4YTIA

Discovery of vx-509 (decernotinib): a potent and selective janus kinase (jak) 3 inhibitor for the treatment of autoimmune disease
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
289
structure length
284
Chain Sequence
b'TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of VX-509 (Decernotinib): A Potent and Selective Janus Kinase 3 Inhibitor for the Treatment of Autoimmune Diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 102
structure length 284
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ytiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ytiA01
3MVMA 3N9XA 2ITVA 4MNFA 3U8WA 3QALE 3QLFA 4C3PA 2IVSA 4GFMA 5HKMA 2P3GX 4U7ZA 5GNKA 4BC6A 4RVTA 3R7UA 3W18A 4L3PA 4XRJA 5IEXA 2VX3A 3I7BA 3ANQA 4KS7A 4BCQA 2QVSE 4C0TA 3ATSA 2PVHA 4W4XA 2W1ZA 4F7NA 4LM5A 2DQ7X 3VS7A 5DYJA 4QP3A 5FWKK 5BYYA 4WNOA 4XG9A 1MRVA 4RGJA 4PUZA 5HI2A 3GFEA 2G9XA 3DOGA 5K9IA 3HAVA 3CKXA 3GEQA 2AC3A 1H0VA 2R3PA 1U54A 3HMPA 4RWKA 2WKMA 3PTGA 3KFAA 3VBTA 1P4OA 2ETKA 4GEOA 4KABA 1H25A 5CAQA 3FQSA 2WTDA 5FEEA 3K5UA 4GG5A 3IQ7A 2IW9A 5JZJA 4OBPA 5AUVA 1REJA 4FUYA 4QMMA 4E4NA 3L9LA 5B2LA 4HOKA 4NWMA 1OIQA 5AR7A 5E1EA 2F57A 3ZC6A 5I4NA 3TKUA 2VTNA 2ZJWA 2ZYBA 3CTHA 4QOXA 5CEIA 2OXYA 2X81A 4NSTA 4FSYA 4TYHA 2OFVA 3Q32A 4TN6A 1OL6A 3UG2A 4AACA 4R3PA 3ZM9A 2OG8A 1GZKA 3QGYA 2FGIA 4FX3A 4HYHA 2UZBA 2WU6A 3KCKA 4OBQA 3SXRA 4JR3A 5CI6A 4Y83A 3UMXA 4EHGA 1Q8UA 5G6VA 1IRKA 1QMZA 3ZLYA 3PY3A 4DGGA 2WXVA 4QP2A 3DBCA 3NS9A 2OJFE 3BLHA 4QYYA 3NVKI 1WAKA 4G34A 4W8EA 4G16A 5C26A 3HV5A 3CS9A 3Q2MA 4JG7A 4O0SA 5HNBA 3UOHA 1YXVA 4EYMA 4D4SA 3WZJA 4ZLZA 1FVVA 4S31A 2R4BA 3BBWA 5IQIA 4O0YA 4C61A 4Z3VA 4IM2A 2EUFB 4L53A 2OF2A 4YJTA 4BDFA 3AC3A 4JQ8A 5I0BA 3LCTA 4LRMA 4AOIA 5M4IA 2QOBA 5CSPA 3L9PA 4EBVA 1YRPA 5E9EA 5FD2A 3GCVA 2WEIA 1WBSA 3D5XA 3R02A 3A4PA 3R8LA 3WOWA 2UW3A 4YUQA 3N4UA 2W5AA 4R5SA 5D7VA 2WU7A 4JBPA 2V5QA 3IECA 4RFMA 3DY7A 5HO6A 1J91A 3WYYA 1RW8A 5AUWA 4O82A 1PYEA 3LFQA 4QP8A 4DEGA 5BVWA 2CGUA 3SD0A 4AG8A 4EK5A 2ZV8A 5LARA 4L3LA 2F7EE 4CZYB 5EHYA 4FBXA 2RG6A 3UPXA 4AN2A 4YLJA 3BHTA 4LRKA 4RA4A 3GB2A 2IN6A 1CSNA 4X3FB 1QPEA 3NAYA 4X0MA 5DRBA 4O7LA 4GT3A 3UO5A 4FOBA 1JLUE 1KOAA 3RK5A 2X2LA 4JIAA 4O0VA 2YDIA 3P08A 3IPHA 4FTNA 4H36A 4I22A 2VO6A 3NSZA 3M1SA 4MBJA 5AR2A 3QCXA 4PNIA 4EOPA 4J7BA 2I0YA 4XH6A 3QTQA 4L46A 1GZ8A 3CGOA 3UVRA 4C35A 4ZS4A 1XBCA 2X4ZA 4MXAA 3CQWA 5CANA 3KK8A 4W8DA 3HZTA 3WE8A 4PQNA 3FY0A 5DT3A 4CLJA 4C58A 4MBLA 4CGAA 3BZ3A 4KA3A 4NTSA 2UW6A 5AP2A 3CR0A 3O23A 5IH4A 4TWPA 1GZNA 3LAUA 1E1XA 2GHGA 3FL4A 3Q4CA 4G3GA 3THBA 3SOAA 5FUTA 2JFLA 4UEUA 4LGDA 3ZEPA 3DJ7A 3F69A 2GTMA 4TTHB 3AC5A 2OZAA 3QQHA 4U9AA 4D5HA 2YABA 1NA7A 4HCUA 2OI4X 1H1SA 3QZGA 4FVQA 4PY1A 5EI8A 3A8WA 4EH3A 2WQNA 5GIPE 2QCSA 3KRLA 1Z57A 2HXLA 1DI8A 5HE0A 3MJ2A 3F9NA 4M13A 2QOKA 1YHVA 1BUHA 3QL8A 3R30A 4JR7A 5AV2A 3TJDA 3R2YA 3CPBA 3PPJA 2XEYA 1GIJA 1GNGA 4M3QA 5KMOA 3SW7A 5HX6A 4NM0A 5BYLA 4O81A 2XYUA 4O86A 3HP2A 4IACA 4IC8A 4NIFB 3DBEA 3AQVA 3NW6A 4ZK5A 3UGCA 4GIHA 4E3CA 5M07A 2QG5A 4U80A 3PRIA 3EYHA 4CT1A 3NUAA 4FV1A 3DK3A 3N4VA 2AC5A 2VO3A 4EH8A 3F88A 1GY3A 4G5PA 2OLCA 5ANDA 3UQFA 2Z60A 4C4GA 3H9OA 4IJPA 4C2VA 3G6HA 2X8DA 2CCIA 4BN1A 4ZJVA 1PXKA 3MPAA 4PL5A 5HTBA 2HZ0A 3TUBA 1NVQA 4MVFA 4BDGA 3F5PA 4DGLC 1PY5A 3FZTA 4FSQA 3EYGA 3KMMA 2C1AA 5BQ0A 3V5WA 2WTIA 4X3FA 4RC3A 2X2MA 3U87A 4X7QA 4QT1A 5CLPA 3QHRA 2DWBA 4FODA 2JDSA 4I5PA 4ZTNA 3UO4A 3UIUA 4DAWA 3P23A 3R9HA 4CYJA 3RJCA 3QYZA 4GRBA 4RX7A 3SHEA 2PWLA 3IO7A 5EHOA 2E9PA 1ZYCA 3FI2A 4JAJA 4F9CA 5LMBA 2UW7A 3HDMA 3PXZA 5L2IA 1J1BA 1FPUA 4ANOA 3FZRA 3R28A 1JSTA 2XK7A 2CNVA 3BV2A 4BBMA 4TWNA 4L68A 4XX9A 4X6QC 5HCYA 4PDSA 3FXZA 4K11A 2WIPA 5DE2A 3A62A 4QPSA 4K1BA 5H9BA 1OBGA 5JSMA 4YP8A 3G2FA 1V0BA 3FLYA 5I9XA 3DAKA 4FG9A 4BCJA 1RE8A 2BALA 3ELJA 2OXDA 3MH2A 1YI6A 5CU4A 2QOFA 3EZVA 2OXXA 3FAAA 3FI4A 3MH1A 4YHJA 4YSMA 4PWNA 4O7YA 4BCMA 3SW4A 4JBOA 1XH7A 3L1SA 3EQBA 1PJKA 2E2BA 4N0SA 4RMZA 4ITIA 4F0FA 4OTRA 4NKAA 4BGGA 1OIYA 1U5QA 1W8CA 5M09A 5FXQA 2P33A 4A4LA 4Y5QA 1XJDA 2FB8A 3NLBA 2YM7A 1KWPA 4A9TA 4KKHA 3V5JA 2E9UA 4CCUA 3PLAE 3HGKA 4XNEA 5ACBC 3DB6A 5HCXA 4C38A 4XG3A 4HVSA 5LXMA 3VUHA 2R3RA 3QRUA 3W2QA 4TYIA 2GNJA 5GZ8A 2BHEA 5CS6A 4FGRA 2CJMA 4HVDA 1W83A 4FSNA 1PKGA 1BX6A 4IQ6A 3JY9A 4BICA 4IXPA 5FEQA 3ROCA 4IZAA 3PG3A 1UNHA 1O9UA 2Z7SA 4JRVA 3VQUA 4IX3A 4K77A 4JDJA 4S2ZA 4BZOA 2UUEA 3G9NA 3RWQA 4DITA 5D12A 4BY9E 2ERZE 2YIRA 3E93A 3QKLA 4O27B 2ZVAA 3P86A 3C4EA 1SNXA 4HJOA 4C4EA 3FMNA 2JAMA 2VGOA 5CSWA 3UE4A 3HECA 4ALUA 1BKXA 4PL3A 4M8TA 2YWVA 3MVHA 4RJ6A 4FTAA 4FK6A 4AA4A 3LKMA 4I6QA 4EH7A 1U4DA 3BHVA 3KCFA 4FV2A 3PPZA 5HCZA 2PVLA 4IWOA 4IVBA 4FSWA 4FTRA 3V51A 5ITAA 2BIYA 2ACXA 1OUYA 4MHAA 4K0YA 5J9YA 3R71A 3H10A 3COKA 3NIZA 5AEPA 3GVUA 4FF8A 4R77A 4E73A 3T3UA 2IZRA 5FXRA 1J7LA 1Z9XA 3I4BA 3VS2A 4FA2A 5KMJA 4O0XA 4XLVA 3RBWA 4BTKA 3SG9A 1U46A 3P7AA 1OVEA 2WQEA 4JI9A 4R3CA 3AD4A 2WB8A 5E1SA 4RA5A 2R2PA 2VO7A 3TWJA 3EN5A 1Y6BA 4AN3A 4IZ7A 3PXQA 2XK3A 3O7LB 4FYNA 5J1WA 5DI1A 4FC0A 4A9YA 1KSWA 3P9JA 4CSVA 4BGHA 4EORA 3AC2A 3FDNA 5M4FA 1KE8A 2EB3A 2YIWA 3E5AA 5DVRA 4HGLA 3FBVA 4RSSA 3LLTA 2XM8A 3ETAA 3O8TA 4M0ZA 4ZMFA 5IEYA 4BGQA 5IH5A 1NW1A 3Q6WA 1RJBA 2R3NA 4FTQA 5IF1A 4QMUA 4F4PA 5HOAA 2P55A 3ORLA 4UBAA 3JYAA 3A8XA 2WMWA 5EQYA 2PSQA 3KMUA 3QA8A 5K0XA 3RPYA 3PIXA 2QODA 2HOGA 4C57A 4KIPA 3U4WA 3ZDIA 4FKTA 4O0RA 2RIOA 5IQEA 4C3FA 4TZRA 3AOXA 3C5UA 3QXPA 4F9WA 2H6DA 3N51A 2C6IA 4OBOA 4B99A 4DFUA 1WBWA 4YZCA 2BUJA 2I1MA 4NFNA 4R3RA 4UYNA 3BEGA 2RFSA 2XJ1A 4P7EA 4CV8A 3BWJA 4FT9A 3MDYA 1MUOA 2F9GA 5HGIA 3MIYA 4KKGA 3Q53A 1M52A 3KGAA 3O51A 4UV0A 4N57A 3M11A 4FICA 3IONA 4YZ9A 5IUGA 1JPAA 3Q4ZA 3GU5A 3MW1A 4NK9A 3V8SA 3NCZA 4RFYA 4YNOA 2R3HA 4Z9LA 5AV0A 3P1AA 4O7TA 3R8UA 5C03A 3WE4A 3VQHA 4AZSA 4IAYA 1WZYA 4O6EA 5B7VA 4ZZNA 4RWLA 3ZXZA 2GS6A 3CSVA 2O5KA 4RQVA 5BUJA 4FKPA 4RWIA 4V01A 5L2SA 3HMOA 2C5NA 2ZDTA 3VRYA 3H3CA 2R64A 4GG7A 5JK3A 3JPVA 4YZDA 2WTKC 3EQFA 2VNYA 5T3QA 3MH3A 1Q24A 2UZOA 3EQIA 4ZTQA 4FZ7A 3F7WA 3OWKA 4CTBA 4AW2A 4M12A 4ZJIA 3HKOA 2Y4PA 2G2HA 3OXTA 4TYJA 4C59A 4R7BA 4J71A 1O6KA 3QUEA 5IQFA 3DFAA 3W8LA 3HRFA 4ZJJA 4AFJA 4DEAA 1V0OA 3DKCA 5CI7A 5AADA 1TVOA 3VUTA 1MRUA 1VYWA 3T3VA 3R7VA 4E5WA 3FMEA 3HUCA 4MEDA 2CPKE 4RIXA 3K54A 2W4JA 1Q3DA 2VD5A 5CVGA 1REKA 2PMOX 4NZWB 3EFKA 4FKLA 3VO3A 3R7IA 2W4OA 4WRGA 3UTOA 4NM3A 4TWCA 4TNDA 5F20A 4FKQA 3NYVA 3NUXA 3DBDA 1CDKA 4GMYA 4IAKA 4LG4A 3DJ5A 3BWFA 2VTOA 3II5A 2IZSA 4L3JA 5CU2A 3RCJA 3VWAA 3A7GA 4RVMA 5IA5A 1ZMVA 2R3KA 4CQGA 4FTIA 3FMMA 5KX8A 5GHVA 3LFCA 3PXYA 1H08A 1I44A 3A7IA 4M66A 3RZBA 5JN2A 4X2GA 2BTSA 5HVKA 2C6DA 4PPCA 1H28A 4NL0A 4YTIA 4RRVA 4DEEA 5ANGA 4Z55A 5IQHA 4U3YA 4BF2A 1OECA 1OITA 2ZMCA 1UKHA 2W1IA 4OW8A 3E7VA 4JVGA 4X2JA 5KMLA 2UW0A 4UMTA 5AAFA 5EQEA 4BDKA 4MF0A 5C8KA 2VRXA 4A07A 1PXIA 1Y57A 3RAIA 2UZEA 4YJPA 3OC1A 5BVEA 3KA0A 5BVFA 2WMUA 3ET7A 1PYXA 4TKSA 4YSJA 4D2TA 2X6EA 4YJOA 3KXMA 2B52A 2X9FA 1Q62A 3JS2A 5EG3A 4DFYA 4F7JA 5KO1A 5AUYA 3UZPA 4BCHA 3DK6A 3LXNA 3PJ2A 2J90A 2XNEA 3IK3A 2B7AA 4DFNA 4E6DA 5KUPA 3KULB 2XRUA 3AC8A 2H9VA 2OIDA 3RM7A 2G2FA 1YXSA 5AMNA 3RPOA 4BKJA 3OXIA 3QTUA 1UKIA 3OY3A 3D94A 4YTHA 5IQBA 4BDEA 3NWWA 4PV0A 2VWXA 5F94A 3FMJA 4Y72A 5A6NA 4WBOA 4CKJA 4XG7A 1ZY4A 4U97A 3LQ8A 3DTWA 2OJIA 4PL4A 2WO6A 3RPVA 2EXCX 2PTKA 4QRCA 3SA0A 4CEGA 2EWAA 3F5XA 4YBKA 2R3MA 5AIKA 1WBNA 2XRWA 4IAZA 3LCKA 3AD5A 4BCGA 4FEXA 3GNIB 4C02A 4EKKA 4RJ3A 2Z7RA 5DR6A 5LMKC 2BRGA 1URCA 4R6VA 3LFDA 3P7CA 1R1WA 2XIZA 3UIMA 4GU6A 4HYSA 5DG5A 2HY81 4TYGA 4B0GA 4ZY5A 4IFCA 5CAVA 3UQCA 1Q99A 3NW7A 4A7CA 1CKPA 3SV0A 3TZMA 2B4SB 2XJ0A 4O91A 5JGBA 3KREA 4DTBA 3ORZA 2UVXA 5DEWA 1ZMWA 3IW6A 5K4IA 5KKRC 4KBCA 5L6OA 4USDA 3MFTA 2X8EA 2E9VA 2V55A 5E8WA 4F6UA 1Q97A 2X7GA 1UU8A 3Q9YA 4IADA 3IKAA 3QTRA 2GTNA 4K8AA 1YXXA 2UVYA 4QP6A 4YJNA 4E5AX 4MNEA 3TUCA 3TTIA 3TM0A 4FZFB 4BR3A 4AGUA 1OPJA 3UQGA 3BV3A 3KVXA 2J50A 5JEBA 2YACA 2WPAA 3SGCA 3OXZA 5CNNA 3OWJA 3QRIA 3QQFA 3OCBA 3PJCA 4ZSLA 3NRMA 4IAFA 1LPUA 4AZVA 3AMAA 4B4LA 5BYZA 4BFMA 2YAKA 4XRLA 4E1ZA 3C13A 3QUDA 2DS1A 4BBFA 2H34A 4RVKA 3ZLWA 1YKRA 5FDXA 4XP0A 3ZSHA 5M06A 3I5NA 3WF5A 3C4CA 2PZIA 3IDPA 1IAHA 3BYMA 4UY9A 4ZMEA 2V0DA 3IDCA 2X7OA 3UVPA 3LFNA 5HZNA 1PW2A 3UO6A 4DCEA 4G1WA 4GCJA 4NKSA 4YJVA 4CFFA 4FNWA 4UMRA 5LJJA 2HWPA 1U59A 2VO0A 4IZYA 4LMUA 4XBRA 1H0WA 3TV4A 4FTJA 5BUIA 5IDNA 3TDVA 4XJ0A 5HIBA 2FO0A 4MXYA 5CASA 2GFCA 4FZ6A 1AQ1A 4F1MA 1FMKA 4PDPA 2VWZA 5B0XA 4U43A 4F9BA 3SXFA 4B9DA 2HZIA 3E3PA 3FSFA 4V05A 1G8AA 5ETAA 1OKYA 4AW1A 4BDIA 2CNQA 3RWPA 2XMYA 3OD6X 4QMPA 2OO8X 4JQ7A 5CQWA 4EKLA 4JIKA 5L6PA 4BI1A 5AFVA 3DAJA 4I92A 2I0HA 2X2KA 3G5DA 4EH4A 3ZEWA 5FXSA 1ZLTA 2XK9A 2J6MA 1R0EA 1I09A 2XNPA 2XF0A 4ENYA 5IMXA 5ANJA 3P5KA 4WD5A 2XCHA 3NIEA 3ZUTA 1G3NA 4ANSA 4EI4A 3QA0A 2WTKB 3F3VA 4CMOA 3OHTA 3OP5A 4WHZA 4ASEA 3UOLA 3QX4A 2YDKA 1FVTA 3EMGA 4DYMA 1URWA 1L8TA 1GZOA 3LW0A 2QU6A 5EW9A 2IVTA 4NUSA 1YXUA 3ALNA 4D28A 4L42A 5IA2A 2ZV7A 3E8EA 2C6OA 2XNGA 4IVDA 5HIEA 4H1MA 2J0JA 4QYEA 5EKOA 2IJMA 5E4HA 5EM6A 2XS0A 4QMVA 3BGQA 3BI6A 3QC9A 3NNVA 4OTPA 1PMUA 2O2UA 3FSKA 4TNBA 5ANKA 4B6LA 4I1ZA 2Y9QA 3F7ZA 4GJ2A 1BI8A 4GYIA 1YXTA 2EXMA 5L8LA 3JUHA 2W9ZB 2WEVA 3R21A 4ERWA 4JLCA 2YITA 3D2KA 4BBEA 5HLNA 3PXFA 2QURA 2GNLA 1YI3A 4RC2A 3T8OA 2SRCA 2J7TA 3VS5A 3K3JA 4QMOA 4QP7A 5J95A 3VHKA 2PZRA 4F1TA 1FGKA 4FKGA 4ZZOA 2NO3A 5K5XA 1H1RA 5FBNC 3Q60A 4FV5A 4EH2A 4AT4A 3NVMB 4FEUA 3B2WA 1IG1A 4EOIA 4DTKA 4RZVA 3FZOA 3RP9A 1SM2A 1ZRZA 3JVSA 3FLSA 3MS9A 4XS2A 4F7LA 2UZNA 4J98A 4FTUA 1O6LA 2JKQA 3A7HA 2BFXA 4JJRA 3QD0A 4U42A 1OIUA 5K4JA 5CF6A 3FI3A 4QTEA 5CSHA 5E90A 4FVRA 4JAIA 3LJ2A 3PWDA 3G15A 2IG7A 2CLXA 4W9XA 4WG3A 1R78A 1XH6A 3PJ8A 2JKOA 4G3EA 5CXHA 5FTQA 2GNHA 4UXQA 5HESA 5L2QA 3V5TA 1NXKA 2XBAA 4E7WA 4DT8A 4FV3A 4MWIA 4HNIA 4BHNA 4USEA 5EYDA 5IPJA 3KXGA 5C01A 3VN9A 4D4YA 1JQHA 4AE6A 4FYOA 1JWHA 2NPQA 4P4CA 2VZ6A 4XUFA 3BIZA 2JBOA 3SRVA 3WZUA 1S9IA 4NJDA 4U5JA 4AZFA 3V3VA 3NEWA 3O2MA 2ESMA 4I0RA 4BZDA 5I3RA 1XH4A 1VJYA 3V5PA 3TNHA 4C7TA 3QWKA 5J9LA 3ROYA 3LMHA 4C37A 1H07A 5AM7A 2YWPA 5JRSA 1OKWA 1Q8WA 1ZYSA 4QMXA 4W9WA 4D2SA 4AZTA 5AP1A 3R83A 4AU8A 2PE1A 4J52A 2VTPA 4W4WA 4W4VA 3PRFA 4JBQA 4EC9A 3G9LX 4CG8A 5DR9A 3QTWA 4FTCA 3OCTA 3BQCA 3R1NA 3BU5A 2PZ5A 3CPCA 4FSRA 1Q4LA 4LL0A 4O7WA 2F2UA 2YM6A 4L8MA 1M2PA 3CE3A 4QMWA 4DLIA 2UZLA 1TQPA 3BE2A 4ERKA 4O2PA 4XG6A 3TXOA 5DGZA 4JS8A 3EJ1A 5AP6A 5FTOA 4GK4A 3P79A 3ZS5A 3CKWA 3DKFA 2RKUA 2HZ4A 2VTAA 4GIIA 4WSYA 5GINE 2IVVA 1YOJA 3F5UA 1WFCA 5CALA 1QPDA 5IU2A 2PVNA 4MH7A 4XHKB 2B9JA 3V6SA 4KIOA 3ZHPC 2A4LA 5KKRB 4RX9A 5I9UA 4PDOA 3D2IA 5L6WL 5B2MA 4RLLA 2QOCA 4C34A 3U55A 4FNZA 5I3OA 5EI6A 3S3IA 3PVGA 1JKLA 4AN9A 2BRHA 4GW8A 1XH8A 2QO9A 4GK2A 4G9RA 4IJ9A 4BIEA 4O38A 3HMIA 4H1JA 4BYJA 3D5UA 1Y8YA 1M7QA 2XVDA 3CEKA 1UA2A 3GXLA 5FBOA 3RVGA 5HLWA 5C4KA 1ZZ2A 3V5QA 2IO6A 5L8KA 4FL3A 5DBXA 4U0IA 5CY3A 1GIIA 2ZAZA 3QCQA 4RVLA 2ITZA 2WMSA 4KSQA 2QO2A 3RZFA 4DT9A 4BDCA 1OL7A 5AM6A 5BMMA 4FV9A 3TZ8A 4ARKA 4Q9ZA 5BX0A 4J97A 3TIZA 3ITZA 3GCQA 5JQ5A 3RPRA 4QTBA 2Y6MA 4EUUA 4IEBA 3I0QA 3BGZA 2VWVA 4KKEA 2ZM3A 2C5XA 4ITJA 4YPSA 3PP1A 2ZDUA 3ZFXA 4D9TA 2PVFA 5KHXA 3QHWA 3UC4A 4EOOA 5CF5A 3EL8A 4OT5A 2C6MA 3LHJA 4KIKB 5LMAA 1XQZA 4F7SA 4NCTA 2BAJA 3BYOA 2BAKA 5CVFA 4XBUA 5CU6A 5IDPA 3PY1A 3ZOSA 3BU6A 2R5TA 4DGNA 1PMEA 3CCNA 3OCSA 3AD6A 3DNEA 3IG7A 3SLSA 4ZLYA 2WAJA 5FGKA 5IZFA 5JFWA 4V0GB 4FKIA 4PMPA 4JOAA 5K3YA 3VBVA 3ZSGA 2QOHA 4RBLA 4IVAA 5LMKA 5LQFA 4JL9A 3FI8A 5E8UA 5HLPA 2XIXA 3G0EA 3RMFA 5JKGA 4NW6A 3FZSA 3ACKA 1H1QA 2IZUA 5HU9A 4EHEA 3GFWA 4USFA 3E62A 4BDBA 4J96A 3QRTA 5JMSA 4AUAA 2R3OA 3DDPA 3TEIA 4F64A 4F6SA 2FUMA 2BCJA 3COMA 2JIVA 4ZOGA 1B39A 2HXQA 3PIZA 3UYSA 4AT5A 1H26A 4UN0C 4O0WA 3REPA 2P2HA 3NNWA 2I7QA 2PUNA 3AC4A 4OTGA 5IA1A 1Z5MA 2WNTA 3DV3A 4GV1A 3JVRA 4CKRA 1UNGA 2JLDA 3FXWA 4DEBA 4LV8A 5A4QA 5CZIA 3EWHA 2VTSA 3FYKX 2QR8A 4QMTA 4E6QA 2YCFA 1KUTA 2Y7JA 4D2VA 4GVJA 3IOKA 4LOQA 2P0CA 3F61A 2YCSA 4N4SA 1MQ4A 1VEBA 2HK5A 2W96B 4HCVA 2J51A 1JOWB 2W4KA 4UB7A 5D7AA 1OUKA 5KHWA 3Q04A 2OJ9A 4MXXA 3TZ7A 3EZRA 3W2OA 2J0MB 4BCPA 2B0QA 1YOMA 3A4OX 4TT7A 3TG1A 2VTMA 2BR1A 3A7JA 3BBTB 4R1YA 5E8VA 1AGWA 2VTLA 1JSVA 4A9RA 1BMKA 2Y4IC 4DCAA 3OT3A 3PFQA 4HZRA 4GKHA 4HZSA 4X21A 5H8BA 3WI6A 2REIA 4ID7A 5IQGA 2B54A 3UP2A 5DH3A 2XIKA 3ZM4A 3R7EA 1ZXEA 1ZAOA 5HNGA 4C2WA 3C1XA 3LFEA 4ACMA 2QLUA 4FKOA 2B9HA 5LVOA 3KF4A 3LIJA 4JBVA 4C8BA 5KBRA 5H3QA 4BTMA 2F2CB 4FGBA 1A48A 3Q6UA 3MFUA 4L7FA 4WSQA 4XP2A 4BB4A 1M7NA 3I81A 4PMSA 5J7HA 3LFSA 4UMUA 1T45A 3AT2A 2R9SA 3EKNA 2X4FA 2CSNA 3D14A 2CLQA 3LQ5A 3HA8A 4MK0A 4N6YA 2O65A 3DXPA 3E7OA 4D5KA 2PE2A 5GJGA 3U54A 3OEZA 4EQUA 2ITUA 4WRSA 3UNJA 3HVCA 1WVYA 2I6LA 3EKKA 4DG3E 2ETRA 2JEDA 4D1SA 4E20A 4GVAA 3VBWA 3VUIA 2OH0E 3KRJA 1PRYA 2PVMA 5I9WA 4H3PA 4NT4A 5CSVA 3HL7A 4E26A 5EM7A 4APCA 1KE5A 1UWHA 1ZOEA 4APPA 2C1BA 2ONLA 5EH0A 5FQDC 4H05A 4EC8A 2BROA 3QAME 4FG8A 3G0FA 5EDQA 3HV3A 3HRCA 5AR8A 5EW3A 5CEPA 4YC8A 4NIFA 4MXZA 5CX9A 3IW8A 1OL5A 3GU4A 2PU8A 4CYIA 5HHWA 4YO6A 1XBAA 2ITWA 4O0UA 5C27A 4FSTA 2WTJA 3KXHA 3FKNA 3MY0A 3LM0A 4EWQA 4GYGA 2UZTA 4U79A 3D0EA 3FY2A 3QKMA 4I4EA 4XLIA 4I20A 3CJGA 3COIA 3KN5A 3G90X 3R22A 1VYZA 2OWBA 4L67A 3ZLSA 4E5BA 3B8QA 2C5YA 5HVJA 4I6FA 1Y91A 4Q5HA 4S34A 4GU9A 1P14A 1E9HA 3G51A 2UW4A 1SZMA 1QCFA 2R3QA 4ZIMA 3DJ6A 5EW8A 3AXWA 3ZTXA 3TDWA 4XV3A 1CMKE 4AT3A 2XKCA 3MFRA 3OW4A 5E8YA 4F6WA 4M69B 4J99A 2Q0NA 5C1QB 2JAVA 2IVUA 2VGPA 5F9EA 5CEOA 3FQEA 4J8MA 4TXCA 3OT8A 4S32A 4BL1A 2YLEA 4ACHA 2XEZA 2OSCA 3AT3A 1OM1A 4RC4A 3HMMA 4D1ZA 5J5SA 1ZYDA 5GJFA 3QD4A 3VS4A 3ZUUA 4S30A 4YURA 5CU0A 2CNUA 4U6RA 4F09A 2YJRA 2VWWA 4YC3A 4PRJA 3NAXA 3VJNA 2YIYA 1NVSA 2PVRA 4X3JA 3FL5A 3MA3A 4CV9A 1PF8A 3VIDA 1YHSA 4PF4A 2CCHA 2BILB 3FPQA 1K9AA 4QQTA 5HBHA 1ZZLA 4IB0A 3R7GA 3QLGA 4Y5HA 2Y6OA 4CMUA 4H3QA 5TOZA 4FTLA 4JG6A 2YJSA 3U51A 3UP7A 1YHWA 4NTTA 4XCUA 2FSMX 3QRKA 1WBOA 3C9WA 5FP5A 3TCPA 3BYUA 4QNYA 4EL9A 3H9RA 4FSZA 4WA9A 3NCGA 3ACJA 2PVKA 4MCVA 1ZYJA 5AP0A 3UYTA 4F70A 1OBDA 2YLFA 4QYFA 3F2AA 1M17A 1OZ1A 4AGWA 3EOCA 3V04A 4I0SA 4BKYA 4FIHA 2EB2A 5E8SA 5IISA 2WOTA 3OY1A 1LEWA 3DS6A 4X2KA 3ZXTA 3GGFA 4I0TA 3R8MA 5G1XA 3SXSA 2W1GA 1K2PA 4F0GA 4FEQA 2YFXA 1YWRA 4DTAA 2JKMA 3CGFA 1T46A 1OGUA 1XBBA 3D5WA 2WMRA 1G5SA 3LVPA 4L6QA 4NFMA 3QQLA 4MTAA 2C4GA 3MVLA 5DT0A 4EBWA 4FL1A 5A14A 5J7BA 2QG7A 4CNHA 4UMQA 4CT2A 3R8VA 1WBPA 2HCKA 3DK7A 4BYIA 4FE2A 3HP5A 4Y73A 5IH6A 3DBFA 3CP9A 5E92A 2J9MA 2QKRA 5AV3A 4PTCA 5FLFA 3NR9A 2W7XA 2XUUA 5EYCA 2KTYA 5AIRA 5F1ZA 3SAYA 4WBBB 4EUTA 3PA3A 4EQMA 3TACA 4R78A 5TKDA 2PUPA 1H27A 4I21A 4Q5EA 1PMNA 4CD0A 1OPLA 1RQQA 2BAQA 2GMXA 1B6CB 2CGXA 4ACGA 2PYWA 1F5QA 4M69A 3VAPA 2OJGA 5A54A 1ZYLA 5HTCA 2YHVA 2VTJA 1OKZA 5HICA 4TL0A 3ANRA 3MYGA 4ZTLA 4DEHA 2G15A 5L2WA 1BLXA 4FT7A 3NUSA 4IM3A 3W2PA 1LUFA 1NY3A 3AMYA 4BDDA 5L4QA 3LLAA 4B8LA 3ZMMA 2W06A 4WO5A 5KZIA 4FV6A 2JDTA 5H8EA 1ZWSA 4NU1A 5AAEA 4E6CA 1V0PA 5DPVA 4FUXA 4BWKA 5CEQA 2XK4A 3POZA 4GT4A 3A7FA 4ORKA 4ANNA 4HW7A 2GQGA 3DKGA 4TPTA 3FZ1A 4C33A 4MF1A 2NRUA 5HBJA 3U6HA 1FQ1B 5TT7A 2JGZA 2HELA 3ENMA 5HG8A 2Y4IB 4FEWA 4BIBA 1NT2A 4OUCA 3GC9A 4MBIA 2GPHA 4RG0A 4XEYA 4CFNA 3NZ0A 4D58A 1PXMA 5M55A 2VWUA 2PE0A 2PMNX 3U9NA 3QKKA 5CEMA 5M57A 3COHA 5BVNA 3BKBA 4PPAA 1G8SA 4H3BA 1PXJA 3R9DA 2VX1A 2WMXA 4DG0E 4EOSA 4FOCA 5CWZA 2RFEA 2YCQA 3HV6A 4RIYB 5K0KA 2PZPA 3EQPA 2I0VA 5KMMA 1IASA 2YA9A 2JBPA 3QZIA 3LPBA 1XWSA 4R1VA 4AZWA 4C4FA 3W16A 4PX6A 5FM2A 4G6LA 3F3UA 4EOJA 4ACDA 5FP6A 1L3RE 3FLWA 3EN9A 4D2WA 4E93A 4Z16A 2X9EA 4FZAB 4K2RA 5DOSA 2RFNA 4U40A 4AP7A 2A27A 3C4FA 5EDPA 3VUMA 1ZARA 3UC3A 4FSUA 4I93A 2BZKB 3ULZA 2X1NA 2XCKA 4OLIA 5J87A 4TWOA 4DH3A 2ITOA 5BVKA 3GU7A 3QD3A 4FV7A 3RINA 3LMIA 4DGMA 5AUUA 4JX3A 3FE3A 5IEVA 2BRBA 4RPVA 3S4QA 3W2SA 4BI0A 3NX8A 4BTJA 3HV7A 3R8PA 2XP2A 4FKVA 4A4OA 4KBAA 2C3JA 4AX8A 1F0QA 1ATPE 3GP0A 4U45A 3TI1A 4R7HA 3F3TA 2WMTA 3HV4A 4U8ZA 3QYWA 3CTQA 5E7RA 3DT1A 5HIDA 4AQCA 5ETIA 4YO4A 4OGRA 4PDYA 5M08A 2B1PA 3O8UA 5AV4A 2ITYA 2OBJA 1Q8YA 4FT3A 4QPMA 3VBQA 2PK9A 2J0IA 2IW8A 5A3XA 3RCDA 3POOA 4H39A 2J4ZA 3GCPA 2VUWA 3DZOA 1YDTE 3RK7A 4OTQA 5IKWA 3FWQA 5BUEA 2ZOQA 4AA0A 4BKZA 4K33A 2PVYA 2ERKA 4I5HA 4MAOA 4RJ8A 5HD7A 4MQ1A 5AWMA 5DLSA 5HE2A 3WF8A 3VS0A 3BPRA 5KMNA 4FTTA 4AZEA 4YLLA 1JKKA 4FIEA 5HD4A 4PMMA 4GUEA 3S1HA 1JBPE 1ZOGA 2VTHA 4QMZA 3E8CA 4J95A 3RK9A 2RG5A 4YGAA 1FVRA 3LCSA 2OJJA 4IAIA 3HRBA 1QL6A 3NDMA 2QU5A 2VU3A 3L8PA 2OKRA 4U81A 1OPKA 3GQIA 3PE1A 2WQMA 4MWHA 4G5JA 5A4EA 3UZTA 4CXAA 1WCCA 2GS7A 3G6GA 1PXOA 2JITA 4AW5A 3QCSA 4HNFA 3LJ1A 4XG2A 5C8NA 4BDAA 2UZDA 4AOTA 5FM3A 4DEDA 3WARA 2R3LA 1IA9A 4M97A 2H8HA 3C0IA 4CFMA 4OAVB 2UZWE 4RZWA 4ZSEA 5BVDA 4JDIA 3SQQA 2C47A 4O1PA 5A46A 4ZY6A 3WF9A 4RJ4A 5K5NA 5M4CA 4GFOA 4QTAA 3G33A 5EYMA 3VS6A 3UNKA 5CEKA 5TO8A 3KL8A 4QTDA 4O84A 3SKCA 3Q52A 1PHKA 3KF7A 5ETCA 5HO8A 1IEPA 5M51A 5EI2A 4Y85A 1W7HA 1S9JA 3RAHA 4O83A 2JDRA 5AX3A 2J0LA 2C5VA 4J8NA 4CVAA 4CCBA 5IA4A 2RF9A 2W9FB 5J5TA 3UIBA 2B53A 4JRNA 2AYPA 2OF4A 4ZXTA 1XO2B 3QTZA 4LI5A 4Y46A 5LVMA 3R2BA 3QQUA 4FEVA 3VS3A 2C6TA 3KULA 3OOGA 4IX4A 3RAWA 3OZ6A 4E6AA 3SVVA 4EJ7A 2Q0BA 4BRXA 4V04A 3NYNA 3R0TA 4QD6A 1LR4A 3MH0A 5AR5A 4BCFA 4PP9A 3PUPA 4FV0A 3RGFA 2QQ7A 1UV5A 2QOQA 3C0GA 5IA0A 4IW0A 3V5LA 2FSTX 5M56A 5GZAA 4DG2E 3EQRA 3WF7A 3KVWA 3IW5A 4YMJA 4AF3A 4HVHA 1R3CA 3FQHA 3VNTA 4S33A 5A4CA 5T6KA 3I6UA 3JY0A 3F3ZA 3MTLA 4WG5A 2V62A 3O17A 4OTIA 1SMHA 3U6JA 2W1EA 3TIYA 4IB3A 5EM8A 4YR8A 2FYSA 3TZ9A 2XNOA 3EQCA 4BCNA 3C4XA 5CQUA 4F08A 4QMQA 2ZB0A 4ZY4A 4NYEA 4PTEA 3TUDA 4QYGA 4ALWA 5I9ZA 3V8TA 2PZYA 2YIXA 1BL6A 5BVOA 3HAMA 4XMOA 5DHJA 3VC4A 3MPMA 3CQEA 1YWVA 1JKTA 3GQLA 3EN6A 3QQJA 4NH1A 3CBLA 4RQKA 4YJUA 4Y8DA 4RIWB 5HEZA 2QOLA 3Q3BA 3MESA 5CT0A 3F66A 3GC8A 3FLNC 4HPUE 4JXFA 5DWRA 3UG1A 3H9FA 4ZSAA 2CGWA 1U54B 4FIJA 2XYNA 4O7VA 3TNPC 4IHPA 2E9OA 4CMTA 1YOLA 4LYNA 5LVLA 4LMNA 5DN3A 4O96A 2Z8CA 2Z7LA 3ORXA 3OWPA 3OOMA 3MVJA 2HW7A 3T9TA 4A9UA 4Z7GA 1W0XC 4W4YA 4H58A 3VUKA 3KXNA 4A06A 2QKWB 4RJ5A 3B8RA 4JG8A 4XYFA 5C4LA 3E92A 3S00A 2RGPA 2ZB1A 2A2AA 3ZSIA 3AT4A 2GDOA 2ITXA 3MFSA 3OW3A 4QP9A 4EK8A 4TYHB 5JGDA 3NPCA 4I94A 2QD9A 3FPMA 4N70A 1Q41A 3BGPA 3UDBA 4DC2A 3KKVA 3A61A 2W1HA 4L01A 3MI9A 3E88A 1HCLA 4UZHA 2YAAA 4HGEA 4QMLA 2F7XE 3W2CA 2XKDA 2VNWA 1H00A 1GJOA 3R8ZA 4DLJA 5HORA 5HX8A 2CKPA 1APME 1DAYA 3MA6A 4DH1A 3ORMA 5AA9A 3O71A 3DTCA 2BMCA 4IWDA 4NJ3A 2O3PA 3A2CA 3D7TB 4MQ2A 4OTFA 3VBXA 3R63A 4IX5A 2EU9A 3DBQA 2GHMA 2W5BA 5C8MA 4R8QA 4EK4A 4EZ7A 5A6OA 5HQ0A 3ZCLA 1UU9A 2CMWA 4YZMA 3C4WA 1IA8A 3HUBA 4Y95A 4QP4A 2H96A 2Y8OA 2X8IA 3LJ0A 4FNYA 2X39A 3CJFA 3ALOA 1FINA 3TKHA 3TV6A 3H4JA 2OICA 3MV5A 4KINA 3BU3A 4EK3A 4L43A 4O7SA 4O21A 3QU0A 3WYXA 4RX5A 3PPKA 3M2WA 1H1WA 5J1VA 4BDHA 3NNUA 4YTFA 2JIIA 3QRJA 4UYAA 3DA6A 4AWIA 5EYKA 2OK1A 3R04A 4FIIA 4GJ3A 4QQCA 3KN6A 4OT6A 2QNJA 4DFZE 2R3FA 2Z7QA 3EN7A 3FC1X 2WTWA 3NUNA 3I6WA 4QMSA 3DB8A 1WBVA 3EFLA 1JKSA 1BI7A 5CSXA 3B2TA 5FG8A 4RIWA 4ZAUA 3NMUF 1R39A 3TN8A 3QUPA 4YHTA 3AGLA 3PSBA 3TNIA 2VN9A 3ZYAA 1PMVA 4BDJA 4ASXA 4YTCA 3ODZX 2BPMA 2Y0AA 4IE9A 4U44A 3ZFMA 5BMSA 5A4LA 2PMLX 1STCE 3BELA 4UWBA 4YJSA 3SC1A 2HIWA 3FUPA 4KNBA 4F9AA 2VWBA 4MXOA 2B55A 4I5MA 4HCTA 4Z7HA 2VTQA 2W1FA 2JDOA 3ZONA 1F3MC 3FJQE 3PA4A 4AGDA 2J5FA 4FV8A 4P5ZA 2BDWA 3S2PA 5HG5A 4M15A 1ZOHA 3TTJA 3WZKA 2XIYA 4AS0A 5GJDA 2FA2A 3ORPA 3P7BA 5CAPA 2B9IA 4YBJA 3VULA 1MQBA 3ERKA 1VR2A 2W17A 4OR5A 4P90A 3EFWA 5CAOA 3QTXA 4O7NA 3LZBA 3LCOA 5AV1A 3PIYA 2QOIA 1MP8A 5JQ8A 4F9YA 1J7UA 4B8MA 1OL1A 2C6LA 2F49A 2OZAB 5A4TA 2VTTA 5KZ0A 4XG4A 3WZDA 3NUUA 3KQ7A 3ZO3A 5LCKA 4BWPA 1AD5A 4J53A 3BHUA 5GZ9A 3GT8A 5DA3A 4EHZA 3LOKA 3D7TA 3ENHA 3UMWA 3Q4UA 2BIKB 3EH9A 2QOOA 2AUHA 1HOWA 3EIDA 3R7YA 4DBNA 4LGHA 3PDTA 2UW5A 4CFXA 1KE9A 3HA6A 3Q9WA 2O8YA 2HENA 4NW5A 3AG9A 3ORKA 4HGTA 2JKKA 3W55A 1KV1A 3CIKA 3F6XA 3PVUA 4RIOA 2GNFA 1LP4A 3I60A 5AR3A 4ACCA 4I23A 2YN8A 3SX9A 4EEVA 4O1OA 1H4LA 1OIRA 3PVBA 1P4FA 1XHAA 3R1SA 3UBDA 4DEIA 3C7QA 2C3LA 4QPAA 2CDZA 3KB7A 4RFZA 3FMDA 2UZUE 4CFWA 4F1OA 5EKNA 3WILA 5KMKA 1Y6AA 3F2RA 4FZDB 3VW8A 2W05A 4EOLA 4ZSJA 4WOVA 3ZRMA 3EQDA 3U9CA 3MBLA 5L8JA 1U5RA 3ZUVA 3BX5A 3K3IA 4I4FA 4ZS0A 3QD2B 4E8AA 3DCVA 3HLLA 3PXKA 3QCYA 3E8DA 3RKBA 3DZQA 4DBXA 3ULIA 4AW0A 4K9YA 4G3DA 2ZMDA 3Q2JA 3NNXA 4GH2A 2Q83A 3LMGA 2GSFA 1K3AA 2C6EA 4TW9A 2PUUA 3DQXA 1YI4A 4ITHA 4DFXE 3DQWA 3T9IA 2BTRA 3BEAA 3EN4A 5D1JA 1OL2A 3PYYA 5CENA 4EHVA 4DHFA 3JR1A 3BHHA 1XH5A 4P2KA 4DGOA 3ZFYA 1M14A 3AMBA 1J1CA 1UU3A 4GT5A 1Q8TA 4FKRA 3DAEA 3R1YA 4F63A 4C4HA 2HZNA 2DUVA 3PJ1A 3BYVA 4EH6A 4BWXA 3VS1A 4G3CA 4RJ7A 5AR4A 3FEGA 4EYJA 3RNIA 3P0MA 3W1FA 4EQCA 3ATTA 2HWOA 4QQ5A 5EDRA 2C68A 4D0WA 5M44A 1LEZA 5HTIA 4KRDA 5CZHA 2I0EA 3QTIA 5AA8A 2O0UA 4LUDA 4E4MA 3VUGA 3WIKA 1KE7A 1YDSE 5CT7A 3NUPA 2YM3A 4KSPA 4ZLOA 1X8BA 3OFMA 3C50A 2A0CX 1DS5A 4JNWA 5EM5A 2OGVA 2OU7A 3D5VA 2ITTA 4A9SA 5EQPA 4CFVA 3PE2A 3PVWA 2CKEA 2XNMA 3BLRA 1FGIA 3F2NA 3KRXA 4G6NA 3W32A 4KUJA 2IW6A 3FYJX 3O8PA 4ZTHA 1H01A 1W82A 4KIQA 2R7IA 3OCGA 4K6ZA 3BLQA 4GL9A 5LVPA 3MSSA 1J3HA 4DH5A 2C0IA 4ZP5A 2EXEA 1RDQE 4L52A 2W1DA 2ZM4A 3TNWA 4C4IA 2PULA 4IDVA 3QQKA 5IG1A 4X2NA 5TE0A 3TL8A 2W5HA 2HYYA 4N6ZA 5FEDA 4KIKA 2C0TA 1B38A 4UALA 2JFMA 4IANA 1JSUA 1YWNA 2BHHA 2C3KA 2W99B 4IFGA 2GS2A 1EH4A 4BCKA 3D83A 3OTVA 2FSOX 4IWPA 3DKOA 3DXNA 3HEGA 3H0YA 3I5ZA 4M7IA 4FI1A 1Q3WA 5DNRA 4ANBA 4MD9E 4U3ZA 4ALVA 4FSMA 4O7RA 4V0GA 5JFSA 4LOPA 4MKCA 1OKVA 3K5VA 3D7ZA 3JXWA 1E1VA 3PSDA 5J9ZA 4KAOA 3ORTA 3UODA 3IOPA 4RX8A 3ZZWA 2UVZA 4YHFA 4DFBA 4ZTMA 2J0KA 4FKSA 5E8ZA 4LUEA 4L00A 2P2IA 4CRSA 2WMAA 1JAMA 4D0XA 4FKWA 5FRIA 3KU2A 4EJNA 1J7IA 3OVVA 5FTGA 5JT2A 2IPXA 2UV2A 3UOKA 2WQBA 3ZDUA 2YEXA 4CZUA 3FMHA 5JFXA 4EH5A 3ZO1A 4EK6A 3FHIA 2WTVA 2BZHB 3AGMA 2XZSA 3GBZA 4LRJA 2XM9A 3R00A 5J79A 2XH5A 3MB6A 1DAWA 3E63A 3F3WA 5KNJA 5HG9A 5ANIA 1A9UA 1VZOA 3A99A 4XP3A 5HG7A 4IWQA 3QZFA 5T68A 5DMZA 1KOBA 3PWYA 3GC0A 1SNUA 4O6LA 1QPCA 5KCVA 3MPTA 4KD1A 4C3RA 4D2RA 2I40A 2RL5A 4DN5A 4DA5A 3MN3A 4JQEA 3UNZA 3OBJA 2CKQA 3O50A 3Q9XA 3FKLA 3IS5A 2NNWB 2BFYA 4XV2A 4QP1A 3VRZA 2VTIA 3LFFA 2HY0A 4I3ZA 2GHLA 2V7AA 4ONAA 5DEYA 2YERA 4C4JA 3WBLA 4FIFA 1FBNA 5D10A 5CTPA 4ASZA 5L2TA 2X7FA 5AJQA 4D1XA 3UPZA 5TR6A 4D4VA 2VAGA 4FV4A 3ZO4A 3UOJA 3IDBA 3LXLA 2XB7A 3DNDA 3HNGA 4PPBA 4OTWA 3DLZA 4YU2A 4ZTSA 4AGCA 3R9NA 3PG1A 1KV2A 3GOPA 5EOLA 4ANMA 4CRLA 4XOZA 3MTFA 2BDJA 2OH4A 2G2IA 3MGYA 4BZNA 4G17A 4P5QA 4BI2A 3R9RA 3UJGA 5LWNA 3N4TA 3R9OA 4AXAA 2XKEA 5I9VA 1M2RA 5I5ZA 4ASDA 5E91A 3ZH8A 5ETFA 3KXXA 3R7OA 5LOHA 1GIHA 1Q61A 4WT6A 3DXQA 4M0YA 3OWLA 4AFEA 4KBKA 4TY1A 2GNIA 3F82A 3E87A 3LXPA 1H1PA 4FNXA 4I6HA 5BPYA 1WMKA 3VJOA 4F65A 3LCDA 3QXOA 3EL7A 2R3JA 5EK7A 4QO9A 4YJRA 4HPTE 4O0TA 3KMWA 5M4UA 3IW4A 4OAUC 4EOKA 4GUBA 3CXWA 1O6YA 5GIOE 3QWJA 3HX4A 2V22A 2QHNA 1DM2A 1TQMA 3W2RA 3Q5IA 2PPQA 3F5GA 1WBTA 3FXXA 3ORIA 5EOBA 2YZAA 2IWIA 3R73A 5L3AA 4E4XA 2ITPA 4JT3A 1UU7A 3DU8A 2PL0A 2CN5A 3DLSA 5KMIA 4KB8A 4EH9A 3TNQB 2E9NA 2GNGA 1PXLA 4G6OA 4AOJA 3MY5A 2RFDA 3GOKA 4L9IA 2ZV9A 3SOCA 2VV9A 1SVGA 4RIXB 4GK3A 5H2UA 4FIGA 3HDNA 3LFAA 3PY0A 4DFLA 4R7IA 3VUDA 3QZHA 5KBQA 2VWYA 3OTUA 5HBEA 1PXNA 2BZJA 2RSVA 2YIQA 4CFUA 3VF8A 2BRNA 4EZ3A 4FVPA 4CZTA 4D2PA 4JX7A 3WZEA 4A4XA 2R0IA 1UWJA 3M42A 4D4RA 4PTGA 2GCDA 4FL2A 4YPDA 5TF9A 2J5EA 2CGVA 4IB5A 3A60A 3PZHA 3PLSA 2XJ2A 1SVHA 1KE6A 2PHKA 4CQEA 4ZTRA 3EB0A 3H0ZA 4UZDA 1CM8A 4I24A 4MYGA 4OTDA 1SYKA 3FHRA 1SVEA 3KC3A 3U4UA 5HE1A 5HE3A 3R1QA 5D11A 5CYIA 4QQJA 5J8IA 4IVCA 2JDVA 5AX9A 4YZBA 2ITQA 4I41A 4BHZA 4WIHA 4YZNA 4QMNA 3L8XA 2XNBA 2C69A 2WIHA 3FC2A 3S95A 4AE9A 4MD8E 3HMNA 4UMPA 2OFUA 4XOYA 1JNKA 3FMKA 4NM7A 3GENA 3LM5A 2CHLA 4CLIA 3MWUA 3BCEA 1W84A 5B2KA 3QF9A 4YLKA 3CD3A 3UZRA 3IGOA 5JGAA 3PA5A 4IC7A 5DT4A 2WMVA 4XV9A 4NEUA 4KRCA 1YW2A 2WFYA 2G1TA 3LE6A 3Q5ZA 3RALA 3QGWA 5AUTA 4X6RA 5D9HA 5ACKA 4NM5A 3C51A 3D4QA 4EOMA 4FTKA 5EFQA 3Q96A 4IBMA 5IUHA 4JDKA 2ETMA 1XR1A 3CC6A 2W0JA 3CY2A 2JIUA 2YM4A 3OROA 2QI8A 3E3BX 3CD8A 4Q2AA 5DFPA 3VBYA 3ZRLA 3GCUA 4EOQA 3RI1A 3LXKA 3QBNA 3V6RA 1IAJA 2YZLA 2C0OA 4L44A 5AP5A 3ORNA 4UWYA 3WF6A 2YM5A 3V8WA 2WOUA 3VVHA 3ODYX 4RWJA 5KE0A 3RTPA 3CY3A 2GQSA 4UWCA 2A19B 4IIRA 2CN8A 4LGGA 1YQJA 3EQHA 3RPSA 2GFSA 2YM8A 4WKQA 3IGGA 4XV1A 5E8XA 4AA5A 3EQGA 2QLQA 3LQ3A 1P5EA 2XK6A 1CKJA 2WZJA 4MX9A 1MRYA 4WNPA 4D9UA 5FDPA 3D15A 4FK3A 4PMTA 1OMWA 2PVJA 3C0HA 3PZEA 1OB3A 2ZV2A 2OIQA 1Q8ZA 5HVYA 3QX2A 3E8NA 3L8SA 2QR7A 2O64A 4IB1A 4J1RA 4TYEA 4XG8A 3D9VA 4G3FA 3W10A 4Q9SA 4C36A 2BDFA 3L9NA 2A1AB 3MB7A 3NGAA 4II5A 1BYGA 3FLZA 1Q5KA 4D55A 3C5IA 4MNEB 2WMQA 1HCKA 4DH7A 2J2IB 4X2FA 1YDRE 2HAKA 3ZU7A 5HO7A 4FKUA 3ZZEA 3FMLA 1DI9A 5IMEA 4BCIA 2O63A 2KULA 4KS8A 2OIBA 5HNIX 5IQCA 4MD7E 1H8FA 3DPKA 1FMOE 3R01A 3KRRA 1PXPA 2WELA 1CTPE 2BVAA 2FVDA 2YISA 4GS6A 3Q9ZA 4MXCA 4BVUA 2Z02A 3W33A 2R3IA 2PUIA 1NVRA 2VTRA 2OZOA 3GI3A 4IZ5A 4HVIA 4CG9A 4UX9A 2WHBA 2HW6A 3H30A 3I0OA 3R6XA 3GU8A 1A06A 3LFBA 4JDHA 4RT7A 3P78A 4IH8A 2GQRA 5IQAA 4TRLA 2R3GA 4IDTA 1OI9A 4B7TA 3IW7A 3RNYA 4KWPA 1Y8GA 3I79A 2ZM1A 4QYHA 1GAGA 2QHMA 3FKOA 3KRWA 3GU6A 2BKKA 1FOTA 1ZY5A 4NCTC 4PP7A 3DFCB 5JZNA 4HGSA 4EWHA 4EONA 5AUZA 4BIDA 5CAUA 2ITNA 3NYXA 4M14A 3V01A 4IMYA 5C9CA 4RIYA 1WVXA 5F4NA 5CU3A 4I6BA 4LQMA 4RLKA 1WVWA 2YCRA 3KEXA 3QQGA 2R0UA 1QPJA 5M53A 2EVAA 5DIAA 3S0OA 5DR2A 3NW5A 4GKIA 5DRDA 2C6KA 3GUBA 3FLQA 5ANOA 3ZLXA 3PXRA 4O2ZA 2C30A 3TT0A 3ZBFA 3NUYA 1XH9A 5CF8A 3RHXA 5ICPA 3Q4TA 2WQOA 5HU3A 1H24A 2CKOA 3ZBXA 3E64A 3FZPA 2LAVA 3C4ZA 5JH6A 2DYLA 3SDJA 2IZTA 1CKIA 3OBGA 1GOLA 4YNEA 3UVQA 3QTSA 4QTCA 2WGJA 2WD1A 4ZZMA 5LVNA 4E4LA 3NYOA 2BRMA 5I9YA 3SG8A 4DINA 2XIRA 3I7CA 3BRBA 3W8QA 4HYUA 3FV8A 4FMQA 3PJ3A 4BTFA 4WG4A 2LGCA 4O22A 2JC6A 3QC4A 4R5YA 4WUAA 2PMIA 2PY3A 2F7ZE 4UXLA 3TJCA 4PNKA 3L9MA 3O0GA 5H8GA 1YVJA 3KK9A 4LOOA 2V7OA 3OUKA 4DF3A 1JVPP 4G2FA 4X3FC 3UIXA 1UNLA 3I1AA 2FH9A 2BKZA 5ANEA 5A9UA 2B9FA 2QO7A 1ZMUA 2C5OA 4LL5A 4ZSGA 3DDQA 4WNKA 4C62A 4M68A 5LCJA 4YJQA 2G01A 2BZIB 4F99A 2WTCA 2XA4A 5EHLA 2XBJA 2Z2WA 5BNJA 1M2QA 4LFIA 3WIGA 5AP3A 4IM0A 5F95A 1IR3A 1V1KA 3VF9A 4ANQA 3P4KA 3RAKA 2UW8A 4GSBA 4QMYA 2NRYA 3CQUA 3CTJA 3L8VA 3MIAA 5CXZA 4BCOA 3ID6C 3BQRA 4K18A 3AC1A 4ENXA 3HYHA 4GFGA 1XKKA 2UW9A 4FTMA 2C3IB 4I5CA 5CVHA 3MY1A 1W98A 4G31A 5AUXA 2GU8A 4HVGA 2FSLX 3VHEA 3VW6A 5AP7A 2XKFA 3GCSA 3PP0A 2VWIA 4FTOA 2XNNA 4FKJA 1P2AA 3BHYA 4CKIA 3PSCA 3OF0A 3MJ1A 3SRVB 3EHAA 4IX6A 4HYIA 2X6DA 1ERKA 2ONLC 3OG7A 3TKIA 4AAAA 2F4JA 5IUIA 3BE9A 2UZVA 3OS3A 5AP4A 4DH8A 3O96A 2QONA 4M67A 3RHKA 2R7BA 1BL7A 3OUNB 3CLYA 4OTHA 3RM6A 4EZ5A 5AAGA 1R0PA 3QFVA 1TQIA 1PKDA 1UVRA 5CF4A 3DGKA 2JD5A 4QNAA 4WNMA 4ANLA 5E8TA 4CTCA 3EFJA 4G9CA 4FT0A 5IA3A 2OW3A 4LV5A 4IAAA 2W1CA 3U6IA 4L45A 4O7ZA 1TKIA 5CNOA 3ZRKA 5LWMA 3OMVA 2NP8A 2P4IA 4M84A 2WMBA 4FG7A 2VX0A 2XK8A 3KXZA 4FT5A 4WUNA 4ZEGA 5D41A 4YC6A 3K2LA 3KY2A 4L7SA 3O7LD 4U41A 3TV7A 3ZC5A 4DE4A 3ZO2A 5IQDA 4FR4A 2X0GA 3OEFX 5JFVA 4F0IA 2QC6A 1ND4A 5JRQA 3GC7A 2YDJA 3BYSA
chains in the Genus database with same CATH superfamily
3MVMA 3N9XA 2ITVA 4MNFA 3U8WA 3QALE 3QLFA 4C3PA 2IVSA 4GFMA 5HKMA 2P3GX 4U7ZA 5GNKA 4BC6A 4RVTA 3R7UA 3W18A 4L3PA 4XRJA 5IEXA 2VX3A 3I7BA 3ANQA 4KS7A 4BCQA 2QVSE 4C0TA 3ATSA 2PVHA 4W4XA 2W1ZA 4F7NA 4LM5A 2DQ7X 3VS7A 5DYJA 4QP3A 5FWKK 5BYYA 4WNOA 4XG9A 1MRVA 4RGJA 4PUZA 5HI2A 3GFEA 2G9XA 3DOGA 5K9IA 3HAVA 3UDTA 3CKXA 3GEQA 2AC3A 1H0VA 2R3PA 1U54A 3HMPA 4RWKA 1ST0A 2WKMA 3PTGA 3KFAA 3VBTA 1P4OA 2ETKA 4GEOA 4KABA 1H25A 5CAQA 3FQSA 2WTDA 5FEEA 3K5UA 4GG5A 3IQ7A 2IW9A 5JZJA 4OBPA 5AUVA 1REJA 4FUYA 4QMMA 4E4NA 3L9LA 5B2LA 4HOKA 4NWMA 1OIQA 5AR7A 5E1EA 2F57A 3ZC6A 5I4NA 3TKUA 2VTNA 2ZJWA 2ZYBA 3CTHA 4QOXA 5CEIA 2OXYA 2X81A 4NSTA 4FSYA 4TYHA 2OFVA 3Q32A 4TN6A 1OL6A 3UG2A 4AACA 4R3PA 3ZM9A 2OG8A 1GZKA 3QGYA 2FGIA 4FX3A 4HYHA 2UZBA 2WU6A 3KCKA 4OBQA 3SXRA 4JR3A 5CI6A 4Y83A 3UMXA 4EHGA 1Q8UA 5G6VA 1IRKA 1QMZA 3ZLYA 3PY3A 4DGGA 2WXVA 4QP2A 3DBCA 3NS9A 2OJFE 3BLHA 4QYYA 3NVKI 1WAKA 4G34A 4W8EA 4G16A 5C26A 3HV5A 3CS9A 3Q2MA 4JG7A 4O0SA 5HNBA 3UOHA 1YXVA 4EYMA 4D4SA 3WZJA 4ZLZA 1FVVA 4S31A 2R4BA 3BBWA 5IQIA 4O0YA 4C61A 4Z3VA 4IM2A 2EUFB 4L53A 2OF2A 4YJTA 4BDFA 3AC3A 4JQ8A 5I0BA 3LCTA 4LRMA 4AOIA 5M4IA 2QOBA 5CSPA 3L9PA 4EBVA 1YRPA 5E9EA 5FD2A 3GCVA 2WEIA 1WBSA 3D5XA 3R02A 3A4PA 3R8LA 3WOWA 2UW3A 4YUQA 3N4UA 2W5AA 4R5SA 5D7VA 2WU7A 4JBPA 2V5QA 3IECA 4RFMA 3DY7A 5HO6A 1J91A 3WYYA 1RW8A 5AUWA 4O82A 1PYEA 3LFQA 4QP8A 4DEGA 5BVWA 2CGUA 3SD0A 4AG8A 4EK5A 2ZV8A 5LARA 4L3LA 2F7EE 4CZYB 5EHYA 4FBXA 2RG6A 3UPXA 4AN2A 4YLJA 3BHTA 4LRKA 4RA4A 3GB2A 2IN6A 1CSNA 4X3FB 1QPEA 3NAYA 4X0MA 5DRBA 4O7LA 4GT3A 3UO5A 4FOBA 1JLUE 1KOAA 3RK5A 2X2LA 4JIAA 4O0VA 2YDIA 3P08A 3IPHA 4FTNA 4H36A 4LDTA 4I22A 2VO6A 3NSZA 1W2DA 3M1SA 2IEWA 4MBJA 5AR2A 3QCXA 4PNIA 4EOPA 4J7BA 2I0YA 3KIOC 4XH6A 3QTQA 4L46A 1GZ8A 3CGOA 3UVRA 4C35A 4ZS4A 1XBCA 2X4ZA 4MXAA 1TZDA 3CQWA 5CANA 3KK8A 4W8DA 3HZTA 3WE8A 4PQNA 3FY0A 5DT3A 4CLJA 4C58A 4MBLA 4CGAA 3BZ3A 4KA3A 4NTSA 2UW6A 5AP2A 3CR0A 3O23A 5IH4A 4TWPA 1GZNA 3LAUA 1E1XA 2GHGA 3FL4A 3Q4CA 4G3GA 3THBA 3SOAA 5FUTA 2JFLA 4UEUA 4LGDA 3ZEPA 3DJ7A 3F69A 2GTMA 4TTHB 3AC5A 2OZAA 3QQHA 4U9AA 4D5HA 2YABA 1NA7A 4HCUA 2OI4X 1H1SA 3QZGA 4FVQA 4PY1A 5EI8A 3A8WA 4EH3A 2WQNA 5GIPE 2QCSA 3KRLA 1XMMA 1Z57A 2HXLA 1DI8A 5HE0A 3MJ2A 3F9NA 4M13A 2QOKA 1YHVA 1BUHA 3QL8A 3R30A 4JR7A 3PUFC 5AV2A 3TJDA 3R2YA 3CPBA 3PPJA 2XEYA 1GIJA 1GNGA 4M3QA 5KMOA 3SW7A 5HX6A 4NM0A 5BYLA 4O4EA 4O81A 2XYUA 4O86A 3HP2A 4IACA 4IC8A 4NIFB 3DBEA 3AQVA 3NW6A 4ZK5A 3UGCA 4GIHA 4E3CA 5M07A 2QG5A 4U80A 3PRIA 3EYHA 4CT1A 3NUAA 4FV1A 3DK3A 3N4VA 2AC5A 2VO3A 4EH8A 3F88A 1GY3A 4G5PA 2OLCA 5ANDA 3UQFA 2Z60A 4C4GA 3H9OA 4IJPA 4C2VA 3G6HA 2X8DA 2CCIA 4BN1A 4ZJVA 1PXKA 3MPAA 4PL5A 5HTBA 2HZ0A 3TUBA 1NVQA 4MVFA 4BDGA 3F5PA 4DGLC 1PY5A 3FZTA 2IF8A 4FSQA 3EYGA 3KMMA 2C1AA 5BQ0A 3V5WA 2WTIA 4X3FA 4RC3A 2X2MA 3U87A 4X7QA 4QT1A 5CLPA 3QHRA 2DWBA 4FODA 2JDSA 4I5PA 4ZTNA 3UO4A 3UIUA 4DAWA 3P23A 3R9HA 4CYJA 3RJCA 3QYZA 4GRBA 4RX7A 3SHEA 2PWLA 3IO7A 5EHOA 2E9PA 1ZYCA 3FI2A 4JAJA 4F9CA 5LMBA 2UW7A 3HDMA 3PXZA 5L2IA 1J1BA 1FPUA 4ANOA 3FZRA 3R28A 1JSTA 2XK7A 2CNVA 3BV2A 4BBMA 4TWNA 4L68A 4XX9A 4X6QC 5HCYA 4PDSA 3FXZA 3BLAA 4K11A 2WIPA 5DE2A 3A62A 4QPSA 4K1BA 5H9BA 1OBGA 5JSMA 4YP8A 3G2FA 1V0BA 3FLYA 5I9XA 4DDIA 3DAKA 4FG9A 1OGYA 4BCJA 1RE8A 2BALA 3ELJA 2OXDA 3MH2A 1YI6A 3BL9A 5CU4A 2QOFA 4DDGA 3EZVA 2OXXA 3FAAA 3FI4A 3MH1A 4YHJA 4YSMA 4PWNA 4O7YA 4BCMA 3SW4A 4JBOA 1XH7A 3L1SA 3EQBA 1PJKA 2E2BA 4N0SA 4RMZA 4ITIA 4F0FA 4OTRA 4NKAA 4BGGA 1OIYA 1U5QA 1W8CA 5M09A 5FXQA 2P33A 4A4LA 4Y5QA 1XJDA 2FB8A 3NLBA 2YM7A 1KWPA 4A9TA 4KKHA 3V5JA 2E9UA 4CCUA 3PLAE 3HGKA 4XNEA 5ACBC 3DB6A 5HCXA 4C38A 4XG3A 4HVSA 5LXMA 3VUHA 2R3RA 3QRUA 3W2QA 4TYIA 2GNJA 5GZ8A 2BHEA 5CS6A 4FGRA 2CJMA 4HVDA 1W83A 4FSNA 1PKGA 1BX6A 4IQ6A 3JY9A 4BICA 4IXPA 5FEQA 3ROCA 4IZAA 3PG3A 1UNHA 1O9UA 2Z7SA 4JRVA 3VQUA 4IX3A 4K77A 4JDJA 4S2ZA 4BZOA 4BJJB 2UUEA 3G9NA 3RWQA 4DITA 5D12A 3W0OA 2ERZE 2YIRA 3E93A 3QKLA 4O27B 2ZVAA 3P86A 3C4EA 4F78A 1SNXA 4HJOA 4C4EA 3FMNA 2JAMA 2VGOA 5CSWA 3UE4A 3HECA 4ALUA 1BKXA 4PL3A 4M8TA 2YWVA 3MVHA 4RJ6A 4FTAA 4FK6A 4AA4A 3LKMA 4I6QA 4EH7A 1U4DA 3BHVA 3KCFA 4FV2A 3PPZA 5HCZA 2PVLA 4IWOA 4IVBA 4FSWA 4FTRA 3V51A 5ITAA 2BIYA 2ACXA 1OUYA 4MHAA 4K0YA 5J9YA 3R71A 3H10A 3COKA 3NIZA 5AEPA 3GVUA 4FF8A 4R77A 4E73A 3T3UA 2IZRA 5FXRA 1J7LA 1Z9XA 3I4BA 3VS2A 4FA2A 5KMJA 3W0MA 4O0XA 4XLVA 3RBWA 4BTKA 3SG9A 1U46A 3P7AA 1OVEA 2WQEA 4JI9A 4R3CA 3AD4A 2WB8A 5E1SA 4RA5A 2R2PA 2VO7A 3TWJA 3EN5A 1Y6BA 4AN3A 4IZ7A 3PXQA 2XK3A 3O7LB 4FYNA 5J1WA 4QEBA 5DI1A 3NFGB 4FC0A 4A9YA 1KSWA 3PFYA 3P9JA 4CSVA 4BGHA 4EORA 3AC2A 3FDNA 5M4FA 1KE8A 2EB3A 2YIWA 3E5AA 5DVRA 4HGLA 3FBVA 4RSSA 3LLTA 2XM8A 3ETAA 3O8TA 4M0ZA 4ZMFA 5IEYA 4BGQA 5IH5A 1NW1A 3Q6WA 1RJBA 2R3NA 4FTQA 5IF1A 4QMUA 4F4PA 5HOAA 2P55A 3ORLA 4UBAA 3JYAA 3A8XA 2WMWA 5EQYA 2PSQA 3KMUA 3QA8A 5K0XA 3RPYA 3PIXA 2QODA 2HOGA 4C57A 4KIPA 3U4WA 3ZDIA 4FKTA 4O0RA 2RIOA 5IQEA 4C3FA 4TZRA 3AOXA 3C5UA 3QXPA 4F9WA 2H6DA 3N51A 2C6IA 4OBOA 4B99A 4DFUA 1WBWA 4YZCA 4MUQA 2BUJA 2I1MA 4NFNA 4R3RA 4UYNA 3BEGA 2RFSA 2XJ1A 4P7EA 4CV8A 3BWJA 4FT9A 3MDYA 1MUOA 2F9GA 5HGIA 3MIYA 4KKGA 3Q53A 1M52A 3KGAA 3O51A 4UV0A 4N57A 3M11A 4FICA 3IONA 4YZ9A 5IUGA 1JPAA 3Q4ZA 3GU5A 3MW1A 4NK9A 3V8SA 3NCZA 4RFYA 4YNOA 2R3HA 4Z9LA 5AV0A 3P1AA 4O7TA 3R8UA 5C03A 3WE4A 3VQHA 4AZSA 4IAYA 1WZYA 4O6EA 5B7VA 4ZZNA 4RWLA 3ZXZA 2GS6A 3CSVA 2O5KA 4RQVA 5BUJA 4FKPA 4RWIA 4V01A 5L2SA 3HMOA 2C5NA 2ZDTA 3VRYA 3H3CA 2R64A 4GG7A 5JK3A 3JPVA 4YZDA 2WTKC 3EQFA 2VNYA 5T3QA 3MH3A 1Q24A 2UZOA 3EQIA 4ZTQA 4FZ7A 3F7WA 3OWKA 4CTBA 4AW2A 4M12A 4ZJIA 3HKOA 4AXEA 2Y4PA 2G2HA 3OXTA 4TYJA 4C59A 4R7BA 4J71A 1O6KA 3QUEA 5IQFA 3DFAA 3W8LA 3HRFA 4ZJJA 4AFJA 4DEAA 1V0OA 3DKCA 5CI7A 5AADA 1TVOA 3VUTA 1MRUA 1VYWA 3T3VA 3R7VA 4E5WA 3FMEA 3HUCA 4MEDA 2X0OA 2CPKE 4RIXA 3K54A 2W4JA 1Q3DA 2VD5A 5CVGA 1REKA 2PMOX 4NZWB 3EFKA 4FKLA 3VO3A 3R7IA 2W4OA 4WRGA 3UTOA 4NM3A 4TWCA 4TNDA 5F20A 4FKQA 3NYVA 3NUXA 3DBDA 1CDKA 4GMYA 4IAKA 4LG4A 3DJ5A 3BWFA 2VTOA 2NYAA 3II5A 2IZSA 4L3JA 5CU2A 3RCJA 3VWAA 3A7GA 4RVMA 5IA5A 1ZMVA 2R3KA 4CQGA 4FTIA 3FMMA 5KX8A 5GHVA 3LFCA 3PXYA 1H08A 1I44A 3A7IA 4M66A 3RZBA 5JN2A 4X2GA 2BTSA 5HVKA 2C6DA 4PPCA 1H28A 4NL0A 4YTIA 4RRVA 4DEEA 5ANGA 4Z55A 5IQHA 4U3YA 4BF2A 1OECA 1OITA 2ZMCA 1UKHA 2W1IA 4OW8A 3E7VA 4JVGA 4X2JA 5KMLA 2UW0A 4UMTA 5AAFA 5EQEA 4BDKA 4MF0A 5C8KA 2VRXA 4A07A 1PXIA 1Y57A 3RAIA 2UZEA 4YJPA 3OC1A 5BVEA 3KA0A 5BVFA 2WMUA 3ET7A 1PYXA 4TKSA 4YSJA 4D2TA 2X6EA 4YJOA 3KXMA 2B52A 2X9FA 1Q62A 3JS2A 5EG3A 4DFYA 4F7JA 5KO1A 5AUYA 3UZPA 4BCHA 3DK6A 3LXNA 3PJ2A 2J90A 2XNEA 3IK3A 2B7AA 4DFNA 4E6DA 5KUPA 3KULB 2XRUA 3AC8A 2H9VA 2OIDA 3RM7A 2G2FA 1YXSA 5AMNA 3RPOA 4BKJA 3OXIA 3QTUA 1UKIA 3OY3A 3D94A 4YTHA 5IQBA 4BDEA 3NWWA 4PV0A 2VWXA 5F94A 3FMJA 4Y72A 5A6NA 4WBOA 4CKJA 4XG7A 1ZY4A 3O5AA 4U97A 3LQ8A 3DTWA 2OJIA 4PL4A 2WO6A 3RPVA 2EXCX 2PTKA 4QRCA 3SA0A 4CEGA 2EWAA 3F5XA 4YBKA 2R3MA 5AIKA 1WBNA 2XRWA 4IAZA 3LCKA 3AD5A 4BCGA 4FEXA 3GNIB 4C02A 4EKKA 4RJ3A 2Z7RA 5DR6A 5LMKC 1W2CA 2BRGA 1URCA 4R6VA 3LFDA 3P7CA 1R1WA 2XIZA 3UIMA 4GU6A 4HYSA 5DG5A 2HY81 4TYGA 4B0GA 4ZY5A 4IFCA 5CAVA 3UQCA 4AQKA 1Q99A 3NW7A 4A7CA 1CKPA 3SV0A 3TZMA 2B4SB 2XJ0A 4O91A 5JGBA 3KREA 4DTBA 3ORZA 2UVXA 5DEWA 1ZMWA 3IW6A 5K4IA 5KKRC 4KBCA 5L6OA 4USDA 3MFTA 2X8EA 2E9VA 2V55A 5E8WA 4F6UA 1Q97A 2X7GA 1UU8A 3Q9YA 4IADA 3IKAA 3QTRA 2GTNA 4K8AA 1YXXA 2UVYA 4QP6A 4YJNA 4E5AX 4MNEA 3TUCA 3TTIA 3TM0A 4FZFB 4BR3A 4AGUA 1OPJA 3UQGA 3BV3A 3KVXA 2J50A 5JEBA 2YACA 2WPAA 3SGCA 3OXZA 5CNNA 3OWJA 3QRIA 3QQFA 3OCBA 3PJCA 4ZSLA 3NRMA 4IAFA 1LPUA 4AZVA 3AMAA 4B4LA 5BYZA 4BFMA 2YAKA 4XRLA 4E1ZA 3C13A 3QUDA 2DS1A 4BBFA 2H34A 4RVKA 3ZLWA 1YKRA 5FDXA 4XP0A 3ZSHA 5M06A 3I5NA 3WF5A 3C4CA 2PZIA 3IDPA 1IAHA 3BYMA 4UY9A 4ZMEA 2V0DA 3IDCA 2X7OA 3UVPA 3LFNA 5HZNA 1PW2A 3UO6A 4DCEA 4G1WA 4GCJA 4NKSA 4YJVA 4CFFA 4FNWA 4UMRA 5LJJA 4I6LA 2HWPA 1U59A 2VO0A 4IZYA 4LMUA 4XBRA 1H0WA 3TV4A 4FTJA 5BUIA 5IDNA 3TDVA 4XJ0A 5HIBA 2FO0A 4MXYA 5CASA 2GFCA 4FZ6A 1AQ1A 4F1MA 1FMKA 4PDPA 2VWZA 5B0XA 4U43A 4F9BA 3SXFA 4B9DA 2HZIA 3E3PA 3FSFA 4V05A 1G8AA 5ETAA 1OKYA 4AW1A 4BDIA 2CNQA 3RWPA 2XMYA 3OD6X 4QMPA 2OO8X 4JQ7A 3NFFB 5CQWA 4EKLA 4JIKA 5L6PA 4BI1A 5AFVA 3DAJA 4I92A 2I0HA 2X2KA 3G5DA 4EH4A 3VONA 3ZEWA 5FXSA 1ZLTA 2XK9A 2J6MA 1R0EA 1I09A 2XNPA 2XF0A 4ENYA 5IMXA 5ANJA 3P5KA 4DHIB 4WD5A 2XCHA 3NIEA 3ZUTA 1G3NA 4ANSA 4EI4A 3QA0A 2WTKB 3F3VA 4CMOA 3OHTA 3OP5A 4WHZA 4ASEA 3UOLA 3QX4A 2YDKA 1FVTA 3EMGA 4DYMA 1URWA 1L8TA 1GZOA 3LW0A 2QU6A 5EW9A 2IVTA 4NUSA 1YXUA 3ALNA 4D28A 4L42A 5IA2A 2ZV7A 3E8EA 2C6OA 2XNGA 4IVDA 5HIEA 4H1MA 2J0JA 4QYEA 5EKOA 2IJMA 5E4HA 5EM6A 2XS0A 4QMVA 3BGQA 3BI6A 3QC9A 3NNVA 4OTPA 1PMUA 2O2UA 3FSKA 4TNBA 5ANKA 4B6LA 4I1ZA 2Y9QA 3F7ZA 4GJ2A 1BI8A 4GYIA 1YXTA 2EXMA 5L8LA 3JUHA 2W9ZB 2WEVA 3R21A 4ERWA 4JLCA 2YITA 3D2KA 4BBEA 5HLNA 3PXFA 2QURA 2GNLA 1YI3A 4RC2A 3T8OA 2SRCA 2J7TA 3VS5A 3K3JA 4QMOA 4QP7A 5J95A 3VHKA 2PZRA 4F1TA 1FGKA 4FKGA 4ZZOA 2NO3A 5K5XA 1H1RA 5FBNC 3Q60A 4FV5A 4EH2A 4AT4A 3NVMB 4FEUA 3B2WA 1IG1A 4EOIA 4DTKA 4RZVA 3FZOA 3RP9A 1SM2A 1ZRZA 3JVSA 3FLSA 3MS9A 4XS2A 4F7LA 2UZNA 4J98A 4FTUA 1O6LA 2JKQA 3A7HA 2BFXA 4JJRA 3QD0A 4U42A 1OIUA 5K4JA 5CF6A 3FI3A 4QTEA 5CSHA 5E90A 4FVRA 4JAIA 3LJ2A 3PWDA 3G15A 2IG7A 2CLXA 4W9XA 4WG3A 1R78A 4DHZA 1XH6A 3PJ8A 2JKOA 4G3EA 5CXHA 5FTQA 2GNHA 1W2FA 4UXQA 5HESA 5L2QA 1NXKA 3V5TA 2XBAA 4E7WA 4DT8A 4FV3A 4MWIA 4HNIA 4BHNA 4USEA 5EYDA 5IPJA 3KXGA 5C01A 3VN9A 4D4YA 1JQHA 4AE6A 4FYOA 1JWHA 2NPQA 4P4CA 2VZ6A 4XUFA 3BIZA 2JBOA 3SRVA 3WZUA 1S9IA 4NJDA 4U5JA 4AZFA 3V3VA 1TFFA 3NEWA 3O2MA 2ESMA 4I0RA 4BZDA 5I3RA 1XH4A 1VJYA 3V5PA 3TNHA 4C7TA 3QWKA 5J9LA 3ROYA 3LMHA 4C37A 1H07A 5AM7A 2YWPA 5JRSA 1OKWA 1Q8WA 1ZYSA 4QMXA 4W9WA 4D2SA 4AZTA 3TMOA 5AP1A 3R83A 4AU8A 2PE1A 4J52A 3W0RA 2VTPA 4W4WA 4W4VA 3PRFA 4JBQA 4EC9A 3G9LX 4CG8A 5DR9A 3QTWA 4FTCA 3OCTA 3BQCA 3R1NA 3BU5A 2PZ5A 3CPCA 4FSRA 1Q4LA 4LL0A 4O7WA 2F2UA 2YM6A 4L8MA 1M2PA 3CE3A 4QMWA 4DLIA 2UZLA 1TQPA 3BE2A 4ERKA 4O2PA 4XG6A 3TXOA 5DGZA 4JS8A 3EJ1A 5AP6A 5FTOA 4GK4A 3P79A 3ZS5A 3BL7A 3CKWA 3DKFA 2RKUA 2A98A 2HZ4A 2VTAA 4GIIA 4WSYA 5GINE 2IVVA 1YOJA 3F5UA 1WFCA 5CALA 1QPDA 5IU2A 2PVNA 4MH7A 4XHKB 2B9JA 3V6SA 4KIOA 3ZHPC 2A4LA 5KKRB 4RX9A 5I9UA 4PDOA 3D2IA 5L6WL 5B2MA 4RLLA 2QOCA 4C34A 3U55A 4FNZA 5I3OA 5EI6A 3S3IA 3PVGA 1JKLA 4AN9A 2BRHA 4GW8A 1XH8A 2QO9A 4GK2A 4G9RA 4IJ9A 4BIEA 4O38A 3HMIA 4H1JA 4BYJA 3D5UA 1Y8YA 1M7QA 2XVDA 3CEKA 1UA2A 3GXLA 5FBOA 3RVGA 5HLWA 5C4KA 1ZZ2A 3V5QA 2IO6A 5L8KA 4FL3A 5DBXA 4U0IA 5CY3A 1GIIA 2ZAZA 3QCQA 4RVLA 2ITZA 2WMSA 4KSQA 2QO2A 3RZFA 4DT9A 4BDCA 1OL7A 5AM6A 5BMMA 4FV9A 3TZ8A 4ARKA 4Q9ZA 5BX0A 4J97A 3TIZA 3ITZA 3GCQA 5JQ5A 3RPRA 4QTBA 2Y6MA 4EUUA 4IEBA 3I0QA 3BGZA 2VWVA 4KKEA 2ZM3A 2C5XA 4ITJA 4O4FA 3PP1A 2ZDUA 4YPSA 3ZFXA 2PVFA 4D9TA 3QHWA 3UC4A 4EOOA 5CF5A 5KHXA 3EL8A 4OT5A 2C6MA 3LHJA 4KIKB 5LMAA 1XQZA 4F7SA 4NCTA 2BAJA 3BYOA 2BAKA 5CVFA 4XBUA 5CU6A 5IDPA 3PY1A 3ZOSA 3BU6A 2R5TA 4DGNA 1PMEA 3CCNA 3OCSA 3AD6A 3DNEA 3IG7A 3SLSA 4ZLYA 2WAJA 5FGKA 5IZFA 5JFWA 4V0GB 4FKIA 4PMPA 4JOAA 5K3YA 3VBVA 3ZSGA 2QOHA 4RBLA 4IVAA 5LMKA 5LQFA 4JL9A 3FI8A 5E8UA 5HLPA 2XIXA 3G0EA 3RMFA 5JKGA 4NW6A 3FZSA 3ACKA 1H1QA 2IZUA 5HU9A 4EHEA 3GFWA 4USFA 3E62A 4BDBA 4J96A 3QRTA 5JMSA 4AUAA 2R3OA 3DDPA 3TEIA 4F64A 4F6SA 2FUMA 2BCJA 3COMA 2JIVA 4ZOGA 1B39A 2HXQA 3PIZA 3UYSA 4AT5A 1H26A 4UN0C 4O0WA 3REPA 2P2HA 3NNWA 2I7QA 2PUNA 3AC4A 4OTGA 5IA1A 1Z5MA 2WNTA 3DV3A 4GV1A 3JVRA 4CKRA 1UNGA 2JLDA 3FXWA 4DEBA 4LV8A 5A4QA 5CZIA 3EWHA 2VTSA 3FYKX 2QR8A 4QMTA 4E6QA 2YCFA 1KUTA 2Y7JA 4D2VA 4GVJA 3IOKA 4LOQA 2P0CA 3F61A 2YCSA 4N4SA 1MQ4A 1VEBA 2HK5A 2W96B 4HCVA 2J51A 1JOWB 2W4KA 4UB7A 5D7AA 1OUKA 5KHWA 3Q04A 2OJ9A 4MXXA 3TZ7A 3EZRA 3W2OA 2J0MB 4BCPA 2B0QA 1YOMA 3A4OX 4BY9E 4TT7A 3TG1A 2VTMA 2BR1A 3A7JA 3BBTB 4R1YA 5E8VA 1AGWA 2VTLA 1JSVA 4A9RA 1BMKA 2Y4IC 4DCAA 3OT3A 3PFQA 4HZRA 4GKHA 4HZSA 4X21A 5H8BA 3WI6A 2REIA 4ID7A 5IQGA 2B54A 3UP2A 5DH3A 2XIKA 3ZM4A 3R7EA 1ZXEA 1ZAOA 5HNGA 4C2WA 3C1XA 3LFEA 4ACMA 2QLUA 4FKOA 2B9HA 5LVOA 3KF4A 3LIJA 4JBVA 4C8BA 5KBRA 5H3QA 4BTMA 2F2CB 4FGBA 1A48A 3Q6UA 3MFUA 4L7FA 4WSQA 4XP2A 4BB4A 1M7NA 3I81A 4PMSA 5J7HA 3LFSA 4UMUA 1T45A 3AT2A 2R9SA 3EKNA 2X4FA 2CSNA 3D14A 2CLQA 3LQ5A 3HA8A 4MK0A 4N6YA 2O65A 4AXDA 3DXPA 3E7OA 4D5KA 2PE2A 5GJGA 3U54A 3OEZA 4EQUA 2ITUA 4WRSA 3UNJA 3HVCA 1ST4A 1WVYA 2I6LA 3EKKA 4DG3E 2ETRA 2JEDA 4D1SA 4E20A 4GVAA 3VBWA 3VUIA 2OH0E 3KRJA 1PRYA 2PVMA 5I9WA 4H3PA 4NT4A 5CSVA 3HL7A 4E26A 5EM7A 4APCA 1KE5A 1UWHA 1ZOEA 4APPA 2C1BA 2ONLA 5EH0A 5FQDC 4H05A 4EC8A 2BROA 3QAME 4FG8A 3G0FA 5EDQA 3HV3A 3HRCA 5AR8A 5EW3A 5CEPA 4YC8A 4NIFA 4MXZA 5CX9A 3IW8A 1OL5A 3GU4A 2PU8A 4CYIA 5HHWA 4YO6A 1XBAA 2ITWA 4O0UA 5C27A 4FSTA 2WTJA 3KXHA 3FKNA 3MY0A 3LM0A 4EWQA 4GYGA 2UZTA 4U79A 3D0EA 3FY2A 3QKMA 4I4EA 4XLIA 4JMQA 4I20A 3CJGA 3COIA 3KN5A 3G90X 3R22A 1VYZA 2OWBA 4L67A 3ZLSA 4E5BA 3B8QA 2C5YA 5HVJA 3W0QA 4I6FA 1Y91A 4Q5HA 4S34A 4GU9A 1P14A 1E9HA 3G51A 2UW4A 1SZMA 1QCFA 2R3QA 4O4BB 3DJ6A 5EW8A 4ZIMA 3AXWA 3ZTXA 3TDWA 4XV3A 1CMKE 4AT3A 2XKCA 3MFRA 3OW4A 5E8YA 4F6WA 4M69B 4J99A 2Q0NA 5C1QB 2JAVA 2IVUA 2VGPA 5F9EA 5CEOA 3FQEA 4J8MA 4TXCA 3OT8A 4S32A 4BL1A 2YLEA 4ACHA 2XAMA 2XEZA 2OSCA 3AT3A 1OM1A 4RC4A 3HMMA 4D1ZA 5J5SA 1ZYDA 5GJFA 3QD4A 3VS4A 3ZUUA 4S30A 4YURA 5CU0A 2CNUA 4U6RA 4F09A 4AAYA 2YJRA 2VWWA 4YC3A 4PRJA 3NAXA 3VJNA 2YIYA 1NVSA 2PVRA 4X3JA 3FL5A 3MA3A 4CV9A 1PF8A 3VIDA 1YHSA 4PF4A 2CCHA 2BILB 3FPQA 4O4CA 3AKJA 1K9AA 4QQTA 5HBHA 1ZZLA 4IB0A 3R7GA 3QLGA 4Y5HA 2Y6OA 4CMUA 4H3QA 5TOZA 4FTLA 4JG6A 2YJSA 3U51A 3UP7A 1YHWA 4NTTA 4XCUA 2FSMX 3QRKA 1WBOA 3C9WA 5FP5A 3TCPA 3BYUA 4QNYA 4EL9A 3H9RA 4FSZA 4WA9A 5BV3A 3NCGA 3ACJA 2PVKA 4MCVA 1ZYJA 5AP0A 3UYTA 4F70A 1OBDA 2YLFA