3B2TA

Structure of phosphotransferase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
305
structure length
288
Chain Sequence
SEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPQMTFKDLVSCTYQLARGMEYLASQKCIHRDLTARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor receptor 2
publication title Structural basis for reduced FGFR2 activity in LADD syndrome: Implications for FGFR autoinhibition and activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 288
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3b2tA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3b2tA01
4G6OA 4NSTA 4AT5A 3S1HA 2J2IB 2VTQA 5M55A 3NSZA 3UOKA 1KWPA 4WOVA 4JIKA 3TACA 4PWNA 4DGMA 4RMZA 4FIEA 3QWJA 2W5BA 5FEDA 5LJJA 4S2ZA 4PV0A 3T9TA 4BGQA 1AD5A 3PIYA 1M52A 3E3BX 3BGPA 2XM9A 3DZOA 1LR4A 1U54B 4NM5A 3SA0A 2P0CA 1SNUA 1JNKA 5BVEA 3GC8A 3G0EA 4KWPA 1KOAA 2C5NA 4D1SA 2QR8A 4FE2A 4ZMEA 1J7UA 4AZSA 4C34A 2QOBA 3QC4A 4AOJA 3QTRA 4UB7A 2NPQA 3UMWA 5I3RA 2BDFA 5GJDA 4HCUA 2FUMA 3QHRA 4XG4A 2VNYA 4FV8A 1H00A 4U8ZA 1GY3A 3PYYA 5JQ5A 2JIIA 4LOQA 4D2SA 4PL5A 1YDRE 3C1XA 3UQCA 4YO4A 2Y4IB 4L44A 4RZVA 4WNKA 3OEFX 1LUFA 1STCE 3B8RA 1KE8A 2BR1A 3FQSA 3LXKA 5J87A 5J9YA 5ETCA 4CVAA 4AP7A 2VTHA 3TNIA 2PVMA 2UW0A 2YCSA 3E62A 2DWBA 4G3EA 3BV2A 1W8CA 2X9FA 5ICPA 4O0WA 2DQ7X 1Q8TA 2V7AA 3CKWA 2WIHA 3TZ8A 4AOIA 5AV3A 2JDSA 4YTCA 5AUTA 1XKKA 2OH0E 4QP7A 5CQWA 4EORA 1M2QA 3RPYA 5HIEA 3FI8A 2XNNA 4F64A 1XR1A 3PG1A 5AAGA 4IE9A 5FUTA 2F9GA 5K5XA 4OR5A 4D0XA 3C0HA 2OIDA 3Q4TA 2GPHA 3AQVA 3S0OA 4D1XA 2JDVA 2B1PA 2X39A 4F7NA 4AX8A 4H39A 5IUGA 5AUVA 1U46A 4IVBA 4KRCA 4XV1A 5HLPA 3U54A 4XBUA 4FK6A 2XIZA 3ET7A 3L9NA 1DI9A 3LMGA 2FSTX 2FA2A 4O2PA 4AE9A 4BWXA 3U6IA 3AC5A 1ZYJA 4HNIA 4L67A 4C57A 4L42A 3BYOA 4MCVA 4FOCA 4CGAA 4YJSA 3LJ2A 2WMAA 4BCNA 4EH9A 2JKOA 2VN9A 1PXNA 4O0RA 3T3UA 3WILA 4TNBA 4BCGA 4R7IA 3V6SA 4RWIA 1XBBA 5FM2A 3W2PA 4X2FA 2WTDA 3BWFA 4R7HA 4QMWA 2HENA 2B4SB 4XG8A 2G2FA 3FXXA 3LCKA 3MBLA 3VUDA 2C3IB 2CMWA 3PUPA 4J8NA 3O8TA 3AG9A 2JITA 4IH8A 4TRLA 4UXQA 2YWVA 3R1SA 3FXZA 3NGAA 4RJ4A 4C38A 4A4OA 5HG8A 2PVHA 1M17A 4Q9SA 3R8UA 4C36A 3FLZA 4I92A 2B7AA 3DK6A 4ZY4A 4Z16A 2QG5A 3QTXA 1FINA 5DR2A 4D2TA 1OVEA 2WTKC 3BKBA 4PPBA 3W1FA 4XP2A 2O5KA 4BZOA 2HW6A 3GU8A 4C3RA 4FI1A 4GVJA 5EM5A 4PDOA 3SKCA 4G6NA 2YAAA 2JFMA 4XHKB 2A0CX 4FT7A 4XG3A 2IJMA 3G51A 5HLNA 3BYUA 4AACA 3D7TB 2C6DA 3FZRA 4O0SA 2ERZE 3OY1A 1RDQE 4JJRA 4XV9A 4MX9A 3V6RA 5BNJA 4ZJJA 3GU4A 3WYYA 4B9DA 1I44A 5EFQA 3LFDA 5AUWA 3Q2MA 2YZAA 4ZTRA 4QQTA 2GHLA 2OJGA 3A8WA 2XVDA 5LMKA 4XV2A 2YAKA 4GSBA 3G9LX 4EC9A 3UGCA 3UP2A 4NFNA 4K0YA 2C69A 5L8JA 3UIMA 4CT2A 4DEDA 2RFSA 1PHKA 3DJ6A 3WE4A 1UU7A 4IVCA 3KK9A 4JVGA 3UODA 5BQ0A 4EH3A 4BGGA 2R3IA 4RIYA 2LGCA 3HP5A 2O0UA 4EK8A 3MS9A 3QTQA 3NAXA 3OBGA 4QQCA 2VZ6A 3QX2A 2O63A 2WFYA 3RNYA 3H3CA 5DNRA 2BKKA 3BX5A 3BE2A 3HLLA 5FBNC 5JZJA 4DG0E 5KMKA 5IUIA 1REKA 3ID6C 2GQGA 3CPBA 1Q4LA 3MGYA 3QXOA 1P5EA 4IXPA 4LQMA 2ZV8A 3UIBA 4O7LA 2C5VA 2BFXA 3G6GA 4M8TA 2VX0A 2Z7SA 3VAPA 1IEPA 2IN6A 3VQUA 1U5QA 4TZRA 1OKVA 2WB8A 2XK6A 2VGOA 4GW8A 3K3IA 2C5OA 4FGBA 3SXRA 5CU2A 5CWZA 2B9JA 2WTCA 3F3WA 3QYWA 4FTQA 4H58A 4RZWA 3ZO2A 4ANNA 1W84A 4BTJA 3P79A 4BTMA 2WD1A 5IA2A 4ZLYA 4EK5A 4ASDA 4Y85A 3V5JA 1G8AA 2ZV2A 3KRRA 3PE1A 2QD9A 5EH0A 4AFEA 3NW6A 5JH6A 3LXPA 2G15A 4YNOA 3GCVA 3OW4A 3FQEA 2OXDA 4J8MA 5G6VA 4ZK5A 3PWDA 4PY1A 2ITYA 1QPDA 4QMUA 4TW9A 4A9RA 5DRDA 1L8TA 1UNHA 4I5PA 4EJNA 2C6MA 4R78A 4JQEA 3BHVA 3WZUA 5IQFA 2R3PA 5DHJA 2BRBA 4EC8A 3BHUA 4O83A 4DEIA 1UWJA 2QQ7A 4E8AA 2ITQA 4IAYA 4WNOA 4KINA 2JIVA 3F9NA 4Q9ZA 2QC6A 4FL2A 1PXPA 4QP1A 3REPA 4RJ5A 5L2IA 4P4CA 5CX9A 5KHXA 1JSTA 3Q04A 4QQJA 3RPRA 2OFUA 2A27A 4IB0A 4FIIA 4M97A 3RZFA 4IX5A 2PU8A 3C4XA 3DBFA 3MFSA 4QP4A 4EONA 1JKKA 5L4QA 3SD0A 4OTGA 1URWA 4HGTA 4RX9A 3VF9A 4C4GA 4QMYA 4D4VA 4U43A 4BYJA 4X21A 4CCUA 4IX3A 5KMJA 3KULB 4MXAA 3UPZA 4DN5A 4F9WA 5H8EA 4HVDA 4BCHA 3TNQB 3KN5A 4UWCA 4NYEA 3ACJA 3VBVA 4D2VA 3KMMA 4L3PA 4BDKA 4CMOA 5CF6A 2GNGA 3CTHA 4BCOA 4G34A 2NP8A 4AAAA 4IB1A 1UNGA 2ACXA 3K54A 1NT2A 4MWIA 4DTBA 2XNBA 3GCPA 4FT5A 5AP7A 4AE6A 2UW3A 4YHJA 3DPKA 5IMXA 4JG8A 3EZVA 5D12A 1OB3A 4ITIA 2CGUA 1VEBA 5HIBA 3SG8A 2R3KA 3NPCA 2X4ZA 3F2AA 2OZAB 1UU9A 3DQXA 3HUCA 3FKNA 2ZV9A 1M7QA 5F1ZA 2ZM3A 4C61A 4EOOA 5KX8A 4O82A 3EOCA 3QBNA 4QP2A 4ZAUA 3DB8A 1WFCA 3SDJA 4H1MA 3CQEA 4CG9A 2NNWB 3QLGA 3VS3A 3U4WA 3F5PA 4IW0A 3LJ1A 1NY3A 4C3PA 5TE0A 3GNIB 3W55A 5L6PA 2PTKA 2XKEA 5AUUA 3K5UA 5GJGA 3LCOA 4IIRA 1PXLA 4D1ZA 5KZIA 2C5XA 2XM8A 4AW2A 2RF9A 3CTQA 1ZMUA 3OW3A 4D5KA 3HX4A 3MDYA 2FB8A 3QTWA 2YCRA 2QVSE 4NUSA 1JQHA 3IONA 4XCUA 4LRJA 4RX8A 2BDWA 5A3XA 3PRIA 5F95A 3SW4A 3PY0A 2R3QA 2PZIA 3R8VA 4TKSA 3ORKA 3HMPA 4D55A 4KIPA 1ZY4A 5BVKA 5FDXA 4N6ZA 2R3LA 2VTRA 1FQ1B 3RK7A 2UW8A 2P2IA 3JXWA 3B2TA 3P7BA 4J53A 2VTTA 4CXAA 5HG9A 4UALA 2KULA 3PJ3A 5AIRA 4FYOA 5G1XA 3AD4A 5E92A 2JKQA 3FBVA 2OJ9A 4EBVA 2UUEA 4FIFA 5A4QA 4I0RA 3P0MA 5A4TA 3LM5A 4WO5A 3VBYA 4EKLA 2XIKA 3QUPA 2FYSA 3LMHA 2OIBA 2R3FA 3EFKA 2OKRA 3AGLA 5AV0A 3GVUA 4U0IA 5HTCA 4IM3A 4EYJA 4L01A 4MF1A 4FSQA 4FV0A 2G2HA 2RFDA 3F5UA 4MBJA 3JR1A 3I0QA 4WG4A 5I9XA 3QQHA 4ZP5A 2P2HA 3UNZA 2GHGA 4LGGA 5CEMA 1PKGA 2EUFB 2I0VA 3FLSA 5KUPA 4A4XA 3SHEA 3U9CA 4O84A 4FTIA 5CU0A 3ZLXA 4QMMA 5AR3A 1ZWSA 4FT3A 4FZ6A 4EUTA 3AT2A 2DS1A 5EYMA 1MQ4A 2C68A 3BGQA 3DNDA 3OXTA 5HKMA 5B2LA 5CQUA 2UZOA 4UWYA 4IAIA 5E8XA 1KUTA 4LRKA 3IS5A 3LFEA 3FEGA 2I0YA 4G31A 5E7RA 4QMQA 2ITVA 5LVLA 4G5JA 3QGYA 4HYIA 5HORA 2QOLA 3F3VA 2WMVA 2Y6OA 3BU6A 5HLWA 2GS7A 4JAIA 4CFWA 4D28A 1PJKA 3KFAA 2IW9A 3HVCA 1WVXA 5L3AA 5LOHA 2CNUA 3EFJA 3S2PA 2X7GA 2Y9QA 3COHA 2IZUA 4JIAA 3C4CA 4ASEA 4BDFA 3EB0A 4E20A 4R1YA 4KUJA 4KAOA 3R7IA 2X9EA 2WTVA 1H4LA 2H96A 3QD4A 3QTZA 4EQCA 4BI1A 3RPSA 4ACCA 4KBCA 2W1FA 2VO7A 3R30A 1FVVA 1YXVA 4FOBA 3H9OA 3MB7A 3IDPA 3EQGA 1OIUA 2J0JA 4D0WA 3QD0A 4G16A 3ZO1A 3NUUA 3O51A 3A4OX 2AC5A 2B53A 2UW9A 5CF4A 4O7ZA 3KF4A 5AUYA 3RCDA 3HP2A 4JBOA 1YOMA 4EOKA 5CU3A 3OC1A 3DGKA 2OO8X 4JR3A 4MVFA 2C1AA 2Y4PA 3QRKA 3NYNA 4O6EA 5L2SA 1DM2A 2I0HA 1BUHA 4PMMA 4ZZOA 1OPLA 5A4EA 4RVTA 3R7GA 1PRYA 4CV8A 4DH5A 4IBMA 5CZIA 4U9AA 4FSUA 3UOHA 1Q8YA 2UVXA 3QXPA 4NW6A 3NLBA 2W1IA 4FKWA 4O7SA 4XH6A 5CVFA 4GCJA 3F3TA 2QONA 3CQUA 4FEXA 4FTUA 5IA3A 3PA4A 2YM5A 1ZAOA 2XK7A 2UV2A 4FV1A 5FM3A 3EQDA 3VC4A 3FSKA 3DA6A 3PPKA 4IAKA 3NUYA 1BX6A 1FMKA 3Q4ZA 4FKUA 5CYIA 3POOA 5AP3A 4BC6A 1PMVA 2EB3A 4OAUC 5A54A 3QKLA 4MNEB 4HYHA 4JXFA 3FMLA 2BRNA 5CSWA 3WOWA 3ZS5A 3DFAA 4BDDA 5EW3A 4CKRA 4MXOA 4WG5A 2C30A 3CKXA 1SMHA 3HZTA 5M56A 4H3PA 4JRNA 4OUCA 4TYEA 3DXNA 4FUXA 4MTAA 4RIXB 4D4YA 1VYZA 3DT1A 3FSFA 3IG7A 4WSYA 3LLAA 2RL5A 4N0SA 5KCVA 2XB7A 4GKIA 3R22A 2BIYA 4R3PA 4DGNA 3ORZA 4V01A 3ZM9A 2PY3A 3O7LB 4B4LA 1T46A 4K18A 5IISA 2FSMX 5HU3A 5H3QA 2BVAA 5JQ8A 2PMOX 2REIA 4GEOA 4QP9A 3NW5A 2R0UA 2WQBA 2NO3A 2E9OA 3RK9A 4MD8E 3U8WA 4R7BA 4FSYA 3DK7A 4BVUA 3LOKA 4FZAB 4XLVA 4G1WA 4FKOA 3GUBA 2OZOA 4I41A 4IM0A 4RRVA 2ESMA 2GU8A 2C0OA 5AP0A 1P2AA 2BROA 2CN5A 4R3RA 4FNXA 4YGAA 4EH2A 4ZEGA 4JS8A 2YIXA 3P1AA 3PLAE 4CFNA 3AC1A 4FK3A 3FDNA 2CLQA 4ACHA 3COKA 3LKMA 5IA4A 4NKSA 4S33A 1HCKA 2HY81 5BMMA 4QYHA 3ROCA 3NCGA 5C4KA 3RWQA 3PIXA 4L9IA 4O7RA 4BCPA 5HEZA 4D2PA 4PMTA 2V7OA 4C62A 3NUXA 5D7VA 4DG2E 2JD5A 2R5TA 4UX9A 3UVRA 2OU7A 3NVKI 4G9RA 5C9CA 5IMEA 2WNTA 3MFTA 5FG8A 2F7ZE 3K3JA 3EQIA 3EWHA 3O2MA 4FYNA 5BPYA 4KS8A 5F4NA 1AGWA 2YDIA 4ENXA 2WTJA 3DBDA 2EXCX 4GT4A 4GYIA 4RA5A 3WZDA 5LWMA 2GS6A 3Q6WA 4EQMA 3UVQA 1UKHA 4FX3A 3KEXA 4YZ9A 3CIKA 4R5YA 4WRSA 4YSJA 3QQUA 3NDMA 2X81A 5DYJA 2C47A 4RIWB 3PVUA 3KCKA 3R1NA 1PXKA 3CP9A 2WMQA 5F94A 2A1AB 4NM3A 4RC4A 3DS6A 3FY2A 3PA5A 5B7VA 5CS6A 2BIKB 2I40A 5EW8A 2IVUA 4C7TA 1TQIA 3WARA 3D4QA 5IQGA 2X7FA 1FGIA 3RBWA 2VGPA 1GIHA 2GNLA 3EJ1A 4DBNA 4EK4A 3M2WA 3WF5A 5CEKA 2J6MA 5JGAA 1R39A 4FTKA 3PJ1A 3CJFA 4WA9A 4CZUA 4CT1A 5LVOA 1FVRA 5AV1A 2O3PA 4O1OA 3MH0A 3OCTA 4AF3A 4CQGA 5CAVA 4GUBA 4FTLA 4PDSA 2WZJA 1JPAA 1MP8A 2HYYA 4A9TA 1APME 2W1GA 3CE3A 3LM0A 4IB5A 5FEEA 3RHKA 4AUAA 4DFBA 3DOGA 2PMNX 3S3IA 5CSVA 5DFPA 2WMBA 3DAKA 1KSWA 4F9CA 2V62A 4E5AX 2O64A 3UJGA 1PW2A 3D14A 3EFWA 4YTIA 4I6FA 1JVPP 1PMEA 2IZSA 5L2TA 2JDTA 5D10A 5FTQA 3RPVA 2EXEA 3O71A 3R63A 4DG3E 4OTWA 2YDJA 3MV5A 3NR9A 4L6QA 4WIHA 5IPJA 5JFWA 5HIDA 3EN4A 3VNTA 3PP1A 4ASXA 2UZWE 3F82A 3KXGA 4FKQA 3R04A 2JBOA 3DU8A 4PL4A 2R9SA 2FSLX 3HDNA 5JZNA 3V01A 4I6BA 3ZUUA 4CQEA 3UZTA 4I24A 5ETIA 3I6UA 1U5RA 5AX3A 2WO6A 4E4NA 3AD5A 3LLTA 3GB2A 4AZFA 2PL0A 3SRVA 3LQ5A 5KNJA 3GU7A 4HYSA 4Y8DA 5B2KA 3RTPA 3E7OA 2X4FA 5J8IA 2J5FA 1M2PA 4HCVA 4IZ5A 1PMUA 4LGDA 5EYDA 5GIOE 3RAIA 5M57A 4LUDA 3QTIA 4ZZMA 3W2CA 4XX9A 2GNFA 3TKUA 2WTWA 5AX9A 3EN9A 1GNGA 4C4FA 3FI3A 2X7OA 4QPAA 3DY7A 4DEBA 3R73A 3FV8A 3NWWA 4HZSA 5GZ8A 2UZLA 5EHLA 5AR5A 3V8WA 4WNPA 4QMLA 4RQVA 4PPAA 3L9PA 4XOYA 3A7FA 4KA3A 2OJFE 5KKRC 3AOXA 4UMPA 4KB8A 3C50A 4FL3A 4IDVA 4JT3A 5HESA 3IO7A 5AR8A 1Y6AA 5KE0A 2GFSA 3EQHA 4MHAA 4TWOA 3LJ0A 4L7SA 2ETRA 4L46A 2VO6A 5A6OA 4WSQA 4C58A 4FVRA 2E9UA 4BDGA 1ZY5A 5CF5A 3FZSA 3FLYA 2BCJA 2J4ZA 2OWBA 4JOAA 2BZIB 4X3FC 2ZDTA 5DG5A 2XCKA 3ZRKA 1CDKA 5ANKA 1DI8A 3IDCA 3LMIA 3OF0A 2F2CB 4G2FA 4M15A 4FA2A 4DH7A 3TT0A 3AXWA 1NVRA 3W8QA 2BILB 2C3LA 4M84A 3G6HA 1W82A 3QQGA 5LCKA 2XH5A 4K11A 3MFRA 4JDJA 2X0GA 4IJ9A 5BMSA 5M4UA 5CEOA 3ODZX 2OSCA 3V5WA 2IO6A 4E6DA 4LYNA 1OL5A 3RK5A 5LQFA 4M14A 4YUQA 4FT0A 4J52A 5HE0A 2VWIA 5DOSA 3QLFA 1YHWA 1DAYA 3R01A 3UQFA 4W4WA 1ZOHA 2VWBA 4QMTA 3I0OA 3ZDUA 1Q3DA 4D4RA 4M7IA 4FIJA 2PUPA 4QMXA 2CNVA 3G5DA 4QNAA 3L9LA 4EBWA 3WZJA 1H1SA 2HCKA 4BIEA 5JFXA 4EH7A 1IRKA 2CCIA 1JSVA 3GQLA 3DQWA 1Q3WA 1WBTA 2UZDA 3P08A 4NM7A 3TZMA 3VUGA 4GFGA 4ANLA 1JKSA 4G3DA 5KMLA 5FXQA 1ZMWA 4HGLA 2QCSA 5IZFA 3ZTXA 4CMTA 3ALNA 1P4OA 3LFBA 4I4EA 1ZOGA 3GU6A 4XNEA 4P90A 4IQ6A 3MVMA 4AW5A 4FZDB 3ITZA 4IDTA 1KE9A 4EL9A 3D94A 1GZNA 2NRYA 1ZARA 2ZB1A 3BPRA 4IAZA 5J7HA 4LMUA 2QHNA 2WQMA 5DEYA 4K77A 4EH6A 5J95A 2W96B 2WOTA 2QHMA 2XKCA 1CMKE 2HZNA 4FV7A 4NIFA 3C4EA 4NU1A 3F61A 4XG7A 4F08A 1KE5A 4ZY5A 4B99A 3H4JA 2EU9A 1NVSA 3PVBA 4DEGA 2VWXA 4E4MA 2UZBA 4FSZA 2ZJWA 4DT8A 1MRVA 4WT6A 4L8MA 2CDZA 1CKPA 2F7EE 2Z7RA 3TG1A 1Z57A 3BWJA 4UBAA 1L3RE 4BIDA 4W8DA 1OMWA 5HO6A 3P4KA 5FD2A 4Q2AA 4DFXE 2X2MA 4QPSA 3E8CA 3LQ3A 3ZUVA 4M0YA 2XEYA 5GHVA 2O8YA 3R83A 4X2GA 3E93A 2BUJA 3P78A 1OITA 2XA4A 3EZRA 3ORXA 5FBOA 3UZPA 4GG5A 4AZVA 4PRJA 3RGFA 2A4LA 3A7IA 2UZUE 2E9VA 3K2LA 5KHWA 4I20A 4MKCA 3SOCA 1U59A 5AP4A 2B55A 4ZTMA 5AFVA 1UKIA 1H25A 4OBPA 3KU2A 3SAYA 4C3FA 2YEXA 2R4BA 5IQDA 4XRLA 3EN5A 4YC6A 3WIGA 2IVTA 4DYMA 5LXMA 3ZZWA 4IWOA 2DYLA 3CEKA 4LUEA 3R7OA 4FVPA 4DLIA 3O96A 3N51A 1FGKA 4TYHA 3OXZA 2UVZA 2IW8A 5TOZA 1OKYA 2HY0A 5HO8A 4PMSA 5AA9A 4FIHA 4RT7A 3UMXA 4C4JA 4R77A 3MA6A 4FTMA 4M67A 4UMTA 4BGHA 3QRTA 3D2IA 2OXYA 4BY9E 2W9FB 3O23A 5L2QA 3R9OA 2VO0A 4OTPA 4F09A 4YR8A 5I4NA 4OTDA 2PVFA 4G3FA 2ITOA 4JLCA 4KSQA 5K4JA 5L8LA 3UPXA 4D58A 4MF0A 5AEPA 2OGVA 5EDQA 1BL7A 4APPA 3EN7A 1ZXEA 2XK4A 2BZKB 4YTFA 3DAEA 4FKIA 3WF7A 4AW0A 2W05A 3OOMA 2WXVA 4YLKA 3ZXZA 4O81A 4EWQA 2CLXA 1MUOA 3R6XA 4O7WA 4KRDA 4FUYA 5GZAA 3QD2B 3ENMA 2XKDA 4RVMA 4DINA 4F9BA 4FMQA 4FT9A 3IW8A 2PHKA 3QCSA 3QZHA 4KS7A 3O7LD 4RC3A 3W2SA 4B8MA 2VTPA 1U54A 3BI6A 4BTKA 4I5MA 1U4DA 4Z7GA 5IF1A 4IC8A 1YDTE 4ANMA 3BYVA 1OBGA 5DT3A 1RJBA 2IZRA 2X1NA 3BELA 4ERWA 5IKWA 1LEWA 1OUYA 4F6UA 3HMMA 3AMBA 3KY2A 3FLWA 3H30A 2HW7A 4O0YA 2EVAA 4YJNA 3DBQA 4RVKA 5H8GA 4AS0A 5KMOA 3GCSA 3OP5A 3JY9A 3VBXA 3C7QA 5IQHA 4IMYA 3VUTA 4O86A 3E7VA 2Q0NA 3MN3A 3ELJA 4CZTA 3Q96A 5BVNA 4BCIA 4X3FA 4B0GA 4YP8A 4YLLA 4W4XA 3KXXA 4DC2A 3R28A 3ZDIA 4U81A 3CS9A 3G0FA 3R02A 4FL1A 3EFLA 2WMTA 2ZVAA 2QOHA 5EI6A 4NTSA 4KD1A 4KIKA 2W17A 4Z9LA 3ZU7A 3HMOA 3Q6UA 4IANA 4FZFB 2WTKB 4QQ5A 5DWRA 2QNJA 4KBAA 4RFMA 2PUNA 4XP3A 3DKGA 3FMNA 4QMZA 3E87A 2W9ZB 4AFJA 3DXQA 5AM6A 3N4UA 1OPKA 4EOLA 4BRXA 5DR9A 4M13A 5IUHA 2X2KA 1Q97A 5EDPA 3A7HA 3KXZA 4ACDA 5JRQA 3LE6A 1RE8A 2VTNA 3TUBA 3TWJA 3DKCA 2ZV7A 2CSNA 2HWPA 3HRFA 4GVAA 5E8YA 4EK3A 5CAOA 5JKGA 2JC6A 3N4TA 3F5XA 4A9UA 4FG9A 5DR6A 5ACBC 5CVHA 1I09A 1A06A 1SVHA 3EIDA 4TY1A 2Z8CA 1GIJA 1WVWA 2HIWA 3E8NA 4I4FA 4WHZA 2B0QA 5TT7A 2J0IA 3HV3A 4I0TA 2ERKA 4F0FA 4NWMA 3OS3A 4GKHA 1Q99A 4F0GA 1Q61A 4IFGA 1IG1A 2B9FA 3LW0A 3QRJA 4QP8A 4BHZA 1LP4A 4QD6A 4F63A 3ZFMA 1BMKA 2JAMA 2W1ZA 3R71A 2FO0A 4HYUA 3NNXA 4QOXA 3ZZEA 5E9EA 4D5HA 4RC2A 3JPVA 1PYEA 5DN3A 4GJ3A 2OBJA 5CEQA 2OG8A 3KXNA 2VD5A 2RG5A 4W4YA 3R9NA 5FDPA 3PFQA 2HXLA 1O6KA 3U51A 4CYIA 1TQMA 1R0EA 3DB6A 2I1MA 4FTAA 4G3GA 4RQKA 5CT7A 5TR6A 3D15A 3ETAA 3R7VA 2GTNA 2WMUA 2VTJA 3BBWA 4GU9A 3MY1A 4YZBA 4ARKA 4GFMA 5J5SA 3R00A 3NNUA 1R0PA 4XBRA 4MXZA 1XH4A 1ZYLA 5D41A 3TJCA 3ZBFA 4J99A 4YNEA 5EM8A 5JK3A 4O7NA 2Z2WA 3T8OA 5DT0A 2C0IA 4TWPA 5E91A 3PY3A 3WE8A 5HG7A 4FSNA 4YZMA 3FMDA 4O7YA 4X3JA 5DPVA 4X2JA 4YC8A 4N6YA 4MAOA 5EKOA 2XK3A 2CGWA 4E6AA 4ZLZA 3VUKA 3IW5A 2OF2A 2BMCA 1H1RA 3OTUA 4GU6A 1SZMA 4YPSA 3DDPA 3OFMA 3VS2A 4HVIA 3JYAA 4FEWA 3RM7A 1YRPA 5AUXA 2CGVA 2ZMCA 2WAJA 4JI9A 5FGKA 5FP5A 2H34A 1K3AA 4QMSA 2ETMA 2PE0A 4FTRA 3QFVA 1VR2A 5BVWA 1BLXA 3BYSA 5FQDC 3V3VA 3COMA 4Y5QA 3PJ2A 4YO6A 5T3QA 5D11A 5HBEA 1E1VA 3I7BA 4DH3A 5L8KA 4RIOA 2YA9A 4JL9A 2UZVA 3FKOA 4HOKA 3AC4A 3T3VA 4DFYA 1J3HA 2I0EA 3QCQA 3AC2A 4AW1A 4QMNA 1QPCA 2YHVA 2W1DA 3QTSA 3F88A 3TV6A 2X2LA 2XP2A 1UVRA 3ULZA 3FYKX 3ZEPA 4CFUA 4EZ7A 5H9BA 2VX1A 3ZSHA 1UNLA 3HMIA 2P3GX 1PYXA 2BRGA 4X6RA 4CKIA 3ULIA 3C4ZA 5HVJA 4N70A 3QQKA 5KBRA 5CTPA 4P2KA 4L3JA 4MBIA 4P5ZA 3FWQA 4UEUA 3FPQA 3THBA 4E1ZA 3FMEA 4O0XA 2ZM1A 4TTHB 4RJ6A 3EQBA 4CTBA 4HW7A 5HO7A 3EH9A 5CSHA 1KE6A 3OROA 2QOQA 3Q9YA 3CQWA 4F70A 4QP3A 1KV1A 3BU3A 3VJOA 2WKMA 4H36A 5CZHA 3HKOA 5AR7A 3NNVA 3VO3A 4CMUA 2ZOQA 1RQQA 3ZCLA 1ZOEA 4CYJA 2QOIA 3SV0A 4HGSA 5I5ZA 4GG7A 2UW7A 1FOTA 3F2NA 5BYLA 4MYGA 3BE9A 4IWDA 4B8LA 4BI2A 5IQBA 3QAME 1JWHA 4EOJA 3KREA 3M42A 5HI2A 5M4FA 5ACKA 4E3CA 4EHZA 4ZZNA 1GZOA 2X8DA 3CLYA 3VRZA 1WCCA 5E8WA 1KOBA 4OBOA 3VF8A 2GQSA 2YDKA 4CKJA 3D2KA 4PNIA 5DE2A 4F1OA 3HGKA 3C4WA 5TO8A 2UZTA 3FAAA 4I5HA 2VNWA 4IX4A 5I9UA 2BFYA 4GK3A 4DITA 4YJUA 1B38A 2C6TA 2NRUA 4QYGA 5CANA 1WZYA 3V5PA 3HECA 3UO4A 4RJ3A 4GUEA 5EYCA 3QU0A 4ANQA 3PVWA 2YZLA 4JDIA 4MQ2A 5EDRA 5F20A 2W06A 2YJRA 1PMNA 4DCAA 4O27B 5HNBA 1WVYA 3MB6A 4FODA 1CKIA 2OZAA 3I5NA 4MD9E 4XP0A 2Y7JA 4WUNA 3DDQA 4E7WA 4F7JA 5L2WA 3O8UA 5A14A 4U40A 3R7EA 5DMZA 1YXTA 4DFLA 4YZNA 4PP9A 5AP1A 3PY1A 1MRUA 3GT8A 3ZC6A 3GCQA 4IHPA 2YIYA 1BI8A 3MH1A 3MIAA 2ZMDA 3ORNA 3BBTB 3QQLA 4GK4A 3UBDA 3VRYA 5AP2A 4DAWA 3OWLA 3ORIA 4ANBA 4C8BA 3DBCA 3GU5A 3LXLA 4BCQA 3HRBA 3Q60A 4XG6A 4J96A 1CTPE 3DK3A 1IASA 2XIXA 1WBOA 4Y83A 3NS9A 5KBQA 5J1VA 4AT3A 3CR0A 5CNNA 2XF0A 4K1BA 4NW5A 4FIGA 4ANOA 2YCFA 4E73A 2HOGA 2JIUA 2XS0A 5EI2A 4YURA 4DFUA 2LAVA 4BCJA 5CU6A 2PSQA 3QYZA 4RG0A 5HHWA 5J79A 5J9LA 1X8BA 4I0SA 4N4SA 2XK8A 5HG5A 3BHTA 3QZFA 4MWHA 2YLEA 3BYMA 4YJVA 5CT0A 4ZJIA 3TJDA 4KIOA 3PXZA 4D2RA 5CASA 3PJ8A 5HVKA 1YHVA 5A4CA 2C4GA 3VUHA 2R3NA 5DGZA 4FC0A 4ZTNA 4DGLC 3EMGA 3UC3A 3G15A 5C01A 2GQRA 5CAPA 2ETKA 5EQPA 2Y8OA 3T9IA 1TVOA 1OECA 1XH6A 2GNHA 4AU8A 4DGGA 1YOJA 3NNWA 3W2QA 5JEBA 1A9UA 5ANIA 5C27A 3TI1A 5GZ9A 1ATPE 3F3UA 3DLSA 3R2YA 2WMSA 4UY9A 3UYSA 5HGIA 4EI4A 4QP6A 4I23A 5M08A 2WU7A 3NIEA 3I6WA 4WKQA 2QOOA 4BN1A 2EB2A 4C37A 1JSUA 5ITAA 2IG7A 1Y91A 1CM8A 3I7CA 4WRGA 3RAWA 5M51A 2XMYA 4QRCA 3LQ8A 3BLRA 5CALA 4MD7E 1FVTA 2YACA 2OXXA 1NXKA 1IAJA 2RKUA 5HCXA 4EH8A 3TIYA 1YQJA 4BI0A 2Y6MA 3MTLA 4D4SA 2VWUA 1M7NA 3U55A 1GAGA 3AC3A 3G9NA 2OICA 5AMNA 4EWHA 4GIHA 4ZS4A 3QD3A 2QLQA 4UMUA 3TV7A 3JY0A 3ODYX 1ZZLA 3EQRA 2XJ2A 3HL7A 2Z7QA 3C0IA 3IPHA 3MY0A 4FKGA 2IVVA 4QTAA 4Y73A 3ZYAA 3DKOA 3DKFA 2QLUA 2BHEA 2VTSA 2WMXA 1OL6A 4KABA 5JRSA 2IW6A 3WZKA 1H07A 5GINE 3MJ1A 3MSSA 5LCJA 5HNGA 3F66A 3DLZA 5HD7A 4CRSA 3PZEA 2GTMA 3H0YA 2C6EA 2X8EA 1GJOA 3FC1X 5HVYA 3TXOA 3D5XA 3PPJA 4M3QA 3ANQA 3GC9A 3MIYA 1YVJA 3PRFA 4FNWA 4HZRA 4IAAA 4OTQA 2HWOA 1XBAA 2V0DA 4BKYA 3TNPC 2ITZA 4UYNA 2CKPA 1M14A 4S34A 2OJIA 3LVPA 4YJRA 3V5TA 3OXIA 3LCSA 5K4IA 2PYWA 2KTYA 2FH9A 3L8PA 2W5AA 3AD6A 4I5CA 4YBJA 2HXQA 4AGDA 4ZTHA 4QYYA 5HTBA 1GIIA 4J1RA 4Y46A 5FTOA 5CI7A 5CLPA 3DNEA 3TTIA 4AN3A 3IW4A 5TF9A 4QNYA 2Z02A 4FKRA 3PXRA 2W4KA 4EOSA 2BRHA 4ZJVA 3FUPA 5E8ZA 3OUNB 3KVXA 2QKWB 2X6DA 4PUZA 3RZBA 3QQJA 3JVSA 5B0XA 3TN8A 4IZYA 3IECA 4ERKA 4U7ZA 1BI7A 2PWLA 2X8IA 5A6NA 3QKMA 4ITJA 4NCTA 5T6KA 3FZTA 4IFCA 1JBPE 4ALVA 2YISA 2Z7LA 4JAJA 4WBBB 3R7UA 4A07A 5BVOA 4S31A 4FSMA 3Q4UA 3ZONA 4II5A 4RJ7A 4Y5HA 4U3ZA 2R3RA 3LAUA 4BDEA 1H0WA 1YKRA 2FSOX 4FTNA 4RLKA 1ZZ2A 5I3OA 3IKAA 3NYOA 3UTOA 4IAFA 3PSCA 3BCEA 3D9VA 3E8DA 3Q5ZA 2XJ1A 3FQHA 5ETFA 3PSDA 4WD5A 3OHTA 4DCEA 1IAHA 4CD0A 1V1KA 2YIWA 1LEZA 1OZ1A 4OTHA 4QTBA 4FNYA 2UW5A 2PZPA 4EEVA 3V8SA 4U97A 1JKLA 3BZ3A 4KKEA 4XUFA 3OEZA 4P7EA 3TUDA 5KMNA 4BIBA 3R8ZA 1V0PA 1Q8WA 2WELA 4Z3VA 5C8KA 5J7BA 4LM5A 5IH5A 4DF3A 1YOLA 3R8PA 5FP6A 1O9UA 4NIFB 5DA3A 4R8QA 3FXWA 3QKKA 4QMOA 2W99B 2OI4X 1K9AA 1YWVA 2H9VA 2ONLA 3HV7A 1QPEA 3MI9A 3R2BA 4J95A 1OL1A 1ZYSA 1JAMA 4QO9A 4RGJA 2VV9A 2V55A 2VTOA 3Q5IA 4O6LA 3HEGA 3KB7A 3IDBA 1ND4A 4FV4A 2XEZA 2H6DA 3IOKA 4F7LA 3OT3A 4FTCA 4KKHA 4JR7A 2J90A 4FVQA 4YJPA 4JX7A 5HCYA 2J5EA 2A19B 2Y4IC 3R9DA 5EKNA 1W98A 1OIRA 2ITUA 2RFEA 3VJNA 3AT4A 1H1QA 3I81A 4IEBA 4ZSJA 3R9HA 4YJQA 5IQEA 4LOPA 3VW6A 4AN2A 3FE3A 4BBMA 4GT3A 3CD3A 5CNOA 1JLUE 2RIOA 3HV5A 3TCPA 1H01A 4KBKA 1E1XA 3LFCA 3SXSA 2OIQA 4CV9A 4USDA 3ZLSA 2XYUA 3TDWA 3FL5A 5BYYA 2J0MB 4LL5A 3ZXTA 4AZWA 4E5WA 2JFLA 4RWKA 3ZBXA 4AA4A 2OJJA 1PF8A 2PVRA 4F6SA 2BHHA 4KSPA 5KMIA 4C35A 3RKBA 1FPUA 4IZAA 4OT6A 3UP7A 3NUAA 1W0XC 4AT4A 2JEDA 5H8BA 4BYIA 3KCFA 5AADA 1XH9A 3CGFA 3IK3A 4M66A 3UG2A 4ZSAA 4E6CA 2XUUA 5CF8A 2VX3A 2Q83A 3ZO3A 3VIDA 3D83A 4FKSA 4CTCA 4D2WA 1OI9A 4G17A 5A46A 3G33A 3TUCA 2CHLA 4LMNA 1H0VA 3PXKA 3PP0A 3HV6A 1UWHA 2BRMA 3PXQA 4ZSLA 1H1PA 1O6YA 5ANEA 3RWPA 3GCUA 3KMWA 2QR7A 3P7CA 4F7SA 4G3CA 3C5UA 1S9JA 3RCJA 1QL6A 3LXNA 4DE4A 3LCTA 2VTAA 5M53A 4M12A 5LWNA 2J7TA 4D9UA 4FZ7A 1K2PA 5CSPA 3LPBA 3RALA 2CNQA 3HMNA 4FV6A 2C5YA 4I6QA 4LI5A 2C6OA 2QG7A 5IA1A 5AP6A 2PZRA 3QHWA 4R6VA 3NW7A 3TL8A 4RSSA 3BEGA 3N9XA 3NUPA 4O22A 3W18A 3WF9A 1R78A 2WIPA 2YCQA 1MRYA 2J0KA 1OL2A 1P14A 2BAQA 1OIQA 2W4OA 3OOGA 3P9JA 4FV9A 4KIQA 3VQHA 4CRLA 5E8VA 4Y95A 4RIYB 3LFAA 3MESA 2PZ5A 1SYKA 4BZDA 2YIQA 1F3MC 1YW2A 3FMJA 3DTCA 4NM0A 3UNJA 2I6LA 5DT4A 3NCZA 4BWPA 3NIZA 2E9PA 3QA8A 4C2WA 4OTFA 2IVSA 2WHBA 1WBSA 3LCDA 3QRUA 4HJOA 1FBNA 4J97A 2QU6A 5KKRB 3W33A 2YIRA 3P5KA 3TKIA 2IPXA 4BF2A 4XRJA 2JDOA 2XNOA 1J91A 5FWKK 4FR4A 5EQYA 5IDPA 4Q5EA 2OF4A 3QCYA 4QYFA 2QODA 3PLSA 4R5SA 2BALA 3ZUTA 3TM0A 1CSNA 1ZLTA 5HX6A 5HBHA 4USFA 4V0GA 2HZIA 5D7AA 3QF9A 4GRBA 2BTSA 4FTJA 4X3FB 4E4XA 3D5VA 2XRWA 4F0IA 4NH1A 5E4HA 2GSFA 3KN6A 2ZDUA 1YI6A 3UDBA 4Z55A 3FHIA 3HDMA 1KV2A 3NAYA 3I4BA 3GBZA 3FYJX 2AUHA 4CNHA 4PQNA 1H8FA 3W2RA 2IWIA 3E63A 3OD6X 4R1VA 4ZTLA 5AJQA 2WMWA 4KIKB 5D9HA 4APCA 2GCDA 4IZ7A 4M69A 3PE2A 5DRBA 4RJ8A 2R3MA 4PTGA 2C6LA 2ITWA 5CAUA 4CZYB 3A61A 4FKTA 2C3JA 3OCGA 3VS7A 3EYHA 3AT3A 3H9RA 1XH8A 3BHYA 4HGEA 4YHFA 4DH1A 4BR3A 3H0ZA 5EHYA 5IH6A 5M4IA 4L43A 3BGZA 2F4JA 3DV3A 4NJDA 3RJCA 3TV4A 2YFXA 3RAKA 3ZRMA 5BVFA 5IEXA 2J0LA 4U45A 4DGOA 4LGHA 3TNHA 4EUUA 3G90X 2B52A 3L9MA 1MQBA 3ORPA 4JBVA 3FY0A 1G5SA 2VTLA 4QPMA 5CY3A 2XNPA 4S32A 4J98A 4AQCA 3PDTA 3CTJA 4PDPA 2R3HA 4QTCA 3TZ9A 3MJ2A 2VU3A 4A9SA 4E26A 4EOIA 5M09A 3ZLWA 2CKEA 4C4IA 3B8QA 3A2CA 4U79A 2UW4A 3CC6A 4W9WA 1OM1A 4O96A 2OW3A 2R0IA 3ACKA 2J9MA 3QL8A 4ACMA 2PVLA 5EK7A 3BQRA 1YXXA 3MPMA 3R1YA 3K5VA 3L8VA 4FKJA 4GT5A 4HCTA 1PKDA 2OK1A 3RNIA 3VULA 4H05A 5AR4A 2BZJA 3H9FA 3OG7A 3W10A 5BX0A 3NEWA 4H3QA 4L52A 3U4UA 5I9WA 5K5NA 5AV2A 4ITHA 3KF7A 2ITNA 4NEUA 5ANDA 3DCVA 1OKZA 3MPTA 3QRIA 5J9ZA 4BKZA 2B9IA 1NW1A 3KXHA 1F0QA 1OL7A 3FMMA 2HZ0A 5HE2A 3QUEA 4IWPA 3F6XA 1XH5A 4EHGA 2O65A 5A4LA 5HD4A 2CJMA 5F9EA 2WOUA 2GMXA 3AMYA 2C6KA 4IB3A 5B2MA 4O21A 3U6HA 4YLJA 1H26A 4ZLOA 4DEEA 5CAQA 3KC3A 2VWZA 3GP0A 4NJ3A 4UYAA 1YWRA 1YDSE 3RI1A 3KGAA 4GMYA 4GH2A 4CLJA 4OAVB 5DI1A 2BAJA 4NZWB 4TL0A 4QTDA 4HPUE 1M2RA 2JKMA 4I1ZA 3RINA 4UMRA 3A7JA 1YXUA 3WF8A 1E9HA 5IQAA 1SVEA 3MYGA 3GOKA 3PXFA 3GGFA 5E8UA 4BL1A 3VHEA 3SQQA 4TYIA 1OUKA 3IQ7A 3R0TA 2FVDA 4P5QA 5HZNA 2JKKA 3DTWA 2VRXA 3QUDA 3NRMA 3TZ7A 4O38A 3ZMMA 5C8NA 2R64A 4YMJA 5TKDA 3Q4CA 5BUJA 2IZTA 4NT4A 3E64A 1DAWA 1ZYCA 3A7GA 2Y0AA 3IW7A 4KNBA 3KKVA 3W32A 2P4IA 2VWWA 4XEYA 3A62A 4PL3A 4D9TA 1VZOA 3FZPA 3ZHPC 4YC3A 4DHFA 4OTIA 2GDOA 3CY3A 5DH3A 4ZXTA 4L7FA 3LFFA 4GYGA 5AR2A 3OWKA 3C9WA 3ALOA 3RMFA 4WNMA 2B9HA 1YXSA 2WQNA 4J7BA 4NL0A 5HX8A 4PPCA 3AC8A 4O7TA 3EN6A 3KMUA 4IM2A 4RX5A 5E90A 4EH5A 3CD8A 3EQCA 2J50A 1CKJA 2YJSA 4AG8A 4GK2A 2JAVA 1R3CA 3MVLA 2UW6A 3FZ1A 3SG9A 1BYGA 3Q9XA 2W1CA 3EQPA 4H3BA 2SRCA 3UO5A 3H10A 4MH7A 1IA8A 1BKXA 4K8AA 4A4LA 3SGCA 2HELA 3PWYA 4LV5A 2XJ0A 1F5QA 2WEVA 3BU5A 3U9NA 3WIKA 2PVYA 4LOOA 2C0TA 1NVQA 2C6IA 3QZGA 4XMOA 3ZSGA 3SOAA 1S9IA 5EM7A 2E9NA 4FKPA 4XG9A 3RAHA 2BKZA 1REJA 2V5QA 3FPMA 4L45A 3VVHA 2PULA 2H8HA 4FEQA 4MXYA 4I3ZA 2P55A 2VUWA 3EYGA 3QCXA 2AYPA 3UZRA 3D7TA 4E93A 4DFNA 5BVDA 3FKLA 5DVRA 3OBJA 4BDCA 5CXZA 5HNIX 3NX8A 3TEIA 3LIJA 5IDNA 2XRUA 3VWAA 3EHAA 2PMIA 1XJDA 3V04A 4FTOA 3FI2A 3PTGA 5I9ZA 4E5BA 1XBCA 3CGOA 3B2WA 3OY3A 4OW8A 3GEQA 3KXMA 3I79A 3UOLA 2BZHB 3I60A 4BWKA 3HRCA 1GOLA 3Q3BA 4DEHA 4GL9A 4FV2A 4ONAA 1FMOE 2YABA 4PX6A 5IA5A 3E92A 5EG3A 4GFOA 4DA5A 5HCZA 4TYGA 3BEAA 3W8LA 3U87A 1PXOA 3WF6A 4BZNA 2UZNA 3M11A 2F49A 3QWKA 3F7ZA 3ZO4A 3KRXA 3ZH8A 5BUEA 3TTJA 4M0ZA 2PPQA 4EQUA 5IH4A 2ZYBA 1B6CB 1J1BA 3BLQA 3MH2A 2WPAA 1WAKA 3QALE 5GJFA 3V8TA 4U6RA 5AWMA 4K9YA 4NKAA 1Y8GA 4ZSGA 3S00A 3F2RA 4O0TA 5LMAA 3EKNA 3V51A 4GIIA 3ZFYA 5M4CA 1OPJA 2YLFA 1H24A 4N57A 4CFXA 3MW1A 3L1SA 3OZ6A 5M44A 1GZ8A 4XLIA 3LFSA 4YU2A 1H1WA 4M68A 4JG6A 1ZMVA 3Q2JA 2R3GA 1QPJA 1VJYA 4TT7A 1BL6A 2BDJA 5KMMA 4AA5A 3A99A 5EYKA 4XOZA 3OMVA 3CSVA 4CFMA 2PMLX 3F69A 2O2UA 4X2KA 4BDHA 4E4LA 4EHVA 4L3LA 3MVHA 3U6JA 3FZOA 4KKGA 3VBTA 1Q41A 3WBLA 3AMAA 3QZIA 4TPTA 1YI3A 4TWCA 3Q53A 4Y72A 3UO6A 5JFVA 1ZRZA 1WBPA 4O7VA 4WG3A 4NK9A 3SC1A 2CPKE 3GQIA 2XNEA 5EI8A 4ANSA 4DFZE 3C4FA 4DEAA 5EOLA 2QI8A 4K33A 2ITTA 3ZEWA 4FEUA 3ZM4A 2WEIA 2PE2A 3R8LA 4O1PA 4C4EA 1J1CA 4B6LA 1H08A 3DBEA 3PA3A 4GV1A 3V5LA 1YI4A 2QU5A 4XYFA 3OWPA 3IGOA 4JDHA 3UOJA 4PF4A 4EKKA 4NCTC 4DT9A 4IX6A 4UMQA 2F2UA 3RPOA 3OCBA 5CXHA 3FLNC 5LARA 3VN9A 3A4PA 3ATSA 2W1HA 4BBFA 3G2FA 4QT1A 2R3OA 3TNWA 1EH4A 5J5TA 4CCBA 5LMBA 3RP9A 4CFVA 1H27A 3MWUA 4NTTA 3VUMA 4FGRA 3R1QA 4OLIA 2F7XE 4A9YA 2X6EA 3UIXA 4W4VA 3KULA 1Q8UA 2WMRA 1LPUA 4JBQA 4HVHA 1UU3A 2PK9A 3E8EA 1IA9A 3D5WA 3AGMA 1R1WA 3R7YA 5T68A 3QA0A 4U3YA 1P4FA 5FEQA 2EWAA 1AQ1A 5IQCA 4RFYA 3CXWA 2XZSA 3RHXA 1URCA 5J1WA 1WBWA 2PUUA 2WU6A 4DLJA 3VS0A 4DTKA 5FXSA 4FTTA 4X2NA 3F3ZA 4XS2A 2VO3A 3HUBA 4FG7A 3CBLA 3HAVA 1J7IA 1Y57A 3Q32A 2XYNA 3CY2A 4YPDA 4F9AA 3FL4A 5HE1A 4BICA 3OT8A 1DS5A 2YN8A 3MH3A 4QYEA 4AGUA 5AP5A 2CN8A 4LFIA 2XIRA 3O17A 3D0EA 2ONLC 4ID7A 2W7XA 4U41A 3SX9A 5AIKA 5CVGA 4BCKA 3FC2A 3POZA 4I6HA 3NVMB 2HK5A 3O0GA 3ORMA 3FHRA 4AOTA 3ZC5A 2XCHA 1OGUA 3FMHA 3GENA 4O0UA 4QMPA 4EJ7A 2FGIA 3HNGA 3R21A 4JQ8A 4ZIMA 1OBDA 4ZOGA 3E3PA 3KL8A 3ZOSA 4CEGA 3EKKA 5E1EA 2QURA 2YM7A 4NFMA 4EZ5A 5L6WL 3Q9ZA 4UZDA 4AZTA 3R9RA 4RA4A 1UV5A 4RVLA 4S30A 3WI6A 5JT2A 2GHMA 4ASZA 3TKHA 3DZQA 2J51A 4ZY6A 3BV3A 4YSMA 5AAEA 5AV4A 1GZKA 3FJQE 4TYJA 5C03A 2QO2A 3P7AA 4J71A 4O0VA 1G8SA 1TKIA 4MBLA 3OTVA 1XH7A 2VWVA 3ERKA 4JBPA 2XNMA 2F57A 5HQ0A 4EYMA 4OTRA 4F6WA 1UA2A 4YJTA 2P33A 2ITPA 2GFCA 4FKLA 4I94A 3TIZA 4EZ3A 3M1SA 1T45A 4AA0A 3GC7A 4O91A 4FF8A 3ZLYA 4BB4A 5IEYA 4GS6A 1IR3A 4YZDA 1YWNA 4MQ1A 1ERKA 3A8XA 2ZB0A 4MXXA 4CG8A 1J7LA 5BYZA 4Z7HA 3VHKA 3KA0A 4F4PA 4USEA 3OWJA 4LRMA 3ZRLA 1WBNA 5ETAA 5EW9A 3VUIA 3ZFXA 3BQCA 3NUNA 2UVYA 5AAFA 5CENA 3GXLA 3QTUA 1YHSA 2UZEA 4G5PA 2Q0BA 3O8PA 3I1AA 4BBEA 5CI6A 3LFNA 5I9VA 4EOQA 4FBXA 3SW7A 4FV5A 5ANJA 3ENHA 4IC7A 3VS4A 3P86A 2YERA 2ZM4A 3MTFA 4RWLA 3IOPA 3NUSA 4JQ7A 1PXJA 3LHJA 3BHHA 5K0KA 3UVPA 2YM8A 3D7ZA 4G6LA 4AXAA 4F1MA 4FICA 1Y6BA 4MK0A 2JBPA 2PE1A 4EH4A 1XWSA 2RG6A 3ROYA 4DH8A 5JSMA 3UQGA 4FG8A 4ALUA 3F7WA 3GC0A 3VBQA 5FTGA 2PVNA 1W83A 1Q24A 2G01A 3BLHA 3SLSA 4F1TA 4UN0C 3N4VA 2WTIA 2ITXA 4U44A 1H28A 3L8XA 2RGPA 4RPVA 2W5HA 1UU8A 3SRVB 3ZSIA 5IA0A 2QOCA 5HU9A 3BRBA 3KRJA 3UIUA 5JGBA 3TDVA 2A2AA 1QMZA 3VS6A 4IVAA 2AC3A 1Q8ZA 1SVGA 1W7HA 3RM6A 4I22A 5HTIA 2G9XA 3O50A 3KRLA 2VWYA 2YITA 3II5A 5H2UA 1HCLA 2JLDA 4A7CA 3NYVA 4FKVA 4PTEA 5FXRA 4H1JA 4TN6A 4ZTQA 1OKWA 2BPMA 1V0OA 5GNKA 5HICA 4X7QA 2GS2A 4UZHA 1G3NA 4UV0A 4W9XA 4FSTA 4X0MA 3QQFA 2R2PA 4XG2A 3VS5A 3KK8A 4U42A 3JVRA 4X6QC 2WGJA 5CSXA 3UC4A 3Q52A 5LVNA 5EOBA 4RWJA 4L00A 3VW8A 3UYTA 5A9UA 5DBXA 3E5AA 5CU4A 3C13A 4TNDA 4AZEA 3CJGA 5C1QB 3HA6A 3WYXA 3KVWA 2CGXA 3LFQA 5AUZA 4CLIA 5M06A 3DFCB 5KZ0A 2YM6A 4K6ZA 3W16A 4C59A 4TWNA 5E8SA 3IW6A 4K2RA 2DUVA 3R8MA 4BKJA 4IWQA 1Z9XA 5I9YA 4F99A 4IJPA 3DJ7A 2QOFA 4LV8A 5K3YA 4FSRA 3JS2A 3A60A 5KO1A 5EM6A 5HOAA 4YZCA 3PVGA 3EL7A 4EK6A 4ENYA 4PDYA 3CPCA 4PNKA 5BUIA 1SNXA 3CCNA 3ORTA 4JNWA 4XJ0A 5JMSA 3ATTA 3VS1A 3DXPA 3GI3A 3PIZA 3DJ5A 1Q62A 3MFUA 3QX4A 5EQEA 2C3KA 2R3JA 3D5UA 3PZHA 5LVPA 3F5GA 3FMKA 4JRVA 3VBWA 4YHTA 2XBJA 5EHOA 5C26A 2CKOA 1KE7A 4FNZA 3DAJA 3HV4A 4AGWA 4ALWA 3EQFA 2PVKA 4FSWA 1V0BA 3BIZA 4RLLA 1JKTA 2BTRA 4AN9A 4BDAA 3Q9WA 1WBVA 2B54A 2VTIA 3PSBA 3E88A 4BCMA 3UNKA 4QMVA 1VYWA 2W4JA 3OUKA 4G9CA 4BTFA 5IU2A 5JGDA 4MNEA 3UG1A 4OBQA 4EOMA 1A48A 4PTCA 5AM7A 5IQIA 3NMUF 5ANOA 3MY5A 4U80A 1QCFA 4ACGA 3JUHA 4BHNA 2ZAZA 3FLQA 2XK9A 4ORKA 4OGRA 2WQEA 2C1BA 2V22A 4IADA 3KQ7A 4U5JA 4RIXA 4XV3A 2G1TA 4ZTSA 1XHAA 4EOPA 4F65A 3GOPA 4C4HA 4HPTE 1PXMA 3MA3A 4L68A 2XKFA 4V04A 2OFVA 4Q5HA 4YJOA 4B7TA 3QGWA 3PPZA 2XNGA 4O2ZA 4RFZA 4ZSEA 4HVSA 4BDJA 4MEDA 3V5QA 1OIYA 4C2VA 2PVJA 2OLCA 4ZMFA 3NYXA 5FRIA 1B39A 4UWBA 4RBLA 2RFNA 2YM4A 5CEIA 2EXMA 3L8SA 3OVVA 5I0BA 4GJ2A 4HNFA 2PZYA 1NA7A 5D1JA 3I5ZA 4AGCA 4JX3A 5HE3A 2YM3A 2GNJA 2W1EA 2XBAA 2JGZA 2XIYA 4R3CA 4TXCA 3MVJA 4IACA 2HZ4A 4V05A 5DLSA 3W2OA 4BDBA 3HYHA 1PXIA 2RSVA 5LMKC 2R7IA 4CFFA 3KRWA 5ANGA 3SVVA 2GNIA 1XQZA 4JDKA 2R7BA 4DTAA 2JDRA 3C51A 3WZEA 4V0GB 1Z5MA 2CKQA 3PXYA 3COIA 5GIPE 1PY5A 1ZYDA 4QTEA 3ORLA 1Y8YA 3P23A 5K0XA 2VTMA 3HA8A 4IVDA 4UXLA 4YTHA 4ZS0A 4BFMA 1HOWA 4A06A 3UE4A 5E8TA 4C0TA 4JG7A 4MXCA 4WBOA 4I93A 2QOKA 1JOWB 3SXFA 3EL8A 3NZ0A 4M69B 3S95A 3GFWA 2G2IA 5FLFA 4LG4A 4AWIA 4CSVA 2W0JA 3FI4A 2YWPA 3C0GA 5DEWA 3OCSA 5DIAA 1SM2A 3PJCA 2QO7A 2E2BA 4TYHB 4C02A 4C33A 4EHEA 5JN2A 1XO2B 3S4QA 4DBXA 2HAKA 5C4LA 4LL0A 3RVGA 4BCFA 4HVGA 5LVMA 5E1SA 2WQOA 5C8MA 4FV3A 2VAGA 5M07A 2OH4A 5IEVA 4RX7A 4I21A 3GFEA 1Q5KA 2QO9A 4W8EA 5AA8A 3QC9A 4PP7A 2I7QA 4RIWA 4WUAA 4PMPA 2BAKA 3LZBA 2QKRA 5HBJA 4L53A 4MNFA 3C5IA 1O6LA 2PUIA 4E6QA 1TQPA 3HAMA 2CCHA 2Z60A 1WMKA 5JFSA 5K9IA 3PG3A 4YBKA 4FEVA 5L6OA 3ANRA 3MPAA 1RW8A 4F9YA 5CEPA 4OT5A 3IGGA 5IG1A 4BDIA
chains in the Genus database with same CATH superfamily
4G6OA 4NSTA 4AT5A 3S1HA 2J2IB 2VTQA 5M55A 3NSZA 3UOKA 1KWPA 4WOVA 4JIKA 3TACA 4PWNA 4DGMA 4RMZA 4FIEA 3QWJA 2W5BA 5FEDA 5LJJA 4S2ZA 4PV0A 3T9TA 4BGQA 1AD5A 3PIYA 1M52A 3E3BX 3BGPA 2XM9A 3DZOA 1LR4A 1U54B 4NM5A 3SA0A 2P0CA 1SNUA 1JNKA 5BVEA 3GC8A 3G0EA 4KWPA 1KOAA 2C5NA 4D1SA 2QR8A 4FE2A 4ZMEA 1J7UA 4AZSA 4C34A 2QOBA 3QC4A 4AOJA 3QTRA 4UB7A 2NPQA 3UMWA 5I3RA 2BDFA 5GJDA 4HCUA 2FUMA 3QHRA 4XG4A 2AEGA 2VNYA 4FV8A 1H00A 4U8ZA 1GY3A 3PYYA 5JQ5A 2JIIA 4LOQA 4D2SA 4PL5A 1YDRE 3C1XA 3UQCA 4YO4A 2Y4IB 4L44A 4RZVA 4WNKA 3OEFX 1LUFA 1STCE 3B8RA 1KE8A 2BR1A 3FQSA 3LXKA 5J87A 5J9YA 5ETCA 4CVAA 4AP7A 2VTHA 3TNIA 2PVMA 2UW0A 2YCSA 3E62A 2DWBA 4G3EA 4AXDA 3BV2A 1W8CA 2X9FA 5ICPA 4O0WA 2DQ7X 1Q8TA 2V7AA 3CKWA 2WIHA 3TZ8A 4AOIA 5AV3A 2JDSA 4YTCA 5AUTA 1XKKA 2OH0E 4QP7A 5CQWA 4EORA 1M2QA 3RPYA 5HIEA 3FI8A 2XNNA 4F64A 1XR1A 3PG1A 5AAGA 4IE9A 5FUTA 2F9GA 5K5XA 4OR5A 4D0XA 3C0HA 2OIDA 3Q4TA 2GPHA 3AQVA 3S0OA 4D1XA 2JDVA 2B1PA 2X39A 4F78A 4F7NA 4AX8A 4H39A 5IUGA 5AUVA 1U46A 4IVBA 4KRCA 4XV1A 5HLPA 3U54A 4XBUA 4FK6A 2XIZA 3ET7A 3L9NA 1DI9A 3LMGA 2FSTX 2FA2A 4O2PA 4AE9A 4BWXA 3U6IA 3AC5A 1ZYJA 4HNIA 4L67A 4C57A 4L42A 3BYOA 4MCVA 4FOCA 4CGAA 4YJSA 3LJ2A 2WMAA 4BCNA 4EH9A 2JKOA 2VN9A 1PXNA 4O0RA 3T3UA 3WILA 4TNBA 4BCGA 4R7IA 3V6SA 4RWIA 1XBBA 5FM2A 3W2PA 3TYKA 4X2FA 2WTDA 3BWFA 4R7HA 4QMWA 2HENA 2B4SB 4XG8A 2G2FA 3FXXA 3LCKA 3MBLA 3VUDA 2C3IB 2CMWA 3PUPA 4J8NA 3O8TA 3AG9A 2JITA 4IH8A 4TRLA 4UXQA 2YWVA 3R1SA 3FXZA 3NGAA 4RJ4A 4C38A 4A4OA 5HG8A 2PVHA 1M17A 4Q9SA 3R8UA 4C36A 3FLZA 4I92A 2B7AA 3DK6A 4ZY4A 4Z16A 2QG5A 3QTXA 1FINA 5DR2A 4D2TA 1OVEA 2WTKC 3BKBA 4PPBA 3W1FA 4XP2A 2O5KA 4BZOA 2HW6A 3GU8A 4C3RA 4FI1A 4GVJA 5EM5A 4PDOA 3SKCA 4G6NA 2YAAA 2JFMA 4XHKB 2A0CX 4FT7A 4XG3A 2IJMA 3G51A 5HLNA 3BYUA 4AACA 3D7TB 2C6DA 3FZRA 3W0NA 4O0SA 2ERZE 3OY1A 1RDQE 4JJRA 4XV9A 4MX9A 3V6RA 5BNJA 4ZJJA 3GU4A 3WYYA 4B9DA 1I44A 5EFQA 3LFDA 5AUWA 3Q2MA 2YZAA 4ZTRA 4QQTA 2GHLA 2OJGA 3A8WA 2XVDA 5LMKA 4XV2A 2YAKA 4GSBA 3G9LX 4EC9A 3UGCA 3UP2A 4NFNA 4K0YA 2C69A 5L8JA 3UIMA 4CT2A 4DEDA 2RFSA 1PHKA 3DJ6A 3WE4A 1UU7A 4IVCA 3KK9A 4JVGA 3UODA 5BQ0A 4EH3A 4BGGA 2R3IA 4RIYA 2LGCA 3HP5A 2O0UA 4EK8A 3MS9A 3QTQA 3NAXA 3OBGA 4QQCA 2VZ6A 3QX2A 2O63A 2WFYA 3RNYA 3H3CA 5DNRA 2BKKA 3BX5A 3BE2A 3HLLA 5FBNC 5JZJA 4DG0E 5KMKA 5IUIA 1REKA 3ID6C 2GQGA 3CPBA 1Q4LA 3MGYA 3QXOA 1P5EA 4IXPA 4LQMA 2ZV8A 3UIBA 4O7LA 2C5VA 2BFXA 3G6GA 4M8TA 2VX0A 2Z7SA 3VAPA 1IEPA 2IN6A 3VQUA 1U5QA 4TZRA 1OKVA 2WB8A 2XK6A 2VGOA 4MUQA 4GW8A 3K3IA 2C5OA 4FGBA 3SXRA 5CU2A 5CWZA 3W0QA 2B9JA 2WTCA 3F3WA 3QYWA 4FTQA 4H58A 4RZWA 3ZO2A 4ANNA 1W84A 4BTJA 3P79A 4BTMA 2WD1A 3W0SA 5IA2A 4ZLYA 4EK5A 4ASDA 4Y85A 3V5JA 1G8AA 2ZV2A 3KRRA 3PE1A 2QD9A 5EH0A 4AFEA 3NW6A 5JH6A 3LXPA 2G15A 4YNOA 3GCVA 1TFFA 3OW4A 3FQEA 2OXDA 4J8MA 5G6VA 4ZK5A 3PWDA 4PY1A 2ITYA 1QPDA 4QMUA 4TW9A 4A9RA 5DRDA 1L8TA 1UNHA 4I5PA 4EJNA 2C6MA 4R78A 4JQEA 3BHVA 3WZUA 5IQFA 2R3PA 5DHJA 2BRBA 4EC8A 4QEBA 3BHUA 4O83A 4DEIA 1UWJA 2QQ7A 4E8AA 2ITQA 4IAYA 4WNOA 4KINA 2JIVA 3F9NA 4Q9ZA 2QC6A 4FL2A 1PXPA 4QP1A 3REPA 4RJ5A 5L2IA 4P4CA 5CX9A 5KHXA 1JSTA 3Q04A 4QQJA 3RPRA 2OFUA 2A27A 4IB0A 4FIIA 4M97A 3RZFA 4IX5A 2PU8A 3C4XA 3DBFA 3MFSA 4QP4A 4EONA 1JKKA 5L4QA 3SD0A 4OTGA 1URWA 4HGTA 4RX9A 3VF9A 4C4GA 4QMYA 4D4VA 4U43A 4BYJA 4X21A 4CCUA 4IX3A 5KMJA 3KULB 4MXAA 3UPZA 4DN5A 4F9WA 5H8EA 1ST4A 4HVDA 4BCHA 3TNQB 3KN5A 4UWCA 4NYEA 3ACJA 3VBVA 4D2VA 3KMMA 4L3PA 4BDKA 4CMOA 5CF6A 2GNGA 3CTHA 4BCOA 4G34A 2NP8A 4AAAA 4IB1A 1UNGA 2ACXA 3K54A 1NT2A 4MWIA 4DTBA 2XNBA 3GCPA 4FT5A 5AP7A 4AE6A 2UW3A 4YHJA 3DPKA 5IMXA 4JG8A 3EZVA 5D12A 1OB3A 4ITIA 2CGUA 1VEBA 5HIBA 3SG8A 2R3KA 3NPCA 2X4ZA 3F2AA 2OZAB 1UU9A 3DQXA 3HUCA 3FKNA 2ZV9A 1M7QA 5F1ZA 2ZM3A 4C61A 4EOOA 5KX8A 4O82A 3EOCA 3QBNA 4QP2A 4ZAUA 3DB8A 1WFCA 3SDJA 4H1MA 3CQEA 4CG9A 2NNWB 3QLGA 3VS3A 3U4WA 3F5PA 4IW0A 3LJ1A 1NY3A 4C3PA 5TE0A 3GNIB 3W55A 5L6PA 2PTKA 2XKEA 5AUUA 3K5UA 5GJGA 3LCOA 4IIRA 1PXLA 4D1ZA 5KZIA 3P5JC 2C5XA 2XM8A 4AW2A 2RF9A 3CTQA 1ZMUA 3OW3A 4D5KA 3HX4A 3MDYA 2FB8A 3QTWA 2YCRA 2QVSE 4NUSA 1JQHA 4QDVA 3IONA 4XCUA 4LRJA 1G8KA 4RX8A 2BDWA 5A3XA 3PRIA 5F95A 3SW4A 3PY0A 2R3QA 2PZIA 3R8VA 4TKSA 3ORKA 3HMPA 4D55A 4KIPA 1ZY4A 5BVKA 5FDXA 4N6ZA 2R3LA 1W2CA 2VTRA 1FQ1B 3RK7A 2UW8A 2P2IA 3JXWA 3B2TA 3P7BA 4J53A 2VTTA 4CXAA 5HG9A 4UALA 2KULA 3PJ3A 5AIRA 3NFGB 4FYOA 5G1XA 3TMOA 3AD4A 5E92A 2JKQA 3FBVA 2OJ9A 4EBVA 2UUEA 4FIFA 5A4QA 4I0RA 3P0MA 5A4TA 3LM5A 4WO5A 3VBYA 4EKLA 2XIKA 3QUPA 2FYSA 3LMHA 2OIBA 2R3FA 3EFKA 2OKRA 3AGLA 5AV0A 3GVUA 4U0IA 5HTCA 4IM3A 4EYJA 4L01A 4MF1A 4FSQA 4FV0A 2G2HA 2RFDA 3F5UA 4MBJA 3JR1A 3I0QA 4WG4A 5I9XA 3QQHA 4ZP5A 2P2HA 3UNZA 2GHGA 4LGGA 5CEMA 1PKGA 2EUFB 2I0VA 3FLSA 5KUPA 4A4XA 3SHEA 2IEWA 3U9CA 4O84A 4FTIA 5CU0A 3ZLXA 4QMMA 5AR3A 1ZWSA 4FT3A 4FZ6A 4EUTA 3AT2A 2DS1A 5EYMA 1MQ4A 2C68A 2XARA 3BGQA 3DNDA 3OXTA 5HKMA 5B2LA 5CQUA 2UZOA 4UWYA 4IAIA 5E8XA 1KUTA 4LRKA 3IS5A 3LFEA 3FEGA 2I0YA 4G31A 5E7RA 4QMQA 2ITVA 5LVLA 4G5JA 3QGYA 4HYIA 5HORA 2QOLA 3F3VA 2WMVA 2Y6OA 3BU6A 5HLWA 2GS7A 4JAIA 4CFWA 4D28A 1PJKA 3KFAA 2IW9A 3HVCA 1WVXA 5L3AA 5LOHA 2CNUA 3EFJA 3S2PA 3VONA 2X7GA 2Y9QA 3COHA 2IZUA 4JIAA 3C4CA 4ASEA 4BDFA 3EB0A 4E20A 4R1YA 4KUJA 4KAOA 3R7IA 2X9EA 2WTVA 1H4LA 2H96A 3QD4A 3QTZA 4EQCA 4BI1A 3RPSA 4ACCA 4KBCA 2W1FA 2VO7A 3R30A 1FVVA 1YXVA 4FOBA 3H9OA 3MB7A 3IDPA 3EQGA 1OIUA 2J0JA 4D0WA 3QD0A 4G16A 3ZO1A 3NUUA 3O51A 3A4OX 4DHJA 2AC5A 2B53A 2UW9A 5CF4A 2NYAA 4O7ZA 3KF4A 5AUYA 3RCDA 3HP2A 4JBOA 1YOMA 4EOKA 5CU3A 3OC1A 3DGKA 2OO8X 4JR3A 4MVFA 2C1AA 2Y4PA 3QRKA 3NYNA 4O6EA 5L2SA 1DM2A 2I0HA 1BUHA 4PMMA 4ZZOA 1OPLA 5A4EA 4RVTA 3R7GA 1PRYA 4CV8A 4DH5A 4IBMA 5CZIA 4U9AA 4FSUA 3UOHA 1Q8YA 2UVXA 3QXPA 4NW6A 3NLBA 2W1IA 4FKWA 4O7SA 4XH6A 5CVFA 4GCJA 3F3TA 2QONA 3CQUA 4FEXA 4FTUA 5IA3A 3PA4A 2YM5A 1ZAOA 2XK7A 2UV2A 4FV1A 5FM3A 3EQDA 3VC4A 3FSKA 3DA6A 3PPKA 4IAKA 3NUYA 1BX6A 1FMKA 3Q4ZA 4FKUA 5CYIA 3POOA 5AP3A 4BC6A 1PMVA 2EB3A 4OAUC 5A54A 3QKLA 4MNEB 4HYHA 4JXFA 3FMLA 2BRNA 5CSWA 3WOWA 3ZS5A 3DFAA 4BDDA 5EW3A 4CKRA 4MXOA 4WG5A 2C30A 3CKXA 1SMHA 3HZTA 5M56A 4H3PA 4JRNA 4OUCA 4TYEA 3DXNA 4FUXA 4MTAA 4RIXB 4D4YA 1VYZA 3DT1A 3FSFA 3IG7A 4WSYA 3AKJA 2RL5A 4N0SA 3LLAA 5KCVA 2XB7A 4GKIA 3R22A 2BIYA 4R3PA 4DGNA 3ORZA 4V01A 3ZM9A 2PY3A 3O7LB 4B4LA 1T46A 4K18A 5IISA 2FSMX 5HU3A 5H3QA 2BVAA 5JQ8A 2PMOX 2REIA 4GEOA 4QP9A 3NW5A 2R0UA 2WQBA 2NO3A 2E9OA 3RK9A 4MD8E 3U8WA 4R7BA 4FSYA 3DK7A 4BVUA 3LOKA 4FZAB 4XLVA 4G1WA 4FKOA 3GUBA 2OZOA 4I41A 4IM0A 4RRVA 2ESMA 2GU8A 2C0OA 5AP0A 1P2AA 2BROA 2CN5A 4R3RA 4FNXA 4YGAA 4EH2A 4ZEGA 4JS8A 2YIXA 3P1AA 3PLAE 4CFNA 3AC1A 4FK3A 3FDNA 2CLQA 4ACHA 3COKA 3LKMA 5IA4A 4NKSA 4S33A 1HCKA 2HY81 5BMMA 4QYHA 3ROCA 3NCGA 5C4KA 3RWQA 3PIXA 4L9IA 4O7RA 4BCPA 5HEZA 4D2PA 4PMTA 2V7OA 4C62A 3NUXA 5D7VA 4DG2E 2JD5A 2R5TA 4UX9A 3UVRA 2OU7A 3NVKI 4G9RA 5C9CA 5IMEA 2WNTA 3MFTA 5FG8A 2F7ZE 3K3JA 3EQIA 3EWHA 3O2MA 4FYNA 5BPYA 4KS8A 5F4NA 1AGWA 2YDIA 4ENXA 2WTJA 3DBDA 2EXCX 4GT4A 4GYIA 4RA5A 3WZDA 5LWMA 2GS6A 3Q6WA 4EQMA 3UVQA 1UKHA 4FX3A 3KEXA 4YZ9A 3CIKA 4R5YA 4WRSA 4YSJA 3QQUA 3NDMA 2X81A 5DYJA 2C47A 4RIWB 3PVUA 3KCKA 3R1NA 1PXKA 3CP9A 2WMQA 5F94A 2A1AB 4NM3A 4RC4A 3DS6A 3FY2A 3PA5A 5B7VA 5CS6A 2BIKB 2I40A 5EW8A 2IVUA 4C7TA 1TQIA 3WARA 3D4QA 5IQGA 2X7FA 1FGIA 3RBWA 2VGPA 1GIHA 2GNLA 3EJ1A 4DBNA 4EK4A 3M2WA 3WF5A 5CEKA 2J6MA 5JGAA 1R39A 4FTKA 3PJ1A 3CJFA 4WA9A 4CZUA 4CT1A 5LVOA 1FVRA 5AV1A 2O3PA 4O1OA 3MH0A 3OCTA 4AF3A 4CQGA 5CAVA 4GUBA 4FTLA 4PDSA 2WZJA 1JPAA 1MP8A 2HYYA 4A9TA 1APME 2W1GA 3CE3A 3LM0A 4IB5A 5FEEA 3RHKA 4AUAA 4DFBA 3DOGA 2PMNX 3S3IA 5CSVA 5DFPA 2WMBA 3DAKA 1KSWA 4F9CA 2V62A 4E5AX 2O64A 3UJGA 1PW2A 3D14A 3EFWA 4YTIA 4I6FA 1JVPP 1PMEA 2IZSA 5L2TA 2JDTA 5D10A 5FTQA 3RPVA 2EXEA 3O71A 3R63A 4DG3E 4OTWA 2YDJA 3MV5A 3NR9A 4L6QA 4WIHA 5IPJA 5JFWA 5HIDA 4O4CA 3EN4A 3VNTA 3PP1A 4ASXA 2UZWE 3F82A 3KXGA 4FKQA 3R04A 2JBOA 3DU8A 4PL4A 2R9SA 2FSLX 3HDNA 5JZNA 3V01A 4I6BA 3ZUUA 4CQEA 3UZTA 4I24A 5ETIA 3I6UA 1U5RA 5AX3A 2WO6A 4E4NA 4DDIA 3AD5A 3LLTA 3GB2A 4AZFA 2PL0A 3SRVA 3LQ5A 5KNJA 3GU7A 4HYSA 4Y8DA 5B2KA 3RTPA 3E7OA 2X4FA 5J8IA 2J5FA 1M2PA 4HCVA 4IZ5A 1PMUA 4LGDA 5EYDA 5GIOE 3RAIA 5M57A 4LUDA 3QTIA 4ZZMA 3W2CA 4XX9A 2GNFA 3TKUA 2WTWA 5AX9A 3EN9A 1GNGA 4C4FA 3FI3A 2X7OA 4QPAA 3DY7A 4DEBA 3R73A 3FV8A 3NWWA 4HZSA 5GZ8A 2UZLA 5EHLA 5AR5A 3V8WA 4WNPA 4QMLA 4RQVA 4PPAA 3L9PA 4XOYA 3A7FA 4KA3A 2OJFE 5KKRC 3AOXA 4UMPA 4KB8A 3C50A 4FL3A 4IDVA 4JT3A 5HESA 3IO7A 5AR8A 1Y6AA 5KE0A 2GFSA 3EQHA 4MHAA 4TWOA 3LJ0A 4L7SA 2ETRA 4L46A 2VO6A 5A6OA 4WSQA 4C58A 4FVRA 2E9UA 4BDGA 1ZY5A 5CF5A 3FZSA 3FLYA 2BCJA 2J4ZA 2OWBA 4JOAA 2BZIB 4X3FC 2ZDTA 5DG5A 2XCKA 3ZRKA 1CDKA 5ANKA 1DI8A 3IDCA 3LMIA 3OF0A 2F2CB 4G2FA 4M15A 4FA2A 4DH7A 3TT0A 3AXWA 1NVRA 3W8QA 2BILB 2C3LA 4M84A 3G6HA 1W82A 3QQGA 5LCKA 2XH5A 4K11A 3MFRA 4JDJA 2X0GA 4IJ9A 5BMSA 5M4UA 5CEOA 3ODZX 2OSCA 3V5WA 2IO6A 4E6DA 4LYNA 1OL5A 3RK5A 5LQFA 4M14A 4YUQA 4FT0A 4J52A 5HE0A 2VWIA 5DOSA 3QLFA 1YHWA 1DAYA 3R01A 3UQFA 4W4WA 1ZOHA 2VWBA 4QMTA 3I0OA 3ZDUA 1Q3DA 4D4RA 4M7IA 4FIJA 2PUPA 4QMXA 2CNVA 3G5DA 4QNAA 3L9LA 4EBWA 3WZJA 1H1SA 2HCKA 4BIEA 5JFXA 4EH7A 1IRKA 2CCIA 1JSVA 3GQLA 3DQWA 1Q3WA 1WBTA 2UZDA 3P08A 4NM7A 3TZMA 3VUGA 4GFGA 4ANLA 1JKSA 4G3DA 5KMLA 5FXQA 1ZMWA 4HGLA 2QCSA 5IZFA 3ZTXA 4CMTA 3ALNA 1P4OA 3LFBA 4I4EA 1ZOGA 3GU6A 4XNEA 4P90A 4IQ6A 3MVMA 4AW5A 4FZDB 3ITZA 2XAMA 4IDTA 1KE9A 4EL9A 3D94A 1GZNA 2NRYA 1ZARA 2ZB1A 3BPRA 4IAZA 5J7HA 4LMUA 2QHNA 2WQMA 5DEYA 4K77A 4EH6A 3AKKA 5J95A 2W96B 2WOTA 2QHMA 2XKCA 1CMKE 2HZNA 4FV7A 4NIFA 3C4EA 4NU1A 3F61A 4XG7A 4F08A 1KE5A 4ZY5A 4B99A 3H4JA 2EU9A 1NVSA 3PVBA 4DEGA 2VWXA 4E4MA 2UZBA 4FSZA 4AAYA 2ZJWA 4DT8A 1MRVA 4WT6A 4L8MA 2CDZA 1CKPA 2F7EE 2Z7RA 3TG1A 1Z57A 3BWJA 4UBAA 1L3RE 4BIDA 4W8DA 1OMWA 5HO6A 3P4KA 4O4FA 4Q2AA 5FD2A 4DFXE 2X2MA 4QPSA 3E8CA 3LQ3A 3ZUVA 4M0YA 2XEYA 5GHVA 2O8YA 3R83A 4X2GA 3E93A 2BUJA 3P78A 1OITA 2XA4A 3EZRA 3ORXA 5FBOA 3UZPA 4GG5A 4AZVA 4PRJA 1VLRA 3RGFA 2A4LA 3A7IA 2UZUE 2E9VA 3K2LA 5KHWA 4I20A 4MKCA 3SOCA 1U59A 5AP4A 2B55A 4ZTMA 5AFVA 1UKIA 1H25A 4OBPA 3KU2A 3SAYA 4C3FA 2YEXA 2R4BA 5IQDA 4XRLA 3EN5A 4YC6A 3WIGA 2IVTA 4DYMA 5LXMA 3ZZWA 4IWOA 2DYLA 3CEKA 4LUEA 3R7OA 4FVPA 4DLIA 3O96A 3N51A 1FGKA 4TYHA 3OXZA 2UVZA 2IW8A 5TOZA 1OKYA 2HY0A 5HO8A 4PMSA 5AA9A 4FIHA 4RT7A 3UMXA 4DDGA 4C4JA 4R77A 3MA6A 4FTMA 4M67A 4UMTA 4BGHA 3QRTA 3D2IA 2OXYA 4BY9E 2W9FB 3O23A 5L2QA 3R9OA 2VO0A 4OTPA 4F09A 4YR8A 5I4NA 4OTDA 2PVFA 4G3FA 2ITOA 4JLCA 4KSQA 5K4JA 5L8LA 3UPXA 4D58A 4MF0A 5AEPA 3PUFC 2OGVA 5EDQA 1BL7A 4APPA 3EN7A 1ZXEA 2XK4A 2BZKB 4AXFA 4YTFA 3DAEA 4FKIA 3WF7A 4AW0A 2W05A 3OOMA 2WXVA 4YLKA 3ZXZA 4O81A 4EWQA 2CLXA 1MUOA 3R6XA 4O7WA 4KRDA 4BJJB 4FUYA 5GZAA 3QD2B 3ENMA 2XKDA 4RVMA 4DINA 4F9BA 4FMQA 4FT9A 3IW8A 2PHKA 3QCSA 3QZHA 4KS7A 3O7LD 4RC3A 3W2SA 4B8MA 2VTPA 1U54A 3BI6A 4BTKA 4I5MA 1U4DA 4Z7GA 5IF1A 4IC8A 1YDTE 4ANMA 3BYVA 1OBGA 5DT3A 1RJBA 2IZRA 2X1NA 3BELA 4ERWA 5IKWA 3AKLA 1LEWA 1OUYA 4F6UA 3HMMA 3AMBA 3KY2A 3FLWA 3H30A 2HW7A 4O0YA 2EVAA 4YJNA 3DBQA 4RVKA 5H8GA 4AS0A 5KMOA 2IF8A 3GCSA 3OP5A 3JY9A 3VBXA 3C7QA 5IQHA 4IMYA 3VUTA 4O4EA 4O86A 3E7VA 2Q0NA 3MN3A 3ELJA 4CZTA 3Q96A 5BVNA 4BCIA 4X3FA 4B0GA 4YP8A 4YLLA 4W4XA 3KXXA 4DC2A 3R28A 3ZDIA 4U81A 3CS9A 3G0FA 3R02A 2X0QA 4FL1A 3EFLA 2WMTA 2ZVAA 2QOHA 5EI6A 4NTSA 4KD1A 4KIKA 2W17A 4Z9LA 3ZU7A 3W0MA 3HMOA 3Q6UA 4IANA 4FZFB 2WTKB 4QQ5A 5DWRA 2QNJA 4KBAA 4RFMA 2PUNA 4XP3A 3DKGA 3FMNA 4QMZA 3E87A 2W9ZB 4AFJA 3DXQA 5AM6A 3N4UA 1OPKA 4EOLA 4BRXA 5DR9A 4M13A 5IUHA 2X2KA 1Q97A 5EDPA 3A7HA 3KXZA 4ACDA 5JRQA 3LE6A 1RE8A 2VTNA 3TUBA 3TWJA 3DKCA 2ZV7A 2CSNA 2HWPA 3HRFA 4GVAA 5E8YA 4EK3A 5CAOA 5JKGA 2JC6A 3N4TA 3F5XA 4A9UA 4FG9A 5DR6A 5ACBC 5CVHA 1I09A 1A06A 1SVHA 3EIDA 4TY1A 2Z8CA 1GIJA 1WVWA 2HIWA 3E8NA 4I4FA 4WHZA 2B0QA 5TT7A 2J0IA 3HV3A 4I0TA 2ERKA 4F0FA 4NWMA 3OS3A 4GKHA 1Q99A 4F0GA 1Q61A 4IFGA 1IG1A 2B9FA 3LW0A 3QRJA 4QP8A 4BHZA 1LP4A 4QD6A 4F63A 3ZFMA 1BMKA 2JAMA 2W1ZA 3R71A 2FO0A 4HYUA 3NNXA 4QOXA 3ZZEA 5E9EA 4D5HA 4RC2A 3JPVA 1PYEA 5DN3A 4GJ3A 2OBJA 5CEQA 2OG8A 3KXNA 2VD5A 2RG5A 4W4YA 3R9NA 5FDPA 3PFQA 2HXLA 1O6KA 3U51A 4CYIA 1TQMA 1R0EA 3DB6A 2I1MA 4FTAA 4G3GA 4RQKA 5CT7A 5TR6A 3D15A 3ETAA 3R7VA 2GTNA 2WMUA 2VTJA 3BBWA 4GU9A 3MY1A 4YZBA 4ARKA 4GFMA 5J5SA 3R00A 3NNUA 1R0PA 4XBRA 4MXZA 1XH4A 1ZYLA 5D41A 3TJCA 3ZBFA 4J99A 4YNEA 5EM8A 5JK3A 4O7NA 2Z2WA 3T8OA 5DT0A 2C0IA 4TWPA 5E91A 3NFFB 3PY3A 3WE8A 5HG7A 4FSNA 4YZMA 3FMDA 4O7YA 4X3JA 5DPVA 4X2JA 4YC8A 4N6YA 4MAOA 5EKOA 2XK3A 2CGWA 4E6AA 4ZLZA 3VUKA 3IW5A 2OF2A 2BMCA 1H1RA 3OTUA 4GU6A 1SZMA 4YPSA 3DDPA 3OFMA 3VS2A 4HVIA 3JYAA 4FEWA 3RM7A 1YRPA 5AUXA 2CGVA 2ZMCA 2WAJA 4JI9A 5FGKA 5FP5A 2H34A 1K3AA 4QMSA 2ETMA 2PE0A 4FTRA 3QFVA 1VR2A 5BVWA 1BLXA 3BYSA 5FQDC 3V3VA 3COMA 4Y5QA 3PJ2A 4YO6A 5T3QA 5D11A 5HBEA 1E1VA 3I7BA 4DH3A 5L8KA 4RIOA 2YA9A 4JL9A 2UZVA 3FKOA 4HOKA 3AC4A 3T3VA 4DFYA 1J3HA 2I0EA 3QCQA 3AC2A 4AW1A 4QMNA 1QPCA 2YHVA 2W1DA 3QTSA 3F88A 3TV6A 2X2LA 2XP2A 1UVRA 3ULZA 3FYKX 3ZEPA 4CFUA 4EZ7A 5H9BA 2VX1A 3ZSHA 1UNLA 3HMIA 2P3GX 1PYXA 2BRGA 4X6RA 4CKIA 3ULIA 3C4ZA 5HVJA 4N70A 3QQKA 5KBRA 5CTPA 4P2KA 4L3JA 4MBIA 4P5ZA 3FWQA 4UEUA 3FPQA 3THBA 4E1ZA 2XALA 3FMEA 4O0XA 2ZM1A 4TTHB 4RJ6A 3EQBA 4CTBA 4HW7A 5HO7A 3EH9A 5CSHA 1KE6A 3OROA 2QOQA 3Q9YA 3CQWA 4F70A 4QP3A 1KV1A 3BU3A 3VJOA 2WKMA 4H36A 5CZHA 3HKOA 5AR7A 3NNVA 3VO3A 4CMUA 2ZOQA 1RQQA 3ZCLA 1ZOEA 4CYJA 2QOIA 3SV0A 3KIOC 4HGSA 5I5ZA 4GG7A 2UW7A 1FOTA 3F2NA 5BYLA 4MYGA 3BE9A 4IWDA 4B8LA 4BI2A 5IQBA 3QAME 1JWHA 4EOJA 3KREA 3M42A 5HI2A 5M4FA 5ACKA 4E3CA 4EHZA 4FJVA 4ZZNA 1GZOA 2X8DA 3CLYA 3VRZA 1WCCA 5E8WA 1KOBA 4OBOA 3VF8A 2GQSA 2YDKA 4CKJA 3D2KA 4PNIA 5DE2A 4F1OA 3HGKA 3C4WA 5TO8A 2UZTA 3FAAA 4I5HA 2VNWA 4IX4A 5I9UA 2BFYA 4GK3A