4YTIA

Discovery of vx-509 (decernotinib): a potent and selective janus kinase (jak) 3 inhibitor for the treatment of autoimmune disease
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
289
structure length
284
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of VX-509 (Decernotinib): A Potent and Selective Janus Kinase 3 Inhibitor for the Treatment of Autoimmune Diseases.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 284
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ytiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ytiA01
2WQMA 4RC2A 3OXTA 4R3CA 3GCUA 1VR2A 3OW4A 5E7RA 2C6IA 4ZTLA 5M51A 2CNVA 4QP7A 5IQFA 4FTMA 2JFLA 3DKCA 3NWWA 3QX4A 3CPBA 4M0YA 3NYVA 1HCKA 4U43A 3UPXA 1APME 5G1XA 2JD5A 1OBGA 4C7TA 2IVTA 3PRIA 5AUYA 4D2WA 3KXNA 4APCA 1J7IA 3UOHA 4AT5A 5IQDA 4IANA 2B55A 5DI1A 1XKKA 5JZNA 3L8VA 4KD1A 2QR8A 5BVEA 4CRLA 2BRNA 4EBVA 4Z7HA 3ZU7A 2HY0A 2UZVA 4XRJA 5FG8A 3KFAA 4IB0A 3FZTA 4DCEA 2QR7A 2PZYA 1G8SA 3ORZA 4EZ3A 3OUNB 2ERKA 3EZRA 3NRMA 3ZBFA 5A4EA 5M44A 3LXLA 5EQPA 1X8BA 2ZV7A 4QMUA 3PY0A 4D9UA 4NTSA 3I81A 4EK8A 4KS7A 3GVUA 1BX6A 4UXQA 3HMNA 4FBXA 4DYMA 5HG8A 4NW5A 3ATTA 3UMWA 3FYJX 3JY0A 3QF9A 4FSNA 3UTOA 4H05A 4MF1A 4OGRA 3AQVA 3DXQA 5M4UA 1JKTA 2R3RA 3JVSA 1ZZLA 3BYSA 1REKA 1FMKA 3I4BA 2BTSA 2HW6A 1W0XC 3TIYA 4E8AA 2I6LA 3EQBA 5FLFA 3FI8A 2PZ5A 3GU4A 4PPCA 1U5QA 4FR4A 2BHEA 4WUNA 4OTHA 5B0XA 2DQ7X 3BBTB 2UW8A 3KK9A 3P78A 4QP8A 4U97A 2X81A 3UODA 3WZJA 3FKOA 1PKDA 4XV3A 3ODYX 5IG1A 2F7EE 5AMNA 4EQMA 3DU8A 3FSFA 3LFBA 4G17A 4H36A 2VN9A 4S30A 5IQEA 5J5SA 4EH4A 3QTUA 4FG8A 5KCVA 3PJCA 4KRCA 3GFEA 5HBJA 5HGIA 3SDJA 3SD0A 1WAKA 2PZIA 4ERWA 5HCYA 2OK1A 4P5QA 4B8LA 1XH4A 5TOZA 2C4GA 3A4OX 3KMUA 4YO4A 4O7TA 4U42A 1MRVA 1OL2A 3DJ7A 4UN0C 2V0DA 3C0IA 5DWRA 4I1ZA 4PL4A 1WBVA 5ANGA 2Z7RA 1OIQA 5CANA 4KIKB 4L52A 4GIHA 2WMQA 5EYCA 2W9FB 4K6ZA 3CEKA 1H0VA 3VUIA 2OFVA 1FMOE 3KMWA 5L6OA 2ZM1A 4IX3A 1KWPA 4FNWA 3S3IA 3VBYA 2Y8OA 4B6LA 4H39A 1EH4A 4ANNA 1JPAA 4AWIA 3KU2A 4ANBA 2JKMA 2WTVA 4AW2A 3QTWA 1ZMWA 3FUPA 4Z9LA 3FC1X 2XMYA 4FNXA 3W32A 4L7SA 1PMVA 4CD0A 4F7JA 3LCKA 5FM3A 1L8TA 3FMHA 5DRBA 5JGBA 3MY1A 1M7QA 3KVXA 5EFQA 4CYJA 4KA3A 1OL5A 3HA8A 3QWKA 1H8FA 4PY1A 5FEEA 3H3CA 4CQEA 2RG5A 4ALUA 5DE2A 3TDVA 2RG6A 3ANQA 5AP1A 3VUKA 2HYYA 2QI8A 3TUBA 5CT7A 4EWHA 4LL5A 4JOAA 2R3HA 4XYFA 4NUSA 3ZFXA 3G5DA 3ZMMA 1UV5A 1OKYA 2BAJA 4FV4A 3Q9ZA 3VIDA 2J9MA 5GZ8A 4FTNA 2ITOA 3TCPA 2HXQA 3MH0A 4AN3A 5DNRA 2CDZA 3NUPA 4C0TA 2OJGA 3SHEA 5HNIX 1PHKA 4ORKA 4RX9A 3CTJA 3DQXA 4W4WA 1OL1A 4TL0A 2QNJA 4ZMFA 4LYNA 1U59A 4R3RA 1Y6AA 4ZLOA 3DQWA 3EQRA 4W4YA 2JBPA 2C3IB 1FVRA 2R3GA 2XNOA 3LZBA 5L2SA 3ITZA 4UYAA 2GNHA 4GK4A 3FC2A 3N4TA 2WEIA 4ANLA 2GU8A 2GNIA 4PDOA 4AN2A 1ZMVA 1GJOA 4QMMA 1SYKA 3RZFA 1O9UA 4K0YA 4MBLA 3F66A 4OTPA 4BBEA 3PSCA 2R3KA 4TW9A 3U55A 4RFYA 5HLWA 4EH5A 3U6IA 3PYYA 3R7OA 3K2LA 1H4LA 2GHMA 3LLTA 3DK7A 3KULB 4WG5A 3SW7A 4BR3A 3QKMA 3ZLYA 3BE2A 4N6YA 1OPJA 2UZTA 2HCKA 2WPAA 3DV3A 4YTCA 1SM2A 5AX9A 2OW3A 2W17A 3DZOA 3IONA 3NCGA 4S34A 2WTJA 3F61A 4EORA 2F7XE 3GOPA 4TZRA 4DFYA 2YACA 2PSQA 2YIYA 3MFTA 5CSPA 5EYDA 2QOOA 2VTNA 5BQ0A 2CKEA 3ERKA 5LVOA 4TNDA 2BDWA 5ANEA 4FTRA 4FV2A 5B7VA 3FLNC 5JFSA 4CCUA 2OWBA 1U46A 4BN1A 4AGWA 4BGGA 3WZKA 3RKBA 4F64A 1PXIA 2OJIA 2E9OA 4XG6A 4EOMA 4QYFA 3UDBA 2GCDA 2B1PA 4BCNA 2XP2A 3FZOA 4WRSA 2J0IA 5A54A 5FDPA 3ZFYA 4DGLC 4EL9A 4MD7E 2VWYA 5GZAA 4C4JA 4OLIA 4RJ3A 3IDBA 4KINA 1NXKA 3R2BA 3SAYA 3TWJA 5BVWA 4TPTA 5LARA 2QO7A 3AD4A 4ACCA 5CU4A 3PJ8A 5CAQA 2CGXA 3TEIA 2I40A 2VWWA 4L43A 4EI4A 5HBHA 4E6DA 3QTRA 3P1AA 3KVWA 5HVYA 4G3FA 4P7EA 3CGOA 4R77A 3OC1A 2PTKA 4RVTA 5HEZA 3VS5A 3P08A 5AUUA 4TYJA 5GJDA 2KTYA 4MXYA 4KRDA 4MX9A 4QMWA 4L68A 3TACA 2XK6A 2BILB 4KIKA 3QKKA 4I5CA 4JG7A 4TWPA 4EHEA 2IVUA 2WU7A 4PWNA 4AZWA 4CFWA 3WIKA 2OXDA 3K3IA 4XP2A 2OSCA 3OHTA 4WT6A 4YNEA 3DK3A 5E8XA 3R7EA 3RK5A 5FWKK 1QPJA 1LEWA 3PY1A 5EDPA 2PULA 4ZTRA 1ZXEA 2PMLX 4IACA 3QQJA 3Q5IA 4N0SA 4DTAA 4IAZA 4FODA 4YHFA 1U4DA 1BLXA 3JUHA 3DLSA 4RGJA 4UB7A 4K2RA 3ZRKA 1YWVA 4M13A 3PDTA 2R0UA 4R6VA 3LFNA 4OBPA 3HEGA 3QQUA 2V5QA 1YI4A 5L3AA 2YM6A 2HWPA 3MYGA 4M69B 1OM1A 4HVDA 3TNWA 4BTJA 5AWMA 3R8PA 3ET7A 3OS3A 5E8WA 3ZLWA 4Y83A 2PVMA 4BKJA 2O3PA 1T46A 2C6TA 2YABA 4AT4A 5IZFA 4NWMA 4IW0A 4U3ZA 4HVGA 4QMSA 5BYYA 1UVRA 1WBTA 2WTDA 4KB8A 3BQRA 3C4EA 2XB7A 5DPVA 2VUWA 4E6QA 3HDMA 5KZ0A 1Y57A 2PVYA 4IWPA 1WZYA 2QOKA 3NPCA 4QMXA 5HICA 2NNWB 1Q8YA 3TT0A 2CLQA 5AUVA 3IGOA 5M55A 5EOBA 3ZEPA 1PXLA 1WBOA 1ATPE 2YCSA 3F69A 3PIYA 4FUYA 4MYGA 5EW3A 4BRXA 2I7QA 2IPXA 4GKHA 2IG7A 1Q3DA 4MD8E 4NFMA 5DOSA 3D9VA 3E8DA 4C2VA 3FMKA 4ZZMA 4AQCA 5J8IA 3CBLA 1KOBA 5A14A 3I5ZA 3F2RA 3H0YA 3FJQE 3FZRA 5AA8A 2ZV2A 2CMWA 5B2LA 4PF4A 4JAJA 3C0HA 4I5MA 5LWNA 4U5JA 2PZPA 3PVGA 5FTOA 5J9YA 5IUHA 3R9OA 2CGVA 3RK9A 4X2NA 4UMUA 2R3IA 3ZXZA 4OAUC 4FEWA 4RVLA 3ZCLA 4BICA 3C0GA 4O91A 2BIKB 4TYIA 4PV0A 2W06A 1UKIA 3DKOA 4CTBA 4FSTA 3EZVA 5KKRC 2VGPA 4OTDA 1K9AA 4C36A 2C5XA 4F0FA 3TKHA 5KKRB 4IADA 4XJ0A 3LQ8A 5CAVA 4B0GA 3R21A 2UW7A 2VTPA 2WMWA 3FXZA 4CFVA 2VWUA 3QYWA 3RTPA 1I09A 5DEYA 1W98A 4FC0A 2GQRA 3WILA 2OJ9A 4C35A 4UMQA 5FXQA 1OITA 4PMSA 4YU2A 4ERKA 5I9WA 4H58A 3KULA 5DIAA 4FVQA 4F6WA 3IW8A 4RWKA 2BZHB 4LOOA 5CU6A 4IXPA 3VBQA 4BY9E 2YLFA 2DWBA 2R3FA 4O0UA 5BVOA 3POOA 1QPDA 4FEQA 4CRSA 3QU0A 4JLCA 2QOIA 2WQOA 3QCXA 4IAIA 4GK2A 4QPSA 3NUSA 5IA4A 2F57A 2V7AA 4YJUA 3QCYA 3QRKA 4C8BA 1DAWA 4TKSA 3TUCA 4EH7A 2XIXA 5CYIA 4I4FA 4E4XA 4O7NA 2UVYA 4PDPA 2ITZA 3FZSA 3O50A 3QD2B 3HECA 3D94A 3JXWA 1TQPA 4FYOA 4L7FA 4K8AA 1YHWA 3PA3A 4W8EA 4O86A 3BBWA 3CQWA 5H3QA 1XQZA 3ZUTA 4DH7A 5KNJA 4Y46A 1B6CB 4MXAA 4F63A 5EM7A 4ZP5A 4NH1A 2UW9A 2WMTA 3ORLA 3R7VA 4FKRA 4D2TA 1R3CA 4FL3A 4YLLA 1LUFA 2YA9A 3E62A 4M14A 3S2PA 4DTKA 3CSVA 2YWPA 4EEVA 5CEIA 4FTKA 4J1RA 3LQ3A 2I0HA 4IE9A 5AR8A 4MF0A 4OBOA 4FZFB 3ZONA 2Y9QA 3P5KA 4H1MA 1Y91A 4D1SA 2ZJWA 4IH8A 4RIOA 3PZHA 2BRBA 4I6FA 5TKDA 2JKOA 3R8MA 3RM7A 4IM3A 4DBNA 4FYNA 3NVMB 4CT2A 4RT7A 1UU3A 1M17A 1P5EA 3ORPA 5J5TA 1NW1A 5E92A 2WNTA 3C9WA 4QQCA 3II5A 5E8SA 5H9BA 4AZSA 4PNKA 1YOMA 4OTWA 1URWA 2R3QA 3DBDA 4QQJA 2XRWA 5JK3A 2VO0A 3C4XA 1URCA 4WRGA 4BCPA 3R28A 4JDIA 5TT7A 3ZSHA 2C3JA 4AU8A 2EB3A 4Q9SA 2JDSA 4XS2A 1Q4LA 3GU5A 4MTAA 2FYSA 2J5FA 4CLIA 4YLKA 4MCVA 3MDYA 2YERA 3DBFA 3QGWA 2WEVA 2Y6OA 3MGYA 3W2OA 1OL7A 1H1SA 1XWSA 2XK9A 4ARKA 3CR0A 1KE5A 1Q8ZA 2WTIA 4JBQA 3PA5A 4KWPA 3COHA 3F7ZA 1M2PA 2PHKA 3HV3A 2W7XA 3EN6A 4WUAA 3D5UA 3SGCA 3V8SA 4ACDA 2BDJA 2C1AA 5JQ8A 4I94A 5KE0A 1FINA 2C5VA 4O0YA 3EQFA 3EQHA 3MPTA 3HGKA 3UJGA 4LI5A 4QQTA 2B0QA 4M69A 2QO2A 3JVRA 3RNIA 3KCFA 3TV4A 2C69A 4BCIA 3ZTXA 3DTCA 4FSUA 5CASA 4FV5A 2QOLA 3C4CA 4GRBA 3SRVB 4I22A 3RJCA 3HUBA 3GFWA 5CSVA 2OICA 2QOHA 3G90X 2ZV8A 4BBMA 5BMMA 2YJSA 4FSWA 1WCCA 3O23A 3VS7A 5M53A 3OT8A 4KIQA 1H27A 3ULIA 3KK8A 4ZTSA 4I20A 4X6RA 3UZRA 2C0IA 3EN5A 4WBBB 5K0XA 4Q2AA 3DDQA 4QP6A 5I9ZA 4QT1A 1E9HA 2ACXA 4J95A 5CVGA 4JDKA 3RHKA 1P14A 5IEYA 3AMAA 3PSBA 4QYEA 3AT4A 3ZC6A 1P4FA 3BIZA 3GCPA 4O7YA 3UYTA 1Q8WA 1BI8A 4Q9ZA 5DEWA 3CD8A 3VULA 3EN7A 4W8DA 1IAHA 3PVUA 5HG9A 4FV1A 4USDA 2FSTX 3Q6UA 3FAAA 2PY3A 4WNMA 4ANMA 3KREA 2OIDA 4U6RA 4BDHA 4EOKA 4ZZNA 1PMEA 2O2UA 4TWCA 1KE7A 5M06A 3F3TA 3TL8A 3C4WA 3LCDA 4ONAA 4RIWB 3CPCA 3AC8A 3GNIB 4LG4A 5CS6A 3LCSA 4L00A 2WD1A 4EKKA 3DY7A 4OT6A 3U51A 3HNGA 3QKLA 1TKIA 4HZSA 5EYKA 2XKFA 5EI6A 2EVAA 5L4QA 4E4NA 2R3PA 4YZMA 5IQGA 2R7BA 3F5GA 4KNBA 1WBPA 4CFMA 3KKVA 3Q60A 5F4NA 1ZY4A 5IPJA 3W33A 3G0EA 4ENXA 4UXLA 2AC5A 2VD5A 5CZHA 5HE3A 4EH8A 2YM7A 4BCJA 1Z9XA 2OLCA 4BCGA 4UMRA 2PVHA 4IQ6A 3OY3A 1GOLA 2XJ1A 4R5YA 5CEPA 1U5RA 4BZOA 3R1NA 5HU9A 4U0IA 3W10A 1H01A 3OUKA 2DUVA 2WMSA 5JH6A 5KO1A 2R3NA 3GUBA 3NIEA 3E3PA 3P7CA 2ZB1A 4UV0A 4XNEA 4ZEGA 4D2SA 1GIJA 3F2NA 3HV7A 5AR2A 5C8NA 2IN6A 3JPVA 2VV9A 2XCHA 4IFGA 4WSYA 3D5WA 2BROA 1I44A 5EM5A 4A4OA 3P23A 2O8YA 3B2TA 4LGDA 4ZSGA 3LXKA 4YPDA 1BKXA 4JIKA 3QTXA 3ZBXA 5FEQA 3A8WA 4RQKA 4BCHA 1PXPA 5ICPA 5HE0A 4JDHA 5EQEA 4CKJA 4UMTA 1JLUE 4WD5A 3O8TA 2OGVA 3BU5A 4HW7A 3POZA 4GEOA 4KSQA 4RIYA 1GNGA 2WMXA 1SZMA 3O71A 2PUNA 5AP6A 4XLIA 1M7NA 3R2YA 4OAVB 3H9OA 5B2MA 5JRQA 4G34A 3UO4A 3DTWA 3EJ1A 4CZUA 3I0QA 3DNEA 3HRBA 3I6UA 4KBAA 5H8GA 3K5UA 4GCJA 5EOLA 5DYJA 2O0UA 5KMIA 3ORTA 2J5EA 4E6CA 3UOJA 2BAQA 3A7JA 4I4EA 4EZ5A 3OXIA 4ZZOA 3FLQA 1W8CA 4DEGA 1LR4A 2IZTA 3EFWA 4RJ5A 5H2UA 4I3ZA 3OTVA 4LMNA 5K0KA 5IDNA 4OUCA 2DS1A 4FIHA 4G9CA 1R1WA 3R63A 3RPSA 5D9HA 3THBA 1K2PA 4DGOA 3QXPA 5A6OA 3FLSA 4W4VA 2VTRA 3PP1A 2R0IA 3R6XA 4G9RA 4Y85A 5FBOA 3HMMA 3F3WA 4PMTA 3DNDA 4Q5HA 4GYGA 3LMIA 1STCE 4HYSA 4WA9A 3V5WA 4H3BA 2J0JA 4LGHA 2X4FA 5JZJA 1KOAA 4BWPA 3VUDA 4FEUA 5EW9A 3F7WA 4MQ2A 2WELA 4Y8DA 5HHWA 5C03A 1F3MC 2X9EA 4EH2A 4O0VA 3R22A 1VYZA 3SRVA 3IQ7A 3BHTA 2OH0E 5AR3A 4W4XA 3RALA 1Z5MA 4ZSLA 1H07A 3CQEA 4FKQA 3TV7A 3WOWA 4M68A 4D1ZA 4CFUA 1RDQE 2OO8X 5L2QA 3U4UA 5L2WA 4L3JA 3VBXA 4FSMA 4YHTA 4F9BA 2NO3A 5AM6A 5AADA 3CE3A 3I7CA 4U7ZA 5FGKA 2ITVA 4LQMA 4GKIA 1NVRA 2IZSA 2Z02A 4XEYA 1NVSA 3FY0A 3SXRA 1XR1A 2Z8CA 2QC6A 2YJRA 2W1CA 3PJ2A 4XLVA 2QG5A 3VRYA 4O7VA 4XHKB 3ZUVA 1AQ1A 3CS9A 2WOUA 3OOGA 3VJNA 1Q97A 3U4WA 4JIAA 4YNOA 5AR4A 3VJOA 3FYKX 5AV3A 2X2LA 3CTQA 4RWJA 5DMZA 4FE2A 1H1RA 4FT9A 4IFCA 4MXOA 5CF6A 4UX9A 5FBNC 3F2AA 5LCKA 3SXSA 3O2MA 3FQHA 2A27A 4EOLA 4S32A 4F1OA 2VTMA 3IPHA 4YBKA 4GH2A 4AF3A 1REJA 4BDIA 4ZMEA 4M67A 4R5SA 4N4SA 5LVMA 3C13A 4RIXB 3PVBA 4RIWA 5AAGA 4BIEA 3TDWA 5CY3A 1OIRA 3TV6A 1UNHA 3FI4A 3RHXA 2W1GA 1R78A 1SVHA 4JBVA 5LVNA 2HIWA 3R02A 4FSQA 3FQEA 2GHGA 3VWAA 3WF6A 3PXKA 1CTPE 4FTCA 3VBWA 3PG1A 1ZAOA 3ZDUA 2YHVA 4AT3A 4TYHB 4IAAA 2JKQA 2VWVA 1BYGA 3C50A 4C02A 2QU6A 4X6QC 3I5NA 3BLRA 4FIFA 4RX5A 3EYHA 3UMXA 4NYEA 5CQUA 4CZYB 2IVVA 4I6BA 3R00A 2JGZA 3QTSA 3UQFA 2B4SB 3R1QA 2GNFA 3QA8A 4DH3A 1ZYLA 3BPRA 3CLYA 3LJ1A 3EKKA 3MSSA 3A62A 3N51A 4FMQA 3MTFA 4IC7A 4BCKA 3I1AA 4C2WA 3FPQA 5FQDC 4UEUA 3Q5ZA 4HOKA 3IW6A 4Z7GA 1H00A 1PXOA 2RL5A 5HESA 4D9TA 3AMBA 4N6ZA 5M07A 3QYZA 2C6EA 3CD3A 3RZBA 4S2ZA 4EHVA 4AFJA 1OIUA 3EYGA 3OCGA 2ZDUA 3QRIA 3VQUA 2Y6MA 4XG9A 3VHEA 4UMPA 2JDOA 2XYUA 1W7HA 2WXVA 5F94A 3QRTA 1XO2B 3E7VA 4EH3A 3N4VA 1GY3A 3WARA 4DFUA 2BRGA 3VS4A 2FH9A 4ANQA 5M4IA 4E1ZA 2XCKA 1MRUA 2G9XA 2FVDA 4WOVA 4PL5A 2ITTA 4AGDA 4JBPA 4QMVA 1XBBA 2Z7LA 1OPLA 2IW9A 4FEVA 3F5XA 3EQPA 2EB2A 5DBXA 3H0ZA 1UWHA 2XKCA 4QMZA 3UZTA 4O27B 4C57A 3COKA 3NS9A 1Q5KA 3G0FA 4NM5A 4W9WA 3UC4A 3HP2A 4LM5A 2GSFA 2G2FA 4PNIA 4BZDA 4QMQA 4HCTA 2YAKA 3ZUUA 3OWJA 5E90A 2C5YA 3KXXA 3BHUA 2B9IA 3L9LA 4J99A 4JRNA 1XH5A 3TKUA 4PMPA 2JLDA 2JIUA 4L46A 3HMIA 4W9XA 3G9LX 1CSNA 4F6UA 4GV1A 2UZDA 3LOKA 4G6LA 4J98A 2ITUA 4TTHB 2YZAA 3LAUA 5LVLA 3WE8A 3FMNA 4WBOA 3O0GA 1SNXA 5ETAA 2A19B 1DAYA 3SQQA 1JSVA 3SW4A 2JDVA 2X2MA 4GFGA 3E88A 3TG1A 2BKKA 1S9IA 3OCTA 4GW8A 4WNKA 1BMKA 3MH3A 3DBEA 4JAIA 3S4QA 1CKIA 2XYNA 4WKQA 4FT3A 3UC3A 3DAKA 3FMEA 2UZLA 3F6XA 4RSSA 3F82A 2QURA 4G3EA 2Z2WA 4IJPA 4R3PA 3NZ0A 2XIYA 3ORKA 1XH8A 5DVRA 5KMOA 3VO3A 2BTRA 5EDQA 2F49A 3QX2A 4U40A 4QP3A 2ITXA 4DC2A 3BWFA 4FTUA 4ZJIA 3ELJA 4I93A 3EFLA 4KAOA 3G2FA 3L8XA 2JAVA 3T9TA 4YC8A 4DLJA 3BLHA 4O81A 5JFXA 4O21A 5KMKA 3CKXA 5HI2A 4YGAA 3IGGA 3ALNA 5DFPA 4EOOA 5D1JA 3QUPA 5AA9A 4IX4A 1ZZ2A 1TVOA 3PWDA 1V0PA 4RJ6A 4D4VA 3OBJA 4EWQA 1UU7A 3CIKA 4J7BA 3QXOA 4LUDA 4MWHA 4QRCA 2CCHA 2OU7A 2P2HA 4O7WA 4DH1A 1PW2A 2WMVA 1H26A 4FOBA 2ZB0A 1ERKA 3EMGA 3UYSA 3ALOA 3UNZA 3C5UA 3G15A 4O83A 5IQIA 4C3PA 2UZOA 2W1IA 5CAPA 1M2RA 3QFVA 3ZZEA 3ORMA 4Z16A 4WG3A 4YPSA 4QMLA 5AP4A 4AGCA 5CI7A 1H24A 4QTEA 4R1VA 4FTOA 3QLGA 4DF3A 2CKQA 4ITIA 5J79A 4FZ6A 5HD7A 5HLPA 1Q41A 5K3YA 4UZHA 3UIMA 4ZY4A 3FL4A 4C3RA 3MIAA 1U54B 1WVYA 1V0OA 3CY3A 2UZEA 2ZAZA 3A7FA 2PPQA 2XK4A 3OXZA 4G3DA 3LJ0A 4EHGA 5M57A 3PZEA 4YSMA 3UVPA 2F9GA 3WI6A 5LOHA 5LMAA 3PXRA 2QOQA 4I0RA 1XH9A 3V5PA 1OBDA 4CG8A 1XH6A 4PL3A 4TYHA 5CWZA 4AXAA 3UE4A 4K11A 4FT5A 4NK9A 3UIBA 3ZSIA 5HO7A 1IEPA 4BB4A 4IB5A 2W1EA 2XIZA 1JKSA 2CNUA 4HVIA 3GOKA 1O6KA 4MBIA 5DN3A 3VF9A 3BWJA 2VO3A 2PMOX 1Q99A 2EXCX 2W1FA 3WZDA 5ANKA 1UA2A 3MS9A 4CMUA 5B2KA 3ZH8A 4NL0A 1VJYA 3VS1A 4ZTHA 3WZEA 1ZOHA 1FOTA 4PMMA 3O51A 5AV4A 4XV9A 3M11A 1M52A 4HPTE 1J1CA 3R7GA 3QQHA 2BAKA 4K9YA 2VWIA 2YIRA 3NUUA 5A4TA 4IX6A 2ZM3A 3KXHA 2UW4A 3PP0A 4UWBA 4ZJVA 5JGDA 1WFCA 2I0YA 3QHWA 3QRUA 4FKPA 4UY9A 5ACKA 3V6SA 5C8KA 5AAFA 4LRJA 1NVQA 3GI3A 2VAGA 3E93A 2C3KA 4JG8A 3CTHA 4M15A 3V01A 1MUOA 2C6OA 1XJDA 2PL0A 3PIZA 3Q4UA 3BZ3A 1H1QA 2R5TA 2ZMCA 2X7FA 5FXSA 4I6HA 2PVNA 4YBJA 4BKZA 4CXAA 2ETKA 5FDXA 3SG9A 3QZIA 4FEXA 4G5PA 4GJ2A 4BCFA 3FWQA 5J87A 4EK5A 2F4JA 3E7OA 1H1PA 4Y5QA 4FUXA 4XBRA 2H34A 3MJ2A 3RPVA 2C6DA 3BGPA 4FKIA 4AA0A 2BR1A 3BV2A 1A06A 4C33A 2WTWA 3V04A 4CMTA 4EOQA 5CU2A 4E93A 2YCFA 2J7TA 1Q8UA 4BTMA 3UIXA 4XUFA 4DITA 3ODZX 2O5KA 4Q5EA 2ZV9A 4RJ4A 5AJQA 4JDJA 2Z7SA 3BI6A 4E20A 2X1NA 5KMMA 5ANIA 1JKLA 2XNMA 4A07A 3MFSA 2VTQA 4I21A 3GU6A 4ID7A 3CY2A 5HQ0A 5AIRA 3PJ1A 2OZAB 3SG8A 4CV8A 2Q0BA 4CQGA 1SNUA 3WF5A 3KA0A 1ZMUA 3Q53A 2HZ0A 2ETMA 5HCXA 4C4EA 4AW0A 3EQCA 5KBRA 4O7LA 2W4KA 3WE4A 3E8NA 4DG2E 1Q24A 4BDDA 3NYXA 5AV1A 2YIXA 4C59A 4ZXTA 1JSTA 2B52A 2KULA 2QOFA 1BUHA 2ZOQA 3RWQA 3MTLA 3HV5A 4LUEA 3W55A 4DT9A 3BLQA 2YM3A 3D15A 4E3CA 3FLYA 3TJDA 2PVJA 3QZHA 4QTAA 4XG4A 1VEBA 5EHYA 5KBQA 5M56A 4FKSA 2RFNA 4FG9A 4O84A 2C1BA 1FVVA 2XNEA 1M2QA 4C4HA 2XIRA 5CSXA 4PTEA 4R7BA 3SOCA 4YJTA 3HYHA 4QYHA 4J96A 4A7CA 2YCRA 5L6WL 3IK3A 4H3QA 2XH5A 3H9FA 3I7BA 3KQ7A 4WIHA 2ITNA 4HPUE 4QYYA 4CTCA 3PPKA 3IS5A 4EJNA 2H9VA 3ZC5A 1PXMA 4L3PA 5EM8A 4TWOA 4JX3A 3HL7A 4YJOA 3OY1A 5HVJA 3P86A 3M1SA 3ZLXA 4EK3A 3ETAA 4LOPA 3LM5A 4RQVA 2W5BA 5J7BA 2BIYA 4FKLA 2CHLA 5FM2A 2Y4PA 2V55A 2XNGA 3EWHA 5E91A 2J4ZA 4HJOA 1UU8A 5KMJA 1A48A 4J52A 3QCSA 4JQ8A 3ORXA 5FUTA 2YM8A 2BRHA 4DG0E 5I0BA 4YZNA 2NPQA 5DH3A 3CC6A 3MV5A 5CXHA 3TKIA 1FQ1B 2VTIA 3PUPA 3REPA 4AS0A 1DI9A 4QMNA 3QL8A 4RZWA 3U8WA 4DGMA 4X2GA 3VVHA 4QTBA 5K5XA 1KE9A 4ZTNA 5LWMA 3SVVA 1AD5A 2GS7A 5HG5A 2JDTA 4JT3A 2XNPA 2YN8A 2RIOA 3UNJA 3RAHA 4FTAA 2G01A 1U54A 2BPMA 3FE3A 4PDSA 2QHNA 4HGTA 3NAYA 4F0GA 4F9YA 2PVRA 2YDJA 5M09A 3WYXA 1G8AA 2I1MA 3MFRA 4U79A 3RGFA 2ITYA 3DOGA 2QODA 4EQUA 4FKUA 3ZLSA 3R9RA 1P2AA 2WAJA 3DXPA 4BCMA 1PKGA 3FQSA 4DH8A 4D2RA 5HX6A 3I6WA 3QBNA 1H0WA 3LMGA 5EDRA 2VO6A 3TNIA 5CI6A 2HZNA 3MN3A 5D10A 2O65A 3TTJA 4GUBA 4NT4A 3EOCA 1Y8GA 2WMUA 2GTMA 2J51A 5T3QA 3O8PA 3AT2A 5BVDA 1TQMA 4F9CA 3Q4TA 5CT0A 3TTIA 1SVGA 3W2SA 5AR5A 2WFYA 4M0ZA 1PY5A 3BYUA 4PPAA 2IZUA 1R0EA 2R2PA 5BMSA 2HY81 4X21A 5AIKA 3ZRLA 5HLNA 3Q3BA 3NAXA 4IM0A 3DBCA 3L9PA 3RNYA 2I0VA 2XRUA 4MHAA 2WU6A 1XBCA 3ZSGA 4ASDA 1UNLA 5AUXA 3EIDA 4HNFA 3GU7A 5HG7A 4BTFA 3S95A 4XOYA 5C26A 3FXWA 3G6HA 3MB6A 1J7LA 1YRPA 4CFXA 3MY0A 4O82A 3OWPA 1K3AA 2WQBA 5CX9A 4DN5A 3NW5A 4BL1A 2ZVAA 4GG5A 3R1SA 5CENA 1IA9A 4QPMA 4DCAA 2A2AA 2C6LA 2GQSA 4HGSA 3MWUA 3P9JA 3S0OA 2QQ7A 3IOKA 4Y73A 3FKLA 3F9NA 5KX8A 1YXTA 2XNBA 4CNHA 3HA6A 5ACBC 2PMNX 2WOTA 2G15A 4HZRA 4DHFA 4F9AA 3W8LA 5IQCA 3D0EA 4DGNA 1GIIA 3D5VA 3L8SA 5IMEA 1AGWA 3G6GA 4AUAA 5F9EA 3QQLA 1Q61A 3DDPA 4GG7A 5LVPA 4G1WA 3GGFA 4O6EA 5L6PA 3U54A 4YJQA 4QMTA 3BYVA 4JRVA 3LFQA 4JNWA 3VS0A 4APPA 4U3YA 1GZKA 1QPCA 4YJPA 3VUMA 4FIIA 5D41A 5HTCA 2VTHA 4FI1A 1WBSA 3BYOA 1WVXA 1IRKA 3ZO1A 3OFMA 4I23A 5LXMA 2JAMA 4AA5A 2OIBA 4YJRA 2ITQA 3DFCB 3G9NA 4CZTA 3HKOA 4DEDA 3FZ1A 3TM0A 4FV9A 4E7WA 2OZAA 3Q2MA 4MVFA 4HGEA 4G3GA 2YFXA 3D7ZA 3KB7A 4GS6A 3L1SA 3P7AA 4EC9A 1PMUA 2QHMA 3TJCA 4K18A 2ZM4A 2R4BA 4FZDB 1IASA 3BQCA 4NSTA 3R7UA 3LHJA 5CAOA 2YM4A 4CFNA 4O6LA 4HGLA 3BKBA 5CU3A 4AN9A 4E4LA 2FGIA 5GNKA 2XK3A 2VTAA 1JBPE 5IA3A 4IDTA 4L67A 4FKWA 4QMYA 4AG8A 4X2KA 4ZS4A 4D5KA 2OBJA 3E64A 4EYJA 4MAOA 5AP7A 5FEDA 4DA5A 3LFAA 4HVHA 5BYLA 2P33A 3FMJA 1DM2A 3KXZA 3T3UA 4ALVA 2YISA 4DE4A 2BMCA 3ZOSA 5TR6A 5K4IA 5LMBA 4RJ8A 3TZ8A 5IEVA 4D1XA 4R8QA 4FZAB 5IA5A 4RRVA 3QA0A 4X3JA 4ZJJA 5C4LA 2VWBA 4R78A 4EH9A 2ESMA 2W96B 4PUZA 4OR5A 4EK6A 3R73A 4XG7A 2VO7A 1OKVA 4M97A 2C6MA 2B53A 5CNOA 3D2KA 2X4ZA 2J50A 3VBVA 2X7GA 2CJMA 2PU8A 4EUUA 4NKAA 1FVTA 4H1JA 4QP2A 4FNZA 5EKOA 4HVSA 5ETFA 4CG9A 4O7ZA 2W1HA 4L6QA 2PYWA 4QYGA 2W5HA 2E9VA 5DG5A 4DT8A 4FV8A 3AMYA 3LFCA 4LV5A 2DYLA 4BHZA 1KV2A 4IB1A 3HV6A 1R39A 5AFVA 1E1VA 4G16A 4WO5A 5E1EA 1B38A 2RFEA 4L8MA 5CEQA 4CEGA 5JN2A 3R8UA 4LL0A 4BIDA 3AD5A 3Q52A 3LFEA 4F9WA 5BVNA 2ETRA 3ENMA 3PRFA 2CLXA 3W16A 2OJFE 5E8VA 4USFA 4U8ZA 4AE9A 2OKRA 2GPHA 3UO6A 3FI3A 4JR7A 3D83A 5E8YA 2E9NA 3VUGA 1LP4A 4BYJA 3DJ5A 4KBCA 3TI1A 4EKLA 3EQGA 4BKYA 4MH7A 1OL6A 2CGUA 5HTIA 4E4MA 2VX1A 4M66A 4C4GA 5DR2A 2UZBA 5DGZA 4AZVA 3AXWA 3CXWA 2QCSA 1J1BA 2UVZA 2J2IB 2VWZA 4M12A 5J95A 3F5UA 3VBTA 2HW7A 4FT0A 1A9UA 2E9UA 5LMKC 5IA0A 3QGYA 4L9IA 3DS6A 3PVWA 3R83A 3PIXA 1BL7A 3UO5A 4XV1A 3MVHA 2PMIA 4MBJA 4DLIA 4MXCA 5AUTA 1L3RE 5LJJA 4E5WA 5JMSA 3MFUA 3W18A 5T6KA 4TWNA 2RFSA 2W9ZB 4IZAA 2OXYA 3NW6A 4EYMA 5J9LA 2YM5A 1Y6BA 1PRYA 3PLSA 2GFSA 4GYIA 4FGRA 2IO6A 5BPYA 2ZMDA 3Q96A 4EZ7A 4JL9A 5IISA 1VZOA 4NCTC 3KRLA 3NVKI 3U6HA 2VX0A 3GCSA 5HOAA 4ALWA 3NMUF 4RBLA 4L3LA 3UP7A 4IVBA 4F7LA 2QU5A 2YLEA 3RBWA 3GQLA 4CV9A 5CF5A 3VUHA 1YHSA 5IA2A 3KRWA 4QOXA 4YUQA 4P90A 4I41A 3OZ6A 4I92A 3V5LA 1T45A 2W5AA 2Y7JA 2FSOX 4NJDA 4WG4A 4XG3A 5EKNA 5IF1A 3ULZA 5JFVA 3OCSA 4YC6A 3COIA 3TNPC 3ZO4A 5BX0A 4FK3A 2R3MA 4ACHA 4BCOA 1QPEA 3HV4A 2HK5A 3Q4ZA 4BHNA 4ZIMA 3TXOA 3LXNA 4IZ5A 4P4CA 3NNWA 1XHAA 2JIIA 4FVRA 4LOQA 1NY3A 3AC4A 2GNGA 4CT1A 2A1AB 2XEZA 3IW4A 3NYOA 3P7BA 4O2ZA 5AUZA 3MH2A 2PVLA 3F5PA 3N9XA 5G6VA 2BVAA 5GIPE 3LE6A 4J8MA 3LQ5A 3VS2A 3BCEA 2WKMA 3KXMA 5I4NA 1CDKA 3QQKA 4EH6A 3Q9WA 2WIPA 4LMUA 5CZIA 4F1TA 3NW7A 4XCUA 3SOAA 4F7NA 4TT7A 1OI9A 2HELA 5HIBA 3WF7A 5CEOA 4D58A 5EH0A 2X6EA 2FB8A 3SXFA 4JBOA 4YMJA 1OB3A 4ZS0A 3RCDA 3LPBA 4IAYA 1W84A 3KF7A 4AW5A 4L44A 5CF4A 4F0IA 2XZSA 2QONA 3EL8A 2V62A 4XH6A 4FIGA 4A4XA 2W1ZA 5J9ZA 3C51A 3ROYA 4FTLA 3CJFA 2W0JA 4RWIA 2HOGA 3NLBA 3P0MA 4GFMA 5H8EA 4DEHA 5IMXA 3TUDA 4C38A 2GS2A 2YITA 3AC3A 4K1BA 1ZYDA 1YWRA 4CYIA 3MBLA 5JKGA 3BGQA 1JSUA 5EI8A 4BDBA 3E5AA 3GXLA 4RC4A 4ACMA 1OMWA 2HENA 4X7QA 2FA2A 5KHWA 4FOCA 5HE1A 4C62A 5DLSA 4C34A 1YHVA 4AFEA 4A9UA 3R71A 4DFZE 4YJNA 2R9SA 4MD9E 2XJ2A 1J3HA 3OEZA 4J8NA 4BVUA 3N4UA 4NZWB 4FZ7A 2BHHA 1YQJA 3Q2JA 2CCIA 4M3QA 4OTQA 2XIKA 4AAAA 4AOTA 4AOIA 2Z60A 3GBZA 3QHRA 4FTJA 3DAEA 4KUJA 3GP0A 3QLFA 4GVAA 2C6KA 3R04A 3NCZA 4II5A 3SC1A 1SMHA 4NW6A 2OF4A 3KMMA 1WVWA 5C01A 2H6DA 4ASZA 1W82A 5E8UA 5AR7A 5HBEA 4NU1A 4AX8A 1HOWA 2WQNA 3RVGA 1MQBA 3HAMA 4H3PA 1YW2A 2XKDA 4RFZA 4V01A 5EHOA 3DBQA 1E1XA 3LW0A 3SLSA 4CKIA 2YDKA 4NJ3A 2YAAA 2SRCA 2VWXA 4CVAA 3R9DA 1PXJA 3W2QA 5ETIA 5L8JA 5CVHA 3CP9A 2GMXA 2XNNA 5A6NA 5I3RA 3D14A 2PE2A 4AA4A 3ZEWA 5IQAA 4YZBA 3GT8A 3RK7A 2I0EA 3RP9A 3COMA 2VTTA 4O1OA 4JQ7A 2YZLA 3H4JA 4DFNA 3BRBA 3I60A 4LRKA 5CSWA 2JEDA 5LMKA 3TNQB 5DT3A 5I5ZA 2BDFA 4FSRA 4KBKA 2G1TA 2CPKE 4GIIA 2UZWE 3SX9A 5A46A 4N70A 5A9UA 3PWYA 3VC4A 1J91A 1OKWA 4IAFA 5AUWA 4FX3A 4B7TA 3VAPA 4A9TA 3U9NA 4DGGA 1CKJA 2F2CB 4RX7A 3VW8A 3HRFA 2JBOA 2PZRA 5EHLA 3RWPA 4B8MA 4OTFA 4YR8A 5HNGA 5IUGA 4D0XA 3NNUA 5HIEA 4V05A 4IC8A 4HCUA 4O2PA 2O64A 5A3XA 3WF9A 4E6AA 2C0OA 4NCTA 5HX8A 4OTRA 1PXNA 3ZXTA 1V0BA 4FSYA 3WYYA 5C8MA 3BHVA 4MNEB 3F3VA 2NRYA 5JEBA 1JQHA 4ZK5A 4F7SA 3E63A 4FTTA 2RSVA 3NR9A 4XOZA 2B54A 3Q9XA 5J1WA 4U9AA 1ZOEA 2UV2A 2R3OA 5DT0A 3UNKA 1WBWA 5C4KA 2ZDTA 1PYXA 2NRUA 4I0SA 4KKGA 4BBFA 3V5JA 1OUKA 3UQCA 5AX3A 2X39A 3HRCA 3B8QA 5EW8A 1ZARA 4Y95A 3MVMA 3C5IA 4QP1A 4EJ7A 2G2HA 4D28A 1OZ1A 4TYGA 2IJMA 2IW8A 4ZY6A 4BGQA 5IH4A 4BI2A 2YIQA 4WNPA 3A7IA 3CJGA 4M84A 4EOPA 4GU9A 3D4QA 4BFMA 3IG7A 2AC3A 4A9YA 2VGOA 3OW3A 3V8TA 3F3ZA 2QVSE 3LM0A 3PJ3A 2QLQA 4GMYA 4YO6A 3AOXA 4YURA 2REIA 2HWOA 2NP8A 3A60A 5F1ZA 3UVQA 2P4IA 2J0MB 1YXXA 3P79A 4KSPA 4O0XA 5AAEA 3VF8A 5GIOE 3C1XA 1PYEA 4LGGA 3OF0A 5HIDA 3ORIA 3PPJA 5A4LA 4RVKA 5HO6A 3ROCA 4AACA 4KKHA 2PWLA 3QC4A 4OTGA 3NYNA 4BF2A 4RWLA 5D7VA 2WHBA 1OVEA 3V3VA 5BUIA 3JY9A 5HD4A 3DFAA 3O7LB 5HZNA 5IU2A 2PUIA 2QO9A 3KGAA 5BVKA 2YEXA 4O7RA 3EFJA 3GCQA 3MPAA 1DS5A 3QALE 1CM8A 2OIQA 1UWJA 3ZHPC 2WMBA 2X2KA 4GU6A 2QLUA 3SA0A 4EONA 4EOSA 4IWDA 1RJBA 3GB2A 2VX3A 1NA7A 3FXXA 4E5BA 5I9XA 4CGAA 3DPKA 4AOJA 4F99A 4Z55A 2QKRA 1YOLA 3R8LA 4A9SA 3KCKA 1IR3A 4ACGA 3IO7A 4DEEA 5E9EA 4YJVA 5CLPA 4K33A 2PVFA 2PK9A 3R1YA 3QZFA 4RFMA 4RIXA 1IAJA 3Q9YA 5CF8A 4TYEA 4DFBA 2PE0A 2YWVA 3JS2A 3UP2A 4DAWA 4ZTQA 2J0KA 4UALA 5KZIA 4BGHA 3VUTA 3ZDIA 1ZYSA 2GNJA 2PUUA 3DB8A 3U87A 4DTBA 3ACJA 3ZFMA 4LV8A 4FIJA 4QQ5A 1ZOGA 2WIHA 1H28A 3EN4A 2C3LA 1YI6A 4RA5A 4M7IA 3EH9A 3VW6A 5KUPA 2EU9A 4PRJA 4YP8A 4BDCA 4PX6A 4I0TA 5FD2A 4CMOA 4F65A 3PLAE 2OZOA 5IDPA 3MH1A 3JR1A 4ZSEA 3UG1A 3FKNA 3GQIA 3NGAA 3QWJA 4MQ1A 4MKCA 3PA4A 4QNAA 3UBDA 5HORA 1ZYJA 3NDMA 4JG6A 4J97A 2WMRA 3F3UA 1OPKA 3SKCA 4IM2A 3NEWA 5A4CA 2C47A 3V6RA 5AP2A 3R01A 2AUHA 4HYHA 3R9HA 5K4JA 5CU0A 2W1DA 1UKHA 3BEAA 5L8KA 2BZJA 4S33A 3D7TB 3GCVA 1MQ4A 3RMFA 4IWQA 2HAKA 2R3LA 5CEMA 4FTQA 5AP5A 3KXGA 4D4RA 4DEIA 2V7OA 3VRZA 5BNJA 3E8EA 2E2BA 2VNYA 5HTBA 1OIYA 4UBAA 4BDAA 3ANRA 2R64A 4YSJA 4JR3A 3UOLA 4V0GB 1BI7A 4ASXA 4AZTA 4EC8A 4ZLZA 1OGUA 4FV6A 4CFFA 3FLZA 5ETCA 1F0QA 2GTNA 3KRRA 3KL8A 2R3JA 4IZYA 3FY2A 5LCJA 1V1KA 3FV8A 3G33A 4YJSA 3BELA 2VTJA 4U80A 4E73A 4FKGA 4NKSA 4G6OA 5DA3A 5EG3A 4KS8A 1G5SA 1P4OA 1BL6A 2B7AA 2VTLA 1ZLTA 4GT3A 2OJJA 3EKNA 3UIUA 4QMOA 3PTGA 1LPUA 3PG3A 5HO8A 4DH5A 2G2IA 1WBNA 5HU3A 3MB7A 1UNGA 4MNEA 4GT5A 2OG8A 3O8UA 3OWLA 4X2JA 1ND4A 4V04A 2P55A 4O22A 4O1PA 1O6YA 3FZPA 3EN9A 4NEUA 1UU9A 4BDEA 4AE6A 5AEPA 2EUFB 4D2PA 3NUYA 2RF9A 2CN8A 1JOWB 1H08A 1RQQA 3QUDA 5ANDA 4B4LA 5T68A 3LFFA 1OUYA 2XKEA 3D5XA 4XX9A 4L42A 4O38A 4EOJA 4ZLYA 4BDKA 4XMOA 3GU8A 1YDSE 4BYIA 5AM7A 3RI1A 4K77A 5IH6A 3IDPA 3Q4CA 2C5OA 4U44A 5GHVA 1KE6A 2Y4IC 4O96A 5E8TA 5D7AA 5KHXA 4YTFA 4E5AX 2Y4IB 4O0SA 1Y8YA 2UW5A 2WQEA 1PMNA 2A4LA 3O96A 4JI9A 3FMMA 4RLKA 2Q83A 3LLAA 3DKGA 4U45A 2BZKB 3AD6A 4C61A 4AZFA 5J1VA 4PQNA 3EHAA 3FHIA 3HUCA 4LFIA 3Q04A 5TO8A 4F70A 1QCFA 4BCQA 3MW1A 3PXQA 4FF8A 3QZGA 4MWIA 4JJRA 2ONLC 3TZ7A 3RCJA 3WBLA 3TZ9A 3PXZA 2CN5A 3KY2A 4G3CA 3DJ6A 4C4IA 3B2WA 3QCQA 2B9JA 3HAVA 4IVCA 2UUEA 2W4OA 3OT3A 4MNFA 2UW0A 5IH5A 2R7IA 2HXLA 3A7HA 4F09A 4AW1A 3OVVA 4PTCA 4R1YA 5ANOA 4LRMA 3FI2A 5CVFA 3FMDA 3A61A 4RMZA 4QMPA 2BZIB 2X6DA 5EI2A 3VS3A 3M42A 3ZZWA 4PTGA 2BCJA 2OH4A 3ZRMA 1FGKA 2J90A 1GIHA 3H9RA 4KKEA 3HLLA 3NSZA 3DT1A 3W2CA 4IMYA 5AP0A 2OXXA 3HZTA 2RKUA 3ZYAA 4F6SA 2QOCA 3F88A 3AGMA 3RAWA 5BUEA 4ANSA 3QD4A 4NM7A 3QAME 4ASEA 3EQIA 3M2WA 2XVDA 3DKFA 1GAGA 1Q62A 3WF8A 3AG9A 3VQHA 3JYAA 1H25A 4NIFB 3EL7A 4YTIA 2H96A 1KV1A 4P5ZA 4BDFA 4PPBA 4XP0A 4L45A 2F2UA 3PFQA 2WMAA 3MY5A 3BGZA 4XRLA 3U9CA 2XM9A 3FEGA 2Y0AA 5IA1A 4UZDA 1GZNA 3LKMA 3RPYA 3LXPA 5IQHA 3B8RA 3PE2A 3UZPA 3VS6A 3ZM4A 2GDOA 3DB6A 4FSZA 4IIRA 2J0LA 5DR6A 3T3VA 2YDIA 4UYNA 2EWAA 4GSBA 3H10A 4GL9A 3CGFA 4R7IA 4TXCA 4B99A 4O7SA 4CCBA 2XS0A 1R0PA 3A4PA 2VZ6A 3OOMA 2VNWA 2QD9A 1Q3WA 3LFDA 2BFXA 2OF2A 2XBAA 3E92A 4Y72A 3VHKA 4I5HA 4IVAA 2P2IA 4TNBA 2JITA 2H8HA 2JC6A 4GT4A 3KF4A 3D7TA 3AC1A 1YOJA 2GFCA 2C30A 3ORNA 5IKWA 4C3FA 2EXMA 5LQFA 3UQGA 2OI4X 5CNNA 2BKZA 4WHZA 4D55A 1O6LA 4EHZA 3RAIA 4A4LA 3L8PA 4S31A 4CLJA 2P0CA 4XG8A 3WIGA 2XEYA 4V0GA 4ZAUA 5GINE 5HVKA 3EFKA 3S1HA 4DBXA 4YC3A 3O17A 1JKKA 1LEZA 3C7QA 5I9YA 5JQ5A 3O7LD 3GC0A 3HMPA 1KE8A 1PJKA 4NM0A 5I9VA 2CNQA 5L8LA 2CKOA 4FT7A 3PPZA 3MJ1A 4RVMA 3W2RA 4O0RA 3C4ZA 1IG1A 4FKTA 3RM6A 2YCQA 4DEBA 3BHHA 3PY3A 4GK3A 3KC3A 2X8DA 3QQFA 4KIPA 5EYMA 5I9UA 3D2IA 4F4PA 3DK6A 2FO0A 2O63A 1GZ8A 2IW6A 3L9MA 3PE1A 4AP7A 4JX7A 1JWHA 3UOKA 5EQYA 4QTDA 4MXZA 5F20A 1FPUA 2UVXA 4E26A 1MRYA 3CQUA 3W2PA 4RIYB 5HE2A 4Y5HA 4ITHA 5M4CA 3FBVA 4YZDA 3T8OA 5HNBA 1YVJA 3E8CA 1Q8TA 1TQIA 2C68A 2FUMA 4FIEA 4R7HA 3BU6A 3HVCA 4YZCA 3R7IA 3DAJA 5FXRA 3NUXA 2W4JA 4GJ3A 1ZYCA 2RFDA 4WNOA 5FTQA 4FICA 4BWKA 1NT2A 5FRIA 5E1SA 4DEAA 2V22A 3DLZA 5M08A 4BZNA 4HYUA 3A8XA 1DI8A 1YDTE 1YWNA 4RG0A 5CSHA 3IECA 4Z3VA 2ITWA 1XBAA 2P3GX 3K54A 3KRXA 1YDRE 3OROA 4OTIA 4QP9A 3GC7A 5AP3A 4IJ9A 3BE9A 4IB3A 3MA6A 3Q32A 3V5QA 4G6NA 3BU3A 3BEGA 3UGCA 3IKAA 5HCZA 4ZSJA 4C4FA 3HMOA 1JVPP 3OTUA 5DT4A 3V5TA 3DZQA 3T9IA 1FGIA 3OEFX 3DXNA 3PXYA 4X3FC 5GJGA 3OG7A 4QP4A 4J71A 2XBJA 4X3FB 1S9JA 3NX8A 4BWXA 4IBMA 3HDNA 2ONLA 3QTIA 3R9NA 3UG2A 2VU3A 3BX5A 4F1MA 3RPRA 4KABA 4TN6A 4YTHA 4IZ7A 4RA4A 5L2IA 4CKRA 3LVPA 1VYWA 4I6QA 4RX8A 3IW5A 5FP6A 2BUJA 1Z57A 3MVLA 3QUEA 4OT5A 3U6JA 2PE1A 3FSKA 3FLWA 2JKKA 3DGKA 3QRJA 4M8TA 4EOIA 3QTQA 3OBGA 2X9FA 2GQGA 3HX4A 5L2TA 4IX5A 4QD6A 3PXFA 4DINA 3OD6X 2XM8A 4IVDA 5TE0A 4ZTMA 4ENYA 3MPMA 5AV2A 3AC5A 2C5NA 4OW8A 4U41A 3A99A 5C1QB 3ZS5A 4JS8A 4FL2A 5ANJA 4BTKA 4PDYA 3R0TA 4FKVA 3NUAA 4XV2A 3OWKA 3ZM9A 3OMVA 2Z7QA 4XP3A 3H30A 4YHJA 4WSQA 3PSDA 2WO6A 4C37A 3MIYA 4YLJA 5TF9A 3R8ZA 4NIFA 2X7OA 3W8QA 3GC9A 4UWYA 1ZWSA 1HCLA 1YI3A 4USEA 2XF0A 4HCVA 3ENHA 4BI0A 3V51A 5CEKA 4L53A 4FKJA 5BUJA 4BI1A 3MA3A 4FTIA 5E8ZA 2QOBA 2X8EA 3QTZA 4A9RA 5JFWA 3TN8A 2ERZE 3V8WA 2WGJA 4QO9A 4ZY5A 2CSNA 3DCVA 1ZRZA 5FP5A 2UZUE 5J7HA 2FSLX 1FBNA 1YKRA 2CGWA 3BV3A 3FL5A 5KMLA 2HZIA 2UZNA 2JDRA 4FV3A 4G2FA 3P4KA 1JAMA 4BC6A 4ZOGA 1YXSA 1G3NA 4RC3A 2FSMX 4TY1A 5IUIA 3VN9A 5A4QA 2RGPA 5ITAA 1QMZA 3GC8A 2EXEA 1WMKA 3E3BX 3EQDA 4L01A 5D12A 3RPOA 5CXZA 4XG2A 1RE8A 5D11A 3RAKA 4D0WA 2XJ0A 3QD0A 5HKMA 4DFXE 4EQCA 4TRLA 4FK6A 1OKZA 2BFYA 1QL6A 3GEQA 5EM6A 3AGLA 3TIZA 2E9PA 5BVFA 3KEXA 5F95A 5FTGA 1PXKA 3VNTA 5JSMA 2BALA 4EBWA 4JXFA 4KIOA 2Q0NA 4MXXA 3TNHA 1J7UA 1SVEA 3LIJA 4A06A 4ANOA 4BDGA 4GFOA 2LGCA 3Q6WA 3CKWA 4EK4A 3UPZA 4FVPA 1H1WA 5AV0A 3AT3A 3G51A 3RINA 4FV0A 3NNVA 2A0CX 4IWOA 2VRXA 4J53A 4U81A 5EK7A 4I5PA 4IEBA 5DHJA 4C58A 2ZYBA 1W83A 2X0GA 2LAVA 4G5JA 2QG7A 4NTTA 2WZJA 4P2KA 4QPAA 3W1FA 3FHRA 4OBQA 3IDCA 5GJFA 3BHYA 3A2CA 1YXUA 2B9HA 5DRDA 4GVJA 3IOPA 3MESA 3QC9A 4HNIA 5CTPA 2UW3A 1IA8A 3FPMA 4IDVA 3DA6A 4CSVA 2CKPA 3LFSA 3ACKA 4RLLA 1MP8A 5GZ9A 3SV0A 4AZEA 1KSWA 2GNLA 4RPVA 5DR9A 4BIBA 3HP5A 4FKOA 5JGAA 2GHLA 1YXVA 2JIVA 3TZMA 4D4YA 4EUTA 1JNKA 2WB8A 3KN6A 3LJ2A 4N57A 3K5VA 2W05A 3NIZA 3L9NA 4QTCA 4X0MA 4RJ7A 3R8VA 4GUEA 3R30A 2OFUA 2XK7A 4O0TA 3CCNA 3KN5A 3K3JA 1PF8A 2AYPA 2C0TA 2VTOA 5CQWA 5C9CA 1RW8A 2UW6A 4D2VA 3ZO2A 4O0WA 3LCTA 3AC2A 3BYMA 5K9IA 4JQEA 2B9FA 2F7ZE 3NUNA 3C4FA 4FA2A 3E87A 2J6MA 3I0OA 4RZVA 3KRJA 3QQGA 4DFLA 4F08A 1ZY5A 5H8BA 1KUTA 5E4HA 5CALA 1B39A 3FDNA 4QNYA 3ZO3A 5CAUA 4ITJA 4MEDA 3IW7A 2WTKC 1XH7A 3OP5A 4G31A 5C27A 2IWIA 3EB0A 2WTKB 4BDJA 2XUUA 4IHPA 3OCBA 5JT2A 4YZ9A 1GZOA 1OECA 2W99B 3NNXA 4I24A 3ATSA 4X3FA 2IVSA 4NFNA 3LMHA 3ID6C 4B9DA 3I79A 5JRSA 3MI9A 3S00A 4FG7A 4MK0A 4UWCA 4FL1A 4XBUA 4DG3E 4HYIA 2PVKA 2GS6A 5K5NA 3LCOA 4ZSAA 3A7GA 3QD3A 4D5HA 4IAKA 3UVRA 2HZ4A 4FNYA 2WTCA 3GENA 2BRMA 4D4SA 4NM3A 2QKWB 2XA4A 4PP7A 4JVGA 1CKPA 4PP9A 5BYZA 2PUPA 4FGBA 3R7YA 4FV7A 2IZRA 2JFMA 1CMKE 1M14A 2VTSA 3FMLA 2ITPA 1F5QA 3WZUA 4AGUA 2X8IA 5IEXA 3MVJA 5IQBA 5KMNA 4X2FA 2XK8A 5I3OA 5M4FA 2YIWA
chains in the Genus database with same CATH superfamily
2WQMA 4RC2A 3OXTA 4R3CA 3GCUA 1VR2A 3OW4A 5E7RA 2C6IA 4ZTLA 5M51A 2CNVA 4QP7A 5IQFA 4FTMA 2JFLA 3DKCA 3NWWA 3QX4A 3CPBA 4M0YA 3NYVA 1HCKA 4U43A 3UPXA 1APME 5G1XA 2JD5A 1OBGA 4C7TA 2IVTA 3PRIA 5AUYA 4D2WA 3KXNA 4APCA 1J7IA 3UOHA 4AT5A 5IQDA 4IANA 2B55A 5DI1A 1XKKA 5JZNA 3L8VA 4KD1A 2QR8A 5BVEA 4CRLA 2BRNA 4EBVA 4Z7HA 3ZU7A 2HY0A 2UZVA 4XRJA 5FG8A 3KFAA 4IB0A 3FZTA 4DCEA 2QR7A 2PZYA 1G8SA 3ORZA 4EZ3A 3OUNB 2ERKA 3EZRA 3NRMA 3ZBFA 5A4EA 5M44A 3LXLA 5EQPA 1X8BA 2ZV7A 4QMUA 3PY0A 4D9UA 4NTSA 3I81A 4EK8A 4KS7A 3GVUA 1BX6A 4UXQA 3HMNA 4FBXA 4DYMA 5HG8A 3UDZA 4NW5A 3ATTA 3UMWA 3FYJX 3JY0A 3QF9A 3UDTA 4FSNA 3UTOA 4H05A 4MF1A 4OGRA 3AQVA 3DXQA 3NFFB 5M4UA 1JKTA 2R3RA 3JVSA 1ZZLA 3BYSA 1REKA 1FMKA 3I4BA 2BTSA 2HW6A 1W0XC 3TIYA 4E8AA 2I6LA 3EQBA 5FLFA 3FI8A 2PZ5A 3GU4A 4PPCA 1U5QA 4FR4A 2BHEA 4WUNA 4OTHA 5B0XA 1ST4A 2DQ7X 3BBTB 2UW8A 3KK9A 3P78A 4QP8A 4U97A 2X81A 3UODA 3WZJA 3FKOA 1PKDA 1W2DA 4XV3A 3ODYX 5IG1A 2F7EE 5AMNA 4EQMA 3P5JC 3DU8A 3FSFA 3LFBA 4G17A 4H36A 2VN9A 4S30A 5IQEA 3BLAA 5J5SA 4EH4A 3QTUA 4FG8A 5KCVA 3PJCA 4KRCA 4LDTA 3GFEA 5HBJA 5HGIA 3SDJA 3SD0A 1WAKA 2PZIA 4ERWA 5HCYA 2OK1A 4P5QA 4B8LA 1XH4A 5TOZA 2C4GA 3A4OX 3KMUA 4YO4A 4O7TA 4U42A 1MRVA 2A98A 1OL2A 3DJ7A 4UN0C 4FJVA 2V0DA 3C0IA 5DWRA 4I1ZA 4PL4A 1WBVA 5ANGA 2Z7RA 1OIQA 5CANA 4KIKB 4L52A 4DDIA 4GIHA 2WMQA 5EYCA 2W9FB 4K6ZA 3CEKA 1H0VA 3VUIA 2OFVA 1FMOE 3KMWA 2X0QA 5L6OA 2ZM1A 4IX3A 1KWPA 4FNWA 3S3IA 3VBYA 2Y8OA 4B6LA 4H39A 1EH4A 4ANNA 1JPAA 4AWIA 3KU2A 4ANBA 2JKMA 2WTVA 4AW2A 3QTWA 1ZMWA 3FUPA 4Z9LA 3FC1X 2XMYA 4FNXA 3W32A 4L7SA 1PMVA 4CD0A 4F7JA 3LCKA 5FM3A 1L8TA 3FMHA 5DRBA 5JGBA 3MY1A 1M7QA 3KVXA 5EFQA 4CYJA 4KA3A 1OL5A 3HA8A 3QWKA 1H8FA 4PY1A 5FEEA 3H3CA 4CQEA 2RG5A 4ALUA 5DE2A 3TDVA 2RG6A 3ANQA 5AP1A 3VUKA 2HYYA 2QI8A 3TUBA 5CT7A 4EWHA 4LL5A 4JOAA 2R3HA 4XYFA 4NUSA 3ZFXA 3G5DA 3ZMMA 1UV5A 1OKYA 2BAJA 4FV4A 3Q9ZA 3VIDA 2J9MA 5GZ8A 4FTNA 2ITOA 3TCPA 2HXQA 3MH0A 2IEWA 4AN3A 5DNRA 2CDZA 3NUPA 4C0TA 2OJGA 3SHEA 5HNIX 1PHKA 4ORKA 4RX9A 3CTJA 3DQXA 4W4WA 1OL1A 4TL0A 4AAYA 2QNJA 4ZMFA 4LYNA 1U59A 4R3RA 1Y6AA 4ZLOA 3DQWA 3EQRA 4W4YA 2JBPA 2C3IB 1FVRA 2R3GA 2XNOA 3LZBA 5L2SA 3ITZA 4UYAA 2GNHA 4GK4A 3FC2A 3N4TA 2WEIA 4ANLA 2GU8A 2GNIA 4PDOA 4AN2A 1ZMVA 1GJOA 4QMMA 1SYKA 3RZFA 1O9UA 4K0YA 4MBLA 3F66A 4OTPA 4BBEA 3PSCA 2R3KA 4TW9A 3U55A 4RFYA 5HLWA 4EH5A 3U6IA 3PYYA 3R7OA 3K2LA 4O4DA 1H4LA 2GHMA 3LLTA 3DK7A 3KULB 4WG5A 3SW7A 4BR3A 3QKMA 3ZLYA 3BE2A 4N6YA 1OPJA 2UZTA 2HCKA 2WPAA 3DV3A 4YTCA 2XAOA 1SM2A 5AX9A 2OW3A 2W17A 3DZOA 3IONA 3NCGA 4S34A 2WTJA 3F61A 4EORA 2F7XE 3GOPA 4TZRA 4DFYA 2YACA 2PSQA 2YIYA 3MFTA 5CSPA 5EYDA 2QOOA 2VTNA 5BQ0A 2CKEA 3ERKA 5LVOA 4TNDA 2BDWA 5ANEA 4FTRA 4FV2A 5B7VA 3FLNC 5JFSA 4CCUA 2OWBA 1U46A 4BN1A 4AGWA 4BGGA 3WZKA 3RKBA 4F64A 1PXIA 2OJIA 2E9OA 4AXCA 4XG6A 4EOMA 4QYFA 3UDBA 2GCDA 2B1PA 4BCNA 2XP2A 3FZOA 4WRSA 4O4BB 3W0NA 2J0IA 5A54A 5FDPA 3ZFYA 4DGLC 4EL9A 4MD7E 2VWYA 5GZAA 4C4JA 4OLIA 4RJ3A 3IDBA 4KINA 1NXKA 3R2BA 3SAYA 3TWJA 5BVWA 4TPTA 5LARA 2QO7A 3AD4A 4ACCA 5CU4A 3PJ8A 5CAQA 2CGXA 3TEIA 2I40A 2VWWA 4L43A 4EI4A 5HBHA 4E6DA 3QTRA 3P1AA 3KVWA 5HVYA 4G3FA 4P7EA 3CGOA 4R77A 3OC1A 4O4FA 2PTKA 4RVTA 5HEZA 3VS5A 3P08A 5AUUA 4TYJA 5GJDA 2KTYA 4MXYA 4KRDA 4MX9A 4QMWA 4L68A 3TACA 2XK6A 2BILB 4KIKA 3QKKA 4I5CA 4JG7A 4TWPA 4EHEA 2IVUA 2WU7A 4PWNA 4AZWA 4CFWA 3WIKA 2OXDA 3K3IA 4XP2A 2OSCA 3OHTA 4WT6A 4YNEA 3DK3A 5E8XA 3R7EA 3RK5A 5FWKK 1QPJA 1LEWA 3PY1A 5EDPA 2PULA 4ZTRA 1ZXEA 2PMLX 4IACA 3QQJA 3Q5IA 4N0SA 4DTAA 4IAZA 4FODA 4YHFA 1U4DA 1BLXA 3JUHA 3DLSA 4RGJA 4UB7A 4K2RA 3ZRKA 1YWVA 4M13A 3PDTA 2R0UA 4R6VA 3LFNA 4OBPA 3HEGA 3QQUA 2V5QA 1YI4A 5L3AA 2YM6A 2HWPA 3MYGA 4M69B 1OM1A 4HVDA 3TNWA 4BTJA 5AWMA 3R8PA 3ET7A 3OS3A 5E8WA 3ZLWA 4Y83A 2PVMA 4BKJA 2O3PA 1T46A 2C6TA 2YABA 4AT4A 5IZFA 4NWMA 4IW0A 4U3ZA 4HVGA 4QMSA 5BYYA 1UVRA 1WBTA 2WTDA 4KB8A 3BQRA 3C4EA 2XB7A 5DPVA 2VUWA 4E6QA 3HDMA 5KZ0A 1Y57A 2PVYA 4IWPA 1WZYA 2QOKA 3NPCA 4QMXA 5HICA 2NNWB 1Q8YA 3TT0A 2CLQA 5AUVA 3IGOA 5M55A 5EOBA 3ZEPA 1PXLA 1WBOA 1ATPE 2YCSA 3F69A 3PIYA 4FUYA 4MYGA 5EW3A 4BRXA 2I7QA 2IPXA 4GKHA 2IG7A 1Q3DA 4MD8E 4NFMA 5DOSA 3D9VA 3E8DA 4C2VA 3FMKA 4ZZMA 4AQCA 5J8IA 3CBLA 1KOBA 5A14A 3I5ZA 3F2RA 3H0YA 3FJQE 3FZRA 5AA8A 2ZV2A 2CMWA 5B2LA 4PF4A 4JAJA 3C0HA 4I5MA 5LWNA 4U5JA 2PZPA 3PVGA 5FTOA 5J9YA 5IUHA 3R9OA 2CGVA 3RK9A 4X2NA 4UMUA 2R3IA 3ZXZA 4OAUC 4FEWA 4RVLA 3ZCLA 4BICA 3C0GA 4O91A 2BIKB 4TYIA 4PV0A 2W06A 1UKIA 3DKOA 4CTBA 4FSTA 3EZVA 5KKRC 2VGPA 4OTDA 1K9AA 4C36A 2C5XA 4F0FA 3TKHA 5KKRB 4IADA 4XJ0A 3LQ8A 5CAVA 4B0GA 3R21A 2UW7A 2VTPA 2WMWA 3FXZA 4CFVA 2VWUA 3QYWA 3RTPA 1I09A 5DEYA 1W98A 4FC0A 2GQRA 3WILA 2OJ9A 4C35A 4UMQA 5FXQA 1OITA 4PMSA 4YU2A 4ERKA 5I9WA 4H58A 3KULA 5DIAA 4FVQA 4F6WA 3IW8A 4RWKA 2BZHB 4LOOA 5CU6A 4IXPA 3VBQA 4BY9E 2YLFA 2DWBA 2R3FA 4O0UA 5BVOA 3POOA 1QPDA 4FEQA 4CRSA 3QU0A 4JLCA 2QOIA 2WQOA 3QCXA 4IAIA 4GK2A 4QPSA 3NUSA 5IA4A 2F57A 2V7AA 4YJUA 3QCYA 3QRKA 4C8BA 1DAWA 4TKSA 3TUCA 4EH7A 2XIXA 5CYIA 4I4FA 4E4XA 4O7NA 5BV3A 2UVYA 4PDPA 2ITZA 3FZSA 3O50A 3QD2B 3HECA 3D94A 3JXWA 1TQPA 4FYOA 4L7FA 4K8AA 4AXEA 3W0SA 1YHWA 3PA3A 4W8EA 4O86A 3BBWA 3CQWA 5H3QA 1XQZA 3ZUTA 4DH7A 5KNJA 4Y46A 1B6CB 4MXAA 4F63A 5EM7A 4ZP5A 4NH1A 2UW9A 2WMTA 3ORLA 3R7VA 4FKRA 4D2TA 1R3CA 4FL3A 4YLLA 1LUFA 2YA9A 3E62A 4M14A 3S2PA 4DTKA 3CSVA 2YWPA 4EEVA 5CEIA 4FTKA 4J1RA 3LQ3A 2I0HA 4IE9A 5AR8A 4MF0A 4OBOA 4FZFB 3ZONA 2Y9QA 3P5KA 4H1MA 1Y91A 4D1SA 2ZJWA 4IH8A 4RIOA 3PZHA 2BRBA 4I6FA 5TKDA 2JKOA 3R8MA 3RM7A 4IM3A 4DBNA 4FYNA 3NVMB 4CT2A 4RT7A 1UU3A 1M17A 1P5EA 3ORPA 5J5TA 1NW1A 5E92A 2WNTA 2AEGA 3C9WA 4QQCA 3II5A 5E8SA 5H9BA 4AZSA 4PNKA 1YOMA 4OTWA 1URWA 2R3QA 3DBDA 4QQJA 2XRWA 5JK3A 2VO0A 3C4XA 1URCA 4WRGA 4BCPA 3R28A 4JDIA 5TT7A 3ZSHA 2C3JA 4AU8A 2EB3A 4Q9SA 2JDSA 4XS2A 1Q4LA 3GU5A 4MTAA 2FYSA 2J5FA 4CLIA 4YLKA 4MCVA 3MDYA 2YERA 3DBFA 3QGWA 2WEVA 2Y6OA 3MGYA 3W2OA 1OL7A 1H1SA 1XWSA 2XK9A 4ARKA 3CR0A 1KE5A 1Q8ZA 2WTIA 4JBQA 3PA5A 4KWPA 3COHA 3F7ZA 1M2PA 2PHKA 3HV3A 2W7XA 3EN6A 4WUAA 3D5UA 3SGCA 3V8SA 4ACDA 2BDJA 3TYKA 2C1AA 5JQ8A 4I94A 5KE0A 1FINA 2C5VA 4O0YA 3EQFA 3EQHA 3MPTA 3HGKA 3UJGA 4LI5A 4QQTA 2B0QA 4M69A 2QO2A 3JVRA 3RNIA 3KCFA 3TV4A 2C69A 4BCIA 3ZTXA 3DTCA 4FSUA 5CASA 4FV5A 2QOLA 3C4CA 3O5AA 4GRBA 3SRVB 4I22A 3RJCA 3HUBA 3GFWA 5CSVA 2OICA 2QOHA 3G90X 2ZV8A 4BBMA 5BMMA 2YJSA 4FSWA 1WCCA 3O23A 3VS7A 5M53A 3OT8A 4KIQA 1H27A 3ULIA 3KK8A 4ZTSA 4I20A 4X6RA 3UZRA 2C0IA 3EN5A 4WBBB 5K0XA 4Q2AA 3DDQA 4QP6A 5I9ZA 4QT1A 1E9HA 2ACXA 4J95A 5CVGA 4JDKA 3RHKA 1P14A 5IEYA 3AMAA 3PSBA 4QYEA 3AT4A 3ZC6A 1P4FA 3BIZA 3GCPA 4O7YA 3UYTA 1Q8WA 1BI8A 4Q9ZA 5DEWA 3CD8A 3VULA 3EN7A 4W8DA 1IAHA 3PVUA 5HG9A 4FV1A 4USDA 2FSTX 3Q6UA 3FAAA 2PY3A 4WNMA 4ANMA 3KREA 2OIDA 4U6RA 4BDHA 4EOKA 4ZZNA 1PMEA 2O2UA 4TWCA 1KE7A 5M06A 3F3TA 3TL8A 3C4WA 3LCDA 4ONAA 4RIWB 3CPCA 3AC8A 3GNIB 4LG4A 5CS6A 2XARA 3LCSA 4L00A 2WD1A 4EKKA 3DY7A 4OT6A 2X0PA 3HNGA 3QKLA 3U51A 1TKIA 4HZSA 5EYKA 2XKFA 5EI6A 2EVAA 5L4QA 4E4NA 2R3PA 4YZMA 5IQGA 2R7BA 3F5GA 4KNBA 1WBPA 4CFMA 3KKVA 3Q60A 5F4NA 1ZY4A 5IPJA 3W33A 3G0EA 4ENXA 4UXLA 2AC5A 2VD5A 5CZHA 5HE3A 4EH8A 2YM7A 4BCJA 1Z9XA 2OLCA 4BCGA 4UMRA 2PVHA 4IQ6A 3OY3A 1GOLA 2XJ1A 4R5YA 5CEPA 1U5RA 4BZOA 3R1NA 5HU9A 4U0IA 3W10A 1H01A 3OUKA 2DUVA 2WMSA 5JH6A 5KO1A 2R3NA 3GUBA 3NIEA 3E3PA 3P7CA 2ZB1A 4UV0A 4XNEA 4ZEGA 4D2SA 1GIJA 3F2NA 3HV7A 5AR2A 5C8NA 2IN6A 3JPVA 2IF8A 2VV9A 2XCHA 4IFGA 4WSYA 3D5WA 2BROA 1I44A 5EM5A 4A4OA 1TFFA 3P23A 2O8YA 3B2TA 4LGDA 4ZSGA 3LXKA 4YPDA 1BKXA 4JIKA 3QTXA 3ZBXA 5FEQA 3A8WA 4RQKA 4BCHA 1PXPA 5ICPA 5HE0A 4JDHA 5EQEA 4CKJA 4UMTA 1JLUE 4WD5A 4QDVA 3O8TA 2OGVA 3BU5A 4HW7A 3POZA 4GEOA 4KSQA 4RIYA 1GNGA 2WMXA 1SZMA 3O71A 2PUNA 5AP6A 4XLIA 1M7NA 3R2YA 4OAVB 3H9OA 5B2MA 5JRQA 4G34A 3UO4A 3DTWA 3EJ1A 4CZUA 3I0QA 3DNEA 3HRBA 3I6UA 4KBAA 5H8GA 3K5UA 4GCJA 5EOLA 5DYJA 2O0UA 5KMIA 3ORTA 2J5EA 4E6CA 3UOJA 2BAQA 3A7JA 4I4EA 4EZ5A 3OXIA 4ZZOA 3FLQA 1W8CA 4DEGA 1LR4A 2IZTA 3EFWA 4RJ5A 5H2UA 4I3ZA 3OTVA 4LMNA 5K0KA 5IDNA 4OUCA 2DS1A 4FIHA 4G9CA 1R1WA 3R63A 3RPSA 5D9HA 3THBA 1K2PA 4DGOA 3QXPA 5A6OA 3FLSA 4W4VA 2VTRA 3PUFC 3PP1A 2R0IA 3R6XA 4G9RA 4Y85A 5FBOA 3HMMA 3F3WA 4PMTA 3DNDA 4Q5HA 4GYGA 3LMIA 1STCE 4HYSA 4WA9A 3V5WA 4H3BA 2J0JA 4LGHA 2X4FA 5JZJA 1KOAA 4BWPA 3VUDA 4FEUA 5EW9A 3F7WA 4MQ2A 2WELA 4Y8DA 5HHWA 5C03A 1F3MC 2X9EA 4EH2A 4O0VA 3R22A 1VYZA 3SRVA 3IQ7A 3BHTA 2OH0E 5AR3A 4W4XA 3RALA 1Z5MA 4ZSLA 1H07A 3CQEA 4FKQA 3TV7A 3WOWA 4M68A 4D1ZA 4CFUA 1RDQE 2OO8X 5L2QA 3U4UA 5L2WA 4L3JA 3VBXA 4FSMA 4YHTA 4F9BA 2NO3A 5AM6A 5AADA 4DHJA 3CE3A 3I7CA 4U7ZA 5FGKA 2ITVA 4LQMA 4GKIA 1NVRA 2IZSA 2Z02A 4XEYA 1NVSA 3FY0A 3SXRA 1XR1A 2Z8CA 2QC6A 2YJRA 2W1CA 3PJ2A 4XLVA 3W0QA 2QG5A 3VRYA 4O7VA 4XHKB 3ZUVA 1AQ1A 3CS9A 2WOUA 3OOGA 3VJNA 1Q97A 3U4WA 2ZFYA 4JIAA 4YNOA 5AR4A 3VJOA 3FYKX 5AV3A 2X2LA 3CTQA 4RWJA 5DMZA 4FE2A 1H1RA 4FT9A 4IFCA 4MXOA 2X0OA 5CF6A 4UX9A 5FBNC 3F2AA 5LCKA 3SXSA 3O2MA 3FQHA 2A27A 4EOLA 4S32A 4F1OA 2VTMA 3IPHA 4YBKA 4GH2A 4AF3A 1REJA 4BDIA 4ZMEA 4M67A 4R5SA 4N4SA 5LVMA 3C13A 4RIXB 3PVBA 4RIWA 5AAGA 4BIEA 3TDWA 5CY3A 1OIRA 3TV6A 1UNHA 3FI4A 3RHXA 2W1GA 1R78A 1SVHA 4JBVA 5LVNA 2HIWA 3R02A 4FSQA 3FQEA 2GHGA 3VWAA 3WF6A 3PXKA 1CTPE 4FTCA 3VBWA 3PG1A 1ZAOA 3ZDUA 2YHVA 4AT3A 4TYHB 4IAAA 2JKQA 2VWVA 1BYGA 3C50A 4C02A 2QU6A 4X6QC 3I5NA 3BLRA 4FIFA 4RX5A 3EYHA 3UMXA 4NYEA 5CQUA 4CZYB 2IVVA 4I6BA 3R00A 2JGZA 3QTSA 3UQFA 2B4SB 3R1QA 2GNFA 3QA8A 4DH3A 1ZYLA 3BPRA 3CLYA 3LJ1A 3EKKA 3MSSA 3A62A 3N51A 4FMQA 3MTFA 4IC7A 4BCKA 3I1AA 4C2WA 3FPQA 5FQDC 4UEUA 3Q5ZA 4HOKA 3IW6A 4Z7GA 1H00A 1PXOA 2RL5A 5HESA 4D9TA 3AMBA 4N6ZA 5M07A 3QYZA 2C6EA 3CD3A 3RZBA 4S2ZA 4EHVA 4AFJA 1OIUA 3EYGA 3OCGA 2ZDUA 3BL7A 3QRIA 3VQUA 2Y6MA 4XG9A 3VHEA 4UMPA 2JDOA 2XYUA 1W7HA 2WXVA 5F94A 3QRTA 1XO2B 3E7VA 4EH3A 3N4VA 1GY3A 3WARA 4DFUA 2BRGA 3VS4A 2FH9A 4ANQA 5M4IA 4E1ZA 2XCKA 1MRUA 2G9XA 2FVDA 4WOVA 4PL5A 2ITTA 4AGDA 4JBPA 4QMVA 1XBBA 2Z7LA 1OPLA 2IW9A 4FEVA 3F5XA 3EQPA 2EB2A 5DBXA 3H0ZA 1UWHA 2XKCA 4QMZA 3UZTA 4O27B 4C57A 3COKA 3NS9A 1Q5KA 3G0FA 4NM5A 4W9WA 3UC4A 3HP2A 4LM5A 2GSFA 2G2FA 4PNIA 4BZDA 4QMQA 4HCTA 2YAKA 3ZUUA 3OWJA 5E90A 2C5YA 3KXXA 3BHUA 2B9IA 3L9LA 4J99A 4JRNA 1XH5A 3TKUA 4PMPA 2JLDA 2JIUA 4L46A 3HMIA 4W9XA 3G9LX 1CSNA 4F6UA 4GV1A 2UZDA 3LOKA 4G6LA 4J98A 2ITUA 4TTHB 2YZAA 3LAUA 5LVLA 3WE8A 3FMNA 4WBOA 3O0GA 1SNXA 5ETAA 2A19B 1DAYA 3SQQA 1JSVA 3SW4A 2JDVA 2X2MA 4GFGA 3E88A 3TG1A 2BKKA 1S9IA 3OCTA 4GW8A 4WNKA 1BMKA 3MH3A 3DBEA 4JAIA 3S4QA 1CKIA 2XYNA 4WKQA 4FT3A 3UC3A 3DAKA 3FMEA 2UZLA 3F6XA 4RSSA 3F82A 3PFYA 2QURA 4G3EA 2Z2WA 4IJPA 4R3PA 3NZ0A 2XIYA 3ORKA 1XH8A 5DVRA 5KMOA 3VO3A 2BTRA 5EDQA 2F49A 3QX2A 4U40A 4QP3A 2ITXA 4DC2A 3BWFA 4FTUA 4ZJIA 3ELJA 4I93A 3EFLA 4KAOA 3G2FA 3L8XA 2JAVA 3T9TA 4YC8A 4DLJA 3BLHA 4O81A 5JFXA 4O21A 5KMKA 3CKXA 5HI2A 4YGAA 3IGGA 3ALNA 5DFPA 4EOOA 5D1JA 4QDEA 3QUPA 5AA9A 4IX4A 1ZZ2A 1TVOA 3PWDA 1V0PA 4RJ6A 4D4VA 3OBJA 4EWQA 1UU7A 3CIKA 4J7BA 3QXOA 4LUDA 4MWHA 4QRCA 2CCHA 2OU7A 2P2HA 4O7WA 4DH1A 1PW2A 2WMVA 1H26A 4FOBA 2ZB0A 1ERKA 3EMGA 3UYSA 3ALOA 3UNZA 3C5UA 3G15A 4O83A 5IQIA 4C3PA 2UZOA 2W1IA 5CAPA 1M2RA 3QFVA 3ZZEA 3ORMA 4Z16A 4WG3A 4YPSA 4QMLA 5AP4A 4AGCA 5CI7A 1H24A 4QTEA 4R1VA 4FTOA 3QLGA 4DF3A 2CKQA 4ITIA 5J79A 4FZ6A 5HD7A 5HLPA 1Q41A 5K3YA 4UZHA 3UIMA 4ZY4A 3FL4A 4C3RA 3MIAA 1U54B 1WVYA 1V0OA 3CY3A 2UZEA 2ZAZA 3A7FA 2PPQA 2XK4A 3OXZA 4G3DA 3LJ0A 4EHGA 5M57A 3PZEA 4YSMA 3UVPA 2F9GA 4BJJB 3WI6A 5LOHA 5LMAA 3PXRA 2QOQA 4I0RA 1XH9A 3V5PA 3W0PA 1OBDA 4CG8A 1XH6A 4PL3A 4TYHA 5CWZA 4AXAA 3UE4A 4K11A 4FT5A 4NK9A 3UIBA 3ZSIA 5HO7A 1IEPA 4BB4A 4IB5A 2W1EA 2XIZA 1JKSA 2CNUA 4HVIA 3GOKA 1O6KA 4MBIA 5DN3A 3VF9A 3BWJA 2VO3A 2PMOX 1Q99A 2EXCX 2W1FA 3WZDA 1XMLA 5ANKA 1UA2A 3MS9A 4CMUA 5B2KA 3ZH8A 4NL0A 1VJYA 3VS1A 4ZTHA 3WZEA 1ZOHA 1FOTA 4PMMA 3KIOC 3O51A 5AV4A 4XV9A 3M11A 1M52A 4HPTE 1J1CA 3R7GA 3QQHA 2BAKA 4K9YA 2VWIA 2YIRA 3NUUA 5A4TA 4IX6A 2ZM3A 3KXHA 2UW4A 3PP0A 4UWBA 4ZJVA 5JGDA 1WFCA 2I0YA 3QHWA 3QRUA 4FKPA 4UY9A 5ACKA 3V6SA 5C8KA 5AAFA 4LRJA 1NVQA 3GI3A 2VAGA 3E93A 2C3KA 4JG8A 3CTHA 4M15A 3V01A 1MUOA 2C6OA 1XJDA 2PL0A 3PIZA 3Q4UA 3BZ3A 1H1QA 2R5TA 2ZMCA 2X7FA 5FXSA 4I6HA 2PVNA 4YBJA 4BKZA 4CXAA 2ETKA 5FDXA 3SG9A 3QZIA 4FEXA 4G5PA 4GJ2A 4BCFA 3FWQA 5J87A 4EK5A 2F4JA 3E7OA 1H1PA 4Y5QA 4FUXA 4XBRA 2H34A 3MJ2A 3RPVA 2C6DA 3BGPA 4FKIA 4AA0A 2BR1A 3BV2A 1A06A 4C33A 2WTWA 3V04A 4CMTA 4EOQA 5CU2A 4E93A 2YCFA 2J7TA 1Q8UA 4BTMA 3UIXA 4XUFA 4DITA 3ODZX 2O5KA 4Q5EA 2ZV9A 4RJ4A 5AJQA 4JDJA 2Z7SA 3BI6A 4E20A 3AKLA 2X1NA 5KMMA 5ANIA 1JKLA 2XNMA 4A07A 3MFSA 4AQKA 2VTQA 4I21A 3GU6A 4ID7A 3CY2A 5HQ0A 5AIRA 3PJ1A 2OZAB 3SG8A 4CV8A 2Q0BA 4CQGA 1SNUA 3WF5A 3KA0A 1ZMUA 3Q53A 2HZ0A 2ETMA 5HCXA 4C4EA 4AW0A 3EQCA 5KBRA 4O7LA 2W4KA 3WE4A 3E8NA 4DG2E 1Q24A 4BDDA 3NYXA 5AV1A 2YIXA 4C59A 4ZXTA 1JSTA 2B52A 2KULA 2QOFA 1BUHA 2ZOQA 3RWQA 3MTLA 3HV5A 4LUEA 3W55A 4DT9A 3BLQA 2YM3A 3D15A 4E3CA 3FLYA 3TJDA 2PVJA 3QZHA 4QTAA 4XG4A 1VEBA 5EHYA 5KBQA 5M56A 4FKSA 2RFNA 4FG9A 4O84A 2C1BA 1FVVA 2XNEA 1M2QA 4C4HA 2XIRA 5CSXA 4PTEA 4R7BA 3SOCA 4YJTA 3HYHA 4QYHA 4J96A 4A7CA 4JMQA 2YCRA 5L6WL 3IK3A 4H3QA 2XH5A 3H9FA 3I7BA 3KQ7A 4WIHA 2ITNA 4HPUE 4QYYA 4CTCA 3PPKA 3IS5A 4EJNA 2H9VA 3ZC5A 1PXMA 4L3PA 5EM8A 4TWOA 4JX3A 3HL7A 4YJOA 3OY1A 5HVJA 3P86A 3M1SA 3ZLXA 4EK3A 3ETAA 4LOPA 3LM5A 4RQVA 2W5BA 5J7BA 4AXFA 2BIYA 4FKLA 2CHLA 5FM2A 2Y4PA 2V55A 2XNGA 3EWHA 5E91A 2J4ZA 4HJOA 1UU8A 5KMJA 1A48A 4J52A 3QCSA 4JQ8A 3ORXA 5FUTA 2YM8A 2BRHA 4DG0E 5I0BA 4YZNA 2NPQA 5DH3A 3CC6A 3MV5A 5CXHA 3TKIA 1FQ1B 2VTIA 3PUPA 3REPA 4AS0A 1DI9A 4QMNA 3QL8A 4RZWA 3U8WA 4DGMA 4X2GA 3VVHA 4QTBA 5K5XA 1KE9A 4ZTNA 5LWMA 3SVVA 1AD5A 2GS7A 5HG5A 2JDTA 4JT3A 2XNPA 2YN8A 2RIOA 3UNJA 3RAHA 4FTAA 2G01A 1U54A 2BPMA 3FE3A 4PDSA 2QHNA