAA 3F7WA 4ACHA 3W2RA 3FLWA 1W2CA 2ZYBA 3OZ6A 4TWCA 4JJRA 1BUHA 3GCVA 2CKQA 4QP4A 1YHWA 5CZIA 4N4SA 4O86A 3FY0A 3KQ7A 4QNYA 5E1EA 3ORLA 4QP9A 4EYJA 4PDSA 4FE2A 5TF9A 2C1AA 3LLAA 3RNYA 4F08A 3TDWA 4IZ7A 3U6IA 2G1TA 4IM2A 2X9FA 4MF0A 5DNRA 4CRLA 4X3FA 2JFLA 2OIDA 3BL7A 4D0XA 4FSWA 5EW8A 5CF6A 3LFSA 3H4JA 5I9YA 3LJ2A 4GIHA 5DT3A 3ORKA 4RWLA 4AU8A 2WELA 3F61A 4GYGA 1H01A 3CS9A 5F95A 5LVOA 5E8WA 1DS5A 3CGOA 3VIDA 2RFEA 1IAHA 5IQBA 3CPCA 3BYVA 3HECA 5HX6A 2G9XA 5FXSA 4FIIA 2V7AA 4G9CA 4N57A 4FI1A 5K5NA 3LHJA 3ENMA 4ANBA 4AXFA 3D9VA 4I6QA 4LOOA 4HVIA 4NFMA 3QTXA 1WVYA 5LVNA 1AGWA 4QYEA 4UWYA 5A46A 2CNUA 3PP0A 3E8DA 1YXUA 3GUBA 4APPA 3AMYA 4CKRA 2XK7A 4AZVA 2W9FB 3VAPA 3GU6A 1BYGA 1Y57A 4FIFA 4WNOA 3ZZEA 4BCNA 4HZSA 2ZMCA 3HEGA 4F1MA 4CGAA 2OZAB 3OP5A 1YI6A 3DLZA 2WQBA 4IXPA 3PA5A 4K2RA 1O6KA 3ZU7A 4GRBA 2B4SB 3EMGA 4ERKA 3UNZA 1YI4A 2UVYA 4NWMA 5H8GA 3E8NA 1BL7A 1YDRE 2QD9A 2WXVA 2VTHA 4FT5A 4FJVA 2ITNA 4PQNA 2BR1A 2ITWA 4RWKA 4NL0A 4CG9A 5T6KA 4N70A 2CKPA 1B6CB 4MNFA 1ST0A 3QRIA 3U6JA 3B8QA 4PX6A 3CD8A 2CCHA 4JQEA 4FTNA 5DOSA 3IPHA 4F70A 4UX9A 2QG7A 2V62A 3UODA 3R7UA 1WBOA 1H27A 2X4FA 3EHAA 4FG7A 2R5TA 4IM0A 2VZ6A 1W2DA 2W4KA 3VC4A 4RWJA 2YLEA 4WG5A 4IAYA 4AF3A 4FYOA 4RFMA 5FEDA 2FH9A 4NM3A 4DGOA 3UDTA 5HNBA 2PMNX 3Q60A 1PXPA 1KE9A 3F82A 4QMWA 4IW0A 5M55A 1GNGA 1ST4A 5TOZA 3DJ7A 4CMUA 3OY3A 3MY1A 2C5XA 2QO2A 3SHEA 1OGYA 1MQBA 1RJBA 2NO3A 4OTGA 4UMQA 4TRLA 5CENA 4IC8A 3QD4A 4TPTA 5E8SA 4ZZMA 3T3VA 3QZFA 2R2PA 2XNGA 2QG5A 2JEDA 3NNUA 3P08A 3CBLA 1UV5A 4A4LA 4C3PA 1RQQA 4FEVA 5EQYA 4FKJA 3P7BA 1OB3A 1Q3DA 3PPKA 3FZ1A 3WARA 4BGQA 2GNGA 2PVYA 3F3VA 3FV8A 3IS5A 2WFYA 2Y0AA 2R3NA 3OUNB 3IG7A 1QPEA 1U5RA 4TYIA 1UWHA 5KMMA 4AW0A 1NT2A 4EH2A 4RBLA 3HV7A 2V5QA 3IECA 1UNLA 1J7LA 3LM5A 1OM1A 5DPVA 3OTVA 5CVHA 5FD2A 3EQRA 2CN5A 2P55A 3OXIA 1R0PA 2F9GA 3IGOA 2C6KA 4O38A 2YM4A 3OMVA 1IAJA 4XG2A 3KIOC 2JFMA 4FX3A 2W99B 2VWIA 4U42A 1PXNA 4CZYB 3NYVA 4BDBA 4AXDA 3QRUA 4U45A 1PY5A 5AADA 1JVPP 4BN1A 4CXAA 2KTYA 2VV9A 4ITJA 4C36A 3DZQA 4EZ7A 2PPQA 3WZEA 3R1QA 2VTAA 5DHJA 4CTBA 4BDKA 2QOBA 2XNPA 3S95A 5TO8A 3EQIA 3P23A 4EWQA 3V8WA 5J5TA 4O0WA 2W17A 4JG6A 3UO4A 1BI8A 2YCFA 3FQEA 5AV3A 4BTJA 5JH6A 5FUTA 3O7LB 3KN6A 5AX3A 1G8KA 4WNKA 1PXIA 4AW2A 3A2CA 4CZTA 4ZLZA 3VNTA 5AV1A 3ULIA 3C0HA 4DT8A 2OFUA 3EZVA 3MFSA 5EYMA 4X3JA 4RX5A 4E5AX 4LI5A 3W33A 2YLFA 2AC5A 5LVLA 4PL3A 1H00A 5GIOE 4RFYA 1WBWA 4QP3A 5GNKA 2J5FA 4YZDA 4IADA 4AFEA 3BYMA 3I4BA 4TYHA 4KIKB 3VW8A 4R1VA 2GQGA 5M4FA 2FB8A 3W18A 2HENA 4BTKA 3NYXA 5LVPA 5GHVA 4XRJA 1PXOA 5E1SA 4ASDA 4EHZA 4QTDA 1Y6AA 2PVHA 4O7ZA 2W1HA 4RJ7A 1Y6BA 3WE4A 1SVGA 3ID6C 3O2MA 2RIOA 3MA3A 3NUNA 4NIFB 4ZTQA 2XNOA 2ZDTA 4FOCA 1UKHA 4OT6A 3DTCA 4NKAA 3TZ9A 2VO7A 3CPBA 4FUYA 1NVQA 2C0TA 1GZOA 5M53A 4XG7A 3LXNA 4LV7A 3Q5IA 4FV7A 3R7GA 3W8LA 2Z7SA 3LMHA 1Q97A 3DS6A 1OVEA 5KCVA 3DA6A 5AAFA 3TV4A 1H08A 2IWIA 3NYNA 5HG9A 5HEZA 4DFLA 2QURA 4O0XA 4EBWA 3MS9A 2IPXA 1QMZA 4A4XA 5IISA 5E92A 1W98A 5CTPA 4DTKA 4YJPA 4CYJA 3IDCA 3PXFA 3V5QA 2A98A 2XJ2A 2G2HA 3ZTXA 4NW5A 3MIYA 4ZZNA 5CEPA 3HDNA 3Q3BA 3QXPA 5A14A 4AA5A 2ZM3A 2DQ7X 4BCFA 5D7AA 4O7LA 4K77A 4O0VA 5EW9A 2B9JA 1JKSA 3PYYA 4J53A 4JBPA 4LM5A 4MEDA 4Y5HA 4BDFA 2WQMA 3FYKX 3QKLA 2YIYA 3HX4A 3KXXA 3LFQA 4QT1A 4CFVA 4U3YA 4MH7A 3FMJA 4V05A 4IWPA 3EQFA 5FBNC 3UOKA 5FM2A 2PUIA 3PXKA 2I7QA 4F65A 3M42A 4I3ZA 3OY1A 4Y85A 1ZARA 2WMWA 3OBGA 3OWPA 2OGVA 3MH1A 3QTZA 2X2LA 3R1YA 3HV3A 4GMYA 4BIBA 5J9YA 1GIHA 2RFSA 2XK9A 3R28A 2BMCA 5IDPA 3R2YA 1WBPA 4C62A 4O22A 3N9XA 4IAFA 3KCFA 5E8ZA 3SKCA 4DYMA 4PMPA 3MPTA 1IG1A 2WD1A 4I6LA 4ZTHA 3DKGA 3F69A 3NUPA 3W0PA 3WF9A 4N6YA 3T8OA 2VTMA 2XIRA 3UP7A 5CT0A 2GNFA 4Z16A 4AACA 3NW6A 5EDPA 4XG8A 4OTIA 3UIMA 3TNHA 4QQJA 4NU1A 5GZAA 4UMTA 4IZ5A 3F3UA 3MWUA 4ID7A 4IB1A 1U54A 3RPSA 1IASA 3C4CA 3P0MA 2R3JA 4WUNA 3VBVA 5H9BA 4G3DA 3VHEA 4C4FA 5CF8A 5JGBA 1OIYA 1OL6A 2F57A 3U87A 3AKLA 1GIJA 2OH4A 4V04A 1FINA 5CVGA 3GI3A 4AT4A 5E4HA 3EYHA 4F7LA 3E8CA 3E3BX 3MIAA 4FKVA 3IW8A 3I5NA 3MPMA 4RX8A 3D5UA 3MBLA 3NW5A 4QP6A 5HG8A 5F1ZA 4XP0A 3AGLA 5IUHA 2WO6A 2E9VA 5AV2A 3R8UA 5HQ0A 5AUWA 2JAMA 3TKIA 1REJA 2B7AA 4M14A 2FGIA 3S2PA 2BFYA 4JAJA 5HTCA 5IPJA 5ITAA 5BMMA 2HOGA 3G9NA 1Q8ZA 3VUTA 5I9UA 4PRJA 1OL7A 4RJ3A 5HTBA 3D4QA 4WSQA 4F6UA 3C1XA 3EFLA 2R7BA 5EG3A 4F7NA 1B38A 2VTNA 3LFEA 3R04A 3KA0A 4GUBA 5E8YA 4WHZA 3QTIA 2PE2A 4UB7A 3M1SA 5HE3A 1ATPE 2GTNA 1WVWA 3R8PA 3KULB 4BCPA 5IA1A 4UXLA 3BHYA 4NCTA 4BDHA 3VRYA 3VQHA 4JR3A 4BFMA 4H3BA 4WIHA 2X8IA 4FZFB 4ARKA 5HTIA 2Y9QA 3BHHA 4PTGA 3FZOA 4RIYB 4H05A 3GT8A 4DHJA 2GHMA 1W7HA 2XM8A 3A4OX 4L6QA 4PUZA 5EYDA 2EXCX 4G31A 3NEWA 4NW6A 3EKNA 1GZKA 2QC6A 4MXYA 5HIDA 4BICA 4ZIMA 3WBLA 3PXQA 3QRJA 1VYWA 3T3UA 5BYYA 1ND4A 3ROCA 5EM7A 2J5EA 2ITXA 2C5VA 5KO1A 3L8VA 4BKZA 2ERZE 2UZOA 5AP1A 5IEVA 5KHXA 4ZY6A 5HI2A 2WMTA 4EOSA 3VS1A 4EOIA 2W1ZA 2OI4X 2WEVA 3N4TA 1M17A 4CFUA 2BDWA 4DG0E 3LCKA 5LMKC 2XH5A 3OROA 3PVBA 4U81A 5CQWA 4APCA 2X1NA 4YZNA 4XHKB 2E2BA 4PV0A 5L6PA 1TZDA 1YXXA 2G2FA 4YPSA 4BIEA 2G15A 2GNHA 3COKA 4ANSA 4ZMEA 5IZFA 4AA4A 2C3KA 5AR2A 5C27A 1YXSA 5KZ0A 4BCGA 4HGEA 4NUSA 3PG1A 2PMLX 2GCDA 1Q41A 5CYIA 4FTCA 4DFZE 2ESMA 2W4OA 4RLKA 5AR7A 5AX9A 2XF0A 3H0YA 4I41A 3NIEA 5HE2A 2PUNA 2BALA 3F5GA 3FPQA 4W4XA 2X8EA 3HYHA 2BAKA 4NK9A 3TCPA 4J95A 4Y5QA 3NX8A 5I9XA 4NJDA 2YABA 5I5ZA 2PZYA 5KE0A 5M51A 2J9MA 2UZTA 3FLSA 3HAMA 3MH3A 5M57A 4FVQA 4MHAA 2J0JA 3EN6A 2F7XE 4PDOA 5CEIA 5B7VA 3O96A 4PWNA 5D9HA 3F7ZA 3FKLA 2W7XA 2GHGA 5HG5A 4PP7A 3DB8A 3MVLA 3QA8A 4IDTA 2IW9A 4UY9A 2X2KA 3KRXA 3SXSA 5M4IA 2XKEA 2W1GA 1XKKA 3BBTB 5K9IA 3W2SA 3VN9A 3AMAA 3QQFA 3ZO2A 4TW9A 4I6HA 5DN3A 4D2PA 4EOLA 3AC4A 5EHYA 2X0PA 3L8XA 4DF3A 3SD0A 4CV9A 2R3HA 3WZDA 2VTIA 1G3NA 5BVOA 3V3VA 2HYYA 1JLUE 4TXCA 4B8MA 5JFVA 1YWVA 4LMUA 3IONA 2YDIA 3O8TA 4FT0A 4CFFA 1L8TA 3AQVA 5JMSA 4M13A 2FVDA 4RVMA 2YIWA 1FVRA 4EONA 4FZ6A 2BRHA 2RFNA 2YM8A 2WU6A 3C51A 3NCZA 4Z9LA 2QLUA 5J9LA 1F5QA 1ZY4A 3QCXA 4KA3A 5DT0A 2GU8A 1OBGA 3CCNA 2B52A 4QMMA 3FHRA 3L9PA 3Q9XA 5BUJA 3R22A 2WTKB 2ITUA 1UNGA 3LFNA 1URCA 2UW6A 3UDZA 2A19B 3UQGA 4C4JA 2YISA 1FVVA 3PZEA 5EH0A 4FTUA 4USDA 4FV5A 3UZTA 4IX4A 4YU2A 4YURA 3WF5A 3R9RA 4EHGA 3IW5A 3R7OA 4YO4A 4WUAA 4AG8A 1NVSA 2XK8A 1QPCA 2HWOA 2BUJA 1QCFA 5CVFA 4U3ZA 1Q8UA 4E1ZA 3A8XA 1PXKA 1VEBA 3PWYA 4BHZA 3GB2A 2WPAA 2XCKA 1M52A 4CLJA 4BY9E 3O71A 2JDVA 4DGMA 2ZVAA 3KRWA 3K5UA 2PMOX 4RT7A 3NUAA 1R78A 4J99A 3VUKA 4KIPA 4H1MA 5KUPA 2X2MA 3D7TA 1JSVA 1ZYJA 3IOPA 2BIKB 5KKRB 4Q9SA 4ERWA 4R78A 4XMOA 4YTCA 3GBZA 2IW6A 3ATSA 2IW8A 3S3IA 2CNVA 4BHNA 3QD3A 3OOGA 4EK6A 3QKKA 4I24A 3MYGA 4ZEGA 5K5XA 5L8KA 3PJ2A 1B39A 5AR3A 4RMZA 5L8LA 3LFAA 4IACA 5BV3A 2XANA 2E9NA 4G34A 5IUGA 5IA2A 3F66A 5ETCA 3BGZA 4GKIA 1HOWA 2NPQA 2XA4A 4C58A 4M8TA 5LCKA 1XMMA 2W1DA 4K11A 3K2LA 2HXLA 3GU8A 1YOJA 2Z02A 4QNAA 1KE7A 3E8EA 1LP4A 4RSSA 1VJYA 3FWQA 3F6XA 2GFCA 3ALOA 1T46A 2BRBA 2WKMA 4J98A 4NJ3A 5M4UA 3TXOA 2BFXA 3I60A 3Q4CA 3ZFYA 2V0DA 3TWJA 4LMNA 5HOAA 4EOKA 3QGWA 3SV0A 5IH5A 3QZHA 4X3FB 3GC8A 2BHHA 3PE2A 3EJ1A 2ITZA 4KBCA 1OL5A 4U7ZA 4MTAA 4EBVA 4A9RA 4O91A 5CSVA 2WTJA 4AOTA 4AGUA 4X2JA 4O6LA 4I5HA 1PW2A 1LUFA 4LDTA 1FVTA 4MNEA 2VNWA 2HCKA 4O7NA 1JSTA 3EL7A 3PSCA 4QOXA 5EOLA 4BC6A 4DEDA 2P2HA 4FEQA 3GCUA 3THBA 3OCTA 3EFJA 3QQJA 2XNMA 4GT5A 4OTWA 4MCVA 3NW7A 1AD5A 3TJCA 3FMHA 3FSFA 4DBXA 2P33A 2ZV2A 4FVRA 1VR2A 5AR5A 3ZLSA 3IW6A 3JVRA 1WZYA 3MPAA 3UVRA 5E8UA 5HVJA 4FVPA 3OW4A 4XUFA 3F5XA 3RAWA 4NYEA 3C0GA 5ETAA 5EHOA 4D9UA 4EI4A 3OHTA 4AN9A 5ANOA 4M0YA 3VF8A 1S9IA 2IG7A 4E5BA 4E73A 1YXVA 3HUCA 3LJ1A 4OBPA 5AIRA 4M66A 4UWBA 3D7ZA 4X2KA 2QKRA 4CNHA 4XV1A 2YCQA 3CD3A 3D2KA 4ALVA 2JGZA 2OWBA 3PLAE 4M84A 4M0ZA 3AKKA 4IZYA 5LARA 4MQ2A 3O7LD 3PFQA 2OW3A 3FC1X 2H34A 5HO8A 3EQHA 3FBVA 4I0TA 2FSLX 2W05A 2B9HA 2WGJA 2WMAA 3EN9A 4ZS0A 4EH3A 3D5WA 3LW0A 3DDQA 3V8TA 3FKOA 1KOBA 3CTHA 3H9OA 4FT9A 4PL5A 4GFMA 3GCQA 4FG8A 2IZRA 3FC2A 1U4DA 2WMVA 2G01A 2G2IA 4EH6A 1UA2A 3HKOA 4KIOA 5AEPA 1MRYA 4P90A 5E8XA 4PDYA 3DU8A 4E3CA 2WEIA 3AD5A 4TKSA 4RFZA 3HRCA 3E62A 4G9RA 2X8DA 1OGUA 4IVCA 2BRGA 2XRWA 4EYMA 3IDPA 3RK5A 5GZ9A 3GC0A 4JG8A 5BMSA 4IHPA 4WA9A 3ERKA 5DLSA 3RINA 4QMVA 4D0WA 2Y4IC 3RM6A 4IAAA 1UU9A 4HNIA 4JDHA 4HCVA 4HZRA 3CLYA 5J87A 3I1AA 4K33A 2JAVA 4WG4A 5DIAA 4DGLC 1P2AA 2VRXA 3KFAA 1NY3A 4G17A 4IAKA 2XIYA 2XAMA 5FWKK 4FTRA 1XWSA 4U80A 3KY2A 3SOCA 2HXQA 1VZOA 3LCOA 2UZNA 1R39A 5DE2A 5HNGA 4YTHA 3R73A 3GXLA 2BIYA 5M07A 3VJOA 5ANKA 4TYGA 3SLSA 3UO5A 5HLPA 4F9CA 4V01A 2JKQA 3TACA 2YN8A 3G5DA 3WYYA 1TQIA 2WTDA 4GK4A 4N6ZA 1YWNA 4EZ3A 4YJUA 3O0GA 1OUYA 3ZC5A 2XM9A 5HO6A 4I5PA 4EOPA 1Y8GA 3AT3A 4AGCA 2WMQA 3S1HA 5CAUA 2Z7LA 2FA2A 3BV3A 3KGAA 3PJ1A 3Q9ZA 5J8IA 3VJNA 4BZDA 3DKCA 2F49A 3K3JA 4QQTA 2BZHB 3BGQA 4XH6A 4XOYA 5M06A 5FTQA 4OTRA 4U79A 5BVWA 3UVPA 4IBMA 5DR2A 2ZMDA 3R30A 5C8NA 1XH7A 4G16A 3I0OA 2X0QA 4F7SA 2A4LA 1PHKA 5TE0A 5EYKA 5KMNA 4BDCA 3FSKA 3SG8A 3C4ZA 4ASXA 3FE3A 3EZRA 3BLHA 2A2AA 4E20A 4EC8A 4K18A 5DBXA 4HOKA 5CXHA 4RQKA 3V5WA 1XBBA 2IEWA 3A60A 5EW3A 1BX6A 2V55A 5FM3A 4XRLA 4C59A 2XBAA 3D83A 2P2IA 3KMMA 4ZSJA 4ENYA 4LRJA 4DLIA 3PIXA 4YPDA 4MAOA 1JKKA 2UW8A 3QYWA 2CKOA 3U4WA 1MRUA 4O4DA 3NR9A 5AP7A 5CEOA 1DAYA 4PPBA 1I09A 3TV7A 3S0OA 4QYYA 5AM6A 3OEZA 3VS0A 4F9YA 4TYHB 3W2QA 4BI2A 5J5SA 1XO2B 3Q53A 4K6ZA 1Q5KA 4XG6A 4EUTA 3O51A 4CFMA 5J7HA 3A61A 3NZ0A 3D15A 4FTMA 3G51A 3LXLA 3KXGA 4YHJA 5LOHA 5M09A 4PNKA 2HK5A 2XBJA 5CX9A 3ZS5A 1EH4A 2PVNA 3WF7A 2OF4A 3OWKA 3QZGA 4BVUA 2RF9A 2YM5A 3OS3A 3QQHA 5TKDA 2GSFA 3ZCLA 4TYJA 2R3OA 2XJ1A 4WRSA 3TDVA 5ANDA 3W0NA 4AUAA 1P4FA 4OR5A 5HVYA 4FICA 3ZSGA 3BYOA 3W0RA 3FLZA 4FF8A 2J0KA 5HLNA 4LFIA 4EH5A 3R8VA 3OWLA 4EORA 3LCDA 2YJSA 2OIBA 2W06A 4BKYA 5HBJA 4EH4A 3GEQA 3LCTA 2WIPA 3TZ8A 4OLIA 3UMWA 1J91A 4BIDA 4O84A 4U5JA 3T9IA 3V6SA 3PG3A 4ONAA 4WT6A 1RDQE 4IFCA 2OG8A 3MY5A 4ZMFA 2Z60A 1P4OA 3DK6A 2VWBA 4K1BA 4BGGA 2R3FA 4OGRA 1WBVA 2BVAA 4WNPA 4YBJA 2QR7A 4XV2A 4XV3A 3HAVA 3DKFA 4EK4A 2C6MA 4FV8A 4WSYA 2ZV8A 4YLJA 4O96A 3LPBA 4AT3A 4S2ZA 5T68A 3UBDA 2XKCA 4AW1A 3JYAA 2R3QA 4K9YA 3OT3A 4RRVA 4H1JA