2ESMA

Crystal structure of rock 1 bound to fasudil
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
400
structure length
400
Chain Sequence
SFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-associated protein kinase 1
publication title The Structure of Dimeric ROCK I Reveals the Mechanism for Ligand Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 125
structure length 400
sequence length 400
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2esmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2esmA01
4FIFA 1ZMWA 2PUIA 2JAVA 4CZTA 3PUPA 4MKCA 2XVDA 3ZONA 3C5IA 4N57A 4C34A 3DTWA 5I0BA 4CG8A 4GFMA 3PPKA 4GU6A 2B9FA 4FIGA 2UW6A 3DU8A 2QO7A 3PLSA 5E8WA 1PXOA 4E6DA 5EI8A 4EZ7A 3HMPA 3VRYA 2C6TA 1IEPA 3NR9A 3D0EA 4G9CA 3NSZA 4X2KA 4CKIA 4E4MA 2ITWA 3D14A 1BI7A 2JIUA 3GEQA 5T68A 4AF3A 2CNVA 4LYNA 1RW8A 5DEYA 3RAHA 1ND4A 5AR2A 3RCDA 4QOXA 3EFJA 5M51A 4G5JA 1JKTA 3F2NA 1M7QA 2VD5A 3OXZA 3TM0A 1ZMUA 2BTRA 3PDTA 4O2ZA 3P4KA 2O8YA 4DYMA 5L2IA 2H9VA 3QTWA 5CS6A 3DBCA 5IUGA 2Z8CA 4MNEB 1CM8A 5C27A 2Q0NA 5FDXA 2BZJA 1Y8GA 2C47A 5HBJA 4A9RA 1Q8UA 2YZAA 5DRBA 4OUCA 4BF2A 4BCMA 4ERWA 2I6LA 4JS8A 5HIBA 2UW8A 4CFNA 4QQTA 5AUTA 5LVPA 4M3QA 3VUMA 5JMSA 4XG9A 2WXVA 2PZRA 3UGCA 4FK6A 3D4QA 1W98A 4OBOA 4WG3A 4GKIA 2W9ZB 4YBJA 4UZHA 1JBPE 4XBUA 4TTHB 3P7CA 2ITTA 1FOTA 4RQKA 4ZK5A 4D4VA 1Z57A 4ZY4A 3JR1A 3GU6A 3U87A 4ACMA 3C51A 4B8LA 5IH4A 2G2FA 5KKRC 4QP7A 4F70A 3HL7A 3U9NA 5CVGA 3QTXA 2V55A 4F08A 2F2CB 3QLGA 4QO9A 3C13A 4CTCA 5IH6A 1PXJA 4BL1A 3NYOA 1DS5A 4V0GB 2XBJA 4IB1A 5FBNC 1IRKA 3PWDA 2QKRA 3ZRLA 3SA0A 2AUHA 5TT7A 2GQSA 2Y7JA 4MF0A 4HPTE 4DFXE 5KKRB 4AA4A 2F9GA 4HVDA 3OUKA 3V8TA 4D9TA 3MH1A 3L8SA 2R3PA 4XRLA 1R3CA 5FEEA 4I5MA 4RVLA 2X9EA 3CGOA 5AMNA 1YXUA 5HG8A 4M14A 3ZZWA 2OWBA 1K3AA 3UIMA 4QQ5A 4DFBA 3ZRMA 5DT4A 3SHEA 4MF1A 3VUGA 5BYLA 4TN6A 1RDQE 2OZAA 4KRDA 3AMBA 4EH8A 4XV3A 3FI4A 3IS5A 3TUCA 3NVMB 3S95A 1W7HA 3VBYA 3GU7A 2CCIA 4DFUA 5BVNA 1ERKA 4NK9A 3NUYA 5H8EA 3SGCA 1ZYJA 3FY0A 3V6SA 1KE5A 4HPUE 4L67A 4JJRA 4H05A 4A4XA 5K4JA 4DT8A 2XK7A 2JGZA 2ZMCA 3HRCA 4OBQA 2X8IA 4IX3A 3BPRA 4PPAA 3ELJA 4HW7A 3DGKA 1OB3A 3RHKA 2JBOA 4IVBA 4R1VA 3FMMA 3OP5A 3RPVA 1JKSA 3ROYA 3DLSA 5IQDA 3ROCA 3I5NA 4D2RA 4WBOA 2R3MA 1WFCA 3VW6A 4L46A 4U81A 4G34A 3KEXA 4FTAA 5I9WA 4F99A 3NNVA 5DEWA 2P2IA 4IDTA 3FE3A 1H27A 4RT7A 3TWJA 3GU4A 1UV5A 2BAQA 3MIYA 5DE2A 3P9JA 4FTQA 5BX0A 2VX1A 4BKZA 2BVAA 3HGKA 3W8LA 3V5TA 2WTCA 4FV5A 2IVSA 2YDIA 3QU0A 4X0MA 4AG8A 5K5XA 4KIQA 1KOAA 4LRMA 2QOFA 4DGMA 4G17A 4W9WA 3ULZA 4XLIA 3F88A 4UALA 4LFIA 5JQ5A 1ZZ2A 2R3FA 3LCSA 2LAVA 5KZIA 4L3LA 3QWJA 4I6QA 3RPSA 4HJOA 4NU1A 3G5DA 3QCYA 1B39A 2NRUA 4RQVA 3MFUA 4BTFA 3VJOA 2QR8A 2PYWA 4YJNA 3AGLA 2A27A 3IDBA 2PMOX 2QO9A 3AC3A 4AT4A 3QFVA 4M8TA 4QP6A 4D4RA 5EYMA 4FT7A 2XIRA 4C61A 1Y91A 5GHVA 5CAOA 4OTQA 3UPZA 3FXXA 1DAYA 3PXRA 3O8PA 5HNGA 5E91A 4AZEA 3D7TB 4BCQA 2C5YA 2RFNA 3F6XA 4W9XA 5C01A 4AZTA 3PSDA 3PG1A 2J5FA 4HZRA 4FKRA 1AQ1A 4EWHA 4BBMA 3BRBA 2IZSA 1DM2A 4JAJA 5CVHA 3PSCA 1W82A 3QQJA 3BYVA 2IO6A 3V5QA 3BLRA 5AUVA 3LAUA 2B4SB 3GC0A 4L68A 3KXNA 2GS2A 2Z7LA 4IXPA 2ITYA 4OBPA 5AP4A 2Z60A 3W2QA 1A9UA 3FLZA 3H9RA 4QP3A 5KBRA 3NUAA 3BU5A 4P5ZA 1G5SA 4AS0A 4IB0A 2IW6A 3TG1A 1Q41A 3PE2A 1UA2A 2QLQA 4OTRA 3NYVA 3FSFA 4GIIA 4J7BA 4U45A 4GSBA 4ZP5A 2YABA 5FXSA 4BDEA 4E4NA 4F0GA 3UNKA 2C1BA 3QYWA 3DXQA 3UZPA 4KIKB 2IW8A 5BUJA 4BBEA 4DC2A 4O0WA 4GIHA 3NDMA 5CAVA 2Q83A 4DA5A 5I9UA 1YHWA 2VTTA 3VS3A 4FKGA 4C4HA 2B9JA 4BHNA 4D4YA 5M4FA 2C69A 2ETKA 1H07A 4RLKA 5C1QB 3MFSA 2BALA 2EXCX 1OIUA 4QTBA 2Q0BA 4QMQA 5LMBA 3QZFA 4MBJA 2UW3A 4J98A 5IA1A 1J7IA 3II5A 2ERKA 1P2AA 2XRUA 1H0VA 3QX4A 5HNBA 4K77A 2ETMA 3PP0A 2YHVA 3Q2JA 3OCGA 4GJ2A 4Q2AA 3NUSA 4D55A 3R8MA 5AAGA 4FSRA 1BKXA 3QD2B 1J1BA 4MD7E 3OS3A 4TWNA 4UV0A 2GNLA 2X6DA 3UVPA 5C8NA 2GFCA 2OJ9A 3H10A 4YJQA 5BYZA 4NFNA 4BDAA 4ZTHA 5K9IA 4FEXA 3QQKA 3G6GA 5I3RA 1GOLA 4TW9A 5HCXA 2YJSA 3TJDA 3FAAA 4UMTA 2OLCA 3CCNA 2W7XA 2XNMA 2E9PA 4MBIA 4QMLA 4B6LA 4FV8A 4JQEA 3ZSGA 3R8VA 2VNYA 4AOIA 5AP1A 3LXNA 3KRWA 4MEDA 3OY1A 1PYXA 3GNIB 2DQ7X 4BI0A 4GFGA 5HG7A 4ZMEA 4IWOA 2X4FA 4E6QA 3I60A 5LVMA 4O86A 2GHLA 5AP6A 5HO8A 3ZM4A 3GGFA 4L6QA 4M69A 1YXVA 4YZCA 4BCGA 4R3CA 4FR4A 5D10A 2R7BA 4XBRA 2OXDA 3QYZA 2Y8OA 4OW8A 5EI2A 4CLIA 4P2KA 5H3QA 3EL7A 3TACA 4C3PA 3S2PA 3CKXA 2PVHA 3Q6WA 3QUDA 1OPKA 4V04A 4CCBA 2YJRA 4E6AA 2QURA 2WNTA 3HUCA 3FHIA 4BCPA 3W2OA 3QALE 4FKQA 5AV3A 2ESMA 5BYYA 4J97A 5HOAA 3AG9A 3FMNA 4U42A 2BRNA 4D2VA 2PZYA 3DK7A 4LMUA 1V0BA 4DEAA 1YOLA 2Z7SA 4FI1A 5A4LA 3E8CA 3N4VA 4J52A 1NT2A 3OZ6A 3DKFA 5EM7A 3D94A 1Q62A 3OWJA 4DG0E 5HHWA 3DV3A 4EKKA 2PUNA 4FIHA 3PY3A 4TZRA 4O7SA 2C1AA 1OIYA 4I0TA 5EH0A 4C35A 3UIXA 3AC8A 3GQIA 1Q97A 5CNNA 5CU0A 4FE2A 5HE3A 5EHLA 3GP0A 4WRSA 2ITQA 3ATSA 4FL3A 2LGCA 2R3KA 2JBPA 3REPA 2IZRA 3ET7A 2FA2A 4DGLC 3HEGA 5BNJA 4D1XA 1ZMVA 4FV6A 1NVQA 3E93A 4PTEA 2OG8A 4U9AA 2ACXA 4HGLA 4XP0A 3RPOA 4ZAUA 4BDHA 4G31A 4GK4A 3A62A 1Q4LA 3DK6A 3GVUA 4IB3A 4BDGA 1P5EA 5E9EA 5ACKA 4D2PA 4DTAA 2ZV9A 3OHTA 3SOAA 3M1SA 4DG3E 3QWKA 1Q8TA 4LMNA 4ZSLA 2E9NA 4O1OA 4WG5A 1WBWA 1I44A 1UWHA 4EBVA 1W84A 3D9VA 2JAMA 5CI7A 4BB4A 5BVOA 5I9YA 1JSTA 5GJDA 5LCKA 5HTIA 5CVFA 3RVGA 3SRVB 5C4KA 3KULA 3OW4A 4WNOA 1FVVA 1CTPE 1Q61A 3A7HA 4RGJA 4XHKB 2R3HA 3VBXA 5FGKA 3A8XA 2XA4A 5E1SA 2A19B 4ACDA 3BE9A 1P4OA 4C2WA 2B1PA 2WMQA 3G90X 4ALVA 5AWMA 3Q5IA 4PL5A 5IQFA 2WEVA 2O3PA 3EH9A 4CQGA 4TYGA 1L3RE 2E9OA 4U5JA 4FT3A 4YJOA 2HAKA 3PVUA 4NIFB 4I0RA 4S31A 3HNGA 2C6KA 1SZMA 2KTYA 3BX5A 1W8CA 3LCDA 3R7IA 3UOLA 2R4BA 3ORNA 4XOZA 5HGIA 5IA4A 3DQWA 4O0RA 1PMEA 3I79A 2WQNA 2PSQA 3RINA 1PXPA 2NP8A 3VHKA 3UIBA 3Q4UA 1XH8A 4PDOA 5AIRA 3VHEA 2CPKE 3BGPA 3R2BA 2B7AA 3OXTA 5DG5A 4G3FA 1E9HA 3RHXA 3SXRA 4UMRA 1KOBA 1UWJA 5HX6A 3OBGA 4P90A 4KWPA 4LOOA 4H3PA 1TKIA 4GMYA 4CLJA 4H58A 5M56A 5IQHA 4FVRA 4S2ZA 4HCUA 3A7GA 3KXGA 3ZS5A 3GU8A 5AP5A 4FSYA 5EKOA 3Q6UA 1OUKA 3RMFA 2WZJA 3W33A 5CSWA 2R64A 2GNGA 4QTAA 4CV9A 4GFOA 4PRJA 1DI9A 3CD3A 3VBTA 4EWQA 3E8DA 2OZOA 3LM0A 3VF9A 3ZBXA 3G0FA 4D2SA 2RSVA 1MUOA 3EN7A 3BI6A 4C02A 3BHVA 1XBBA 2VWZA 3OT3A 4FKLA 4HNIA 4RIOA 4BCIA 3F9NA 4D58A 2BDJA 3VS4A 2P3GX 5FM3A 2P33A 3NYXA 5GJFA 4EBWA 4BKJA 1OL7A 3G0EA 3R1NA 1APME 4OT6A 5CQUA 1Q5KA 4TWOA 5DH3A 5DHJA 2HCKA 3MPAA 1YKRA 3RP9A 1H00A 4Y5HA 4M15A 3BHUA 5HVKA 3U6IA 3NIEA 4M0ZA 3CGFA 1H26A 4PPCA 5F4NA 1Y6AA 2BPMA 3E92A 3R1YA 2GPHA 4FSWA 2OI4X 4Y85A 5E8XA 3FHRA 3UVQA 3Q9YA 3WZUA 3TUBA 3NPCA 5HNIX 5M55A 2W5BA 1H1RA 3KCKA 2GNHA 4FOBA 4GYGA 3Q4ZA 4Q5HA 4EQCA 3ZUUA 5ETFA 1FBNA 3HUBA 4M97A 2PVNA 2V22A 3FXZA 1RE8A 3F66A 3I7BA 3UNJA 2WOUA 2XIZA 1WVYA 4V05A 4Y83A 1YI4A 2X2LA 3L8XA 2WIHA 3I7CA 5J5TA 3F3TA 2XEZA 3BBWA 3C9WA 3CQEA 2Z2WA 4CCUA 5BPYA 3WZEA 5FWKK 1JWHA 5DR6A 3ZEWA 5BVEA 3PA4A 4EJ7A 4FIEA 4IHPA 2CKOA 4XS2A 4N6YA 1Q99A 3K54A 4PTGA 2R7IA 4PPBA 1UKIA 2C6IA 4RZVA 2QU5A 3RAWA 1XH4A 4EOPA 2UZTA 3U55A 1H24A 1WBNA 2W1IA 1SNUA 4IAKA 1PKGA 3EQBA 2V7AA 3IOKA 4C4IA 4JRNA 4MVFA 5KCVA 3SOCA 5AAFA 5AR7A 5M4CA 4EYJA 4I92A 3PSBA 4ORKA 4FSTA 3R7UA 3I0QA 4TPTA 3WARA 4TYJA 4RWKA 3D2IA 3JUHA 4G9RA 3HV6A 1OGUA 4A9YA 1NVRA 3NNWA 4FNWA 4IM3A 2ZAZA 4PL4A 4QNYA 4BICA 3G2FA 3PJ8A 4U6RA 2XB7A 4FNZA 5F1ZA 3GOPA 3PY1A 2OIBA 1K2PA 4C0TA 2X6EA 3OUNB 4PDPA 4RIWB 4TYIA 4JI9A 4UWYA 4ZEGA 1H1QA 2VX3A 3QTRA 4FEQA 4HVSA 4FVQA 4O38A 2WPAA 4AZVA 2PK9A 4L3JA 2W1CA 4QMMA 4TKSA 4LGDA 4AGCA 5M07A 4UXLA 3SD0A 5AEPA 4DLIA 4DF3A 3DA6A 4TNDA 4EUUA 5K4IA 3NUPA 4HGTA 3RKBA 3MH2A 3LPBA 4AUAA 5AX9A 3HA8A 4XG7A 5CZIA 3ATTA 4ZS0A 1BYGA 5J8IA 4A9UA 4C57A 3C4ZA 4C62A 1PYEA 3KFAA 4JXFA 4RX5A 3MBLA 4JQ8A 3QTUA 4O27B 3EL8A 3V5PA 4BR3A 2YFXA 2PVRA 3ACJA 1ZRZA 4KKHA 4FV4A 4RIYA 3FI2A 3ALNA 1CDKA 5M53A 4GL9A 3R7OA 3SAYA 4I6HA 3IDPA 3BWFA 1Y57A 5BVWA 4CMTA 3HP2A 5HBHA 4ZY5A 3EJ1A 3PA3A 1PXLA 4MNFA 1PXMA 2ITUA 3R22A 4Z7HA 3QXPA 2W99B 2CKQA 2C5XA 2FSMX 4ONAA 1XR1A 2JIVA 3W1FA 2OO8X 4LUEA 4BTMA 4LRJA 1WBVA 4X3FB 1NW1A 2I0YA 2FGIA 3E8EA 3EN6A 3EOCA 4KKEA 1BX6A 3NWWA 1UU8A 5JGBA 2XRWA 1ZOHA 3L9NA 4ZJVA 1WBOA 3K5UA 3KGAA 2WQBA 5IEVA 1I09A 3F61A 3QXOA 4I5CA 3P08A 4FGBA 5CALA 2BIKB 4FTCA 3P7BA 3FMLA 3OVVA 1UNGA 3D2KA 4EHEA 1JQHA 2J50A 2VWUA 3FWQA 2ZV7A 1O6YA 1SYKA 1LUFA 1PKDA 2YCSA 4TYHA 5ANOA 4BCFA 3FLYA 2W5AA 1XQZA 2IN6A 4IEBA 3TXOA 2JITA 1ZXEA 4I0SA 4CXAA 5D12A 5L8KA 5M44A 2QD9A 1GIIA 1O6LA 3V3VA 3KULB 3EN5A 2PE2A 4BN1A 2F7ZE 1JKKA 4EI4A 3MTLA 5M08A 2CHLA 1TQMA 2GSFA 2QC6A 2WTWA 3B8QA 4C36A 1FPUA 3P7AA 4E7WA 5TR6A 4AGDA 3PXFA 5IDPA 3S4QA 1FVRA 3OC1A 3V5WA 5JFWA 4MXAA 4IJPA 3IW7A 5AM6A 5LWMA 2PZPA 3FMKA 3PXQA 4GUEA 5IKWA 1H4LA 2VTHA 5JK3A 2VX0A 5E90A 4AA0A 4HYSA 3MVJA 3CKWA 1LEWA 2CNUA 2X2KA 1Y8YA 3KQ7A 4WUNA 4QP4A 4K1BA 1OKZA 4R1YA 3GT8A 1XKKA 4BCKA 4LG4A 4D4SA 2J51A 1JVPP 3AMYA 4KIPA 3TZ7A 5C4LA 2JKOA 3R73A 4FKTA 4WKQA 3ZFYA 5E1EA 2ZDUA 3QZIA 4RLLA 4IDVA 2JDOA 3P5KA 4FL2A 4Y95A 3DXNA 2AC3A 5D7VA 1LP4A 2DYLA 4HZSA 2GU8A 5FLFA 4B4LA 3VS0A 3TNIA 4BDCA 5L6OA 3KK9A 5KMIA 4J71A 4DTBA 1FQ1B 2NO3A 3TZ8A 2C30A 4QMOA 4F7SA 4FKIA 1CMKE 3D15A 2UZUE 2CN5A 3KXMA 3CD8A 1ZY4A 3UOKA 4WSQA 2QLUA 4C2VA 4R7BA 1BL6A 2G9XA 3T9TA 3NRMA 2UVYA 4FKSA 5HU3A 2UW9A 1U54B 1XO2B 4F09A 3SVVA 4LM5A 2OJFE 2BIYA 4ZTNA 3WYYA 3P0MA 1OZ1A 3PE1A 3NW7A 4LUDA 5L2TA 3E7VA 2UV2A 3W55A 4PV0A 2QG5A 3L8PA 4L7SA 2QI8A 3VIDA 4F1OA 5CXZA 4QNAA 2W4KA 4YJVA 4L3PA 3C4WA 4RRVA 3RZFA 3FZTA 4FOCA 5EOLA 2HYYA 1WBTA 4M68A 3T3VA 5AUUA 5IU2A 3NUNA 3FLSA 4IFGA 3QF9A 4B7TA 4KIOA 2ZV2A 4EOSA 1CKIA 3FEGA 1JSVA 5CWZA 3ZXZA 3BQRA 3GOKA 3VWAA 5C26A 4IW0A 5AA9A 2A0CX 1WCCA 2WTIA 4FMQA 4FZDB 4FTTA 4JT3A 2NRYA 3ZRKA 4A7CA 3VC4A 5J7HA 4R6VA 2CSNA 3D5WA 3NX8A 2RKUA 4W4XA 5CT0A 5IMXA 2YZLA 5HTCA 2FUMA 3JYAA 1WVWA 2AYPA 4GG7A 4KABA 2C6MA 4CYJA 4IZAA 2HIWA 1NXKA 2BFYA 2VWIA 2BFXA 4U0IA 1MRVA 2GTMA 2EB2A 4FEVA 4QYHA 5ANGA 3IGOA 2X7GA 3UBDA 3PG3A 4ERKA 2C0OA 3OBJA 4PMTA 4YUQA 4BDIA 5D1JA 3HA6A 5HD7A 4BDBA 3F82A 3OXIA 2VTSA 1OI9A 1TQPA 3BIZA 3EKNA 1K9AA 3IGGA 4FSNA 4IVDA 4IWQA 4YJUA 3UODA 3BV3A 4AE9A 3AQVA 1CKJA 4O0VA 5AUXA 3UMXA 2R5TA 5E92A 4BDDA 4C3FA 4FT0A 4C4EA 2WHBA 1H25A 3L9LA 3PRIA 4YPDA 2VWXA 2YWPA 2ZM4A 2PMNX 5FUTA 3UTOA 1PMVA 3VRZA 3DAEA 1UVRA 2ITXA 5AIKA 4BY9E 4FTUA 3NVKI 2PWLA 2ZB0A 3O50A 4XG2A 3O23A 2GNJA 4TRLA 2XNGA 5DR2A 5HU9A 2OF2A 4IADA 3Q32A 5DI1A 3F3WA 4RC4A 4IFCA 4MH7A 3C4CA 4YJRA 3RCJA 3NGAA 1EH4A 4F9YA 4TXCA 4X2GA 5LJJA 4U80A 3NS9A 4QMUA 4X2NA 5IQIA 2YM5A 5E8YA 4TY1A 2UZNA 2HWOA 5FM2A 5M4UA 2F2UA 3RWQA 2YACA 3ZC6A 2FSLX 3FL4A 3FLQA 1URWA 3MB6A 4ANBA 3ORZA 3U51A 4NFMA 3OEFX 2REIA 4GUBA 4UY9A 4IBMA 1V1KA 3LXKA 4H1JA 3ZO4A 2WAJA 1W0XC 5DIAA 3RBWA 3E63A 4A4OA 2ITNA 5FRIA 3ACKA 2OFVA 3KXHA 3MH3A 3O96A 5E8TA 2IZUA 3G6HA 3SG9A 3QQFA 3BELA 3W10A 4C59A 5IG1A 5IA2A 4EH9A 5AA8A 4GT4A 4D1SA 4C33A 3F2AA 4GK2A 4QQCA 1SVGA 1JOWB 5EOBA 4D2TA 4FZ6A 4XMOA 3B2TA 3EZRA 3Q60A 3UO4A 3WOWA 5A4CA 3GCPA 2G2HA 3BBTB 1F3MC 3LCKA 4QYGA 3KCFA 4KRCA 5ANDA 4ZSGA 5JFSA 4LV5A 2C3IB 4QD6A 3LCTA 2O65A 3O51A 4O22A 3EFWA 5CENA 2XYUA 3BHHA 4MWHA 4TYHB 5E8VA 3R6XA 3QGYA 5AJQA 1M14A 3LFEA 5JEBA 2XKCA 4QPAA 5AM7A 3U6JA 2GMXA 4FKJA 3DTCA 3TTIA 2WEIA 2B9HA 1LEZA 5JFXA 4BTKA 2XM8A 4FT9A 3DKGA 3ZEPA 3LMIA 2BROA 3E3PA 3ZUTA 3QC4A 3CS9A 4XG3A 4EQMA 1GZ8A 1BI8A 2I0EA 2BMCA 2WKMA 3ZXTA 4USFA 4EOIA 4DAWA 4EOJA 2IG7A 4IWDA 3AMAA 3D7ZA 3OWLA 1Q3DA 5AP3A 3FQEA 3IOPA 5A46A 5LMAA 4RVTA 2OF4A 3DCVA 4NM3A 3VUDA 3F2RA 2UZLA 2BDWA 3PXKA 2BKKA 3SXSA 3M42A 4Z55A 3VO3A 5HCYA 5JFVA 4F0IA 3OFMA 4BHZA 2OXYA 4K18A 5GIPE 4DHFA 4BCHA 5L6WL 4BWKA 4S33A 1QMZA 1E1VA 5EQEA 4O7ZA 1XH9A 2XNBA 3TKUA 3A4OX 3F3ZA 2WMRA 1Q8ZA 3MY0A 3MPTA 4APCA 4CT2A 4H36A 4NYEA 1OPLA 3UYSA 5FDPA 4K9YA 4CMOA 4EK6A 2B54A 2FH9A 3CR0A 4O7WA 3E64A 4NKAA 4OAVB 3GC9A 3R7GA 4RIXA 4PDSA 4JOAA 5IA3A 4E4LA 3MA3A 4DFNA 3EQGA 3E8NA 5EW3A 1ZY5A 3BV2A 4BCNA 3LLAA 2JD5A 3E5AA 3IO7A 2PE1A 2W0JA 4XG8A 1SMHA 3DDPA 2GQGA 4B0GA 4RPVA 4FNXA 4OTDA 4YLKA 2P55A 5CY3A 3QRUA 4FTJA 3MJ2A 3PXYA 4QMTA 5GZ8A 5I5ZA 4B8MA 3LE6A 4RJ5A 5J5SA 2W1EA 2X0GA 4KUJA 5L4QA 1OL1A 2GHGA 1H1WA 2WMAA 2GS6A 4IJ9A 2R0UA 3IONA 1YWVA 4IB5A 2OH0E 2R9SA 4YHFA 4I6BA 5DRDA 4I6FA 4AT3A 1AD5A 1XHAA 4DLJA 3IK3A 3C4FA 5IMEA 5A6OA 3LFNA 3QTZA 1SVEA 3I6WA 3VUIA 3UQFA 1NY3A 2WU7A 1ZOEA 3NNXA 4MXZA 4OTWA 4XV9A 4E4XA 5A4TA 3NMUF 2XNNA 3TKIA 3WZKA 3ERKA 1RQQA 4ENYA 3FC1X 4QMYA 5JRQA 2J0IA 4ZY6A 3VQUA 2QG7A 2CNQA 4C38A 5ITAA 3TNWA 2KULA 2XS0A 3ORTA 3GB2A 2RG5A 4LOPA 3IW8A 5K0KA 3LQ3A 5IQEA 3HRBA 1GJOA 2WFYA 2WMBA 4LRKA 5L2WA 2I7QA 1UU7A 2Z7RA 3POOA 5FP6A 4JX7A 4RA4A 1IAJA 2X2MA 2UVZA 4L9IA 3R01A 5LXMA 3RWPA 4YTHA 5KZ0A 1FVTA 3KU2A 2PUUA 2VWBA 3DFAA 4EOLA 4AN9A 3ZLYA 3EHAA 3SC1A 4D1ZA 1J7UA 2OJIA 3QA8A 2Z02A 3FI8A 3TNPC 3LKMA 1M17A 4FTRA 5KMMA 4U79A 1A06A 3U4UA 1KE9A 3TT0A 4C4JA 3GQLA 5G1XA 4UEUA 3Q4TA 3UDBA 5IZFA 3UOHA 3LQ5A 3FUPA 2PVMA 4F7LA 5T3QA 4CV8A 4M0YA 1X8BA 2R3QA 1KV1A 2QOQA 4IQ6A 1R0PA 5C9CA 1PF8A 5F9EA 4Y72A 4YNOA 4FV1A 4L52A 4QRCA 3LIJA 4U7ZA 3D5XA 2V0DA 1PJKA 4FODA 3MWUA 4DGOA 4BDKA 4F9WA 4R78A 2W4OA 5KMKA 2X8EA 5HD4A 2A4LA 3O71A 3A7IA 3OTUA 4K6ZA 3TTJA 4PX6A 2HELA 3FYJX 4FUXA 4RFYA 3RK9A 3VS5A 1KE7A 5LVLA 4QTDA 4C4FA 4F9CA 1FMOE 4RWLA 3EN9A 3FZSA 5I3OA 3UZTA 5B0XA 4M66A 2Y6OA 2QNJA 4N0SA 5B2LA 2WGJA 3Q5ZA 2JDTA 3O7LB 4FBXA 3WI6A 3HMIA 3VBVA 1GZOA 1M2RA 3V04A 2F4JA 3Q2MA 2BAKA 2CGWA 4EKLA 1AGWA 2J0LA 2R3NA 2R3OA 4OR5A 3U4WA 5M4IA 4AACA 2UUEA 4EEVA 1BL7A 3CC6A 2GNFA 3DXPA 5EG3A 3DKCA 2C4GA 4BKYA 3R04A 1OBGA 5CU2A 5DA3A 4ANNA 2XP2A 4NW5A 3QGWA 2OZAB 3DZQA 2C5OA 3OG7A 4E20A 1GAGA 4O6EA 4CNHA 3EFKA 4UYAA 4F9AA 1H01A 4GJ3A 2JDRA 2UW0A 3Q9XA 4UYNA 4YLJA 3AT4A 3RGFA 4CFVA 4DCAA 5AUWA 1P4FA 4ZSEA 3ALOA 5EKNA 4EK5A 3LLTA 1PXKA 4MYGA 4ZTLA 3PVBA 3W18A 4FF8A 5HG9A 4O96A 3DY7A 5BUEA 2C6OA 5HG5A 3H4JA 4WA9A 4ACGA 2ZM3A 2C6LA 3KL8A 3PLAE 3HECA 2O0UA 3ANQA 4IX5A 3E7OA 3QHWA 5D11A 4PF4A 4DEDA 1YHSA 1Q8WA 5FEQA 1FMKA 2WTKC 4JAIA 1YWRA 3C0HA 4YHJA 1YXXA 4FZAB 3QRIA 3VS7A 2CJMA 5TOZA 3RK5A 4OTFA 3S1HA 1PMUA 4OGRA 2X7OA 1U5RA 2O63A 4BCJA 2FVDA 1OL6A 5D7AA 3NNUA 4E1ZA 5A6NA 3O0GA 4MX9A 3LQ8A 5HE0A 3ZDIA 3Q4CA 3DNDA 5I9ZA 4QT1A 5HBEA 2EUFB 5DOSA 2HZ0A 2YIQA 3R1SA 5AV4A 3F7WA 2VWYA 3UPXA 3JPVA 2ZM1A 3AT3A 4R8QA 4F1TA 3CPBA 3TNHA 4CQEA 4QMSA 4EH7A 2CN8A 3L1SA 4L45A 3HAVA 3ZMMA 1ZYLA 3A61A 2NPQA 3UP7A 4U40A 3G15A 2XYNA 4Y8DA 4YJSA 5JZJA 4I22A 2J0KA 2VO7A 4BZOA 2JKKA 3A7FA 4ASEA 4OTGA 2I1MA 2FB8A 5EDPA 2C5VA 3R00A 2VTOA 4TWPA 2W1HA 3BGZA 2PVKA 3MW1A 1OIQA 3QCXA 3HZTA 3R02A 4DGNA 1P14A 3BCEA 4I3ZA 2PL0A 3BLQA 4YHTA 4CRLA 4Q9ZA 4ZJIA 1Q8YA 4FA2A 4KBCA 3IKAA 2HK5A 1WMKA 5BVDA 1QPCA 2ZOQA 1XBCA 4RSSA 4RVMA 5AR3A 4EH6A 3LFAA 2HY0A 4NM5A 1L8TA 4F6SA 3B8RA 4W8DA 1IAHA 4L43A 3E87A 4P7EA 4DITA 1BMKA 1OUYA 1PXNA 1REKA 1WVXA 2OW3A 5TKDA 3GC7A 3VJNA 5CAPA 4WUAA 1WBSA 2ITOA 2OGVA 2H96A 2Y4IC 4MAOA 4RJ6A 4YLLA 5C8MA 1U59A 2B55A 2VV9A 4KB8A 4MTAA 4U3ZA 3BYMA 4KNBA 1FGIA 2G15A 4PY1A 3COHA 2UZBA 3C4XA 4EONA 5CSPA 4JG6A 3ORIA 4YGAA 3BQCA 4QMPA 1UNHA 4YBKA 3P1AA 3EN4A 3MJ1A 3T8OA 4B99A 2YAAA 3CY3A 3FKOA 1YDSE 4ENXA 3FMHA 4II5A 4WRGA 4JBQA 1M2QA 2A1AB 5B2KA 2YISA 4LL5A 4JRVA 5KMOA 3PYYA 2XCHA 4A9TA 3PVWA 5I4NA 2GDOA 3ZHPC 3PJ2A 5HO7A 3ZDUA 4ASZA 4ASDA 4FV0A 5EI6A 3W32A 3WE4A 5CF4A 2J5EA 4K8AA 1H8FA 3HVCA 5CYIA 4ZJJA 1R78A 5AR4A 3RPRA 3EFLA 3MY1A 4MQ1A 3U6HA 4JQ7A 2WTDA 3FZPA 1ZWSA 4E73A 1Q24A 2PZIA 1O6KA 3BZ3A 3MTFA 4FX3A 5LARA 4R5SA 4BDJA 3L8VA 4R5YA 4I4FA 5E8SA 2GCDA 5GNKA 4JDJA 2R3JA 4AZWA 2PUPA 4YNEA 1H28A 3NZ0A 3OWKA 2C3JA 4BGQA 3MESA 4FYOA 4G6LA 4AN3A 4I94A 3T3UA 3UE4A 4IH8A 4EH5A 2IVVA 2JEDA 4HCTA 1A48A 5DWRA 5T6KA 4E5AX 3LJ2A 3GCUA 4GK3A 4K11A 4BGHA 2FO0A 3L9MA 3MFTA 4BRXA 4BFMA 2XNOA 3QUEA 3RK7A 5DT0A 3PZHA 2OU7A 4AE6A 1OECA 3E3BX 2O5KA 2UZOA 5FXRA 4APPA 3R28A 4MXCA 1V0PA 4M69B 3I81A 4KS8A 4PMSA 4DEHA 2XK8A 1T46A 4FKVA 3UO6A 2QCSA 2VWVA 2IPXA 5TE0A 3V8WA 2VO6A 4PNKA 3UZRA 3MV5A 4QYFA 5J9YA 2QOHA 4HOKA 1ZYCA 3LM5A 4U3YA 3SQQA 4ZTRA 5D41A 3LFFA 5I9VA 5HI2A 4D9UA 2RF9A 2BZHB 3SXFA 3VQHA 2J6MA 5JH6A 1UU9A 2WQOA 5AUYA 2J0JA 4F4PA 3DB8A 3LFDA 4EYMA 3TZ9A 3RZBA 3AC4A 1R0EA 2RFEA 1VYZA 4BBFA 3ZLSA 3S3IA 4CGAA 4X6RA 2OKRA 3OCTA 5DPVA 4ANMA 4BIDA 1STCE 1LR4A 2FSOX 4AU8A 4WNMA 3KVXA 1YOJA 5CEIA 3WYXA 1WBPA 5H2UA 4KD1A 1JNKA 5HIEA 4XP2A 5JGAA 1PRYA 3K3IA 5EYKA 3QKMA 4JG7A 5HZNA 3PP1A 4OTPA 3AT2A 3DFCB 4QP9A 3H9OA 4V0GA 5JGDA 4TT7A 3ENHA 4GG5A 4RX9A 1MQBA 1ZYSA 4FVPA 4Y5QA 4I41A 4MD9E 4D5HA 2I0VA 2Y0AA 1Q3WA 2XUUA 4H39A 4DH1A 2FSTX 4FG9A 4CKJA 4O1PA 4U43A 5JSMA 4AWIA 4ANSA 2EXMA 3KKVA 5DGZA 4OAUC 3DBEA 2ZV8A 4KSPA 2PVFA 3HDMA 4NWMA 4UB7A 4NSTA 2WTVA 2YIYA 3R71A 3GFWA 2R3LA 2HW7A 4DEBA 2YWVA 4ZZOA 4NTSA 1WZYA 3QD3A 3HX4A 1XH7A 4O81A 2J2IB 2W1FA 4ZOGA 2BHEA 3QKLA 2OK1A 4YO6A 3NW5A 4E26A 5HLNA 3QKKA 4XJ0A 2YA9A 4W4YA 3SW7A 2XJ0A 2OIQA 1PW2A 2A2AA 5CTPA 4ZTSA 3VUHA 3NCGA 3VUKA 3DBQA 2YERA 2WMUA 3ZH8A 1VR2A 3FZ1A 3ZLWA 4FNYA 2UW4A 4PP9A 3HMNA 3I0OA 5ICPA 3QLFA 4G6NA 2WD1A 1ZLTA 4ZSJA 2QHNA 3QRKA 4MD8E 3VVHA 3W2PA 2OXXA 4PQNA 2VTLA 2YDKA 3Q52A 4QQJA 4G5PA 4IZ7A 5HVJA 2YM3A 3ZUVA 5CF8A 4J8NA 5J87A 2UZEA 4C58A 2JKMA 4FK3A 1GIHA 4RJ7A 3ORMA 4AAAA 5CLPA 2QVSE 4G3GA 5J1VA 3AC1A 3VS1A 5HEZA 4AW0A 2X7FA 4FG7A 1ZOGA 2VTQA 1JLUE 3BLHA 2OFUA 4BDFA 3LW0A 5L2QA 5EQPA 3DOGA 1J1CA 1BUHA 4GVJA 4GU9A 4I5HA 2YM7A 4I93A 3SDJA 3TKHA 3WIKA 3EZVA 4FV7A 4RBLA 2GHMA 3HKOA 3R1QA 4JG8A 5KNJA 4O7RA 4YTFA 2XBAA 3CEKA 1IASA 3QZHA 2H34A 4DN5A 4MWIA 3QRJA 4H1MA 4F0FA 3DZOA 1U4DA 4UXQA 4J53A 5AADA 2YM4A 2HW6A 2UVXA 3BE2A 4QYYA 1OL5A 2WTJA 5KE0A 3R9DA 5A54A 1CSNA 5JZNA 3A60A 3RNIA 1OIRA 1YWNA 5A14A 5EDQA 3CIKA 3JVRA 2JDVA 4IAZA 3GCQA 3TCPA 5BVKA 2VGPA 5LOHA 1U46A 4XRJA 1QCFA 5EFQA 3ORKA 5HE1A 2XEYA 4TYEA 2YIWA 3ZM9A 5JN2A 3F69A 3ITZA 1URCA 2IW9A 4ID7A 3O17A 3D7TA 3PXZA 2RIOA 1ATPE 4WNPA 3OMVA 2PMLX 3GU5A 4AFJA 3TIYA 4EZ3A 3TN8A 1NA7A 2F49A 2PE0A 4WD5A 3QZGA 4YZMA 4JBVA 3TDWA 5HKMA 4AZFA 1YXTA 4NKSA 2W9FB 2WQMA 2ZYBA 2BILB 4HYHA 4GKHA 4RFZA 1QL6A 3R7EA 4GCJA 5ETIA 2JDSA 1GZNA 3LXLA 1GIJA 4NW6A 3WF8A 4RWIA 4UMUA 5EW9A 1ZARA 4O0SA 5DMZA 3NW6A 2Y9QA 3HLLA 3GCVA 4FKWA 4QP8A 4O7VA 3QTIA 4FSQA 4AOJA 4FKOA 3MGYA 4XNEA 4QMNA 4QPSA 3FBVA 3ZO1A 4DT9A 4QTEA 4FTIA 4H3BA 3ZSIA 3CJFA 3FJQE 5FD2A 4DFLA 5CANA 2PVYA 3IPHA 4PMPA 3DKOA 3V01A 5CQWA 4RJ8A 4PUZA 3GI3A 3TJCA 3PJ3A 3DJ5A 4O82A 1BLXA 3CPCA 2C3KA 4YP8A 5C8KA 3ZO3A 3WF9A 1YI6A 2OJJA 3C4EA 4OTHA 3FQHA 4EHVA 4DEIA 4WHZA 5HCZA 5AV1A 4IC8A 2CGXA 3A8WA 4DH5A 3QC9A 4ALWA 4QMZA 3BYUA 4G3DA 1FINA 3LMHA 3E62A 1M7NA 2WB8A 4JVGA 2WO6A 4DE4A 1Z5MA 1E1XA 3R2YA 4FV9A 2HZIA 4WOVA 4CSVA 4EK3A 2CLQA 3EB0A 1VYWA 3QX2A 2BR1A 2XIXA 2C0TA 3MA6A 4IE9A 5KO1A 1TVOA 1G8SA 2IZTA 3PIYA 2W06A 3GBZA 4XG6A 5DLSA 4L01A 4I4EA 4K33A 2FYSA 2XNEA 4IAAA 4JBOA 4D2WA 4KBAA 3IECA 2BUJA 2W05A 4I20A 4WIHA 5H9BA 4TL0A 4P4CA 3G33A 3SV0A 4GEOA 3LFQA 4YC8A 3FPMA 1OPJA 4CRSA 2DS1A 2VZ6A 1PY5A 5FTOA 4CFWA 2VAGA 5KMJA 3TUDA 4IANA 2BTSA 2ITVA 3RAKA 3W2SA 1CKPA 4KSQA 3OW3A 3MDYA 2VU3A 4O91A 5ANIA 4O7YA 2WU6A 5CSHA 3N51A 4CKRA 3I6UA 2V5QA 2X39A 2YIXA 3AGMA 1HCKA 3CLYA 3CXWA 3H30A 2I40A 1B38A 2YAKA 4FTOA 4IZYA 4AXAA 4EQUA 3KK8A 3QA0A 5EHOA 4C3RA 3RALA 4BYJA 1YW2A 5D9HA 3AD5A 1QPJA 1REJA 3L9PA 2WMVA 2PY3A 3OCBA 2W1DA 3PVGA 4J8MA 1OKVA 4NM7A 4RIYB 5CU6A 3DQXA 4W4VA 4YTCA 3BEGA 3CY2A 4FICA 4BWXA 4YZNA 3SLSA 1S9IA 3R9RA 3EQPA 3IQ7A 5FP5A 3MI9A 4J95A 4XH6A 2QONA 2XCKA 5DBXA 2XIKA 4IM2A 2C0IA 5IDNA 3V5JA 1OM1A 4UWCA 4R3RA 3ZLXA 4W8EA 3WZJA 3FL5A 2QOLA 5E7RA 4XLVA 3FMDA 3PZEA 4YZDA 2Y6MA 3BGQA 3VBWA 4YZ9A 5B2MA 5LQFA 3HV7A 3QD4A 2HOGA 2C6DA 4FL1A 2HXQA 4O7NA 4EOOA 2ONLA 4XCUA 3CBLA 3EWHA 2XKFA 4JDKA 1ZYDA 3FXWA 4XUFA 3V8SA 1OL2A 3CQUA 3LOKA 3H0ZA 3OCSA 4HYIA 5CU4A 1J3HA 5DVRA 3DNEA 1WAKA 3OOMA 1HCLA 3DK3A 2XNPA 1TQIA 2VTAA 3VN9A 3VULA 2PZ5A 4XV1A 3Q53A 1RJBA 3F5XA 5IUIA 4D0XA 1J7LA 5AV0A 3OF0A 3RTPA 4Q5EA 2YN8A 4CEGA 3CP9A 3DJ6A 5L3AA 3AC5A 3FKLA 3GCSA 2IVTA 3FDNA 3S00A 1G3NA 3Q96A 3R8LA 2CGUA 3HRFA 1R1WA 4E5BA 4CZUA 5CEMA 2ITPA 1KV2A 1UU3A 4GYIA 3UO5A 4MBLA 2OBJA 5BMMA 3HV4A 2UW7A 5EDRA 3COMA 2UW5A 3NUUA 5ACBC 5A9UA 3GXLA 3F5GA 3ZTXA 5C03A 4ANQA 5AP7A 4FKUA 5CF5A 1S9JA 5CU3A 3PWYA 4YU2A 3SRVA 1QPEA 1T45A 3ZYAA 5CEKA 5LMKA 3OEZA 4XX9A 3VNTA 3RI1A 2QHMA 2G2IA 2WQEA 2BRMA 2X1NA 3C0GA 4YC6A 2RGPA 4YSMA 3WE8A 3FY2A 2O64A 5AP0A 2C3LA 3DBDA 4F1MA 5AFVA 4FEUA 2IVUA 3OY3A 3HDNA 2X4ZA 4KS7A 5AX3A 4BC6A 2VTRA 1ZAOA 5JQ8A 5F94A 5DYJA 4KKGA 4NCTA 4NIFA 3QTQA 4AP7A 2VWWA 4EC8A 1IR3A 2ITZA 4DFYA 3JY0A 3K3JA 2YLFA 2RL5A 3ORXA 3TIZA 5DT3A 4JR3A 3LMGA 3OD6X 5M06A 3KN6A 5HX8A 4J1RA 2V7OA 4YJTA 5IA5A 3UG2A 4ACCA 4O0YA 3MY5A 3HV5A 4BCOA 2QOIA 5CX9A 4E5WA 3C0IA 4AA5A 2R3RA 4RZWA 4QMWA 3JXWA 3KVWA 5A4EA 1GY3A 2OH4A 2OSCA 3QRTA 5E4HA 3Q04A 3BEAA 3ZZEA 5IEYA 5E8UA 5I9XA 1IG1A 4ZTMA 2XZSA 3PTGA 2YITA 4Y46A 4BI1A 3AOXA 2VTPA 2CKPA 3KMUA 3LFSA 4WNKA 3HMMA 3CTJA 2XM9A 3R9HA 3ORPA 3F3VA 2ZDTA 3JY9A 1MP8A 3QQHA 3UQGA 4R7HA 3IW4A 4FG8A 4KINA 3O7LD 1PHKA 1H1SA 1OVEA 2BCJA 4QP1A 5KHXA 3V6RA 4O7TA 4MQ2A 2GNIA 4ZZMA 3EKKA 3QAME 4OT5A 4A07A 3LFBA 4IAIA 3CTHA 3FI3A 4O6LA 2EB3A 3WZDA 4LOQA 4QYEA 4RJ3A 4HCVA 4QMXA 4Z9LA 1IA9A 4FC0A 2BRHA 4MHAA 4IZ5A 4C4GA 3FZOA 4IM0A 3ULIA 2RG6A 4JIAA 4M7IA 2HXLA 3HYHA 4U8ZA 5H8BA 3EQRA 4U41A 3DLZA 4I5PA 3PIXA 4U44A 3M11A 4UMPA 3HAMA 3KB7A 3MN3A 4RX7A 2ZB1A 3KMMA 4JX3A 3W2CA 4IAFA 5M57A 5GZ9A 4EORA 4Z16A 5FTGA 3LVPA 5J79A 2XJ2A 4ALUA 3U8WA 1YQJA 3EQCA 3A2CA 5GJGA 1JAMA 4ITHA 5HVYA 4IX6A 3BYOA 3POZA 2QR7A 4X21A 5CSVA 4IVCA 5HE2A 4CMUA 4BYIA 4HVGA 3IG7A 2BRBA 4JDHA 4ITJA 4MCVA 4USEA 3KMWA 3UYTA 2JC6A 2W17A 3QHRA 2C5NA 5DNRA 5CF6A 4CTBA 4EUTA 3F3UA 1UNLA 4Z3VA 4NT4A 4NJDA 3NEWA 2WMWA 2X81A 4P5QA 2XK6A 4V01A 3NCZA 3Q3BA 3MFRA 1G8AA 3PJ1A 4F7JA 3GFEA 3EQIA 4YJPA 3WF6A 3TV6A 2RFSA 4DTKA 3KXXA 3EIDA 3ZBFA 2YCFA 3AXWA 4RA5A 4W4WA 3R8UA 4F9BA 5K0XA 2WMTA 4NM0A 5JRSA 2OJGA 3KY2A 2WMXA 4Q9SA 3GENA 5ANKA 3EMGA 4IC7A 1OBDA 4C37A 1YDTE 3MVLA 1KUTA 2E9UA 3UMWA 3COIA 4DINA 4JLCA 5HO6A 2ZMDA 5BVFA 1M2PA 3HV3A 3TL8A 3KRJA 2XKDA 1QPDA 5CSXA 2CKEA 4AZSA 3DT1A 4FUYA 4F6WA 4IACA 3IW6A 5HORA 5CEPA 5FXQA 3I5ZA 4QP2A 4DH7A 4FTKA 4RIWA 4YZBA 2BZKB 2W4JA 1OITA 2QOBA 5IISA 3PPJA 4M67A 3R7VA 5J7BA 4AX8A 2CGVA 2UZVA 4I21A 5DN3A 3R7YA 3CQWA 4L7FA 4YMJA 1Z9XA 2HWPA 4EOKA 3ZU7A 4WSYA 5FEDA 3P86A 3RJCA 3Q9ZA 4O7LA 3MSSA 3PPZA 4CZYB 4DBNA 5B7VA 4EOMA 4ACHA 5LCJA 2B9IA 2UZWE 4FTMA 2XF0A 3C1XA 4S32A 2W1ZA 4FIJA 4QTCA 5J9ZA 2ONLC 4E3CA 4ASXA 3P23A 5JT2A 5L8LA 3LJ0A 3KRLA 2XK3A 3R8PA 5CI6A 1FGKA 4DEGA 4F7NA 2VNWA 2VRXA 5CT7A 4ZTQA 5G6VA 3N4UA 3OT8A 3IDCA 2F57A 4JDIA 1R39A 4D5KA 1SVHA 4CYIA 1M52A 2XMYA 4AGUA 2BRGA 4EH3A 3F5UA 4TWCA 5IQGA 4AW2A 3K5VA 2ETRA 3FKNA 3A4PA 3ODZX 1YRPA 3A7JA 2P2HA 3D83A 4NTTA 4RC3A 4MXXA 3V51A 3QQGA 2GQRA 4FGRA 4LGGA 3NYNA 4ZZNA 1KWPA 1MRYA 2H8HA 4G3EA 4D0WA 3BYSA 3WIGA 4X3FA 4EHGA 1HOWA 5AUZA 4QMVA 2YCRA 2Z7QA 3WF5A 3OWPA 3QD0A 4MK0A 3G9NA 4JL9A 4WT6A 3JVSA 4AFEA 3MYGA 5F20A 3VUTA 5IPJA 4ZLOA 3DDQA 1J91A 5J95A 1SNXA 3KF7A 1DI8A 4BGGA 4CFFA 4EL9A 2QKWB 1VZOA 2W1GA 4QPMA 2J9MA 5L8JA 3QUPA 1V0OA 4GW8A 2HY81 5LMKC 1OMWA 2R0IA 2IJMA 1UKHA 2WTKB 4BWPA 5HIDA 1H08A 5FG8A 3DBFA 2SRCA 3ETAA 3EQFA 4RC2A 1F5QA 4B9DA 3CSVA 4CG9A 5ETAA 5GINE 3VW8A 4X2JA 5EYCA 3UC4A 4YTIA 3Q9WA 4UZDA 3TDVA 4LGHA 5E8ZA 4O2PA 4NCTC 4RVKA 4C8BA 2G1TA 4FT5A 4O0UA 3ZSHA 2DWBA 3IW5A 4OLIA 5HESA 4RMZA 3W2RA 2HENA 2F7EE 2RFDA 1VJYA 3R0TA 3PIZA 3ZOSA 2J0MB 4UWBA 4CFMA 4YSJA 4L42A 5IF1A 1XBAA 4RIXB 3TEIA 4A4LA 4R77A 4LI5A 4PNIA 2VO3A 1JPAA 3BHTA 4IIRA 2ZJWA 2QO2A 3PFQA 3UQCA 2EVAA 5TO8A 3LFCA 1LPUA 3VAPA 4C7TA 4NUSA 4DFZE 2CDZA 4ZS4A 3CJGA 2WIPA 2PU8A 5BQ0A 2J7TA 5HICA 3NAXA 4JIKA 4ZXTA 5TF9A 2C68A 3HMOA 3DJ7A 3N9XA 4GRBA 4XG4A 3UNZA 5CAUA 4HGEA 4NEUA 2E2BA 4IWPA 2DUVA 2G01A 2XIYA 3FPQA 5K5NA 3ENMA 3TI1A 2Y4IB 4UMQA 4AW1A 4O0TA 3ZFXA 5HTBA 1U54A 5ANEA 4YURA 2XJ1A 3UG1A 1XWSA 3VS6A 2VTMA 3ODYX 4KA3A 5CXHA 3N4TA 4FZFB 3AD4A 4ZLZA 4YR8A 4K2RA 2WOTA 3FLNC 2W96B 1NVSA 4EZ5A 2YM8A 3C5UA 1YI3A 1PXIA 2BHHA 2V62A 3KC3A 4S30A 1PMNA 4ARKA 4ANLA 4X2FA 3H3CA 3FMJA 3MVHA 3DAJA 4DGGA 1IA8A 3QBNA 4O83A 3ZC5A 1Y6BA 3TZMA 4XYFA 3O2MA 4CFUA 4N4SA 3W8QA 4CD0A 4X3JA 5EM5A 4XOYA 3GC8A 3T9IA 4AOTA 4E6CA 2P0CA 4WO5A 3PY0A 2BDFA 4J99A 3BHYA 4AT5A 5F95A 4Z7GA 3WF7A 4BZDA 2OICA 4BIEA 3D5UA 4NJ3A 2X8DA 3R83A 3RPYA 5LVNA 3THBA 4CT1A 5J9LA 3BWJA 4K0YA 2R3IA 5EYDA 5LVOA 3QTSA 4ZIMA 3WBLA 5J1WA 3DAKA 2EWAA 1JKLA 2GFSA 3UVRA 5EQYA 2QU6A 3I4BA 5H8GA 5CASA 3FYKX 3FV8A 3NLBA 2BKZA 5A3XA 1VEBA 2QOCA 4PL3A 2OIDA 2PVLA 3PRFA 3B2WA 3R8ZA 5IH5A 5JKGA 2QOKA 2Y4PA 4EOQA 2CCHA 2J4ZA 4RFMA 4JNWA 4MNEA 5FBOA 3H9FA 3CE3A 3F7ZA 5EHYA 4FTLA 2PHKA 5CEQA 3RNYA 2HZNA 1ZZLA 2BAJA 3KN5A 5CNOA 2CMWA 3EYGA 3MVMA 5EW8A 3BU3A 5AAEA 3MB7A 4FTNA 5DFPA 4RJ4A 4FV2A 5IQAA 2NNWB 4JR7A 3UIUA 4PTCA 3C7QA 3VBQA 5CZHA 5KX8A 5KUPA 3ORLA 2PMIA 4L53A 3O8TA 5GZAA 4O84A 4NH1A 3KF4A 3QCSA 2JIIA 3FQSA 3LHJA 4KAOA 5DR9A 4DH3A 5IUHA 3FZRA 3MIAA 4LL0A 4NZWB 4CVAA 5HLWA 4I24A 4FSUA 5HQ0A 5AP2A 4M13A 3RM7A 2JLDA 5BUIA 4FZ7A 3F5PA 4UBAA 3ZCLA 2PPQA 4L00A 4LV8A 3MS9A 3HP5A 1YDRE 2J90A 4U97A 3A99A 3R21A 4PP7A 4FSMA 4Y73A 5HLPA 3TV7A 5CEOA 4BI2A 5KBQA 4J96A 2JFLA 4N6ZA 4G3CA 2XK9A 2PVJA 4HVIA 1B6CB 4ZLYA 3V5LA 4AGWA 4HVHA 2GS7A 4FKPA 4F63A 3ZO2A 2QQ7A 4X3FC 1YXSA 4XV2A 3UC3A 3FMEA 2YLEA 4G6OA 2O2UA 4IX4A 2JKQA 2VTNA 3I1AA 3LXPA 3WILA 3U54A 1SM2A 3SKCA 3RM6A 5L2SA 2QOOA 5IQBA 4DG2E 1H0WA 1O9UA 3R9NA 3MPMA 4IVAA 4EC9A 3C50A 4G2FA 2EU9A 2YIRA 3H0YA 2E9VA 1GNGA 5EM8A 2B0QA 2VTIA 3CTQA 3QQLA 4FSZA 2VTJA 4AQCA 4EHZA 4M84A 2JFMA 3KA0A 3TNQB 4UX9A 3EQHA 2AC5A 3QCQA 4F6UA 1KE6A 3LJ1A 2GTNA 4FYNA 4L44A 4BTJA 3AC2A 4PWNA 2IWIA 3DS6A 4IMYA 1U5QA 4A9SA 4LQMA 4X6QC 4GVAA 3ZFMA 1YHVA 3BKBA 3UP2A 5CAQA 3LCOA 2F7XE 2X9FA 4GT3A 5ETCA 4R7IA 3KXZA 4FIIA 2ERZE 3AD6A 1OKYA 3DB6A 3PA5A 4XP3A 4DBXA 4DH8A 4ITIA 3NAYA 4YC3A 4OTIA 1H1PA 4GV1A 2I0HA 5AV2A 4IAYA 4YO4A 2CLXA 2ZVAA 3O8UA 1OKWA 4PMMA 4ANOA 1KE8A 3M2WA 1MRUA 4USDA 2R2PA 4KBKA 3OTVA 2B52A 3COKA 3K2LA 3RAIA 4GS6A 3NIZA 4I23A 3ID6C 2C6EA 3GUBA 4UN0C 5KMLA 2VGOA 4E93A 5KHWA 3R30A 5L6PA 3S0OA 3KRRA 4E8AA 2UZDA 3EYHA 3P78A 3BU6A 2QODA 4N70A 4O0XA 5ANJA 3E88A 1DAWA 3U9CA 3VF8A 1GZKA 4EJNA 4NL0A 3OOGA 4I1ZA 1F0QA 4S34A 1MQ4A 4RWJA 3FSKA 3SW4A 5FTQA 3VS2A 2W5HA 4GH2A 4MXYA 4BVUA 4CFXA 1KSWA 2YM6A 4A06A 3UOJA 5FQDC 4XEYA 2XKEA 3DPKA 5IQCA 2BZIB 1JSUA 4WG4A 4RG0A 1W83A 2EXEA 4AW5A 2HZ4A 3KREA 2XH5A 4HNFA 4EK4A 5IEXA 3R9OA 3NUXA 4DEEA 5K3YA 5EM6A 4AN2A 1XH6A 5EK7A 4H3QA 3QL8A 3JS2A 3KRXA 3QQUA 4TNBA 3OROA 4GT5A 3FC2A 4G1WA 1YOMA 2PULA 3MH0A 4BIBA 4JBPA 5LWNA 3ANRA 4EH4A 4ZSAA 4HGSA 4YPSA 4DCEA 3EQDA 4ZMFA 2VN9A 2VUWA 3LZBA 1YVJA 4L8MA 3W16A 2YEXA 4F65A 3D5VA 3PJCA 5BMSA 1XJDA 3TV4A 3SG8A 3G51A 2WMSA 4KIKA 2XK4A 4F64A 5KMNA 3G9LX 5IA0A 4D28A 4HYUA 1XH5A 2R3GA 2H6DA 3FLWA 4BZNA 2P4IA 5A4QA 4PDYA 4EK8A 2YDJA 5AR5A 4EH2A 3R63A 4M12A 4O21A 2PTKA 4FEWA 4G16A 5M09A 3UJGA 2WELA 2VO0A 4FV3A 5AR8A 4MXOA 5GIOE 4X7QA 3SX9A 3P79A 4R3PA 4RX8A 4WBBB 2B53A 2YCQA
chains in the Genus database with same CATH superfamily
4FIFA 1ZMWA 2PUIA 2JAVA 4CZTA 3PUPA 4MKCA 2XVDA 3ZONA 3C5IA 4N57A 4C34A 3DTWA 5I0BA 4CG8A 4GFMA 3W0RA 3PPKA 4GU6A 2B9FA 4FIGA 2UW6A 3DU8A 2QO7A 3PLSA 5E8WA 1PXOA 4E6DA 5EI8A 4EZ7A 3HMPA 3VRYA 2C6TA 1IEPA 3NR9A 3D0EA 4G9CA 3NSZA 4X2KA 4CKIA 4E4MA 2ITWA 3D14A 1BI7A 2JIUA 3GEQA 5T68A 4AF3A 2CNVA 4LYNA 1RW8A 5DEYA 3RAHA 1ND4A 5AR2A 3RCDA 4QOXA 3EFJA 5M51A 4G5JA 1JKTA 3F2NA 1M7QA 2VD5A 3OXZA 3TM0A 1ZMUA 2BTRA 3PDTA 4O2ZA 3P4KA 2O8YA 4DYMA 5L2IA 2H9VA 3QTWA 5CS6A 3DBCA 5IUGA 2Z8CA 4MNEB 1CM8A 5C27A 2Q0NA 5FDXA 2BZJA 1Y8GA 2C47A 5HBJA 4A9RA 1Q8UA 2YZAA 5DRBA 4OUCA 4BF2A 4BCMA 4ERWA 2I6LA 4JS8A 5HIBA 2UW8A 4CFNA 4QQTA 5AUTA 5LVPA 4M3QA 3VUMA 5JMSA 4XG9A 2WXVA 2PZRA 3UGCA 4FK6A 3D4QA 1W98A 4OBOA 4WG3A 3PUFC 4GKIA 2W9ZB 4YBJA 4UZHA 1JBPE 4XBUA 4TTHB 3P7CA 2ITTA 1FOTA 4RQKA 4ZK5A 4D4VA 1Z57A 4ZY4A 3JR1A 3GU6A 3U87A 4ACMA 3C51A 4B8LA 5IH4A 2G2FA 5KKRC 4QP7A 4F70A 3HL7A 3U9NA 5CVGA 3QTXA 2V55A 4F08A 2F2CB 3QLGA 4QO9A 3C13A 4CTCA 5IH6A 1PXJA 4BL1A 3NYOA 1DS5A 4V0GB 2XBJA 4IB1A 5FBNC 1IRKA 3PWDA 2QKRA 3ZRLA 3SA0A 2AUHA 5TT7A 2GQSA 2Y7JA 4MF0A 4HPTE 4DFXE 5KKRB 4AA4A 2F9GA 4HVDA 3OUKA 3V8TA 4D9TA 3MH1A 3L8SA 2R3PA 4XRLA 1R3CA 5FEEA 4I5MA 4RVLA 2X9EA 3CGOA 5AMNA 1YXUA 5HG8A 4M14A 3ZZWA 2OWBA 1K3AA 3UIMA 4QQ5A 4DFBA 3ZRMA 5DT4A 3SHEA 4MF1A 3VUGA 5BYLA 4TN6A 2XARA 1RDQE 2OZAA 4KRDA 3AMBA 4EH8A 4XV3A 3FI4A 3IS5A 3TUCA 3NVMB 3S95A 1W7HA 3VBYA 3GU7A 2CCIA 4DFUA 5BVNA 2AEGA 1ERKA 4NK9A 3NUYA 5H8EA 3SGCA 1ZYJA 3FY0A 3V6SA 1KE5A 4HPUE 4L67A 4JJRA 4H05A 4A4XA 5K4JA 4DT8A 2XK7A 2JGZA 2ZMCA 3HRCA 4OBQA 2X8IA 4IX3A 3BPRA 4PPAA 3ELJA 4HW7A 3DGKA 1OB3A 3RHKA 2JBOA 4IVBA 4R1VA 3FMMA 3OP5A 3RPVA 4AXDA 1JKSA 3ROYA 3DLSA 5IQDA 3ROCA 3I5NA 4D2RA 4WBOA 2R3MA 1WFCA 3VW6A 4L46A 4U81A 4G34A 3KEXA 4FTAA 5I9WA 4F99A 3NNVA 5DEWA 2P2IA 4IDTA 3FE3A 1H27A 4RT7A 3TWJA 3GU4A 1UV5A 2BAQA 3MIYA 5DE2A 3P9JA 4FTQA 5BX0A 2VX1A 4BKZA 2BVAA 3HGKA 3W8LA 3V5TA 2WTCA 4FV5A 2IVSA 2YDIA 3QU0A 4X0MA 4AG8A 5K5XA 4KIQA 1KOAA 4LRMA 2QOFA 4DGMA 4G17A 4W9WA 3ULZA 4XLIA 3F88A 4UALA 4LFIA 5JQ5A 1ZZ2A 2R3FA 3LCSA 2LAVA 5KZIA 4L3LA 3QWJA 4I6QA 3RPSA 4HJOA 4NU1A 3G5DA 3QCYA 1B39A 2NRUA 4RQVA 3MFUA 4BTFA 3VJOA 2QR8A 2PYWA 4YJNA 3AGLA 2A27A 3IDBA 2PMOX 2QO9A 3AC3A 4AT4A 3QFVA 4M8TA 4QP6A 4D4RA 5EYMA 4FT7A 2XIRA 4C61A 1Y91A 5GHVA 5CAOA 4OTQA 3UPZA 3FXXA 1DAYA 3PXRA 3O8PA 5HNGA 5E91A 4AZEA 3D7TB 4BCQA 2C5YA 2RFNA 3F6XA 4W9XA 5C01A 4AZTA 3PSDA 3PG1A 2J5FA 4HZRA 4FKRA 1AQ1A 4EWHA 4BBMA 3BRBA 2IZSA 1DM2A 4JAJA 5CVHA 3PSCA 1W82A 3QQJA 3BYVA 2IO6A 3V5QA 3BLRA 5AUVA 3LAUA 2B4SB 3GC0A 4L68A 3KXNA 2GS2A 2Z7LA 4IXPA 2ITYA 4OBPA 5AP4A 2Z60A 3W2QA 1A9UA 3FLZA 3H9RA 4QP3A 5KBRA 3NUAA 3BU5A 4P5ZA 4I6LA 1G5SA 4AS0A 4IB0A 3AKJA 2IW6A 3TG1A 1Q41A 3PE2A 1UA2A 2QLQA 4OTRA 3NYVA 3FSFA 4GIIA 4J7BA 4U45A 4GSBA 4ZP5A 2YABA 5FXSA 4BDEA 4E4NA 4F0GA 3UNKA 2C1BA 3QYWA 3DXQA 3UZPA 4KIKB 2IW8A 5BUJA 4BBEA 4DC2A 4O0WA 4GIHA 3NDMA 5CAVA 2Q83A 4DA5A 5I9UA 1YHWA 2VTTA 3VS3A 4FKGA 4C4HA 2B9JA 4BHNA 4D4YA 5M4FA 2C69A 2ETKA 1H07A 4RLKA 5C1QB 3MFSA 2BALA 2EXCX 1OIUA 4QTBA 2Q0BA 4QMQA 5LMBA 3QZFA 4MBJA 2UW3A 4J98A 5IA1A 1J7IA 3II5A 2ERKA 1P2AA 2XRUA 1H0VA 3QX4A 5HNBA 4K77A 2ETMA 3PP0A 2YHVA 3Q2JA 3OCGA 4GJ2A 4Q2AA 3NUSA 4D55A 3R8MA 5AAGA 4FSRA 1BKXA 3QD2B 1J1BA 4MD7E 3OS3A 4TWNA 4UV0A 2GNLA 2X6DA 3UVPA 5C8NA 2GFCA 2OJ9A 3H10A 4YJQA 5BYZA 4NFNA 4BDAA 4ZTHA 5K9IA 4FEXA 3QQKA 3G6GA 5I3RA 1GOLA 4TW9A 5HCXA 2YJSA 3TJDA 3FAAA 4UMTA 2OLCA 3CCNA 2W7XA 2XNMA 2E9PA 4MBIA 4QMLA 4B6LA 4FV8A 4JQEA 3ZSGA 3R8VA 2VNYA 4AOIA 5AP1A 3LXNA 3KRWA 4MEDA 3OY1A 1PYXA 3GNIB 2DQ7X 4BI0A 4GFGA 5HG7A 4ZMEA 4IWOA 2X4FA 4E6QA 3I60A 5LVMA 4O86A 2GHLA 5AP6A 5HO8A 3ZM4A 3GGFA 4L6QA 4M69A 1YXVA 4YZCA 4BCGA 4R3CA 4FR4A 5D10A 2R7BA 4XBRA 2OXDA 3QYZA 2Y8OA 4OW8A 5EI2A 4CLIA 4P2KA 5H3QA 3EL7A 3TACA 4AXFA 4C3PA 3S2PA 3CKXA 2PVHA 3Q6WA 3QUDA 1OPKA 4V04A 4CCBA 2YJRA 4O4DA 4E6AA 2QURA 2WNTA 3HUCA 3FHIA 4BCPA 3W2OA 3QALE 4FKQA 5AV3A 2ESMA 5BYYA 3W0OA 4J97A 5HOAA 3AG9A 3FMNA 4U42A 2BRNA 4D2VA 2PZYA 3DK7A 4LMUA 1V0BA 4DEAA 1YOLA 2Z7SA 4FI1A 5A4LA 3E8CA 3N4VA 4J52A 1NT2A 3OZ6A 3DKFA 5EM7A 3D94A 1Q62A 3OWJA 4DG0E 3W0NA 5HHWA 3DV3A 4EKKA 2PUNA 4FIHA 3PY3A 4TZRA 4O7SA 2C1AA 1OIYA 4I0TA 1OGYA 5EH0A 4C35A 3UIXA 3AC8A 3GQIA 1Q97A 5CNNA 5CU0A 4FE2A 5HE3A 5EHLA 3GP0A 4WRSA 2ITQA 3ATSA 4FL3A 2LGCA 2R3KA 2JBPA 3REPA 2IZRA 3ET7A 2FA2A 4DGLC 3HEGA 5BNJA 4D1XA 1ZMVA 4FV6A 1NVQA 3E93A 4PTEA 2OG8A 4U9AA 2ACXA 4HGLA 4XP0A 3RPOA 4ZAUA 4BDHA 1W2CA 4G31A 4GK4A 3A62A 1Q4LA 3DK6A 3GVUA 4IB3A 4BDGA 1P5EA 5E9EA 5ACKA 4D2PA 4DTAA 2ZV9A 3OHTA 3SOAA 3M1SA 4DG3E 3QWKA 1Q8TA 4LMNA 4ZSLA 2E9NA 4O1OA 4WG5A 1WBWA 1I44A 2X0PA 1UWHA 4EBVA 1W84A 3D9VA 2JAMA 5CI7A 4BB4A 5BVOA 5I9YA 1JSTA 5GJDA 5LCKA 5HTIA 5CVFA 3RVGA 3SRVB 5C4KA 3KULA 3OW4A 4WNOA 1FVVA 1CTPE 1Q61A 3A7HA 4RGJA 4XHKB 2R3HA 3VBXA 5FGKA 3A8XA 2XA4A 5E1SA 2A19B 4ACDA 3BE9A 1P4OA 4C2WA 2B1PA 2WMQA 3G90X 4ALVA 5AWMA 3Q5IA 4PL5A 5IQFA 2WEVA 2O3PA 3EH9A 4CQGA 4TYGA 1L3RE 2E9OA 4U5JA 4FT3A 4YJOA 2HAKA 3PVUA 4NIFB 4I0RA 4S31A 3HNGA 2C6KA 1SZMA 2KTYA 3BX5A 1W8CA 3LCDA 3R7IA 3UOLA 2R4BA 3ORNA 4XOZA 5HGIA 5IA4A 3DQWA 4O0RA 1PMEA 3I79A 2WQNA 2PSQA 3RINA 1PXPA 2NP8A 3VHKA 3UIBA 3Q4UA 1XH8A 4PDOA 5AIRA 3VHEA 2CPKE 3BGPA 3R2BA 2B7AA 3OXTA 5DG5A 4G3FA 1E9HA 3RHXA 3SXRA 4UMRA 1KOBA 1UWJA 5HX6A 3OBGA 4P90A 4KWPA 4LOOA 4H3PA 1TKIA 4GMYA 4CLJA 4H58A 5M56A 5IQHA 4FVRA 4S2ZA 4HCUA 3A7GA 3KXGA 3ZS5A 3GU8A 5AP5A 4FSYA 5EKOA 3Q6UA 1OUKA 3RMFA 2WZJA 3W33A 5CSWA 2R64A 2GNGA 4QTAA 4CV9A 4GFOA 4PRJA 1DI9A 3CD3A 3VBTA 4EWQA 3E8DA 2OZOA 3LM0A 3VF9A 3ZBXA 3G0FA 4D2SA 2RSVA 1MUOA 3EN7A 3BI6A 4C02A 3BHVA 1XBBA 2VWZA 3OT3A 4FKLA 4HNIA 4RIOA 2AQXA 3F9NA 4BCIA 2BDJA 4D58A 3VS4A 2P3GX 5FM3A 2P33A 3NYXA 5GJFA 4EBWA 4BKJA 1OL7A 3G0EA 3R1NA 1APME 4OT6A 5CQUA 1Q5KA 4TWOA 5DH3A 5DHJA 2HCKA 3MPAA 1YKRA 3RP9A 1H00A 4Y5HA 4M15A 3BHUA 5HVKA 3U6IA 3NIEA 4M0ZA 3CGFA 1H26A 4PPCA 5F4NA 1Y6AA 2BPMA 3E92A 3R1YA 2GPHA 4FSWA 2OI4X 4Y85A 5E8XA 3FHRA 3UVQA 3Q9YA 3WZUA 3TUBA 3NPCA 5HNIX 5M55A 2W5BA 1H1RA 3KCKA 2GNHA 4FOBA 4GYGA 3Q4ZA 4Q5HA 4EQCA 3ZUUA 5ETFA 1FBNA 3HUBA 4M97A 2PVNA 2V22A 3FXZA 1RE8A 3F66A 3I7BA 3UNJA 2WOUA 2XIZA 4JMQA 1WVYA 4V05A 4Y83A 1YI4A 2X2LA 3L8XA 2WIHA 3I7CA 5J5TA 3F3TA 2XEZA 4LDTA 3BBWA 3C9WA 3CQEA 2Z2WA 4CCUA 5BPYA 3WZEA 5FWKK 1JWHA 5DR6A 3ZEWA 5BVEA 3PA4A 4EJ7A 4FIEA 4IHPA 2CKOA 4XS2A 4N6YA 1Q99A 3K54A 4PTGA 2R7IA 4PPBA 1UKIA 2C6IA 4RZVA 2QU5A 3RAWA 1XH4A 4EOPA 2UZTA 3U55A 1H24A 1WBNA 2W1IA 1SNUA 4IAKA 1PKGA 3EQBA 2V7AA 3IOKA 4C4IA 4JRNA 4MVFA 5KCVA 3SOCA 5AAFA 5AR7A 5M4CA 4EYJA 4I92A 3PSBA 4ORKA 4FSTA 3R7UA 3I0QA 4TPTA 3WARA 4TYJA 4RWKA 3D2IA 3JUHA 4G9RA 3HV6A 1OGUA 4A9YA 1NVRA 3NNWA 4FNWA 4IM3A 2ZAZA 4PL4A 4QNYA 4BICA 3G2FA 3PJ8A 4U6RA 2XB7A 4FNZA 5F1ZA 3GOPA 2XAOA 3PY1A 2OIBA 1K2PA 4C0TA 2X6EA 3OUNB 4PDPA 4RIWB 4TYIA 4JI9A 4UWYA 4ZEGA 1H1QA 2VX3A 3QTRA 4FEQA 4HVSA 4FVQA 4O38A 2WPAA 4AZVA 3N4UA 2PK9A 4L3JA 2W1CA 4QMMA 4TKSA 4LGDA 4AGCA 5M07A 4UXLA 3SD0A 5AEPA 4DLIA 4DF3A 3DA6A 4TNDA 4EUUA 5K4IA 3NUPA 4HGTA 3RKBA 3MH2A 3LPBA 4AUAA 5AX9A 3HA8A 4XG7A 5CZIA 3ATTA 4ZS0A 1BYGA 5J8IA 4A9UA 4C57A 3C4ZA 4C62A 1PYEA 3KFAA 4JXFA 4RX5A 3MBLA 4JQ8A 3QTUA 4O27B 3EL8A 3V5PA 4BR3A 4DHJA 2YFXA 2PVRA 3ACJA 1ZRZA 4KKHA 4FV4A 4RIYA 3FI2A 3ALNA 1CDKA 5M53A 4GL9A 3R7OA 3SAYA 4I6HA 3IDPA 3BWFA 1Y57A 5BVWA 4CMTA 3HP2A 5HBHA 4ZY5A 3EJ1A 3PA3A 1PXLA 4FRFA 4MNFA 1PXMA 2ITUA 3R22A 4Z7HA 3QXPA 2W99B 2CKQA 2C5XA 2FSMX 4ONAA 1XR1A 2JIVA 3W1FA 2OO8X 4LUEA 4BTMA 4LRJA 4AAYA 1WBVA 4X3FB 1NW1A 2I0YA 2FGIA 3E8EA 3EN6A 3EOCA 4KKEA 1BX6A 3NWWA 1UU8A 5JGBA 2XRWA 1ZOHA 3L9NA 4ZJVA 1WBOA 3K5UA 3KGAA 2WQBA 5IEVA 1I09A 3F61A 3QXOA 4I5CA 3P08A 4FGBA 5CALA 2BIKB 4FTCA 3P7BA 3FMLA 3OVVA 1UNGA 3D2KA 4EHEA 1JQHA 2J50A 2VWUA 3FWQA 2ZV7A 1O6YA 1SYKA 1LUFA 1PKDA 2YCSA 4TYHA 5ANOA 4BCFA 3FLYA 3AKKA 2W5AA 1XQZA 2IN6A 4IEBA 3TXOA 2JITA 1ZXEA 4I0SA 4CXAA 5D12A 5L8KA 5M44A 2QD9A 1GIIA 1O6LA 3V3VA 3KULB 3EN5A 2PE2A 4BN1A 2F7ZE 1JKKA 4EI4A 3MTLA 5M08A 2CHLA 1TQMA 2GSFA 2QC6A 2WTWA 3B8QA 4C36A 1FPUA 3P7AA 4E7WA 5TR6A 4AGDA 3PXFA 5IDPA 3S4QA 1FVRA 3OC1A 3V5WA 5JFWA 4MXAA 3BL9A 4IJPA 3IW7A 5AM6A 5LWMA 2PZPA 3FMKA 3PXQA 4GUEA 5IKWA 1H4LA 2VTHA 5JK3A 2VX0A 5E90A 4AA0A 4HYSA 3MVJA 3CKWA 1LEWA 2CNUA 2X2KA 1Y8YA 3KQ7A 4WUNA 4QP4A 4K1BA 1OKZA 4R1YA 3GT8A 1XKKA 4BCKA 4LG4A 4F78A 4D4SA 2J51A 1JVPP 3AMYA 4KIPA 3TZ7A 5C4LA 2JKOA 3R73A 4FKTA 4WKQA 3ZFYA 5E1EA 2ZDUA 3QZIA 4RLLA 4IDVA 2JDOA 3P5KA 2X0QA 4FL2A 4Y95A 3DXNA 2AC3A 5D7VA 1LP4A 2DYLA 4HZSA 2GU8A 5FLFA 4B4LA 3VS0A 3TNIA 4BDCA 5L6OA 3KK9A 5KMIA 4J71A 3KIOC 1FQ1B 4DTBA 2NO3A 3TZ8A 2C30A 4QMOA 4F7SA 4FKIA 1CMKE 3D15A 2UZUE 2CN5A 3KXMA 3CD8A 1ZY4A 3UOKA 4WSQA 2QLUA 4C2VA 4R7BA 1BL6A 2G9XA 3T9TA 3NRMA 2UVYA 4FKSA 5HU3A 2UW9A 1U54B 1XO2B 4F09A 3SVVA 4LM5A 2OJFE 2BIYA 4ZTNA 3WYYA 3P0MA 1OZ1A 3PE1A 3NW7A 4LUDA 5L2TA 3E7VA 2UV2A 3W55A 4PV0A 2QG5A 3L8PA 4L7SA 2QI8A 3VIDA 4F1OA 5CXZA 4QNAA 2W4KA 4YJVA 4L3PA 3C4WA 4RRVA 3RZFA 3FZTA 4FOCA 5EOLA 2HYYA 1WBTA 4M68A 3T3VA 5AUUA 5IU2A 3NUNA 3FLSA 4IFGA 3QF9A 4B7TA 4KIOA 2ZV2A 4EOSA 1CKIA 3FEGA 1JSVA 5CWZA 3ZXZA 3BQRA 3GOKA 3VWAA 5C26A 4IW0A 5AA9A 2A0CX 1WCCA 2WTIA 4FMQA 4FZDB 4FTTA 4JT3A 2NRYA 3ZRKA 4A7CA 3NFGB 3VC4A 5J7HA 4R6VA 2CSNA 3D5WA 3NX8A 2RKUA 4W4XA 5CT0A 5IMXA 2YZLA 5HTCA 2FUMA 3JYAA 1WVWA 2AYPA 4GG7A 4KABA 2C6MA 4CYJA 4IZAA 2HIWA 1NXKA 2BFYA 2VWIA 2BFXA 4U0IA 1MRVA 2GTMA 2EB2A 4FEVA 4QYHA 5ANGA 3IGOA 2X7GA 3UBDA 3PG3A 4ERKA 2C0OA 3OBJA 4PMTA 4YUQA 4BDIA 5D1JA 3HA6A 5HD7A 4BDBA 3F82A 3OXIA 2VTSA 1OI9A 1TQPA 3BIZA 3EKNA 1K9AA 3IGGA 4FSNA 4IVDA 4IWQA 4YJUA 3UODA 1ST4A 3BV3A 4AE9A 3AQVA 1CKJA 4O0VA 5AUXA 3UMXA 2R5TA 5E92A 4BDDA 4C3FA 4FT0A 4C4EA 2WHBA 1H25A 3L9LA 3PRIA 4YPDA 2VWXA 2YWPA 2ZM4A 2PMNX 5FUTA 3UTOA 1PMVA 3VRZA 3DAEA 1UVRA 2ITXA 5AIKA 4BY9E 4FTUA 3NVKI 2PWLA 2ZB0A 3O50A 4XG2A 3O23A 2GNJA 4TRLA 2XNGA 5DR2A 5HU9A 2OF2A 4IADA 3Q32A 5DI1A 3F3WA 4RC4A 4IFCA 4MH7A 3C4CA 4YJRA 3RCJA 3NGAA 1EH4A 4F9YA 4TXCA 4X2GA 5LJJA 4U80A 3NS9A 4QMUA 4X2NA 5IQIA 2YM5A 5E8YA 4TY1A 2UZNA 2HWOA 5FM2A 5M4UA 2F2UA 3RWQA 2YACA 3ZC6A 2FSLX 3FL4A 3FLQA 1URWA 3MB6A 4ANBA 3ORZA 3U51A 4NFMA 3OEFX 2REIA 4GUBA 4UY9A 4IBMA 1V1KA 3LXKA 4DHIB 4H1JA 3ZO4A 2WAJA 1W0XC 5DIAA 3RBWA 3E63A 4A4OA 2ITNA 5FRIA 3ACKA 2OFVA 3KXHA 3MH3A 3O96A 5E8TA 2IZUA 3G6HA 3SG9A 3QQFA 3BELA 3W10A 4C59A 5IG1A 5IA2A 4EH9A 5AA8A 4GT4A 4D1SA 4C33A 3F2AA 4GK2A 4QQCA 1SVGA 1JOWB 5EOBA 4D2TA 4FZ6A 4XMOA 3B2TA 3EZRA 3Q60A 3UO4A 3WOWA 5A4CA 1XMLA 3GCPA 2G2HA 3BBTB 1F3MC 3LCKA 4QYGA 3KCFA 4KRCA 5ANDA 4ZSGA 5JFSA 4LV5A 2C3IB 4QD6A 3LCTA 2O65A 3O51A 4O22A 3EFWA 5CENA 2XYUA 3BHHA 4MWHA 4TYHB 5E8VA 3R6XA 3QGYA 5AJQA 1M14A 3LFEA 5JEBA 2XKCA 4QPAA 5AM7A 3U6JA 2GMXA 4FKJA 3DTCA 3TTIA 2WEIA 2B9HA 1LEZA 5JFXA 4BTKA 2XM8A 4FT9A 3DKGA 3ZEPA 3LMIA 2BROA 3E3PA 3ZUTA 3QC4A 3CS9A 4XG3A 4EQMA 1GZ8A 1BI8A 2I0EA 2BMCA 2WKMA 3ZXTA 4USFA 4EOIA 4DAWA 4EOJA 2IG7A 4IWDA 3AMAA 3D7ZA 3OWLA 1Q3DA 5AP3A 3FQEA 3IOPA 4DDIA 5A46A 5LMAA 4RVTA 2OF4A 3DCVA 4NM3A 3VUDA 3F2RA 2UZLA 2BDWA 3PXKA 2BKKA 3SXSA 3M42A 4Z55A 3VO3A 5HCYA 5JFVA 4F0IA 3OFMA 4BHZA 2OXYA 4K18A 5GIPE 4DHFA 4BCHA 4FJVA 5L6WL 4BWKA 4S33A 1QMZA 1E1VA 4BJJB 5EQEA 4O7ZA 1XH9A 2XNBA 3TKUA 3A4OX 3F3ZA 2WMRA 1Q8ZA 3MY0A 3MPTA 4APCA 4CT2A 4H36A 4NYEA 1OPLA 3UYSA 5FDPA 4K9YA 4CMOA 4EK6A 2B54A 2FH9A 3CR0A 4O7WA 3E64A 4NKAA 4OAVB 3GC9A 3R7GA 4RIXA 4PDSA 4JOAA 5IA3A 4E4LA 3MA3A 4DFNA 3EQGA 3E8NA 5EW3A 1ZY5A 3BV2A 4BCNA 3LLAA 2JD5A 3E5AA 3IO7A 2PE1A 2W0JA 4XG8A 1SMHA 3DDPA 2GQGA 4B0GA 4RPVA 4FNXA 4OTDA 4YLKA 2P55A 5CY3A 3QRUA 4FTJA 3MJ2A 3PXYA 4QMTA 5GZ8A 5I5ZA 4B8MA 3LE6A 4RJ5A 5J5SA 2W1EA 2X0GA 4KUJA 5L4QA 1OL1A 2GHGA 1H1WA 2WMAA 2GS6A 4IJ9A 2R0UA 3IONA 1YWVA 4IB5A 2OH0E 2R9SA 4YHFA 4I6BA 5DRDA 4I6FA 4AT3A 1AD5A 1XHAA 4DLJA 3IK3A 3C4FA 5IMEA 5A6OA 3LFNA 3QTZA 1SVEA 3I6WA 3VUIA 3UQFA 1NY3A 2WU7A 1ZOEA 3NNXA 4MXZA 4OTWA 4XV9A 4E4XA 5A4TA 3NMUF 2XNNA 3TKIA 3WZKA 3ERKA 1RQQA 4ENYA 3FC1X 4QMYA 5JRQA 2J0IA 4ZY6A 3VQUA 2QG7A 2CNQA 4C38A 5ITAA 3TNWA 2KULA 2XS0A 3ORTA 3GB2A 2RG5A 4LOPA 3IW8A 5K0KA 3LQ3A 5IQEA 3HRBA 1GJOA 2WFYA 2WMBA 4LRKA 5L2WA 2I7QA 1UU7A 2Z7RA 3POOA 5FP6A 4JX7A 4RA4A 1IAJA 2X2MA 2UVZA 4L9IA 3R01A 5LXMA 3RWPA 4YTHA 5KZ0A 1FVTA 3KU2A 2PUUA 2VWBA 3DFAA 4EOLA 4AN9A 3ZLYA 3EHAA 3SC1A 4D1ZA 1J7UA 2OJIA 3QA8A 2Z02A 3FI8A 3TNPC 3LKMA 1M17A 4FTRA 5KMMA 4U79A 1A06A 3U4UA 1KE9A 3TT0A 4C4JA 3GQLA 5G1XA 4UEUA 3Q4TA 3UDBA 5IZFA 3UOHA 3LQ5A 3FUPA 2PVMA 4F7LA 5T3QA 4CV8A 4M0YA 1X8BA 2R3QA 1KV1A 2QOQA 4IQ6A 1R0PA 5C9CA 1PF8A 5F9EA 4Y72A 4YNOA 4FV1A 4L52A 4QRCA 3LIJA 4U7ZA 3D5XA 2V0DA 1PJKA 4FODA 3MWUA 4DGOA 4BDKA 4F9WA 4R78A 2W4OA 5KMKA 2X8EA 5HD4A 3BLAA 2A4LA 3O71A 3A7IA 3OTUA 4K6ZA 3TTJA 4PX6A 2HELA 3FYJX 4FUXA 4RFYA 3RK9A 3VS5A 1KE7A 5LVLA 4QTDA 4C4FA 4F9CA 1FMOE 4RWLA 3EN9A 3FZSA 5I3OA 3UZTA 5B0XA 4M66A 2Y6OA 2QNJA 4N0SA 5B2LA 2WGJA 3Q5ZA 2JDTA 3O7LB 4FBXA 3WI6A 3HMIA 3VBVA 1GZOA 1M2RA 3V04A 2F4JA 3Q2MA 2BAKA 2CGWA 4EKLA 1AGWA 2J0LA 2R3NA 2R3OA 4OR5A 3U4WA 5M4IA 4AACA 2UUEA 4EEVA 1BL7A 3CC6A 2GNFA 3DXPA 5EG3A 3DKCA 2C4GA 4BKYA 3R04A 1OBGA 5CU2A 5DA3A 4ANNA 2XP2A 4NW5A 3QGWA 2OZAB 3DZQA 2C5OA 3OG7A 4E20A 1GAGA 4O6EA 4CNHA 3W0QA 3EFKA 4UYAA 4F9AA 1H01A 4GJ3A 2JDRA 2UW0A 3Q9XA 4UYNA 4YLJA 3AT4A 3RGFA 4CFVA 4DCAA 5AUWA 1P4FA 4ZSEA 3ALOA 5EKNA 4EK5A 3LLTA 1PXKA 4MYGA 4ZTLA 3PVBA 3W18A 4FF8A 5HG9A 4O96A 4O4CA 3DY7A 5BUEA 2C6OA 5HG5A 3H4JA 4WA9A 4ACGA 2ZM3A 2C6LA 3KL8A 3PLAE 3UDTA 3HECA 2O0UA 3ANQA 4IX5A 3E7OA 3QHWA 5D11A 4PF4A 1XMMA 2ZFYA 4DEDA 1YHSA 1Q8WA 5FEQA 1FMKA 2WTKC 4JAIA 1YWRA 3C0HA 4YHJA 1YXXA 4FZAB 3QRIA 3VS7A 2CJMA 5TOZA 3RK5A 4OTFA 3S1HA 1PMUA 4OGRA