3B2TA

Structure of phosphotransferase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
305
structure length
288
Chain Sequence
SEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPQMTFKDLVSCTYQLARGMEYLASQKCIHRDLTARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor receptor 2
publication title Structural basis for reduced FGFR2 activity in LADD syndrome: Implications for FGFR autoinhibition and activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 288
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3b2tA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3b2tA01
1WBSA 4C59A 4EOPA 4OTDA 3ROCA 2FSLX 3CXWA 3ORKA 4YNOA 2ITTA 1JOWB 3AC2A 4RVLA 3Q3BA 2VNYA 3MFRA 4U3YA 3PVBA 4NL0A 4HPTE 4BTFA 1GZ8A 1Z5MA 4ZLZA 1XQZA 3BX5A 3UOKA 4AA4A 3AMAA 1WMKA 3ANRA 5D11A 4CKJA 4D9TA 2KULA 4YO4A 3QUEA 3BE9A 4YPSA 5CXHA 5C8MA 3ZRLA 3OCBA 4I24A 4AZTA 1ND4A 1JBPE 4EH4A 3FJQE 2E9OA 3ACJA 4BBEA 3KN5A 1GOLA 4LYNA 4R3CA 3OOMA 3MA6A 5AA8A 4O84A 2J0JA 5EYMA 3OCTA 2JDRA 3RNYA 4H1JA 5BMMA 3S3IA 4JX3A 5GIPE 1BUHA 4ENYA 1XBCA 3CGOA 2QNJA 1P2AA 1J91A 4FSNA 4ANOA 4RIXA 3LQ3A 4FV1A 3KK9A 3O8PA 4XG7A 5BYZA 4CKRA 4RGJA 3BHTA 4MD9E 4IDTA 4S34A 3T9TA 5AP1A 4W4XA 3OT3A 3FMMA 1B38A 1KE7A 4E1ZA 4ITHA 2YISA 4UZDA 4X2JA 2C5YA 2GHLA 4ZY6A 4ANBA 3VIDA 3LZBA 5EOLA 3R01A 4U6RA 1WAKA 3E63A 3NRMA 4BCIA 3Q4CA 4I92A 3RCDA 2J0KA 2VTIA 3JYAA 3HA8A 1LEZA 3KULB 3CQWA 2WZJA 4S2ZA 5C8KA 3SG9A 3LLTA 2QO9A 2I40A 4FVRA 2E9NA 3F5GA 4MBLA 3R22A 4DH3A 1MUOA 5ANOA 4MXOA 2ITVA 3P78A 3I7BA 4FV6A 4HGLA 3R7VA 4F1MA 4C4GA 2W05A 3UVPA 1DI9A 4EH2A 4K8AA 5L6WL 3R02A 3QZHA 2W99B 1FVVA 2GFSA 2WMVA 4JRVA 4BDEA 4BDAA 5A14A 4F1OA 3QKMA 1QPCA 5EYCA 3LFDA 4C4JA 1ZOGA 4GFMA 3TJCA 2VWVA 3A8XA 3HV7A 4G3GA 4F4PA 3SOCA 1SZMA 1WBWA 3VUTA 5IKWA 2ZMDA 3D5VA 4QP9A 5KMIA 4OTHA 2OO8X 2BRMA 1JKKA 1K9AA 5HLPA 2QOQA 3OP5A 4EBVA 3C7QA 4BY9E 2C6TA 4HVHA 2OU7A 3Q5ZA 1SNUA 4F0FA 4JVGA 4GYGA 4XG8A 4ACDA 4YUQA 1H0VA 3QC4A 5HCZA 5AADA 2PZYA 1FMOE 4AZEA 3UZTA 2XKEA 4FBXA 5C4LA 2UW4A 3CTQA 4RIOA 2PYWA 4U79A 4L9IA 4CEGA 4H3QA 4D58A 1OIRA 3GFWA 4PTGA 5BYYA 3ORIA 3CJFA 4MXAA 5DI1A 4ASDA 1IR3A 5CAQA 4U41A 2XIXA 3ENMA 4BWPA 4XOYA 2V7OA 3L9PA 4FKWA 3PJCA 5IEXA 2FB8A 2JFMA 2CNVA 2HW7A 4JBOA 4MBJA 4BZDA 1PXIA 4PP9A 2A2AA 3DB8A 5CEQA 1S9JA 3LQ5A 1W0XC 3O8UA 4YHTA 3C13A 1UU3A 5F94A 3UMWA 5CAVA 3GU5A 4QP7A 2PZPA 3OTUA 2JDTA 3F3UA 3JR1A 2PWLA 4R3PA 4WRSA 1W82A 4RVTA 3SVVA 4AWIA 3H0ZA 2QD9A 3HX4A 2O2UA 4V04A 4D4SA 2CDZA 4U42A 4EONA 4K9YA 4AGCA 4E4MA 3FV8A 4I5PA 4G5JA 3BQRA 4D0XA 3QRTA 3Q53A 1ZMWA 1ZYSA 2PVMA 3HAVA 1Q8YA 3CY2A 3JVRA 3QCQA 2QO7A 3NUXA 1LPUA 3D2KA 4CKIA 3GCSA 2YIXA 3R7UA 5HG5A 1VEBA 3MH1A 4IVBA 3VS2A 3NX8A 1ERKA 4BCGA 4Y5QA 3PE1A 2WQMA 3C51A 2BTSA 4I1ZA 4NJ3A 3QTQA 3ZYAA 3KC3A 2YITA 3DBEA 5IU2A 3FMDA 3O50A 4LOQA 2XNPA 1YXTA 4EZ7A 1VYWA 2PZIA 3NW5A 3Q9XA 4M3QA 4IIRA 4QYEA 4DGMA 4EZ3A 4YTFA 3N9XA 2C5OA 3I0QA 4JQ7A 3NNXA 2C6IA 4ZTSA 4XP3A 2WMXA 3VUHA 1CMKE 4YC3A 5CU6A 4AFJA 4DEIA 5C8NA 4EH5A 3QUPA 4HVSA 5ANDA 3HV4A 4HYUA 4J96A 4FICA 3ZBXA 4TKSA 5I9VA 3ZSGA 3EMGA 3QC9A 3DCVA 4FC0A 3D15A 4L3LA 4PUZA 3DK7A 3O2MA 1JSVA 2Y4IB 2OFVA 2W4JA 1RE8A 3NWWA 1PXMA 1UVRA 2YZLA 3ULZA 1URCA 3TIYA 4BZOA 3RCJA 2HYYA 4UWBA 3GQLA 4LFIA 5M4FA 2VUWA 2VGPA 4UYAA 3UO4A 4NTSA 4R7BA 1WBOA 1OKWA 2R3PA 3HVCA 3DQWA 3FLSA 3UIBA 3BIZA 3UP2A 4EH9A 4YLJA 1J7UA 4RJ7A 5KHXA 3BGQA 3UC4A 4DHFA 3V04A 4EOOA 1W83A 4OTFA 5HVJA 3NUAA 4G34A 2NP8A 4XEYA 2Y6MA 4LV5A 2GHMA 2C3LA 3C50A 1GIJA 3EN7A 3FPMA 3N51A 4OTPA 5HI2A 5TO8A 2YACA 3RALA 4RJ6A 4AOJA 3MVMA 5HE1A 3W2PA 2WFYA 4I5MA 4BHNA 4FV4A 1WBNA 3V5JA 4L46A 1UNGA 1URWA 4LMNA 4JOAA 3R30A 2QODA 3FC1X 3SGCA 1U46A 1NVRA 1PHKA 1KWPA 4ARKA 2G2HA 3FZOA 5LWNA 5F20A 4NJDA 3GCVA 4D2SA 2ZB0A 4HYHA 2X4FA 2WMWA 3MGYA 2BZKB 5IEYA 2R7BA 2XNBA 3GVUA 3Q9YA 1VZOA 4EBWA 4IWDA 1IEPA 4EJ7A 3R21A 3FI4A 4ZS4A 3WF7A 5C03A 4JG8A 2Y7JA 3RK5A 4TNDA 3UPXA 4PDYA 3OWJA 2UV2A 1UU7A 4F0IA 4XV3A 2J4ZA 3EFLA 5AIKA 3UMXA 3HGKA 3II5A 2QU5A 5DR6A 4ZMFA 3EQCA 1AQ1A 4IH8A 5E7RA 3D2IA 3KQ7A 4PMSA 4X3JA 3DPKA 1ZYDA 3O17A 3VS7A 3FL5A 2J5EA 4FIJA 3VBVA 2YIYA 3QALE 4G5PA 3GXLA 5HVKA 4QD6A 2OJGA 3GB2A 3EWHA 4RX8A 5DT3A 3ZEWA 4WT6A 4EWQA 3TUBA 4I6BA 5B2KA 3TV7A 4RZVA 1OUKA 3COMA 2R3QA 2PVYA 3DQXA 2PUIA 2CKQA 3FSKA 3C0HA 5F95A 4FSQA 5HG8A 2P2IA 5LCKA 3S95A 3QF9A 4F9BA 3ET7A 3HYHA 1H1PA 3JS2A 5IDPA 2CJMA 3GCQA 4YLKA 4E4LA 2ZJWA 3OEZA 2CGUA 4KABA 2CLXA 4RWLA 2PZ5A 3TTIA 4O7RA 3FKNA 3P7BA 2GS7A 1H1QA 4FV2A 1R0EA 2FSMX 4JR7A 4WUAA 4EK4A 4AT3A 4HW7A 3P1AA 1ZLTA 2VTNA 2XRUA 2IZSA 4DE4A 3I79A 3MWUA 2GQRA 4RPVA 4C4FA 4WOVA 2WEIA 4X21A 3C5UA 3R8ZA 1Q8WA 4O22A 1OIYA 2XEYA 4CMUA 3L9MA 3SV0A 2OICA 2JKQA 3PA3A 3VS5A 5CALA 4OT6A 4EH3A 1UNLA 5I9WA 1YWVA 2A1AB 1H1SA 1J1BA 5DE2A 5LJJA 2WTDA 2NRUA 3JY0A 5H3QA 4DFXE 4NH1A 1ZYJA 5I0BA 4O38A 4MWHA 3S1HA 3MESA 5DIAA 3WIKA 4FNYA 2VO6A 4G3CA 5EM6A 5CT0A 4C36A 2B7AA 2XNOA 4YZCA 4WHZA 3ZXZA 3JPVA 4AG8A 2QONA 3H4JA 4EOJA 4GKHA 4H36A 4FKQA 3SAYA 3IONA 3QU0A 4IVCA 4TZRA 5EW9A 2ONLC 3FUPA 4R8QA 4AE9A 3QFVA 3KMWA 5AP0A 3UBDA 2WHBA 4JJRA 5HO6A 5M51A 3QCYA 3QUDA 1GIHA 5KBQA 3VVHA 3FC2A 4DT8A 1QL6A 1WBTA 3TZ9A 5KZIA 3FKLA 4Y83A 4C2VA 4ZLYA 1Q3WA 3KXXA 4L3JA 1J7LA 5CSXA 5CSPA 3TEIA 3OZ6A 2XP2A 4G3EA 4R7HA 4C8BA 1PRYA 4JXFA 3Q60A 1PF8A 4F9CA 3GOKA 3LAUA 5CF8A 5HQ0A 1PMNA 4C7TA 2YJRA 2WB8A 4P4CA 5E8ZA 5CU3A 3M11A 3Q96A 3Q9ZA 4LQMA 3ZLSA 4BIEA 3G9LX 3TACA 2FYSA 1XH8A 3PLSA 4I6HA 4C4HA 4MF0A 3PG1A 3ZSIA 3FZTA 3H9OA 4I20A 4CFUA 4RC2A 3DKOA 2VGOA 1XHAA 4J52A 5J8IA 2BKZA 5EQEA 3VHKA 1XH7A 4C02A 3ZONA 4G3FA 2BZIB 3EQFA 2ZAZA 2GNJA 2IZUA 3E64A 2QVSE 4L7FA 2HOGA 3GFEA 4W9WA 4WG5A 5FEQA 3ZC6A 3WF6A 5A4LA 5F9EA 4EC9A 4FIEA 2F49A 4I0TA 2WXVA 1K2PA 2VWBA 3FL4A 3SDJA 2RGPA 2WIHA 4O7SA 1AD5A 4ZP5A 2OSCA 4Q5HA 5E8SA 4MX9A 5KMKA 4OAVB 4YJRA 5DFPA 5M57A 2C1BA 3QXPA 3O7LD 4A4XA 4QP6A 3HAMA 2HENA 4NSTA 2WTKB 3NW7A 4FEQA 4TYJA 2F9GA 4CFMA 3FKOA 1QPEA 3UGCA 4FL1A 2V7AA 4LRJA 5AP6A 4BCMA 1YI3A 4YJPA 3ZLYA 2I7QA 4G6LA 4UV0A 1XBAA 4O81A 3EKNA 2ZM4A 4DH8A 1RQQA 3L1SA 4IMYA 4RJ5A 3IGOA 4M69A 4EUTA 3VWAA 5BX0A 3KMUA 4YO6A 1XWSA 5A9UA 4BDKA 2H96A 3FXWA 4WNMA 3NMUF 4E26A 4Z3VA 5FDXA 4PQNA 4QYGA 4DA5A 3P5KA 2OKRA 1VR2A 2YIWA 4ZTRA 3DOGA 3PXKA 4LI5A 4QMSA 2R7IA 2IW8A 2OJ9A 5AX3A 4ANQA 3R1YA 3AC1A 4GIHA 4RLLA 4D4VA 5TF9A 3O7LB 3TUCA 2H8HA 3UIXA 4BGGA 2OBJA 5EYKA 1BLXA 3UQGA 3POOA 4XUFA 4DG2E 3GOPA 4C61A 2Y0AA 2OK1A 2GS2A 3OXIA 4ZZMA 1J7IA 5LQFA 4FKPA 3NYNA 4AF3A 4JL9A 4XG4A 3SC1A 4AGWA 3ORPA 2QO2A 3VW6A 3AT3A 4FT5A 2XS0A 4QMPA 4RFYA 1OKVA 1Q4LA 4FYNA 4EYMA 3NCZA 5IH4A 1F5QA 3UC3A 4F9WA 4O0UA 5I3OA 3HL7A 3MIAA 3ODYX 5CEKA 1WCCA 5CYIA 4E5BA 2V22A 3F9NA 4YZMA 2Z02A 1R39A 2ETKA 3DZOA 3GC0A 3QD3A 4W4YA 4F63A 1XKKA 5BVDA 3G15A 3MN3A 4USFA 4AT4A 3WZEA 2WTIA 3MIYA 5IA5A 1KUTA 1NVQA 4DEGA 5I9YA 4FF8A 4YJSA 2WELA 2QLUA 4WNKA 4ALUA 2UW5A 3U6IA 2VWYA 3M42A 1MP8A 4JX7A 4KBCA 4WD5A 4Y95A 1R3CA 4B0GA 2PMNX 2YM8A 3DNDA 1ZOHA 2XK6A 3W32A 4HGEA 4JI9A 3U9CA 3E92A 4YGAA 3L8PA 3LJ1A 4YC6A 1O6LA 4CCUA 3QKLA 2WMAA 4V01A 5BYLA 2GMXA 2ZM3A 3TI1A 4CZYB 3PJ1A 4UMQA 2IO6A 2HXLA 3K3IA 4L43A 4FSRA 5IA3A 2BKKA 3QL8A 3W8LA 5DA3A 1M52A 1JKLA 3EFJA 3QTZA 3HUCA 3TZ7A 4OLIA 5K9IA 5A54A 3CKXA 3VC4A 4Q5EA 5J1WA 3ZTXA 4YJQA 3QQJA 1H1RA 5CF4A 1QPDA 4N6YA 1H28A 4AZFA 2BFXA 3DXNA 3P7CA 5J7HA 3IS5A 3LE6A 5IQAA 5KMOA 2LGCA 3UNZA 4EH8A 3P23A 4PL5A 4P7EA 3OC1A 3VBWA 2VTOA 5B2MA 2YCRA 4XV1A 3G51A 5AUXA 5KKRB 2ITQA 3LFAA 2UZOA 4JAJA 5J7BA 3SD0A 5KMNA 3OG7A 4FTOA 4BDDA 1VJYA 3QTIA 1NT2A 4Q9SA 4ONAA 5IQIA 3SX9A 3I81A 2BDFA 4HYSA 4XBRA 3DKFA 4E5WA 4YC8A 3QZGA 3P9JA 2VTQA 4ID7A 2GDOA 3NUPA 4FNWA 3T3UA 2GPHA 4RFMA 4OT5A 3OWKA 2HIWA 4U5JA 5E8UA 3V8TA 2A4LA 3SOAA 5CVFA 4GMYA 3TUDA 3C4FA 2W9FB 2VU3A 3R8VA 3OEFX 4AT5A 3QGYA 1F0QA 3LMGA 2IPXA 4MH7A 3MFSA 3C4WA 3ZUVA 1T46A 3BWJA 3NR9A 2EWAA 3ZZEA 1M7NA 3PP0A 4CT2A 1YW2A 5FUTA 2PL0A 3QTSA 5E8TA 3RAHA 3DJ7A 5BMSA 1YI6A 3OF0A 3W2SA 5CWZA 1G3NA 1JWHA 1APME 2WTVA 2I0HA 3R8UA 3GU4A 5K0XA 4I22A 4GJ3A 3CC6A 3AD4A 2C5VA 5CY3A 4NU1A 1Q24A 3RVGA 3TWJA 1Q8ZA 1E9HA 3FLZA 4V0GA 4H05A 2GNLA 4FG8A 4ERKA 3OUNB 4EOSA 2J90A 2BRBA 3Q4UA 2JEDA 2WMRA 3C0GA 3Q6WA 4N70A 3QCSA 3ANQA 4AS0A 3EJ1A 3L9NA 2G15A 3FE3A 4QTDA 4IX3A 5CX9A 4DH1A 4EHZA 3DLZA 4GH2A 3ZSHA 2W4OA 3DKCA 1Q8TA 3EFKA 5IUGA 5HNGA 1BKXA 3SW7A 3F82A 5BNJA 4KIPA 2J51A 3AD5A 3ORZA 1ATPE 3LFSA 4O86A 2NO3A 3CQEA 4PP7A 4PX6A 2R4BA 1R1WA 1W8CA 4IQ6A 5HVYA 5M4UA 2XCKA 4C4EA 1U54B 4IXPA 2ITUA 4FUXA 4ACCA 2UZLA 2I0EA 5T6KA 3VJNA 2YWPA 2KTYA 3H9FA 4XV2A 4U80A 4NM7A 4EKLA 3RJCA 2UUEA 4BGQA 2ZDUA 5L3AA 5GINE 5AV0A 4UMPA 1Q41A 3QX2A 2YM3A 3BV2A 2BPMA 2RKUA 3KXHA 4ZJJA 3SXSA 3QRKA 5D7VA 2W0JA 5HTCA 4E6CA 4YP8A 1PYEA 3MFUA 5EM8A 1KOAA 2W1CA 4YU2A 2ETRA 5A46A 1W84A 5JEBA 4DH7A 5KO1A 4K77A 5AR2A 5GIOE 1H24A 3QKKA 5IA0A 2SRCA 2C6DA 3CD3A 3RMFA 3UP7A 4FV9A 4ZY5A 3ZC5A 2YDKA 1JAMA 5I5ZA 2W96B 3PY1A 2RFSA 3I5ZA 2OIBA 2UW6A 5ACKA 4D1SA 4CYJA 5M08A 2XVDA 2IG7A 4YZNA 2QQ7A 4FKVA 4J8NA 1CSNA 5K4JA 1AGWA 2X9FA 3FZSA 5J9LA 2YEXA 4UZHA 3COKA 5JH6A 4AA5A 2Q0NA 4TYGA 2OZOA 4FTTA 3FQSA 2PMLX 2B9HA 4E20A 4UWCA 4XCUA 2EVAA 4PV0A 1P4OA 2X9EA 3S0OA 3FYJX 4YPDA 4YTHA 3NVMB 2BRGA 4O7NA 4L7SA 3WF8A 3HMPA 5HNBA 4YSJA 3WYYA 3HRCA 3GCUA 1QCFA 3L8XA 3P0MA 2Q83A 4L3PA 3HP2A 4K11A 1O9UA 3BYSA 4RQKA 5EH0A 3UQFA 4O96A 2ZV9A 5HKMA 4ZJVA 3BHYA 3U55A 3QZIA 3MVLA 4KS8A 5JN2A 2O63A 4D5KA 4XG2A 2WKMA 5KZ0A 4BL1A 3IQ7A 3FZ1A 4PL4A 4L44A 3ZUTA 2OZAB 4X6QC 5DNRA 4D1ZA 4F65A 1OM1A 1H07A 4B4LA 3WZUA 5AP3A 4AU8A 2BRHA 4B6LA 4Z16A 2JDSA 3PWDA 2G1TA 3LPBA 4RMZA 5FG8A 5A6OA 4LUDA 3R9HA 4G6NA 4RA5A 5IQFA 3P4KA 3FPQA 5HBJA 5IEVA 2P2HA 4G1WA 2R9SA 3SQQA 4CV8A 3LHJA 4EK5A 1GIIA 4JLCA 3MY0A 3TV6A 3PG3A 5BUJA 4TL0A 2DYLA 2OIDA 3BYOA 5E90A 3HMNA 2W5HA 4DTAA 3G6HA 3U4WA 4BIBA 2JKMA 1ZZLA 4XP2A 3ZRMA 2O64A 5EW8A 3EOCA 4P90A 5AUZA 5M4IA 4LMUA 1OIUA 4IWOA 3R71A 5EDQA 3FMNA 5DH3A 3O23A 3DLSA 4CG8A 1OBGA 2XNEA 3EN5A 3BU3A 4D0WA 2H6DA 5D12A 4YZDA 4ANMA 2RL5A 5ANGA 4B9DA 4FKSA 4DT9A 4FTIA 5CVHA 4QYFA 3LM0A 5D9HA 2WTCA 4NIFB 5J79A 5DOSA 2EXEA 3R1NA 2WNTA 5EI8A 2JDOA 3O0GA 4FSMA 4WNOA 5I9ZA 1OL7A 1SVEA 1KE8A 3OBGA 2GS6A 3E7VA 4M0ZA 3W8QA 3OT8A 3WARA 2PUPA 4LGDA 5AV4A 4R3RA 2YAKA 4GUEA 5K0KA 3V51A 2OLCA 2BZJA 1TQMA 3WOWA 4K1BA 2QOKA 1H27A 2A19B 5E8YA 5FWKK 3RINA 3MJ2A 5ANKA 2XBJA 4ZTHA 4DEHA 3EB0A 4PWNA 3CY3A 3V5TA 3DBCA 4F99A 4ZMEA 2CPKE 5LMKC 5K5NA 4XRLA 4M15A 2PUNA 4WO5A 3MJ1A 4GCJA 4M8TA 2YHVA 2Z7LA 3IPHA 4EL9A 4M84A 3R9NA 1YDRE 4CYIA 2WAJA 3TV4A 3OS3A 3WI6A 5DEWA 5M56A 5FP6A 1DAYA 3NAYA 4L45A 5IA4A 5EQPA 4G31A 2WOUA 5AIRA 2YN8A 2W1FA 5IH5A 2XJ1A 3ZXTA 1NW1A 2O5KA 4KBAA 2CGWA 5CVGA 1FQ1B 3LXPA 3NUNA 2JBOA 3ZO2A 4LRKA 4GIIA 5CU2A 3R9OA 4AW2A 4PDOA 4CMTA 3TTJA 4QTBA 3W18A 3GC9A 4HVGA 2CKEA 2RG5A 3EQHA 1PXKA 4MD7E 3OHTA 4Y72A 4EJNA 3DBDA 2PE2A 5FDPA 1W7HA 2C3JA 1J1CA 2I0YA 3COIA 4FTQA 4GFOA 4GK3A 4ANLA 4DH5A 2FGIA 1YOMA 4TTHB 3KREA 4FTAA 3RI1A 4U97A 2R3HA 3A60A 5TR6A 2JKOA 4BZNA 4KINA 2GHGA 3WIGA 3BELA 2YZAA 2Y4IC 3BBWA 5GHVA 4PPBA 3H30A 3ZLWA 3TG1A 4F70A 2HZNA 1V0PA 3N4UA 4Z55A 3RGFA 3RPSA 2OXYA 3CPCA 4MNEA 1GJOA 3HMIA 4IX6A 4U8ZA 3IOPA 2UZVA 2A0CX 4O6EA 3VUMA 2XRWA 4NEUA 4BKJA 2HWOA 3PFQA 3QA8A 3QRUA 3A4PA 3PVGA 2HY81 5I9XA 3LCSA 2UW0A 3FWQA 3DBFA 4F9YA 2BMCA 2VX1A 4FIFA 5HO7A 4PMTA 4LUEA 3UIMA 3VBXA 4JDHA 5HESA 2FO0A 3E87A 2AC5A 5AR7A 4PNKA 2HWPA 4TYHA 3WZJA 5IF1A 2PMIA 3DJ6A 3BPRA 2IN6A 3WILA 2J50A 3SRVA 3E8CA 3PUPA 4QMWA 1H00A 4O0TA 3BBTB 4FV8A 4GS6A 4HVIA 4ASZA 5AV3A 1FOTA 4DGOA 4RX5A 4USEA 4O7TA 4EI4A 3CTHA 4JDKA 4R1YA 5CEPA 5I3RA 3A7JA 5ITAA 5FQDC 5CTPA 3F3ZA 3PXQA 3R63A 4UWYA 5DVRA 1NA7A 3BV3A 2QOFA 4AUAA 2VN9A 4TW9A 4X2NA 3Q6UA 2JAMA 5HCXA 1H25A 3MW1A 1BX6A 3PSBA 4HGSA 2CGXA 2RSVA 2ONLA 2XUUA 4W9XA 2P4IA 5CNNA 2ITYA 3FXZA 2WEVA 2W4KA 4FOCA 5HD7A 4M7IA 3QTRA 3FDNA 3MS9A 4OTGA 4ORKA 3KXNA 3VF8A 3VULA 4JDJA 4YTCA 3TXOA 5HD4A 1JKTA 3IOKA 5TT7A 5IQGA 4J53A 4QPMA 3WYXA 4GRBA 1UU8A 5JQ8A 5KNJA 4KA3A 2FVDA 3RAKA 3REPA 5HIEA 3LJ0A 1M7QA 1REKA 4C58A 3KB7A 4ZZNA 4UXQA 1I44A 4A9RA 2JAVA 2B1PA 3PRFA 4TT7A 4RIYB 2EU9A 4U9AA 4USDA 2AYPA 5L8KA 5DWRA 2UZBA 3DAEA 4PY1A 2ITXA 3EN4A 4LM5A 4E8AA 3PY3A 4GU9A 2F7XE 3Q2MA 5CSWA 5HE2A 3UE4A 3NIZA 3F61A 5B0XA 3DGKA 3C4EA 2E9PA 1ZRZA 3B2WA 2XIKA 4FZDB 1TQPA 3UOHA 4BCQA 4RIWB 1R78A 2G2FA 3PPKA 5M55A 3QAME 3QHWA 2VWIA 5CAPA 2PVNA 3I7CA 1RJBA 1IRKA 4K6ZA 2QCSA 3BWFA 1MRYA 3LCOA 4FNZA 3SHEA 4DFZE 5EG3A 2UVXA 4F7SA 2HZ0A 2WGJA 4J71A 3QBNA 4MQ1A 4X3FB 4YNEA 5KMMA 3R7IA 2QKWB 2ESMA 2IVSA 4ZIMA 3VS4A 2XEZA 1X8BA 4WUNA 5T68A 2R3JA 3RK7A 2XBAA 4FTUA 4DG3E 3FHRA 5IMEA 1YDSE 1FPUA 3QQHA 2C0TA 5BVEA 3LFNA 2WQEA 5CAUA 2W9ZB 5JFXA 3OW3A 3THBA 3CJGA 2ITZA 2NRYA 1UU9A 1IASA 4DBNA 4F1TA 3FEGA 3BHVA 1KE5A 4XLIA 3QLGA 2X2LA 3FMHA 4KIKA 5K4IA 2XM8A 4HNIA 4OTRA 4TRLA 2R0IA 3OTVA 1M2RA 1H4LA 3D7TA 5F4NA 3NNVA 1XO2B 2PVKA 1BL7A 1OI9A 1Y6BA 1ZOEA 3O51A 5ANIA 5FXQA 3TL8A 4PNIA 5FM3A 4O0XA 5HGIA 1PYXA 1OBDA 1BL6A 4XP0A 4MBIA 1Q8UA 3KRXA 4QTEA 4O82A 3QQFA 3W2QA 1FINA 2J9MA 2CNQA 4TYEA 3RHXA 3QQUA 2IVTA 3I6UA 2ZV8A 4RBLA 5AMNA 1ZAOA 3LCKA 4IAYA 2HZ4A 5E91A 2YM7A 5HZNA 3T9IA 3MI9A 4PTEA 1LP4A 3F2NA 3U4UA 2HY0A 1ZY4A 4I4EA 5AAGA 5AR5A 4YBKA 4BDFA 5M06A 1TKIA 3KL8A 2WU6A 2ITWA 4N57A 4IVAA 4D9UA 3FLWA 3SXFA 3KFAA 2C0IA 3N4VA 1YOJA 2OJJA 4DFBA 3FSFA 3RAWA 3KK8A 3UZRA 5HIDA 4D28A 4QQ5A 4J1RA 3RWPA 2C6KA 4W8DA 4RIXB 5AUYA 3FMLA 4KIOA 2GNIA 4IFGA 4FTNA 5B2LA 5GJDA 1XR1A 2R0UA 3BRBA 5CI6A 5L2SA 4RC4A 3NNUA 4O0VA 2PY3A 4PPAA 4QOXA 2YIQA 3O96A 3ZEPA 1P4FA 4F6UA 5LMAA 4QMOA 4BCJA 1PJKA 2WMSA 1KV1A 3HMMA 3BQCA 4WG4A 2O3PA 5A4QA 5BPYA 4EZ5A 5J9ZA 2DQ7X 4QQJA 2WTKC 4BCPA 2JC6A 3D9VA 3S2PA 1U5RA 5HG9A 3R7OA 3W16A 4KBKA 3VW8A 4WKQA 3KRJA 5EHYA 3RM7A 3DT1A 4IZAA 5EM7A 2YLFA 4IWQA 4K0YA 3IW8A 4H39A 4MXYA 3BGZA 4E6DA 3EYHA 3RZBA 1Q99A 5DEYA 2P3GX 2R5TA 4FSYA 3DFCB 2X6EA 1U59A 2YLEA 3VS0A 4DFLA 3V5LA 3HZTA 4FT0A 4O0WA 3HECA 4EK6A 2O65A 4BDHA 4FV7A 4BCNA 4DEDA 4B8LA 3DFAA 1OPLA 4J97A 3MPMA 4QMQA 4O27B 1KE6A 3OUKA 5HX6A 3R0TA 3N4TA 1PXOA 2BAKA 3O8TA 2VWXA 2J0IA 3VO3A 2X6DA 4E3CA 3BLQA 1YHWA 4GT3A 3QGWA 3HDNA 3FZPA 4ZK5A 3GT8A 1U5QA 5DHJA 3K54A 5HBEA 3UODA 4C3FA 4Y5HA 3IG7A 4QTCA 4A06A 3EQRA 3K2LA 4DCEA 4FEUA 3R83A 2XIZA 1YQJA 3F5UA 2ZOQA 4C34A 2FH9A 2C5NA 4HCTA 3ZO3A 3QD4A 3BGPA 4FKJA 1VYZA 4I5HA 4X7QA 1JPAA 4EK3A 2XCHA 5DPVA 4L68A 4AOTA 5EFQA 4DBXA 2VTHA 2OI4X 3HA6A 3KRWA 4CFNA 3U8WA 3GBZA 2C6LA 2C47A 3RPVA 3HUBA 2RIOA 1FGIA 4PMMA 3SXRA 3E3PA 4BDCA 4CTBA 1SNXA 4NW6A 4FA2A 3A4OX 4NWMA 3IECA 5ETIA 4FIGA 3QYZA 4CQGA 4DINA 4YMJA 3ID6C 3R04A 4I3ZA 5HNIX 3QD0A 3CE3A 3TT0A 3DDPA 3F69A 1GNGA 4FI1A 4ANSA 2OGVA 4Z9LA 3MY5A 5GJFA 4ERWA 4KKEA 3R7EA 4FL3A 4BTKA 1CDKA 2IW9A 1E1XA 3KN6A 4PL3A 3C5IA 2CGVA 3MY1A 3WBLA 3E62A 4YZ9A 4FEXA 4QMZA 1P5EA 2I6LA 4GU6A 4AZWA 2PU8A 1FGKA 1M2QA 1ZY5A 5FEDA 2OXDA 2CSNA 3IW4A 4FV3A 4O0RA 2C4GA 5HE3A 3R8LA 5IPJA 5L6OA 2YAAA 3V01A 1G8SA 1Y8YA 2R3LA 3QZFA 3UG1A 1CKPA 2JBPA 4GVJA 4IANA 1SVHA 5HICA 5TKDA 2X2KA 1BYGA 4R7IA 2I1MA 3NUSA 3EFWA 3MPTA 4ASEA 4O7ZA 3BCEA 3H10A 5G1XA 4IAFA 2BRNA 3EH9A 3RPYA 4AFEA 5KKRC 3UQCA 3TDVA 1Q5KA 4K2RA 2WPAA 2Y4PA 4IX4A 4MK0A 2FSTX 3MYGA 4YJVA 5FXSA 4BVUA 5IQEA 3TNQB 1M17A 2B9JA 4YJUA 4BC6A 5IQBA 3C4CA 3F5XA 5FRIA 4O6LA 3EQGA 3FMJA 4FSUA 4M14A 3G0EA 5KBRA 3G90X 1A06A 1OPKA 3PVWA 3TKHA 3IW7A 3NVKI 2XZSA 3EN6A 5AP4A 4ALVA 2ITPA 4U43A 5C9CA 3MSSA 4APPA 4FKIA 4IB1A 2QURA 3P86A 4KWPA 1WFCA 5K5XA 3EQPA 3GUBA 4CT1A 1O6YA 3CTJA 3R00A 3KY2A 4DYMA 5AFVA 1YKRA 3NS9A 4W4WA 4U81A 5D41A 3ZM4A 4UMTA 5CENA 4I5CA 1IA9A 3R9DA 2WIPA 4D2VA 1CM8A 2WMBA 4MHAA 5DT4A 5J5SA 2J0MB 5DRBA 2YDJA 4JQ8A 2CCHA 3T3VA 5DGZA 2IZTA 5FM2A 3UG2A 1OIQA 2XA4A 4FZFB 4YR8A 5E4HA 2BAQA 4A4OA 3ATTA 3VRZA 3COHA 1F3MC 3KULA 4ACGA 4AW0A 4DF3A 3CCNA 2QR8A 4JNWA 4FKGA 5HHWA 1OMWA 5TE0A 4C38A 4D2PA 3HRBA 4E7WA 4XMOA 3F2RA 3LCTA 1HCLA 4XRJA 4AN9A 4U0IA 1JSTA 2XF0A 4FT7A 2W7XA 5CZHA 4BFMA 2WQNA 4E4XA 2Z60A 4KKHA 5LOHA 3ZS5A 3A61A 3GC8A 3W33A 3WF9A 3QQKA 2G01A 3ZZWA 4CSVA 3V5WA 4R1VA 3BHHA 4FKRA 2QHMA 2QG5A 4FMQA 5HBHA 4AP7A 4WRGA 2CKPA 5KCVA 5FTOA 4GFGA 2WO6A 2CNUA 4CV9A 1YXXA 4H1MA 3PRIA 4J95A 4CLIA 4O0SA 1YXVA 1GZKA 1OL5A 3QLFA 4M97A 2Y8OA 4OTQA 5AV2A 1R0PA 1HCKA 3F3WA 2QKRA 3QWKA 4FX3A 2UZTA 4YJTA 2IWIA 3SKCA 3MFTA 3GU7A 5IH6A 4X6RA 4O2ZA 4FT9A 1OVEA 1XH5A 3OWPA 2UZEA 1IAJA 2WOTA 4O2PA 4EOKA 4RT7A 3FLNC 3ZH8A 2PVLA 3CR0A 3U6HA 4KAOA 2J5FA 4F6WA 3FMEA 2YJSA 3CBLA 3TIZA 4J98A 3RNIA 4IFCA 2B53A 2R3MA 1JNKA 3O71A 2PUUA 4BKZA 2YM4A 3WE8A 4D55A 3PIYA 3ORTA 2VO7A 2UW7A 3VS1A 4EOMA 4NT4A 3HP5A 2IW6A 4GUBA 4CD0A 5BVOA 3TNHA 1PKDA 4Q9ZA 2PVHA 5FXRA 3A99A 2BR1A 3A62A 3POZA 4NCTC 4C2WA 3MBLA 2RG6A 3LFFA 4AXAA 3DKGA 4DGGA 4AACA 4XG3A 4R77A 5M44A 3A7IA 4E4NA 4U44A 3JUHA 3AGMA 3BE2A 4JIAA 2BROA 4IWPA 2BZHB 3PXZA 3Q4ZA 4ACHA 4FOBA 2FUMA 4CXAA 5BUIA 3AMBA 4ZTMA 5ETCA 3OVVA 3F7WA 5LMKA 2X7FA 3PYYA 3MB7A 4OR5A 3AQVA 5EHLA 4BGHA 4FVPA 4MF1A 5D10A 3NYXA 4KNBA 4DAWA 4IEBA 4BTJA 1JQHA 2UW9A 3I5NA 4MNFA 3D83A 3L9LA 3OBJA 2BHHA 1XH9A 2VWUA 3QTXA 3W1FA 4JBQA 2W06A 5HTBA 3BU5A 4C57A 2UW3A 3HKOA 4I6FA 2HAKA 3F3TA 3MA3A 3PE2A 4A9SA 1ZYCA 2R3FA 1H1WA 3CD8A 5JK3A 4ZTQA 2ERKA 1T45A 5IDNA 3PDTA 3H9RA 2XKCA 4RJ4A 3C4ZA 3GI3A 2OFUA 1Y91A 4NM3A 5AUTA 3BYMA 3A2CA 5HCYA 2B9IA 2JIUA 2X8DA 4I0SA 2YCFA 3L8VA 4OGRA 3W2OA 3KXGA 3QA0A 3HLLA 5AM6A 2QU6A 5J9YA 4QPSA 4NM5A 4UN0C 5AV1A 2XM9A 2XK4A 1PY5A 4EQUA 2YA9A 4QRCA 2JIVA 1PMVA 4FGRA 4LGGA 5FGKA 2QOBA 4DITA 3KVXA 1ZWSA 4AW5A 3I1AA 4QMMA 3EQIA 4QNYA 3V6SA 3P08A 3QX4A 4U7ZA 4C62A 1A48A 3IO7A 3NIEA 3K3JA 3LFEA 3IGGA 4QYHA 2UZWE 3E8EA 1G5SA 4CLJA 3VUDA 3HDMA 4DLIA 4IDVA 3EQBA 5L2WA 4ZSAA 3ERKA 3D94A 3QHRA 4IC8A 5AP2A 4A07A 5AAEA 5C1QB 4RC3A 2DS1A 4GG7A 4W8EA 2WTWA 1KV2A 1STCE 3DTCA 4ENXA 2OF2A 4BCFA 4RWIA 2ERZE 4KKGA 1DI8A 1BI7A 2Q0BA 2W1GA 3ORNA 2YM5A 3KGAA 3SLSA 4KS7A 3HV5A 3VNTA 2QOLA 5CU4A 1SVGA 3H3CA 5FTQA 4YURA 2B9FA 2GNHA 3D4QA 4OUCA 1Y8GA 3PIZA 5DYJA 3F6XA 1RW8A 2O0UA 4ANNA 2VTSA 3TKUA 4WNPA 3UOLA 2RFEA 3ZCLA 4GG5A 4QMNA 4O1PA 5KMLA 4FZ6A 4BCOA 2CCIA 4IACA 3EN9A 5CU0A 3BZ3A 5L2TA 4FG9A 1FVRA 4NFNA 5E8WA 1HOWA 4C4IA 1WZYA 5BQ0A 3NDMA 1UV5A 3BLRA 3K5VA 2AC3A 4GEOA 4HCVA 3C1XA 2BCJA 4M69B 5AAFA 4O7YA 2B54A 4ASXA 1OPJA 3LVPA 4A9UA 1SYKA 2VRXA 4IVDA 3FLYA 2BTRA 4MQ2A 4MVFA 4PF4A 3PPJA 4G6OA 3ULIA 3VBQA 3W2CA 3UZPA 5JRQA 4L00A 4ZLOA 3FMKA 3NYOA 2C5XA 4RX7A 4MYGA 5DR2A 5AEPA 2QOHA 4ITJA 3EYGA 5KX8A 5HIBA 4FSWA 4XS2A 4OAUC 3VUKA 3MPAA 4D2WA 3MVHA 3NLBA 5AWMA 2HCKA 3D7ZA 3EKKA 4WBOA 1V0BA 4NZWB 5IUIA 1LR4A 3EIDA 5CI7A 2OF4A 4RRVA 2WU7A 3LFQA 4J8MA 2XMYA 4XX9A 4ZSEA 3TN8A 3Q52A 3KXMA 4I6QA 3F2AA 2OJFE 2GCDA 3ZLXA 3FXXA 1YRPA 4HZRA 4QNAA 4DEAA 3E88A 2QOIA 5LMBA 4HZSA 5LXMA 3R8MA 4ZSGA 1ZYLA 2XIRA 1DAWA 3MV5A 4UXLA 4ZTLA 1NY3A 4TWOA 2R2PA 3M1SA 2OIQA 3PZHA 3PXRA 1LUFA 1M2PA 3PWYA 4IM3A 3DXQA 2GQGA 5GZ9A 4D2TA 5E1EA 3PXFA 4OBQA 4HGTA 5C27A 4IAZA 4QMXA 3GENA 4BKYA 3LW0A 3IK3A 2BFYA 3OWLA 3ZOSA 5D1JA 2W1DA 4IJPA 4ACMA 4F64A 4IW0A 4X2GA 5G6VA 3GU8A 1J3HA 5LARA 2W1HA 4CGAA 3ALOA 4FTCA 4UY9A 2QOCA 3VS6A 1B39A 1YXUA 2X4ZA 1TQIA 4K18A 1OITA 3V5PA 3SA0A 4Z7GA 1UNHA 2C6OA 4NYEA 2AUHA 4FV0A 2BALA 4FUYA 2J7TA 4EWHA 2X1NA 1QPJA 3W2RA 4EH7A 1IA8A 3AG9A 4ZY4A 3PSDA 4YHJA 3WZDA 5EQYA 4LRMA 3FQHA 2W1IA 4FSZA 5IA1A 2VD5A 2X2MA 4UMUA 4TNBA 4GW8A 2WMQA 4XH6A 2VX3A 5A6NA 5JFWA 3PSCA 3L8SA 5DG5A 4RQVA 2P33A 5GNKA 2XK9A 4EHVA 5DBXA 1LEWA 2XKFA 2WMUA 3KF7A 2C69A 4AX8A 3MVJA 5AR8A 5J87A 3RK9A 5IG1A 1I09A 4IZ5A 1G8AA 3QQGA 1V0OA 2ETMA 3PJ2A 2E9UA 3ALNA 1XH6A 3TNIA 4BDIA 1YWNA 3FY2A 2XYUA 2PK9A 3ZUUA 4DFUA 1Q97A 2BAJA 2VNWA 4DGNA 4E6AA 4LG4A 4GSBA 3BYVA 4JRNA 1MQ4A 1OL1A 3F66A 3FZRA 4BWKA 5IUHA 3IW6A 1MRUA 2C30A 4O21A 5ETFA 3NAXA 5JMSA 2R3OA 4RX9A 3ZBFA 1Q61A 2Z7RA 5DT0A 2C6MA 4E93A 2F4JA 3E7OA 1NVSA 3KMMA 2FSOX 2QLQA 4YHFA 3AD6A 4W4VA 4Y85A 4A4LA 3UYSA 1P14A 5H9BA 2YCQA 4IE9A 1W98A 1JLUE 1L3RE 5AR4A 5H2UA 5CZIA 5ANEA 4FVQA 1YVJA 4X3FC 3U51A 2PVRA 4NUSA 2QI8A 4BCHA 2ZV2A 2Y9QA 4NM0A 4OTIA 3R1QA 5DRDA 3OXZA 4F0GA 1K3AA 3VAPA 2YWVA 2VTJA 3DJ5A 4WG3A 4EOQA 4NKAA 1UKHA 2QC6A 4V0GB 3RTPA 2JDVA 2VTAA 4C3PA 4AN3A 2VTPA 1EH4A 5GZAA 3ORXA 3I0OA 5L2IA 3AGLA 4DTKA 4QP3A 5EI6A 4GV1A 3K5UA 3MH3A 1JVPP 2CLQA 3IDBA 4XV9A 4EQMA 2XNMA 1MQBA 5FEEA 4BBFA 1CTPE 4FG7A 1OECA 4FE2A 4IB3A 4M0YA 3ETAA 2VTRA 4RVMA 4JT3A 1DS5A 4RJ8A 3UO6A 5H8EA 5FBOA 3DK3A 4AN2A 3IKAA 3B8RA 3V5QA 3S00A 3SW4A 1PW2A 3PPZA 3NYVA 3CGFA 4IX5A 3IW5A 1JKSA 4Q2AA 3MH0A 4WSQA 5CQWA 3RAIA 4G2FA 3PXYA 3CPBA 1CKIA 3Q9WA 1SMHA 2X7OA 5LVLA 1ZARA 2Y6OA 5CLPA 4RFZA 4P5QA 3NGAA 4M13A 2ZYBA 4L42A 1Y57A 4CZTA 1YXSA 4E6QA 1O6KA 1OKZA 4CZUA 4D4RA 2JGZA 2Z2WA 3DBQA 3OCSA 5KE0A 3A7HA 4J7BA 5BVKA 2R3KA 5JKGA 4P2KA 2YIRA 4L8MA 4BYJA 5L2QA 4BDGA 3VS3A 5E9EA 5JT2A 3A7GA 3EQDA 4IHPA 3DXPA 5IQHA 4FK6A 3LLAA 4V05A 4B99A 5L4QA 2F2UA 4GT4A 4HYIA 4UEUA 3ZFYA 4MTAA 2C68A 3C4XA 3MDYA 5EDRA 2X0GA 5LCJA 3NCGA 2H34A 3BU6A 3KCFA 4OW8A 4TWNA 2ITOA 3ZHPC 2BIKB 4EOIA 2G9XA 4NFMA 3RM6A 4AGUA 3BKBA 3U87A 4ALWA 4YJOA 4QMUA 4S31A 4LL5A 4U3ZA 4APCA 4E73A 5AJQA 3W10A 3G33A 2PMOX 3QRIA 2CHLA 3UNJA 2OW3A 4IAIA 3RHKA 3TZMA 2Z7QA 2JITA 4DGLC 4YJNA 5ETAA 2WQBA 2PVFA 2JLDA 5HU3A 4EUUA 3C0IA 4PMPA 5CQUA 1YHVA 4G17A 2ZMCA 4PRJA 2A27A 2UW8A 4ZJIA 3JY9A 1YDTE 4TWPA 4BDBA 4C33A 2IJMA 3U54A 4ZTNA 3PVUA 4FIIA 4L52A 4QP2A 1SM2A 4GL9A 4EHEA 2YCSA 4UYNA 2BHEA 1MRVA 3GU6A 3DNEA 4C0TA 4HJOA 4KB8A 3NPCA 3R73A 4XG6A 4IM0A 2PSQA 4L6QA 2XJ0A 4JG7A 3AC8A 4XJ0A 2YDIA 2PVJA 3PA4A 3PY0A 4FTJA 4F9AA 5HORA 3BEAA 4MXZA 2CMWA 2ITNA 2XKDA 4MD8E 3EZVA 4P5ZA 3B2TA 4EYJA 3KCKA 4JAIA 3UVRA 5CANA 4G16A 3FAAA 2RFDA 2R64A 3F7ZA 5EI2A 3LCDA 3B8QA 5LWMA 3AT2A 2IZRA 4KRDA 3E8DA 2OJIA 1Z57A 5AA9A 4AW1A 4UMRA 5LVNA 4M66A 4RJ3A 5HU9A 3Q32A 3UNKA 2UZNA 2V55A 4AAAA 4CFFA 2ZVAA 4EHGA 4FEWA 3SG8A 3S4QA 4XNEA 4IBMA 5E8VA 2HW6A 2EXCX 4ZS0A 4EC8A 4CRLA 2R3RA 4IADA 4YTIA 4MEDA 5BVFA 2C1AA 3LJ2A 3NSZA 4YZBA 5H8BA 4BDJA 3R2BA 4RLKA 4DEEA 2W17A 5JGAA 3DDQA 3BHUA 1YI4A 3KEXA 3QTUA 3OCGA 3GCPA 2J2IB 3CQUA 4FTLA 5IZFA 3AC5A 2CN8A 4IZ7A 4S33A 2F2CB 3HV6A 2OWBA 4JG6A 4O7VA 4J99A 2EUFB 4FZAB 3GP0A 3R8PA 4OTWA 4DN5A 3DV3A 5JZJA 2V62A 4HOKA 2GQSA 2QR7A 1OUYA 3LXNA 4IM2A 3I4BA 5C4KA 4YSMA 5ACBC 4DEBA 4G3DA 4A7CA 4G9RA 4S30A 5CEOA 5HLNA 2F57A 3T8OA 2B52A 3GGFA 5AP5A 5E8XA 2ZDTA 5IISA 1GZOA 5HEZA 5IMXA 3LFBA 3HEGA 4FKOA 4FKUA 4FNXA 5TOZA 3ZO4A 2JFLA 3NUYA 4DTBA 4QP1A 4CNHA 3E8NA 3LXKA 3ZMMA 2GFCA 4O1OA 5ANJA 5HG7A 3PA5A 1L8TA 3TDWA 5KHWA 1OB3A 2V5QA 3LFCA 2NPQA 5EW3A 3RZFA 2VO3A 4GKIA 3AC3A 4RG0A 1KSWA 2DUVA 2WQOA 3ITZA 4CTCA 1NXKA 4FSTA 1U54A 1YHSA 4H3BA 4IZYA 4I94A 3ELJA 4GK4A 4KSPA 4QMTA 4QMVA 3U9NA 1Q3DA 1BI8A 2ACXA 2EXMA 4O7LA 4U40A 5JQ5A 1M14A 1GAGA 2GU8A 4D5HA 5LVOA 3ZFMA 3FI8A 1PMEA 3R7YA 3QD2B 4AZSA 5CEMA 4BYIA 5EKNA 3KU2A 3VUIA 4OBPA 4RSSA 4JR3A 5M53A 5CEIA 2OG8A 4N4SA 3CEKA 4MNEB 1TVOA 5JFVA 2RF9A 5AP7A 4L67A 1OGUA 2WD1A 3FLQA 1H01A 4FTRA 4NKSA 5AUUA 3FI2A 5HTIA 4JQEA 5C01A 3OD6X 3IDPA 4CG9A 2OH4A 2QHNA 3A7FA 2Z8CA 4UX9A 2E2BA 5LVPA 3CLYA 4QT1A 2V0DA 2PTKA 1GY3A 3HMOA 4WA9A 4QO9A 2BUJA 2JKKA 5LVMA 2GNGA 2GNFA 4CFVA 4R5YA 3V6RA 4D2RA 3UDBA 3DTWA 4NCTA 4MCVA 4N0SA 5FD2A 5AUVA 4TYHB 4FKLA 3FBVA 3BEGA 3I6WA 5FP5A 5FLFA 2YFXA 5J95A 3EL7A 4LOPA 3KKVA 3CS9A 3SRVB 2P0CA 4Y8DA 4RWJA 3VBTA 4A9TA 4F6SA 1FMKA 3UOJA 3F3VA 3DB6A 5AR3A 2FA2A 4ZSJA 1OL2A 3TM0A 3UJGA 4FL2A 3PJ8A 3AT4A 3D14A 4M67A 3E5AA 5A4EA 3KVWA 1PXJA 2ZB1A 4C37A 2VTTA 4WSYA 3BYUA 4PPCA 4I21A 1IG1A 3OFMA 3OW4A 4LL0A 4Y46A 3RKBA 4R5SA 2OZAA 4ZAUA 5CXZA 5JSMA 4XBUA 4CQEA 4LOOA 3DAKA 3RWQA 2I0VA 4RZWA 3GNIB 1PMUA 1QMZA 3DK6A 3TNPC 3NUUA 2UVZA 2O8YA 2UZDA 3D0EA 3KXZA 3Q4TA 3QYWA 5T3QA 3ZRKA 5AX9A 4BI0A 5JGDA 3E3BX 3LIJA 4I41A 3ZDIA 1WVYA 4AZVA 2WTJA 3FQEA 5ICPA 2J0LA 3TJDA 2XB7A 5DN3A 4UB7A 4CFWA 1H0WA 4F09A 2R3GA 4MWIA 5DMZA 4EKKA 1WVXA 4GK2A 1H26A 3FYKX 4FTKA 3CP9A 2XK3A 3OY1A 4G9CA 1PKGA 2J6MA 2HK5A 2W5BA 3QQLA 5M07A 2P55A 4XHKB 4F7NA 4MKCA 5CS6A 4FR4A 4RWKA 1DM2A 4TPTA 3AOXA 4H3PA 5A4TA 4O7WA 2H9VA 4RVKA 4L53A 5IQDA 2C6EA 2HXQA 4X2KA 2HZIA 2VTLA 4FIHA 4F7LA 2PPQA 2BIYA 3DY7A 3IDCA 5HX8A 4K33A 3MTFA 3AXWA 1PXLA 5JZNA 3RBWA 3NNWA 3ZM9A 4NIFA 3LXLA 4TY1A 4UALA 4M12A 4NTTA 3QCXA 5GJGA 4HCUA 4Z7HA 3V3VA 3HRFA 4GJ2A 4H58A 1GZNA 5KUPA 1ZMUA 1FBNA 2VV9A 5C26A 4I23A 1PXPA 2ZV7A 4BRXA 3FHIA 3Q5IA 4CFXA 4IJ9A 5M4CA 1IAHA 2VAGA 3C9WA 3R6XA 5DR9A 5CASA 3DA6A 4CRSA 3E93A 1XH4A 3VJOA 3PLAE 3NEWA 5JFSA 5JGBA 4QQCA 4O83A 2GTNA 2CKOA 1E1VA 1ZZ2A 5EOBA 5F1ZA 3G5DA 1Z9XA 3CKWA 3PP1A 4XYFA 2BDJA 1H8FA 2ZM1A 3PZEA 4IB0A 2JD5A 3G2FA 4NK9A 2HELA 3VUGA 5H8GA 2G2IA 4RA4A 4YBJA 4BF2A 3ROYA 3ZDUA 2JIIA 4DFNA 5KMJA 1PXNA 2B4SB 4IAKA 3F88A 4B7TA 5E1SA 4II5A 1OKYA 4JBVA 4KIKB 5HO8A 3VQHA 2Z7SA 3D7TB 5EM5A 4QMLA 1Q62A 3F5PA 5IQCA 4M68A 4JDIA 3DS6A 4FT3A 3TNWA 4O91A 5CSHA 2C3KA 5AUWA 2XIYA 2CN5A 5EHOA 4FKTA 3OROA 4PDSA 1ZXEA 2GSFA 3TCPA 3VQUA 1KOBA 4BI2A 2UZUE 4CCBA 4JIKA 4IC7A 4BHZA 4F7JA 3KRRA 3UYTA 4B8MA 1WBPA 4DC2A 3MB6A 5CF6A 3LKMA 3D5XA 2X7GA 1ZMVA 2EB2A 2REIA 4QP4A 3ZFXA 5HLWA 4QPAA 4R78A 4S32A 1WBVA 2VWWA 5L8JA 5J1VA 2F7EE 3DZQA 1KE9A 2OXXA 3A8WA 3WE4A 1UA2A 2IVVA 3CIKA 2B55A 2VO0A 1XBBA 3Q2JA 4UBAA 5EK7A 2LAVA 5A4CA 5L6PA 4TXCA 4GVAA 4XG9A 3ZU7A 3MTLA 4I0RA 4TN6A 3R9RA 4I93A 3FY0A 4FGBA 2VX0A 3ACKA 5FBNC 4XOZA 4FODA 4DCAA 1Y6AA 5CT7A 5L8LA 5EKOA 2BVAA 4KRCA 2YERA 3HNGA 4TWCA 4FZ7A 5I9UA 5A3XA 2PULA 2R3NA 3JVSA 2C3IB 2XNGA 3R28A 4ZXTA 2XK7A 3PTGA 5DLSA 5BUEA 5K3YA 4KD1A 5J5TA 2YM6A 1CKJA 4AQCA 3ODZX 4MXCA 3VN9A 3VBYA 3R1SA 2BILB 3PIXA 3DAJA 3GEQA 4DLJA 3QRJA 3QWJA 4X2FA 3OMVA 4A9YA 3G0FA 4QP8A 5BVWA 3KRLA 1UWHA 3TKIA 4FYOA 1RDQE 4AE6A 4FTMA 4U45A 2XH5A 3OY3A 1YWRA 4WIHA 4XLVA 3TZ8A 2F7ZE 2W5AA 2PZRA 2B0QA 3ZO1A 2PE0A 2C0OA 4NW5A 4HPUE 4ZEGA 3WZKA 2X8IA 3V8WA 3UO5A 4Y73A 1BMKA 3NW6A 3G6GA 3OOGA 1FVTA 4CMOA 4QQTA 4FV5A 4EQCA 4BBMA 4N6ZA 4QMYA 5HOAA 1REJA 2X8EA 3JXWA 4EEVA 4OBOA 3LMHA 3LMIA 4MAOA 1B6CB 4HNFA 2NNWB 4KUJA 4BCKA 2XJ2A 2XNNA 4PTCA 4LGHA 4QTAA 5CNOA 2WMTA 3RP9A 3H0YA 2QOOA 4ZSLA 4E5AX 4I4FA 5B7VA 5HE0A 3UTOA 3G9NA 1WVWA 3AMYA 4BTMA 3I60A 3M2WA 5CF5A 3U6JA 1JSUA 4D1XA 3P79A 1UWJA 3PJ3A 4AA0A 3GC7A 5M09A 2GTMA 3V8SA 3LM5A 4ZZOA 5GZ8A 5EYDA 2PE1A 4KIQA 4RIYA 2EB3A 4C35A 5D7AA 4BR3A 4LV8A 5CSVA 4BN1A 3VF9A 3WF5A 4HVDA 4EORA 3KA0A 2PHKA 3UIUA 3RPRA 1H08A 3LQ8A 3OXTA 4IAAA 1U4DA 2UVYA 1A9UA 4L01A 3R7GA 4YLLA 3VRYA 3P7AA 4EK8A 4CVAA 3HV3A 4C3RA 3D5UA 3ORMA 1V1KA 4MXXA 4RIWA 5I4NA 3UPZA 3AC4A 2BDWA 4QYYA 3NZ0A 2OH0E 1S9IA 3KF4A 4X0MA 4ZOGA 3EL8A 1YOLA 2E9VA 4KSQA 4EH6A 3W55A 2W1ZA 1UKIA 2VTMA 4BB4A 4DG0E 3GQIA 4BICA 3CSVA 1OL6A 4BIDA 3QXOA 3ORLA 3QTWA 4R6VA 3ENHA 4TYIA 5JRSA 4DFYA 2RFNA 4X3FA 3R2YA 4FEVA 3BI6A 3RPOA 2IVUA 4WBBB 4JS8A 2X39A 5FTGA 2X81A 4GYIA 2DWBA 2XYNA 2W1EA 3EHAA 4GT5A 2R3IA 4FK3A 5EDPA 3DU8A 5E92A 2VZ6A 5CAOA 3EZRA 3LOKA 2QG7A 4JBPA 3ATSA 4BWXA 2XK8A 4F08A 4D4YA 3Q04A 4EOLA 5AM7A 4PDPA 5BVNA 2VWZA 2YABA 4ITIA 4O0YA 1OZ1A 4AOIA 1XJDA 4IB5A 4BI1A 3D5WA 3FI3A 3VHEA 4AGDA 3BLHA 3MH2A 3UVQA 5IA2A
chains in the Genus database with same CATH superfamily
1WBSA 4C59A 4EOPA 4OTDA 3ROCA 2FSLX 3CXWA 3ORKA 4YNOA 2ITTA 1JOWB 3AC2A 4RVLA 3Q3BA 2VNYA 3MFRA 4U3YA 3PVBA 4NL0A 4HPTE 4BTFA 1GZ8A 1Z5MA 4ZLZA 1XQZA 3BX5A 3UOKA 4AA4A 3AMAA 1WMKA 3ANRA 5D11A 4CKJA 1XMLA 4D9TA 2KULA 4YO4A 3QUEA 3BE9A 4YPSA 5CXHA 5C8MA 3ZRLA 3OCBA 4I24A 4AZTA 1ND4A 1JBPE 4EH4A 3FJQE 2E9OA 3ACJA 4BBEA 3KN5A 1GOLA 4LYNA 4R3CA 3OOMA 3MA6A 5AA8A 4O84A 4BJJA 2J0JA 5EYMA 3OCTA 2JDRA 3RNYA 4H1JA 5BMMA 3S3IA 4JX3A 5GIPE 1BUHA 4ENYA 1XBCA 3CGOA 2QNJA 1P2AA 1J91A 4FSNA 4ANOA 4RIXA 3LQ3A 4FV1A 3KK9A 3O8PA 4XG7A 5BYZA 4CKRA 4RGJA 4DDGA 3BHTA 4MD9E 4IDTA 4S34A 3T9TA 5AP1A 4W4XA 3OT3A 3FMMA 1B38A 1KE7A 4E1ZA 4ITHA 2YISA 4UZDA 4X2JA 2C5YA 2GHLA 4ZY6A 4ANBA 3VIDA 3LZBA 5EOLA 3R01A 4U6RA 1WAKA 3E63A 3NRMA 4BCIA 3Q4CA 4I92A 3RCDA 2J0KA 2VTIA 3JYAA 3HA8A 1LEZA 3KULB 3CQWA 2WZJA 4S2ZA 5C8KA 3SG9A 3LLTA 2QO9A 2I40A 4FVRA 2E9NA 3F5GA 4MBLA 3R22A 4DH3A 1MUOA 5ANOA 3AKLA 4MXOA 2ITVA 3P78A 3I7BA 4FV6A 4HGLA 3R7VA 4F1MA 4C4GA 2W05A 3UVPA 1DI9A 4EH2A 4K8AA 5L6WL 3R02A 3QZHA 2W99B 1FVVA 2GFSA 2WMVA 4JRVA 4BDEA 4BDAA 5A14A 4F1OA 3QKMA 1QPCA 5EYCA 3LFDA 4C4JA 1ZOGA 4GFMA 3TJCA 2VWVA 3A8XA 3HV7A 4G3GA 4F4PA 3SOCA 1SZMA 1WBWA 3VUTA 5IKWA 2ZMDA 3D5VA 4QP9A 5KMIA 4OTHA 2OO8X 2BRMA 1JKKA 1K9AA 5HLPA 2QOQA 3OP5A 4EBVA 3C7QA 4BY9E 2C6TA 4HVHA 2OU7A 3Q5ZA 1SNUA 4F0FA 4JVGA 4GYGA 4XG8A 4ACDA 4YUQA 1H0VA 3QC4A 5HCZA 5AADA 2PZYA 1FMOE 4AZEA 3UZTA 2XKEA 4FBXA 5C4LA 2UW4A 3CTQA 4RIOA 2PYWA 4U79A 4L9IA 4CEGA 4H3QA 4D58A 1OIRA 3GFWA 4PTGA 5BYYA 2X0OA 3ORIA 3CJFA 4MXAA 5DI1A 4ASDA 1IR3A 4DHIB 5CAQA 4U41A 2XIXA 3ENMA 4BWPA 4XOYA 2V7OA 3L9PA 4FKWA 3PJCA 5IEXA 2FB8A 2JFMA 2CNVA 2HW7A 4JBOA 4MBJA 4BZDA 1PXIA 4PP9A 2A2AA 3DB8A 5CEQA 1S9JA 3LQ5A 1W0XC 3O8UA 4YHTA 3C13A 1UU3A 5F94A 3UMWA 5CAVA 3GU5A 4QP7A 2PZPA 3OTUA 2JDTA 3F3UA 3JR1A 2PWLA 4R3PA 4WRSA 1W82A 4RVTA 3SVVA 4AWIA 3H0ZA 2QD9A 3HX4A 2O2UA 4V04A 4D4SA 2CDZA 4U42A 4EONA 4K9YA 4AGCA 4E4MA 3FV8A 4I5PA 4G5JA 3BQRA 4D0XA 3QRTA 3Q53A 1ZMWA 1ZYSA 2PVMA 3HAVA 1Q8YA 3CY2A 3JVRA 3QCQA 2QO7A 3NUXA 1LPUA 3D2KA 4CKIA 3GCSA 2YIXA 3R7UA 5HG5A 1VEBA 3MH1A 4IVBA 3VS2A 3NX8A 1ERKA 4BCGA 4Y5QA 3PE1A 2WQMA 3C51A 2BTSA 4I1ZA 4NJ3A 3QTQA 3ZYAA 3KC3A 2YITA 3DBEA 5IU2A 3FMDA 3O50A 4LOQA 2XNPA 1YXTA 4EZ7A 1VYWA 2PZIA 3NW5A 3Q9XA 4M3QA 4IIRA 4QYEA 4DGMA 4EZ3A 4YTFA 3N9XA 2C5OA 3I0QA 4JQ7A 3NNXA 2C6IA 4ZTSA 4XP3A 2WMXA 3VUHA 4QDVA 1CMKE 4YC3A 5CU6A 4AFJA 4DEIA 5C8NA 4EH5A 3QUPA 4HVSA 5ANDA 3HV4A 4HYUA 4J96A 4FICA 3ZBXA 4TKSA 5I9VA 3ZSGA 3EMGA 1OGYA 3QC9A 3DCVA 4FC0A 3D15A 4L3LA 4PUZA 3DK7A 3O2MA 1JSVA 2Y4IB 2OFVA 2W4JA 1RE8A 3NWWA 1PXMA 1UVRA 2YZLA 3ULZA 1URCA 3TIYA 4BZOA 3RCJA 2HYYA 4UWBA 3GQLA 4LFIA 5M4FA 2VUWA 2VGPA 4UYAA 3UO4A 4NTSA 4R7BA 1WBOA 1OKWA 2R3PA 3HVCA 3DQWA 3FLSA 3UIBA 3BIZA 3UP2A 4EH9A 4YLJA 1J7UA 4RJ7A 5KHXA 3BGQA 3UC4A 4DHFA 3V04A 4EOOA 1W83A 4OTFA 5HVJA 3NUAA 4G34A 2NP8A 4XEYA 2Y6MA 4LV5A 2GHMA 2C3LA 3C50A 1GIJA 3EN7A 3FPMA 3N51A 4OTPA 5HI2A 5TO8A 2YACA 3RALA 4RJ6A 4AOJA 3MVMA 5HE1A 3W2PA 2WFYA 4I5MA 4BHNA 4FV4A 1WBNA 3V5JA 4L46A 1UNGA 1URWA 4LMNA 4JOAA 3R30A 2QODA 3FC1X 3SGCA 1U46A 1NVRA 1PHKA 1KWPA 4ARKA 2G2HA 3FZOA 5LWNA 5F20A 4QDEA 4NJDA 3GCVA 4D2SA 2ZB0A 4HYHA 2X4FA 2WMWA 3MGYA 2BZKB 5IEYA 2R7BA 2XNBA 3GVUA 3Q9YA 1VZOA 4EBWA 4IWDA 1IEPA 4EJ7A 3R21A 3FI4A 4ZS4A 3WF7A 5C03A 4JG8A 2Y7JA 3RK5A 4TNDA 3UPXA 4PDYA 3OWJA 2UV2A 3W0NA 1UU7A 4F0IA 4XV3A 2J4ZA 3EFLA 5AIKA 3UMXA 3HGKA 3II5A 2QU5A 5DR6A 4DDIA 3EQCA 1AQ1A 4IH8A 5E7RA 4ZMFA 3D2IA 3KQ7A 4PMSA 4X3JA 3DPKA 1ZYDA 3O17A 3VS7A 3FL5A 2J5EA 4FIJA 3VBVA 2YIYA 3QALE 4G5PA 3GXLA 5HVKA 4QD6A 2OJGA 3GB2A 3EWHA 4RX8A 5DT3A 3ZEWA 4WT6A 4EWQA 3TUBA 4I6BA 5B2KA 3TV7A 4RZVA 1OUKA 3COMA 2R3QA 2PVYA 3DQXA 2PUIA 2CKQA 3FSKA 3C0HA 5F95A 4FSQA 5HG8A 2P2IA 5LCKA 3S95A 3QF9A 4F9BA 3ET7A 3HYHA 1H1PA 3JS2A 5IDPA 2CJMA 3GCQA 4YLKA 4E4LA 2ZJWA 3OEZA 2CGUA 4KABA 2CLXA 4RWLA 2PZ5A 3TTIA 4O7RA 3FKNA 3P7BA 3UDTA 2GS7A 1H1QA 4FV2A 1R0EA 2FSMX 4JR7A 4WUAA 4EK4A 4AT3A 4HW7A 3P1AA 1ZLTA 2VTNA 2XRUA 2IZSA 4O4EA 4DE4A 3I79A 3MWUA 2GQRA 4RPVA 4C4FA 4WOVA 2WEIA 4X21A 3C5UA 3R8ZA 1Q8WA 4O22A 1OIYA 2XEYA 4CMUA 3L9MA 3SV0A 2OICA 2JKQA 3PA3A 3VS5A 5CALA 4OT6A 4EH3A 1UNLA 5I9WA 1YWVA 2A1AB 1H1SA 1J1BA 5DE2A 5LJJA 2WTDA 2NRUA 3JY0A 5H3QA 4DFXE 4NH1A 1ZYJA 5I0BA 4O38A 4MWHA 3S1HA 3MESA 5DIAA 3WIKA 4FNYA 2VO6A 4G3CA 5EM6A 5CT0A 4C36A 2B7AA 2XNOA 4YZCA 4WHZA 3ZXZA 3JPVA 4AG8A 2QONA 3H4JA 4EOJA 4GKHA 4H36A 4FKQA 3SAYA 3IONA 3QU0A 4IVCA 4TZRA 5EW9A 3BL9A 2ONLC 3FUPA 4R8QA 4AE9A 3QFVA 3KMWA 5AP0A 3UBDA 2WHBA 4JJRA 5HO6A 5M51A 3QCYA 3QUDA 1GIHA 5KBQA 3VVHA 3FC2A 4DT8A 1QL6A 1WBTA 2NYAA 3TZ9A 5KZIA 3FKLA 4Y83A 4C2VA 4ZLYA 1Q3WA 3KXXA 4L3JA 1J7LA 5CSXA 5CSPA 3TEIA 3OZ6A 2XP2A 4G3EA 4R7HA 4C8BA 1PRYA 4JXFA 3Q60A 1PF8A 4F9CA 3GOKA 3LAUA 5CF8A 5HQ0A 1PMNA 4C7TA 2YJRA 2WB8A 4P4CA 5E8ZA 5CU3A 3M11A 3Q96A 3Q9ZA 4LQMA 3ZLSA 4BIEA 3G9LX 3TACA 2FYSA 1XH8A 3PLSA 4I6HA 4C4HA 4MF0A 3PG1A 3ZSIA 3FZTA 3H9OA 4I20A 4CFUA 4RC2A 3DKOA 1TZDA 2VGOA 1XHAA 4J52A 5J8IA 2BKZA 5EQEA 3VHKA 1XH7A 4C02A 3ZONA 4G3FA 2BZIB 3EQFA 2ZAZA 2GNJA 2IZUA 3E64A 2QVSE 4L7FA 2HOGA 3GFEA 4W9WA 4WG5A 5FEQA 3ZC6A 3WF6A 5A4LA 5F9EA 4EC9A 4FIEA 2F49A 4I0TA 2WXVA 1K2PA 2VWBA 3FL4A 3SDJA 2RGPA 2WIHA 4O7SA 1AD5A 4ZP5A 2OSCA 4Q5HA 5E8SA 4MX9A 5KMKA 4OAVB 3AKKA 4YJRA 5DFPA 5M57A 2C1BA 3QXPA 3O7LD 4A4XA 4QP6A 3HAMA 3W0PA 2HENA 4NSTA 2WTKB 3NW7A 4FEQA 4TYJA 2F9GA 4CFMA 3FKOA 1QPEA 3UGCA 2AQXA 4FL1A 2V7AA 4LRJA 5AP6A 4BCMA 1YI3A 4YJPA 3ZLYA 2I7QA 4G6LA 4UV0A 1XBAA 3KIOC 4O81A 3EKNA 2ZM4A 4DH8A 1RQQA 3L1SA 4IMYA 4RJ5A 3IGOA 4M69A 4EUTA 3VWAA 5BX0A 3KMUA 4YO6A 1XWSA 5A9UA 4BDKA 2H96A 3FXWA 4WNMA 3NMUF 4E26A 4Z3VA 5FDXA 4PQNA 4QYGA 4DA5A 3P5KA 2OKRA 1VR2A 2YIWA 4ZTRA 3DOGA 3PXKA 4LI5A 4QMSA 2R7IA 2IW8A 2OJ9A 5AX3A 4ANQA 3R1YA 3AC1A 4GIHA 4RLLA 4D4VA 5TF9A 3O7LB 3TUCA 2H8HA 3UIXA 4BGGA 4I6LA 2OBJA 5EYKA 1BLXA 3UQGA 3POOA 4XUFA 4DG2E 3GOPA 4C61A 2Y0AA 2OK1A 2GS2A 3OXIA 4ZZMA 1J7IA 5LQFA 4FKPA 3NYNA 4AF3A 4JL9A 4XG4A 3SC1A 4AGWA 3ORPA 2QO2A 3VW6A 3AT3A 4FT5A 2XS0A 4QMPA 4RFYA 1OKVA 1Q4LA 4FYNA 4EYMA 3NCZA 5IH4A 1F5QA 3UC3A 4F9WA 4O0UA 5I3OA 3HL7A 3MIAA 3ODYX 5CEKA 1WCCA 5CYIA 4E5BA 2V22A 3F9NA 4YZMA 2Z02A 1R39A 2ETKA 3DZOA 2X0QA 3GC0A 3QD3A 4W4YA 1XKKA 4F63A 5BVDA 3G15A 3MN3A 4USFA 4AT4A 3WZEA 2WTIA 3MIYA 5IA5A 1KUTA 1NVQA 4DEGA 5I9YA 4FF8A 4YJSA 2WELA 2QLUA 4WNKA 4ALUA 2UW5A 3U6IA 2VWYA 3M42A 1MP8A 4JX7A 4KBCA 4WD5A 4Y95A 1R3CA 4B0GA 2PMNX 2YM8A 3DNDA 1ZOHA 2XK6A 3W32A 4HGEA 4JI9A 3U9CA 3E92A 4YGAA 3L8PA 3LJ1A 4YC6A 1O6LA 4CCUA 3QKLA 2WMAA 4V01A 5BYLA 2GMXA 2ZM3A 3TI1A 4CZYB 3PJ1A 4UMQA 2IO6A 2HXLA 3K3IA 4L43A 4FSRA 5IA3A 2BKKA 3QL8A 3W8LA 5DA3A 1M52A 1JKLA 3EFJA 3QTZA 3HUCA 3TZ7A 4OLIA 5K9IA 5A54A 3CKXA 3VC4A 4Q5EA 5J1WA 3ZTXA 4YJQA 3QQJA 1H1RA 5CF4A 1QPDA 4N6YA 1H28A 4AZFA 2BFXA 3DXNA 3P7CA 5J7HA 3IS5A 3LE6A 5IQAA 5KMOA 2LGCA 3UNZA 4EH8A 3P23A 4PL5A 4P7EA 3OC1A 3VBWA 2VTOA 5B2MA 2YCRA 4XV1A 3G51A 5AUXA 5KKRB 2ITQA 3LFAA 2UZOA 4JAJA 5J7BA 3SD0A 5KMNA 3OG7A 4FTOA 4BDDA 1VJYA 3QTIA 1NT2A 4Q9SA 4ONAA 5IQIA 3SX9A 3I81A 2BDFA 4HYSA 4XBRA 3DKFA 4E5WA 4YC8A 3QZGA 3P9JA 2VTQA 4ID7A 2GDOA 3NUPA 4FNWA 3T3UA 2GPHA 4RFMA 4OT5A 3OWKA 2HIWA 4U5JA 5E8UA 3V8TA 2A4LA 3SOAA 5CVFA 4GMYA 3TUDA 3C4FA 2W9FB 2VU3A 3R8VA 3OEFX 4AT5A 3QGYA 1F0QA 3LMGA 2IPXA 4MH7A 3MFSA 3C4WA 3ZUVA 3TMOA 1T46A 3BWJA 3NR9A 2EWAA 3ZZEA 1M7NA 3PP0A 4CT2A 1YW2A 5FUTA 2PL0A 3QTSA 5E8TA 3RAHA 3DJ7A 5BMSA 1YI6A 3OF0A 3W2SA 5CWZA 1G3NA 1JWHA 1APME 2WTVA 2I0HA 3R8UA 3GU4A 5K0XA 4I22A 4GJ3A 3CC6A 3AD4A 2C5VA 5CY3A 4NU1A 1Q24A 3RVGA 3TWJA 1Q8ZA 1E9HA 3FLZA 4V0GA 4H05A 2GNLA 4FG8A 4ERKA 3OUNB 4EOSA 2J90A 2BRBA 3Q4UA 2JEDA 2WMRA 3C0GA 3Q6WA 4N70A 3QCSA 3ANQA 4AS0A 3EJ1A 3L9NA 2G15A 3FE3A 4QTDA 4IX3A 5CX9A 4DH1A 4EHZA 3DLZA 4GH2A 3ZSHA 2W4OA 3DKCA 1Q8TA 3EFKA 5IUGA 5HNGA 1BKXA 3SW7A 3F82A 5BNJA 4KIPA 2J51A 3AD5A 3ORZA 1ATPE 3LFSA 4O86A 2NO3A 3CQEA 4PP7A 4PX6A 2R4BA 1R1WA 3W0SA 1W8CA 4IQ6A 5HVYA 5M4UA 2XCKA 4C4EA 1U54B 4IXPA 2ITUA 4FUXA 4ACCA 2UZLA 2I0EA 5T6KA 3VJNA 2YWPA 2KTYA 3H9FA 4XV2A 4U80A 4NM7A 4EKLA 3RJCA 2UUEA 4BGQA 2ZDUA 5L3AA 5GINE 5AV0A 4UMPA 1Q41A 3QX2A 2YM3A 3BV2A 2BPMA 2RKUA 3KXHA 4ZJJA 3SXSA 3QRKA 5D7VA 2W0JA 5HTCA 4E6CA 4YP8A 1PYEA 3MFUA 5EM8A 1KOAA 2W1CA 4YU2A 2ETRA 5A46A 1W84A 5JEBA 4DH7A 5KO1A 4K77A 5AR2A 5GIOE 1H24A 3QKKA 5IA0A 2SRCA 2C6DA 3CD3A 3RMFA 3UP7A 4FV9A 4ZY5A 3ZC5A 2YDKA 1JAMA 5I5ZA 2W96B 3PY1A 2RFSA 3I5ZA 2OIBA 2UW6A 5ACKA 4D1SA 4CYJA 5M08A 2XVDA 2IG7A 4YZNA 2QQ7A 4FKVA 4J8NA 1CSNA 5K4JA 3NFFB 1AGWA 2X9FA 3FZSA 5J9LA 2YEXA 4UZHA 3COKA 5JH6A 4AA5A 2Q0NA 4TYGA 2OZOA 4FTTA 3FQSA 2PMLX 2B9HA 4E20A 4UWCA 4XCUA 2EVAA 4PV0A 1P4OA 2X9EA 3S0OA 3FYJX 4YPDA 4YTHA 3NVMB 2BRGA 4O7NA 4L7SA 3WF8A 3HMPA 5HNBA 4YSJA 3WYYA 3HRCA 3GCUA 1QCFA 3L8XA 3P0MA 2Q83A 4L3PA 3HP2A 4K11A 1O9UA 3BYSA 4RQKA 5EH0A 3UQFA 4O96A 2ZV9A 5HKMA 4ZJVA 3BHYA 3U55A 3QZIA 3MVLA 4KS8A 5JN2A 2O63A 4D5KA 4XG2A 2X0PA 2WKMA 5KZ0A 4BL1A 3IQ7A 3FZ1A 4PL4A 4L44A 3ZUTA 2OZAB 4X6QC 5DNRA 4D1ZA 4F65A 1OM1A 1H07A 4B4LA 3WZUA 5AP3A 4AU8A 2BRHA 4B6LA 4Z16A 2JDSA 3PWDA 2G1TA 3LPBA 4RMZA 5FG8A 5A6OA 4LUDA 3R9HA 4G6NA 4RA5A 5IQFA 3P4KA 3FPQA 5HBJA 5IEVA 2P2HA 4G1WA 2R9SA 3SQQA 4CV8A 3LHJA 4EK5A 1GIIA 4JLCA 3MY0A 3TV6A 3PG3A 5BUJA 4TL0A 2DYLA 2OIDA 3BYOA 5E90A 3HMNA 2W5HA 4DTAA 3G6HA 3U4WA 4BIBA 2JKMA 1ZZLA 4XP2A 3ZRMA 2O64A 5EW8A 3EOCA 4P90A 5AUZA 5M4IA 4LMUA 1OIUA 4IWOA 3R71A 5EDQA 3FMNA 5DH3A 3O23A 3DLSA 4CG8A 1OBGA 2XNEA 3EN5A 3BU3A 4D0WA 2H6DA 5D12A 4YZDA 4ANMA 2RL5A 5ANGA 4B9DA 4FKSA 4DT9A 4FTIA 5CVHA 4QYFA 3LM0A 5D9HA 2WTCA 4NIFB 5J79A 5DOSA 2EXEA 3R1NA 2WNTA 5EI8A 2JDOA 3O0GA 4FSMA 4WNOA 4O4CA 1OL7A 5I9ZA 1SVEA 1KE8A 3OBGA 2GS6A 3E7VA 4M0ZA 3W8QA 3OT8A 3WARA 2PUPA 4LGDA 5AV4A 4R3RA 2YAKA 4GUEA 5K0KA 3V51A 2OLCA 2BZJA 1TQMA 3WOWA 4K1BA 2QOKA 1H27A 2A19B 5E8YA 5FWKK 3RINA 3MJ2A 5ANKA 3W0MA 2XBJA 4ZTHA 4DEHA 3EB0A 4PWNA 3CY3A 3V5TA 3DBCA 4F99A 4ZMEA 2CPKE 5LMKC 5K5NA 4XRLA 3UDZA 4M15A 2PUNA 4WO5A 3MJ1A 4GCJA 4M8TA 2YHVA 2Z7LA 3IPHA 4EL9A 4M84A 3R9NA 1YDRE 4CYIA 2WAJA 3TV4A 3OS3A 3WI6A 5DEWA 5M56A 5FP6A 1DAYA 3NAYA 4L45A 5IA4A 5EQPA 4G31A 2WOUA 5AIRA 2YN8A 2W1FA 5IH5A 2XJ1A 1W2CA 3ZXTA 1NW1A 2O5KA 4KBAA 2CGWA 5CVGA 1FQ1B 3LXPA 3NUNA 2JBOA 3ZO2A 4LRKA 4GIIA 5CU2A 3R9OA 4AW2A 4PDOA 4CMTA 3TTJA 4QTBA 3W18A 3GC9A 4HVGA 2CKEA 2RG5A 3EQHA 1PXKA 4MD7E 3OHTA 4Y72A 4EJNA 3DBDA 2PE2A 5FDPA 1W7HA 2C3JA 1J1CA 2I0YA 3COIA 4FTQA 4GFOA 4GK3A 4ANLA 4DH5A 2FGIA 1YOMA 4TTHB 3KREA 4FTAA 3RI1A 4U97A 2R3HA 3A60A 5TR6A 2JKOA 4BZNA 4KINA 2GHGA 3WIGA 3BELA 2YZAA 2Y4IC 3BBWA 5GHVA 4PPBA 3H30A 3ZLWA 3TG1A 4F70A 2HZNA 1V0PA 3N4UA 4Z55A 3RGFA 3RPSA 2OXYA 3CPCA 4MNEA 1GJOA 3HMIA 4IX6A 4U8ZA 3IOPA 2UZVA 2A0CX 4O6EA 3VUMA 2XRWA 4NEUA 4BKJA 2HWOA 3PFQA 3QA8A 3QRUA 3A4PA 3PVGA 2HY81 5I9XA 3LCSA 2UW0A 3FWQA 3DBFA 4F9YA 2BMCA 2VX1A 4FIFA 5HO7A 4PMTA 4LUEA 3UIMA 3VBXA 4JDHA 5HESA 2FO0A 3E87A 2AC5A 5AR7A 4PNKA 2HWPA 4TYHA 3WZJA 5IF1A 2PMIA 3DJ6A 3BPRA 2IN6A 3WILA 2J50A 3SRVA 3E8CA 3PUPA 4QMWA 1H00A 4O0TA 3BBTB 4FV8A 4GS6A 4HVIA 4ASZA 5AV3A 1FOTA 4DGOA 4RX5A 4USEA 4O7TA 4EI4A 3CTHA 4JDKA 4R1YA 5CEPA 5I3RA 3A7JA 5ITAA 5FQDC 5CTPA 3F3ZA 3PXQA 3R63A 4UWYA 5DVRA 1NA7A 3BV3A 2QOFA 4AUAA 2VN9A 4TW9A 4X2NA 3Q6UA 2JAMA 5HCXA 1H25A 3MW1A 1BX6A 3PSBA 4HGSA 2CGXA 2RSVA 2ONLA 2XUUA 4W9XA 2P4IA 5CNNA 2ITYA 3FXZA 2WEVA 2W4KA 4FOCA 5HD7A 4M7IA 3QTRA 3FDNA 3MS9A 4OTGA 4ORKA 3KXNA 3VF8A 3VULA 2XANA 4JDJA 4YTCA 3TXOA 5HD4A 1JKTA 3IOKA 5TT7A 5IQGA 4J53A 4QPMA 3WYXA 4GRBA 1UU8A 5JQ8A 5KNJA 4KA3A 2FVDA 3RAKA 3REPA 5HIEA 3LJ0A 1M7QA 1REKA 4C58A 3KB7A 4ZZNA 4UXQA 1I44A 4A9RA 2JAVA 2B1PA 3PRFA 4TT7A 4RIYB 2EU9A 4U9AA 4USDA 2AYPA 5L8KA 5DWRA 2ZFYA 2UZBA 3DAEA 4PY1A 2ITXA 3EN4A 4LM5A 4E8AA 3PY3A 4GU9A 2F7XE 3Q2MA 5CSWA 5HE2A 3UE4A 3NIZA 3F61A 5B0XA 3DGKA 3C4EA 2E9PA 1ZRZA 3B2WA 2XIKA 4FZDB 1TQPA 3UOHA 4BCQA 4RIWB 1R78A 2G2FA 3PPKA 5M55A 3QAME 3QHWA 2VWIA 5CAPA 2PVNA 3I7CA 1RJBA 1IRKA 4K6ZA 2QCSA 3BWFA 3PUFC 1MRYA 3LCOA 4FNZA 3SHEA 4DFZE 5EG3A 2UVXA 4F7SA 2HZ0A 2WGJA 4J71A 3QBNA 4MQ1A 4X3FB 4YNEA 5KMMA 3R7IA 2QKWB 2ESMA 2IVSA 4ZIMA 3VS4A 2XEZA 1X8BA 4WUNA 5T68A 2R3JA 3RK7A 2XBAA 4FTUA 4DG3E 3FHRA 5IMEA 1YDSE 1FPUA 3QQHA 2C0TA 5BVEA 3LFNA 2WQEA 5CAUA 2W9ZB 5JFXA 3OW3A 3THBA 3CJGA 2ITZA 2NRYA 1UU9A 1IASA 4DBNA 4F1TA 3FEGA 3BHVA 1KE5A 4XLIA 3QLGA 2X2LA 3FMHA 4KIKA 5K4IA 2XM8A 4HNIA 4OTRA 4TRLA 2R0IA 3OTVA 1M2RA 1H4LA 3D7TA 5F4NA 3NNVA 1XO2B 2PVKA 1BL7A 1OI9A 1Y6BA 1ZOEA 3O51A 5ANIA 5FXQA 3TL8A 4PNIA 5FM3A 4O0XA 5HGIA 1PYXA 1OBDA 1BL6A 4XP0A 4MBIA 1Q8UA 3KRXA 3NFGB 4QTEA 4O82A 3QQFA 3W2QA 1FINA 2J9MA 2CNQA 4TYEA 3RHXA 3QQUA 2IVTA 3I6UA 2ZV8A 4RBLA 5AMNA 1ZAOA 3LCKA 4IAYA 2HZ4A 5E91A 2YM7A 5HZNA 3T9IA 3MI9A 4PTEA 1LP4A 3F2NA 3U4UA 2HY0A 1ZY4A 4I4EA 5AAGA 5AR5A 4YBKA 4BDFA 5M06A 1TKIA 3KL8A 2WU6A 2ITWA 4BJJB 4N57A 4IVAA 4D9UA 3FLWA 3SXFA 3KFAA 2C0IA 3N4VA 1YOJA 2OJJA 4DFBA 3FSFA 3RAWA 3KK8A 3UZRA 5HIDA 4D28A 4QQ5A 4J1RA 3RWPA 2C6KA 4W8DA 4RIXB 5AUYA 3FMLA 4KIOA 2GNIA 4IFGA 4FTNA 5B2LA 5GJDA 1XR1A 2R0UA 3BRBA 5CI6A 5L2SA 4RC4A 3NNUA 4O0VA 2PY3A 4PPAA 4QOXA 2YIQA 3O96A 3ZEPA 1P4FA 4F6UA 5LMAA 4QMOA 4BCJA 1PJKA 2WMSA 1KV1A 3HMMA 3BQCA 4WG4A 2O3PA 5A4QA 5BPYA 4EZ5A 5J9ZA 2DQ7X 4QQJA 2WTKC 4BCPA 2JC6A 3D9VA 3S2PA 1U5RA 1VLRA 5HG9A 3R7OA 3W16A 4KBKA 3VW8A 4WKQA 3KRJA 5EHYA 3RM7A 3DT1A 4IZAA 5EM7A 2YLFA 4IWQA 4K0YA 3IW8A 4H39A 4MXYA 3BGZA 4E6DA 3EYHA 3RZBA 1Q99A 5DEYA 2P3GX 2XAOA 2R5TA 4FSYA 3DFCB 2X6EA 1U59A 2YLEA 3VS0A 4DFLA 3V5LA 3HZTA 4FT0A 4O0WA 1W2FA 3HECA 2O65A 4BDHA 4FV7A 4BCNA 4DEDA 4B8LA 4EK6A 3DFAA 1OPLA 4J97A 3MPMA 4QMQA 4O27B 1KE6A 3OUKA 5HX6A 3R0TA 3N4TA 1PXOA 2BAKA 3O8TA 2VWXA 2J0IA 3VO3A 2X6DA 3W0OA 4E3CA 3BLQA 1YHWA 4GT3A 3QGWA 3HDNA 3FZPA 4ZK5A 3GT8A