4YTIA

Discovery of vx-509 (decernotinib): a potent and selective janus kinase (jak) 3 inhibitor for the treatment of autoimmune disease
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
289
structure length
284
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of VX-509 (Decernotinib): A Potent and Selective Janus Kinase 3 Inhibitor for the Treatment of Autoimmune Diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 102
structure length 284
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ytiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ytiA01
2IJMA 2CNVA 4R5YA 2R3PA 3JYAA 3WOWA 4O7NA 3AMYA 3PP0A 1OM1A 2OXDA 2GDOA 3RPVA 3UC3A 4DH1A 4I0RA 4Q5HA 5ETCA 4E6QA 2VWIA 4I21A 2VTOA 2A4LA 5ICPA 2GFCA 3F5UA 3OC1A 3BCEA 3TTJA 3A8WA 4I92A 4QPSA 4R1VA 3ZEPA 4QP4A 3GOKA 4IZ5A 3W2CA 3AQVA 2FSMX 5CVGA 4RIWB 2J4ZA 3FAAA 2FSLX 4OTHA 4RA5A 3ZFYA 4IVCA 3N4UA 3QC9A 4QYFA 4XV9A 3FI8A 3NNUA 3FMEA 4MK0A 4U0IA 3Q9XA 3DT1A 4USDA 1GIIA 5FEDA 5IA2A 4TNBA 4FGBA 4RJ5A 5A9UA 4CLIA 4M0YA 4N6YA 2VTIA 3U6IA 2C5NA 3KULA 3BGQA 4EUTA 4J8MA 3R00A 3AD6A 3CLYA 2F7XE 3MESA 5JMSA 3COKA 2JKOA 4LL0A 3UIXA 4DLIA 4YTCA 4D2PA 1R0PA 4DHFA 3PA3A 5T3QA 4HZSA 4IEBA 5L2QA 2BKKA 3Q53A 2JKQA 3HAMA 1ZYJA 4LM5A 1XO2B 2R3IA 3BLQA 4D4VA 4YJRA 1W83A 4APPA 4F08A 3E62A 2WU7A 3H3CA 4NUSA 4QP8A 4E5WA 2I0HA 4RG0A 3DKCA 3HV4A 4O1OA 4E4LA 4E20A 4ASXA 2OH4A 4J97A 1GIJA 4R7BA 2GCDA 4FKSA 5A4LA 3EN6A 4V05A 2Q83A 3W8LA 4O7WA 4MBIA 1PHKA 4CFFA 4NSTA 1SM2A 1JKSA 2PVNA 3C0IA 4FI1A 5A46A 3HRBA 2JIIA 4RIXB 3LCDA 4K6ZA 3VQHA 2ETRA 4IX6A 4EH9A 1YHWA 4YSJA 3MTFA 3OBJA 3QWJA 1Q8YA 4M8TA 3ZFXA 4G5PA 4K2RA 1OVEA 2ZM4A 5A3XA 2R3RA 4E6CA 3LFAA 4TYJA 3WBLA 3QUPA 3LKMA 4NH1A 1JKTA 2ZDUA 5AP6A 4S33A 3OWPA 1PKDA 2OGVA 4N4SA 5E8YA 3RWQA 4WOVA 1Q8ZA 4FV0A 3RCDA 2YM5A 4W8EA 4M97A 3UVQA 4MXAA 3PXYA 4I0SA 3UNZA 3EHAA 2VTQA 5IMEA 4XUFA 4X7QA 3UQCA 3NAXA 4DFBA 4E26A 2B52A 4H39A 2XH5A 3CPBA 3BQCA 1JPAA 5CS6A 1J3HA 2VAGA 3OF0A 5HO8A 3P4KA 5IUHA 4YZCA 2IO6A 4PDSA 5H3QA 3SX9A 2YIYA 3U9NA 3PIYA 4KIKB 1UA2A 4ZTRA 4L3JA 4GV1A 1UNHA 3POOA 2R7IA 3OWKA 5EM6A 2OIQA 4UMQA 4V01A 5FG8A 5B2KA 4MHAA 4D2SA 2OH0E 3D5WA 4FK6A 2C5XA 4BKYA 2C0OA 5DVRA 2B9HA 4ZK5A 4FZ7A 3ZLYA 3QRIA 4IZYA 1JSTA 2WMBA 4M3QA 4U81A 3Q5ZA 4BIDA 4NM7A 1ATPE 4YHTA 5I3OA 5CZHA 1OUKA 5BUEA 1J7LA 3S4QA 2DYLA 3D2IA 2C6KA 1URWA 3OFMA 4A9SA 4CQGA 1M14A 3CR0A 5J8IA 5FEEA 4XG6A 1UV5A 2BUJA 2JFLA 4PTGA 4U42A 1OECA 4JRVA 3TNQB 3RM7A 3TNWA 3ZS5A 3RMFA 4KIKA 3NIZA 4DT8A 4KNBA 5D41A 3GCSA 4ZY4A 3E5AA 3ELJA 4APCA 5LCKA 5KKRB 3K2LA 3ORZA 3I60A 4IB0A 5M53A 1Y57A 4TTHB 5AP2A 5AV2A 1Q41A 5CXZA 3QKLA 5KHXA 3IW4A 3QCQA 4XH6A 2UW5A 2WZJA 2VGPA 4G16A 4F0GA 3PPJA 3QC4A 4U3YA 3NYVA 4IWDA 3SD0A 1GZ8A 1YOMA 5EKOA 4ZSGA 4L7SA 3IK3A 5CASA 2VNWA 1HCKA 3PJ8A 4ZTSA 5JEBA 2OJFE 2WIHA 4F7JA 5IA4A 1Y8GA 2OK1A 5L8JA 4EJNA 4ZLZA 4RZVA 4BZNA 3Q4CA 1DI9A 4PMMA 4BDHA 4EWHA 1YRPA 5HVJA 3OT3A 3G15A 2R0UA 4C3PA 5E8SA 3RHKA 1GZOA 2Y4IC 4I41A 3NNVA 3BHUA 4IFCA 5M06A 1TQIA 4DEGA 3S1HA 3KF4A 4YHJA 4KS7A 4O0VA 1BMKA 4CVAA 5HTIA 3F3VA 1RE8A 4XP0A 4DA5A 3C9WA 4FTOA 2J0MB 4G17A 1SYKA 4BBMA 3NYXA 3JUHA 3R04A 3D94A 1DI8A 2QCSA 2R3LA 3MB6A 3WIKA 4JL9A 2B54A 3SW7A 4AUAA 1PXMA 2OXXA 4GVAA 4DEBA 3QFVA 4F1OA 3QLFA 5AAGA 4EUUA 3PZEA 4P2KA 4RX5A 3D5VA 5DA3A 1KUTA 4DF3A 4IVBA 3LFDA 1Z9XA 4HYIA 3LLAA 3ANQA 4FTMA 3TUCA 2RFSA 4FEXA 3GU6A 2X7OA 3MB7A 3Q6UA 4MTAA 4LMUA 3JPVA 4XP3A 3EH9A 4P5QA 5GIPE 3KU2A 4MNEB 2H6DA 4JG6A 3OCBA 2QOLA 5GZ8A 3KMMA 5HORA 3W55A 2CKEA 1U4DA 4DE4A 4GSBA 2IVVA 3QYZA 5F1ZA 3VJNA 4CYIA 5LCJA 4O2ZA 2XK3A 1J1BA 3GQIA 3H0YA 3MH0A 4FSUA 3O23A 2VO3A 2YWPA 4I22A 2EXCX 3WYYA 2WAJA 5A4CA 3FKNA 5EYDA 3PVBA 5EK7A 3JVSA 4WD5A 4YJSA 4D0XA 1W8CA 4ZSAA 4RFZA 5E90A 4Z3VA 4G3GA 2YAKA 3NEWA 4CFWA 3FLQA 3BV2A 3ZXZA 5EQEA 2XM8A 4IVDA 1QL6A 4IHPA 5AIKA 5KE0A 3F2RA 1ZYCA 2RGPA 3BIZA 4JS8A 4D4RA 3UJGA 2IZSA 2VGOA 3KXZA 3O17A 2R3FA 1CKJA 1UKIA 1IR3A 3I0OA 2QU5A 4EHGA 4YSMA 4DTAA 3F3UA 3OVVA 3UIMA 3BV3A 3L9NA 3QCSA 1OKVA 2E9UA 5GZ9A 3TWJA 4A9UA 5JSMA 4XBRA 2XKCA 5CI6A 5I9XA 4BY9E 4O7SA 1Y6BA 2YIRA 2YA9A 4Y73A 2BZJA 1J7UA 2OLCA 2X2KA 3QTIA 4MH7A 3KA0A 4EYMA 1XH4A 1H07A 3QTZA 3PY3A 1M2QA 3OCSA 3UYTA 2RF9A 2XIXA 3NR9A 4GYIA 4XMOA 4JBQA 5CX9A 2PVHA 2WD1A 3OEFX 3UVPA 1U46A 3LLTA 4UXLA 4RPVA 5KMNA 3TEIA 3GQLA 3AD4A 3WF5A 4BZDA 2VX3A 3QD2B 2R3KA 1PMUA 4UWYA 3RAWA 2WTCA 2GS2A 3WILA 3ZZEA 1OBGA 4GIIA 2B9IA 4E8AA 3GFEA 4FL3A 4F6SA 5F94A 5J5SA 4JBOA 1F3MC 3D4QA 1GZNA 4M67A 1Q4LA 1G8AA 1H27A 2YCRA 2R7BA 4G31A 3RAHA 2UVXA 4Y85A 4E3CA 2YWVA 2J7TA 2OZOA 1OI9A 2ONLC 1H01A 2I0VA 4EH2A 2C47A 2PY3A 1NW1A 3ULIA 5FEQA 2XRWA 1KOAA 3HVCA 4C37A 2WTVA 2WEIA 3R0TA 2VO0A 3COIA 5BX0A 5LWNA 3GFWA 3T9IA 4UWCA 1K2PA 4AE9A 4ZSLA 3H9RA 5LVNA 2NRYA 4EBVA 3UO4A 2XB7A 4ZTHA 5KX8A 1P2AA 3F7ZA 2W1IA 3O2MA 4F0IA 2C6TA 2WTIA 4TRLA 1SMHA 5IA3A 2J50A 1H25A 3M42A 4JG7A 2CHLA 4EQCA 5AP4A 2JD5A 2F4JA 4J99A 4CSVA 1Q8TA 1SVHA 4G1WA 5I4NA 1BI7A 1KV1A 3HKOA 2GS7A 3DZQA 2VV9A 2YIWA 5D1JA 5HZNA 2W99B 2XNPA 4H05A 5JFSA 2HXLA 5DT3A 4AG8A 4DEHA 5M4FA 2WNTA 3RZBA 4GRBA 3N9XA 4JX3A 5ANIA 2C0IA 4YLKA 1UU7A 2JDSA 2H9VA 3FLSA 3ENHA 5DFPA 4CEGA 4TKSA 2CGXA 5IF1A 3KK8A 1ZYDA 3PWYA 3EQCA 3BPRA 3P9JA 3LXNA 1W98A 1B6CB 2FH9A 2IW6A 5LMAA 3HV7A 3V8WA 4J96A 3IDBA 4FZFB 4BDAA 3UZTA 4EJ7A 2OO8X 4FR4A 2CDZA 3O8PA 1YWNA 4WSQA 3KRRA 3DK6A 5E91A 3W32A 4X3FC 1FVVA 5BVDA 4HGEA 1OPJA 3NDMA 2R3MA 2QNJA 4ACCA 4K11A 5D7AA 2X8IA 4XG7A 4RZWA 4D28A 3OBGA 1BUHA 1PYXA 2HWPA 1Y8YA 3KGAA 4JNWA 1Q61A 3K54A 3KF7A 4FBXA 1Q62A 4L3PA 3Q04A 4HVHA 1YVJA 1XQZA 3FZTA 5TO8A 4A4XA 4EKKA 4O82A 5TR6A 3VBTA 5M08A 3R8MA 2BFXA 3Q4TA 3TI1A 3ET7A 3QL8A 4GKHA 2C5VA 3TIZA 4UB7A 5H8GA 3VHKA 1QPDA 4BHZA 3P23A 3G51A 4IW0A 5AEPA 5JRQA 3VBQA 4EH3A 1WCCA 1B38A 3GVUA 3SAYA 1REKA 3DCVA 4HCTA 2I40A 3CY3A 3GCPA 3LPBA 4L9IA 4DEAA 3V5JA 4L46A 4AN9A 2BAKA 4YC6A 5DT4A 1WVYA 2UV2A 3THBA 4I23A 2PVRA 4ZOGA 1YI4A 3QZHA 4RJ8A 2VTSA 3GT8A 4BCQA 2JLDA 4FTKA 2HW6A 2LGCA 3RKBA 4OR5A 5D11A 2WMSA 4YZMA 2JC6A 4FKRA 4ZTNA 4RBLA 4EHVA 2UZNA 2FSTX 3GGFA 5DPVA 3UDBA 4WBBB 4PP7A 3OT8A 2DUVA 3U9CA 1WBTA 3VNTA 4BCIA 1UKHA 3R21A 4P4CA 3RPOA 1M7QA 2G01A 4NTSA 2J6MA 3OCGA 5ANDA 4CFNA 4D9UA 5HO7A 5M56A 4NZWB 3PXQA 4OTPA 2HIWA 4DCAA 1P14A 2W17A 1YDRE 3T9TA 4YZDA 3QQHA 5IQBA 1YXSA 3C4CA 2YABA 4CFVA 4UWBA 2QU6A 3E8DA 3ZBXA 4EK4A 4UN0C 1A9UA 4CT2A 3ZUTA 2HXQA 4IZAA 4UV0A 3VW6A 4F9YA 2QO9A 2UZUE 4YMJA 2HW7A 3C4WA 2XBAA 3HGKA 4IC7A 4MD8E 4RIYB 4QYEA 5HE0A 5C27A 3O7LB 3QHRA 3VUHA 4BCMA 2P4IA 3D2KA 3QCYA 4NKSA 4F99A 2BDFA 4DG3E 2PUUA 3MA3A 3AC4A 1UNLA 5FRIA 2ZOQA 3VF9A 4YNEA 3EQGA 2WMQA 1NY3A 4D5HA 3FZRA 4FL2A 3BLRA 2XK6A 2XEZA 2Y8OA 2VTLA 3NW7A 3FKLA 2GNLA 3QTWA 4CCUA 4OAUC 3FI2A 1FMOE 2JKMA 4JQ7A 1I44A 2J2IB 4BYIA 4RVKA 5IQIA 3QRJA 4I5CA 4WHZA 1JOWB 3AD5A 4QQJA 2HYYA 3POZA 3L8VA 5CF4A 3NX8A 3AG9A 3T8OA 2X6EA 2PUNA 1G5SA 1WBWA 3DBCA 4B6LA 4M7IA 2FB8A 3FSKA 4GFOA 4YGAA 2C6DA 3N4VA 3QUDA 4ZZOA 5A54A 5AR4A 1Y6AA 1JVPP 4MNFA 3HYHA 4QP9A 1PRYA 3EKKA 3LFFA 3C4FA 4CXAA 4C4JA 4YC8A 5LARA 1O6KA 5L6PA 2PVLA 3LFEA 5IQCA 2QO7A 4ZMFA 3I0QA 5FQDC 4GG5A 2HY0A 3IS5A 2VRXA 2AC3A 3F3TA 4QYHA 4R3CA 4BDGA 4E1ZA 1P4FA 3HDNA 4XG9A 5G6VA 5B2LA 4AA0A 4YZNA 1KE5A 1ZZ2A 4FEVA 3KXMA 5T68A 3P79A 2FA2A 2Z8CA 4PMPA 4UX9A 3LZBA 2ETMA 4MD9E 4Z9LA 3TNPC 4ZLYA 2OZAB 2Z2WA 5HG7A 3D15A 4HW7A 1DS5A 3OTUA 2O2UA 4IVAA 4LQMA 4X21A 4JR3A 3MTLA 2ITYA 3F3WA 1ZXEA 3GNIB 3UIBA 4A07A 3NMUF 3UBDA 3IW6A 3EN4A 3EN5A 1PXJA 2WQEA 2NP8A 3COMA 3KXGA 3PSBA 4HCVA 3RK5A 2PL0A 3F88A 4MBLA 3E8NA 4BBEA 2WEVA 3OS3A 2PU8A 4EQUA 3CIKA 3S3IA 4F65A 3PG1A 5KCVA 1BX6A 4FIEA 4RGJA 3BU3A 3VF8A 1GIHA 3BGPA 3QZIA 4AA4A 4UMUA 4U7ZA 1V1KA 4HGSA 5LMKA 4FSNA 1X8BA 5BMSA 1H28A 2GHLA 5J9YA 5L2TA 2PZYA 3EOCA 3R8ZA 5CU6A 4CTCA 4U6RA 2PWLA 4UZDA 2R3OA 2OZAA 4G3FA 4D0WA 3P08A 4X2NA 2KULA 3VJOA 4XLIA 4YO4A 2O64A 4HNFA 4HPTE 2FO0A 2XK8A 1YI6A 3ZO4A 3NUPA 4BZOA 1CKPA 3QGYA 2ZV7A 2ITPA 3WZDA 2EUFB 4C8BA 2BDJA 3WYXA 3QA0A 4QTBA 4ACHA 2Y0AA 4C33A 2WHBA 2W96B 1PMEA 3GBZA 2I6LA 4RMZA 4WSYA 3NNWA 2IW9A 4M13A 4MX9A 3A7FA 3L1SA 5KZ0A 5CYIA 2YACA 4FNZA 1M2PA 4KA3A 4GUBA 3R7UA 4EKLA 3DBFA 2C6MA 4NW5A 3N4TA 4TPTA 3LIJA 5CTPA 3NGAA 5KBQA 1KE9A 4GH2A 4JRNA 3VAPA 5ETFA 3O50A 4JOAA 4AOTA 5JFVA 3ZM4A 4C36A 5KHWA 4FKOA 3DDPA 3LOKA 2HCKA 2B55A 5HOAA 4X3JA 3SGCA 1FVTA 4A7CA 2YN8A 1QCFA 5J9ZA 3GOPA 3R7YA 3R71A 3MFTA 3EFKA 2F7EE 3FY2A 4MWIA 4OBPA 4ANLA 5A4QA 3GU8A 5BNJA 5DI1A 4F6WA 4FSWA 2H34A 3K5UA 2GNHA 3OWLA 4KSPA 5F20A 4IAZA 3MPMA 4PUZA 4XP2A 3V5LA 4HGLA 4TYHB 4CMTA 4W4VA 2WELA 4C62A 4I5PA 5FP6A 4EBWA 2CNQA 3D9VA 5JGBA 5CF5A 4KBKA 3NVKI 4A4OA 3PIXA 5KMMA 3BE2A 2W5HA 3RALA 1TVOA 5AMNA 5BYZA 2GQSA 2X9FA 4FC0A 4LRMA 4MXOA 5AUTA 2HZ4A 2P2IA 3LFCA 4EZ3A 2CPKE 5L2IA 3FYKX 4YHFA 5ANJA 1JAMA 5GNKA 5AP3A 4DLJA 2QOFA 2J90A 3W2RA 4ALUA 3EL7A 5AAFA 5HU9A 1BL7A 3NW6A 4FT0A 4QQCA 3CE3A 4BI2A 4TYHA 2YM3A 5FUTA 1OKWA 2J51A 4F4PA 5K0KA 4EORA 5HVKA 4MD7E 1H1PA 2WOUA 4NW6A 3R28A 3QD0A 3QA8A 5CEIA 4AFJA 4OAVB 3FPQA 4YLLA 2Y4IB 3VW8A 4AT3A 4CGAA 2B53A 2YDJA 3V01A 5IKWA 4C02A 5HLNA 2GHGA 4IANA 4M69B 5HBHA 2BFYA 2YM8A 1RDQE 4GFMA 4LOPA 3ZSGA 4DBNA 4XX9A 1PJKA 3ETAA 4CRSA 3TZ7A 4LGGA 2P0CA 5ANKA 4J7BA 2UZWE 1BL6A 3QTRA 2XCHA 2YCSA 4ZS0A 2RFDA 1YOJA 1XH6A 2XBJA 4PL3A 3V6RA 3PSCA 1FPUA 2BAJA 2C0TA 2Z60A 2B1PA 4NCTA 4RVTA 3V5QA 5B7VA 1JSVA 2PVJA 2OBJA 3QWKA 4C4IA 2X7FA 5I9VA 1O6LA 2IZUA 1Q3DA 1VYZA 4MVFA 1H8FA 4RC4A 4L3LA 4OTQA 4RWIA 3TKHA 3QQJA 3FHRA 4DFNA 3MY5A 4ERWA 1E1XA 3GC8A 4IADA 4I4FA 4KIPA 2UZLA 3LCOA 3V5TA 2CLXA 4O2PA 3W33A 5CEKA 5IQGA 2V0DA 5FDXA 2G15A 5JQ8A 3LE6A 4FTIA 3T3VA 3GUBA 4GCJA 4FOBA 3PSDA 5AM6A 4DEIA 4WA9A 5DNRA 1GNGA 2Y4PA 3DS6A 5KMLA 3ATTA 3BBTB 4FE2A 4LGDA 3KN6A 4FZDB 3NUAA 3QTUA 5BVKA 2FGIA 4IWOA 4ZSEA 4CRLA 5FDPA 3ZXTA 3MY0A 5B0XA 4AS0A 1YXVA 3PA4A 5EI2A 2GTNA 2ERKA 4LG4A 1PXPA 1SNUA 2W1CA 3SDJA 5EW9A 1WBVA 3V51A 5H8EA 5IQEA 1Z5MA 3DAJA 3EFWA 5C9CA 4C58A 3B2WA 2X2LA 2R4BA 2X4FA 4PNIA 5AX3A 4X6QC 5FXRA 1OMWA 4MF0A 3ZBFA 3R8VA 5HIDA 2PZRA 2VTPA 3C1XA 3R1SA 4RIWA 3EQRA 2VWVA 4MWHA 3WZUA 2IZRA 2WXVA 2A19B 2XZSA 4F9BA 2QURA 4FUYA 2XYUA 5IUIA 1URCA 2G1TA 4PMTA 5CXHA 3CKXA 3KRJA 4G34A 4G9CA 4EOQA 2BHHA 3DAKA 3ID6C 4GJ2A 4IM2A 2B0QA 3ZLXA 2BZIB 2EXEA 4TWNA 4PWNA 3C4EA 3TNIA 1IRKA 1STCE 3EQIA 3PJCA 4KIQA 4OTDA 2VTRA 2OJJA 5EHOA 2Y6OA 3L9LA 4JDHA 1NXKA 3EWHA 3DBQA 4HYHA 3UG1A 4FYOA 2WMTA 1YXXA 4CMUA 5IA0A 4Z55A 4JBVA 5AA9A 1YDSE 4GU6A 4JQEA 2XF0A 2C3IB 4UXQA 4BGQA 5CAPA 1H08A 3L8XA 4QP1A 5D9HA 3GP0A 4I24A 1BI8A 3EFJA 4GIHA 3MWUA 2J5EA 1JNKA 3A4OX 2FVDA 4ZZMA 3D14A 3FQSA 3LW0A 3V6SA 4BDFA 3A7JA 3E88A 4C3RA 4FSYA 5DEYA 4E6AA 3MVMA 5FM2A 5H9BA 2B4SB 3LAUA 3PYYA 5EHLA 4EOJA 5M4IA 4B0GA 3F5XA 4PY1A 4RIXA 3LMGA 4J71A 4N70A 4FIHA 4E7WA 3EMGA 5CALA 4YZBA 4U43A 5AJQA 4QQTA 3SLSA 3AC2A 5HCZA 3VUDA 2C30A 2P3GX 1ZY5A 4WG3A 5DEWA 2CCHA 2YERA 2RG5A 5IDPA 3IG7A 3I5ZA 3R8PA 4O7RA 1V0PA 4AWIA 2X9EA 2GFSA 5FGKA 4QMVA 3BGZA 3A60A 4XNEA 4EZ7A 3TZ8A 4D2TA 4BHNA 3HNGA 4ZLOA 2VWXA 3HEGA 2C5OA 2W7XA 1WFCA 3EN9A 4FEQA 3EN7A 3V8TA 4BGGA 4CZYB 2CMWA 3A4PA 5HG8A 1DAWA 2E2BA 1H4LA 4HVGA 4UMPA 3II5A 4D4SA 3KY2A 2GTMA 4H1JA 2HOGA 4FG9A 3O8TA 5CSPA 5KNJA 3FLZA 4IQ6A 4DGMA 4U8ZA 5J7BA 3AT2A 2BZHB 4IFGA 5DYJA 5EM8A 2ACXA 5AM7A 4EHEA 2E9PA 2GQRA 1OUYA 3PG3A 3OD6X 4I6BA 4ZS4A 2UZTA 4ZJVA 3BYVA 3FL4A 5LXMA 3HA6A 1YW2A 5AR5A 1KSWA 3C4XA 4EHZA 5HQ0A 1H24A 5IQDA 2WMWA 2REIA 1OL7A 3KXHA 3QQKA 4AGWA 2CKPA 5BYLA 3GI3A 2AUHA 5EI8A 5J7HA 2JDTA 5IEVA 3TKUA 3E3PA 4LUDA 4JXFA 4X3FB 2WMRA 2PE2A 3FMJA 1RQQA 3GXLA 3QXOA 3IOKA 4KS8A 1R1WA 5KMKA 3KKVA 1ZMWA 3ZM9A 3PXZA 3AMBA 5JQ5A 5ETAA 1WVXA 5CNOA 4FG7A 5HKMA 3RK7A 1PKGA 3E8EA 3HX4A 2PVFA 4TYEA 3W2OA 5CAOA 1IASA 3BYUA 2C68A 4ZJJA 3RTPA 3I5NA 5D7VA 2ZDTA 2C6OA 3NAYA 1RW8A 1BLXA 4UYNA 1QPJA 3LXKA 4OUCA 4K18A 3NZ0A 4MKCA 4L00A 5A14A 3F69A 3F9NA 4O0UA 3P0MA 3NVMB 5M57A 4EOOA 3R8LA 2R3QA 5GINE 5C03A 2QKWB 5KZIA 3BHVA 2RKUA 2WQBA 4IB1A 4X3FA 4AGDA 4QMNA 4FSRA 4ANOA 3FWQA 1ZYLA 3C50A 3O8UA 5AWMA 3RINA 1GZKA 2YIXA 1W0XC 2X0GA 1H00A 1J1CA 2OJGA 4WKQA 3TZ9A 3VS3A 4BF2A 3FXXA 4E5BA 3DY7A 3BQRA 4CFXA 2X39A 2ZMDA 2OW3A 3ZU7A 4BCPA 3CS9A 5CU3A 3VHEA 4DC2A 5LVMA 3KEXA 1PXLA 3U51A 4CZTA 3ZSHA 3C13A 5JH6A 4DEDA 4LUEA 2QI8A 3SOAA 3OROA 2C6LA 2HELA 3EYGA 4WG4A 4ZTMA 3G90X 4FEWA 5AUUA 4XG3A 1LP4A 5HBEA 3ZO2A 3D0EA 4RT7A 2VU3A 1OKYA 3KN5A 5E8UA 3DA6A 4IAAA 3KXXA 1XHAA 4BDDA 1K3AA 2UW9A 4IX5A 4KWPA 1H0WA 2A0CX 4I4EA 5DRBA 3LQ5A 5HHWA 3FEGA 4A06A 1PXIA 4YP8A 3K5VA 5DGZA 3VS4A 3WF7A 3W1FA 5AIRA 4OLIA 4FTRA 3LCSA 3TXOA 4HZRA 1UNGA 3OP5A 4IB3A 4NK9A 5C01A 3R30A 1NA7A 2RFNA 4C61A 2ITOA 2PUPA 2ZB1A 3VRZA 5EW3A 3RJCA 4ZTQA 4KIOA 4BI1A 5M44A 1S9IA 2X2MA 3MFUA 2VTHA 5HG9A 4ALVA 4CKIA 5M07A 3AGLA 2FSOX 5IPJA 4E5AX 3HV3A 3CQUA 4MNEA 3EQFA 3PLSA 3UOHA 5FD2A 3FZ1A 1YOLA 5AUXA 3TJDA 4NL0A 3TUDA 4I0TA 4L7FA 4WNKA 3RCJA 2QODA 3G6HA 4XJ0A 2Y6MA 3Q4UA 5E8TA 1MRUA 5E1EA 3C0HA 3I79A 3UIUA 5DR2A 3DTWA 3CTQA 3H9OA 3U55A 4H36A 5HTCA 4FUXA 4TYGA 5I3RA 3GC0A 3LCTA 5D12A 4FF8A 2VTAA 2E9NA 2A1AB 4PF4A 5HU3A 3TZMA 2YAAA 4BCNA 5C1QB 3E7OA 2F7ZE 5L2SA 4XOZA 4CQEA 5FTGA 2JIUA 3CJGA 2R64A 3NYOA 1XH9A 4EEVA 1K9AA 2WOTA 4MQ1A 3Q4ZA 5I9ZA 3BZ3A 4E73A 4DH3A 4YTHA 2YDKA 2I1MA 4B8LA 4FV2A 1UVRA 5HCXA 3ULZA 3D83A 4QP7A 4FV7A 1PMVA 4FT9A 4FK3A 3PTGA 4O91A 5F4NA 4WIHA 4G6OA 3P78A 3LJ2A 4BDBA 2VNYA 5EYKA 4FKPA 4IAKA 4CCBA 3DU8A 3QD4A 5E8WA 4DTKA 3OXZA 4D2VA 2VWUA 4R7HA 4ANMA 4IE9A 3SVVA 1BYGA 4FL1A 5BUIA 2C3KA 2YEXA 3UMWA 4ASZA 4BCFA 4C2WA 3PLAE 4Y83A 3HZTA 3LQ8A 4O21A 5CSVA 5BVEA 4C59A 5GJDA 3HRFA 1M2RA 4DINA 4RQKA 4FT3A 3SXFA 4TL0A 2JBOA 2JGZA 4NIFB 4U79A 4ALWA 5F9EA 4M66A 4RX7A 4F7LA 5J1WA 3ACKA 4WUAA 4Z7GA 2XK7A 5I0BA 3TUBA 3TV6A 3BHHA 5AP0A 3DK3A 2BRBA 4MXZA 5DE2A 2YIQA 1YXTA 3O0GA 4NM0A 3TV4A 4DITA 3HMIA 5CEMA 1PF8A 1UWJA 3VUTA 3NUNA 3R2YA 3TN8A 2XM9A 3ZOSA 3EQPA 1QPCA 5IEXA 2OWBA 4FSTA 3PXRA 2QLUA 3FC2A 3PJ3A 5L4QA 3V5WA 4EH4A 3KB7A 3JY9A 2C1AA 2OU7A 4RFMA 5HE3A 4G3CA 4AGCA 3AT3A 4JDKA 3MY1A 4XS2A 4IAIA 3FZSA 4O22A 4FODA 4MQ2A 3IECA 3BEAA 3E93A 4IJPA 4A9RA 2BZKB 4YURA 4WRSA 4FIFA 4E6DA 4ENYA 3HECA 5JFXA 4J1RA 4BCJA 4RWKA 3ACJA 2V7AA 5EFQA 3QTSA 3VWAA 4U41A 2QONA 3Q3BA 2PZ5A 2YJRA 5TF9A 2HAKA 4AW0A 1UU9A 2QKRA 2GS6A 4Y8DA 2QR8A 2C4GA 4W8DA 1ZY4A 2W1EA 3CTJA 3KVWA 3PXFA 3SG9A 4WNMA 1YI3A 4LRJA 2X7GA 5FTQA 4YU2A 2VUWA 4AFEA 2Z02A 5CU4A 5AR7A 4QQ5A 4XG2A 4ID7A 1NT2A 3SC1A 4USEA 4WUNA 2YISA 3PRIA 3KMUA 4FVQA 3E3BX 2PZIA 3PVUA 5JRSA 3WZEA 3VS0A 4NFMA 3RPRA 3DJ6A 5BVFA 4O84A 5ANEA 4H3QA 2JAMA 2GU8A 1OIYA 5ETIA 2OJIA 3WARA 4B99A 5DIAA 3MJ2A 5HIEA 5C8KA 4NYEA 4P5ZA 3PJ1A 3OWJA 4AZWA 2QVSE 5EW8A 3GU4A 4XV3A 4EONA 3VC4A 3PDTA 2W1ZA 3F82A 5E4HA 3G0FA 2I0YA 4FTUA 3OZ6A 3VS1A 3QZGA 4TY1A 4ZXTA 3FXZA 3PRFA 1MP8A 3L8SA 4DN5A 4NWMA 3ZSIA 3OTVA 3RWPA 3QRUA 4EOMA 2BMCA 2PE0A 4RVMA 5ANGA 2UVYA 3F7WA 1DM2A 2QG7A 3QD3A 2WMVA 2PMNX 4F63A 3HUBA 3WIGA 3G0EA 5KMIA 2QOQA 4R8QA 3CBLA 2P55A 3R73A 4NJ3A 4GW8A 4LL5A 4I6QA 4RWJA 3RHXA 4KABA 2UVZA 4NEUA 2ZM3A 2BALA 4R78A 3QGWA 4PNKA 1F0QA 2CGWA 2G2HA 3AT4A 4FKJA 4KRDA 2QR7A 2IG7A 3FUPA 4X2JA 4HVSA 3TV7A 3UE4A 3DQXA 4C57A 3EYHA 3G6GA 1KE8A 4XRJA 5IMXA 2WQNA 5GJFA 3OW4A 3KL8A 4HGTA 5AX9A 5HNBA 4B9DA 4YJOA 1VEBA 4IWQA 2XNGA 4CG9A 3A62A 1LR4A 4NU1A 3ZFMA 4BTJA 3IOPA 4KINA 2X81A 3HMPA 3N51A 4K33A 1M7NA 5M4UA 2EVAA 4WRGA 5AV3A 4CG8A 3TKIA 1ND4A 2BIYA 2JDOA 3P86A 4HPUE 2W4OA 3ZEWA 2WTKC 2YFXA 4RQVA 4ZJIA 3IDCA 1OL2A 4RC2A 3AOXA 3T3UA 5CF8A 3MGYA 4NT4A 3LCKA 3R83A 4EZ5A 5JGAA 2X1NA 3I4BA 5EDPA 3MFSA 4RIYA 4QNYA 2QOKA 3BWFA 4O83A 3OOGA 4G3DA 2BRGA 4ZMEA 2VO7A 3HP5A 2UZOA 3I7BA 2UW0A 2ESMA 4YBKA 4BCGA 3Q5IA 2IWIA 3NUYA 4U5JA 3FI4A 4C2VA 4EH8A 4FGRA 4FKIA 4YJQA 1H1WA 4JIAA 4G3EA 3UYSA 3MPAA 4FVPA 4RA4A 4E4MA 5TE0A 3VN9A 4L68A 1G8SA 3QHWA 4FIIA 4IWPA 4WG5A 3TIYA 4DFUA 3Q9YA 4G9RA 4BCHA 4FV4A 5I9YA 3Q9ZA 4IM3A 4G6NA 4P90A 3QKMA 3ORTA 1P4OA 3E7VA 3C5UA 5AR3A 5HTBA 4FTNA 3NS9A 3VUGA 3H4JA 4TYIA 5CAQA 3W8QA 4K8AA 4R1YA 4ANQA 3CY2A 3DXNA 4BDEA 2BTRA 4IJ9A 3IONA 5H2UA 3EZVA 4O6EA 2OICA 2OIBA 3LJ1A 4Q2AA 2QD9A 4CMOA 5G1XA 3CD8A 4C38A 3PPZA 2WPAA 4QTAA 3ZRKA 4FKLA 2O63A 5AP5A 5IQFA 2WTWA 3VS5A 4PDYA 3ALNA 2ITZA 2O65A 2CN5A 3CTHA 5HICA 2VWBA 1S9JA 2PUIA 4I5MA 5CZIA 2VZ6A 4PQNA 3LMIA 2W4KA 4FICA 3FJQE 4XG4A 5CEQA 1KV2A 2OKRA 3LVPA 2ZB0A 4G5JA 4F9CA 1LEZA 3VBXA 1APME 4AN2A 1U5RA 1J91A 4RJ3A 4FV1A 3A99A 4YO6A 2W1DA 4EOIA 4V0GB 4CFUA 4TWPA 4DYMA 1R3CA 2W06A 4TT7A 5CSXA 3DFCB 3IKAA 3CPCA 4W4XA 1ZMUA 3AXWA 3CD3A 1IEPA 3E87A 5CNNA 2ZM1A 2X8EA 2R0IA 3NNXA 4CZUA 2JKKA 3GCUA 4QP2A 5TOZA 1W7HA 1PXKA 4BCOA 2BPMA 3QALE 3DAEA 4KKGA 2ZAZA 4YNOA 3QU0A 4JAIA 2O3PA 1W82A 2ITUA 1YWRA 3KRLA 4F6UA 3O51A 5DG5A 3ZHPC 4KAOA 5K9IA 3K3IA 4RLLA 2A2AA 3WZKA 3D7TB 5A4EA 2W05A 2I7QA 4UY9A 2R2PA 2JEDA 4AACA 3G2FA 4JJRA 3RPYA 4DBXA 3TJCA 3F3ZA 3A7IA 5L8LA 2XNNA 4D9TA 4QD6A 3PZHA 5CT0A 3HV5A 4KBAA 5DLSA 5KUPA 5AV0A 4H58A 3VVHA 5J5TA 4TWCA 3GC7A 1SVEA 1G3NA 3QCXA 4RFYA 3TNHA 3QQFA 3Q2JA 4EH6A 2ITWA 5AA8A 4OTGA 2XJ0A 3GEQA 2XNMA 2BRNA 3S0OA 2FUMA 2W1GA 4I6FA 4R5SA 3G9LX 3DXQA 3F5GA 1PY5A 4L8MA 2PYWA 1HCLA 4FNWA 4HYUA 5HE1A 3UTOA 3NWWA 3KRXA 4U9AA 3W18A 4HVIA 4JT3A 5EM5A 2E9OA 1U59A 4ZZNA 2BHEA 2WMAA 2RIOA 2C6IA 4F9WA 3UNKA 3D7TA 3HMNA 4GJ3A 3BYOA 4LV8A 4F64A 4PX6A 2H96A 4U40A 4D4YA 4B4LA 1ERKA 4CV9A 5HLWA 2XIRA 4FX3A 3FLWA 1ZOHA 2ETKA 5EYCA 5AUZA 4QT1A 2OFUA 2VTJA 5EHYA 3W10A 1LUFA 4H1MA 2PPQA 2VWZA 3RAIA 5IISA 3U8WA 3FMDA 2R3GA 5CWZA 5FXSA 1ZAOA 3K3JA 1TQPA 2CLQA 4AOJA 5AFVA 2HK5A 2DQ7X 3UNJA 4QPAA 3UZPA 3OXTA 4P7EA 3JS2A 3M2WA 1RJBA 3RI1A 3HRCA 3E92A 3FLNC 2EXMA 2HENA 4FKUA 1WVWA 3MI9A 5FM3A 5DWRA 4E4NA 5LWMA 5L6OA 3RAKA 4CNHA 2JDVA 4DTBA 3MPTA 4LOQA 3ODYX 3P7BA 4FV3A 3OY3A 3EQDA 1YQJA 2XA4A 4GEOA 4PRJA 2DS1A 2ZV8A 4XV2A 2LAVA 3A61A 3DGKA 4RWLA 2UW3A 5CI7A 3G9NA 5IH6A 2O5KA 3LFNA 4QMZA 2XMYA 4LGHA 1H0VA 4PV0A 3Q32A 3PUPA 4BTMA 5IU2A 4BIEA 2YDIA 4DFYA 3IO7A 5F95A 5LMBA 3KREA 2X8DA 3OG7A 3Q96A 4X2KA 2BILB 3E63A 4ZIMA 4H3BA 3CGOA 4YUQA 5C26A 5C8NA 4DG0E 1ZWSA 2NO3A 5DT0A 2XKEA 1BKXA 4QMYA 3BE9A 4GFGA 3F6XA 3W2SA 2PHKA 4FTQA 4LMNA 4M14A 3RZFA 3GC9A 4GK4A 2ZYBA 5FTOA 3QUEA 3SOCA 3W16A 5J1VA 4M69A 3KRWA 3PE1A 1ZZLA 4QMSA 2QQ7A 4A9YA 4BN1A 2PMIA 2W5BA 3ZC5A 5HGIA 4X2GA 3SG8A 3F2AA 3M11A 2PULA 3PY1A 5FP5A 4D2WA 3DKOA 3KULB 1SNXA 4FSZA 4DEEA 4C7TA 5HX6A 2VTMA 4PL5A 1GAGA 5HNGA 3DDQA 5HESA 3ANRA 4NKAA 4LOOA 4LYNA 4U97A 1FMKA 4O96A 5HI2A 3V5PA 3ZTXA 5FXQA 5IQAA 4GU9A 4XOYA 3BELA 3MYGA 4MAOA 1WMKA 4FZ6A 4KD1A 5K5XA 4O81A 4X0MA 3ZLSA 2F2CB 3UOLA 4MYGA 1OPLA 3FQHA 2GNIA 2ITXA 5HLPA 3AC5A 2WO6A 4DH8A 3PE2A 2BROA 5HE2A 4RX9A 4JX7A 2GQGA 4DCEA 3R9NA 3VS2A 4I20A 3I6WA 1MRVA 5AUVA 3EQBA 1OL5A 3WZJA 5FWKK 5L8KA 4LI5A 4AF3A 1O6YA 3UGCA 2BR1A 4EK5A 1OKZA 3EKNA 4I3ZA 4O0RA 2NRUA 4PP9A 3CEKA 3DQWA 4IX4A 5JK3A 4W4YA 1SZMA 4GT4A 4WNPA 5JGDA 3R7IA 5LMKC 3UPXA 2F2UA 4XV1A 1E1VA 2B9JA 3UQFA 3KCKA 3PFQA 5ACBC 2XNOA 3MVLA 4L67A 5J95A 1W84A 4W9WA 5HNIX 2B7AA 4FKQA 4WNOA 3R7GA 3BKBA 3LQ3A 3KMWA 1JSUA 3FV8A 3EQHA 5DHJA 4EC9A 4C34A 3B8RA 4FKTA 2A27A 3COHA 4U80A 4BWPA 4F0FA 2EB2A 4DGOA 1ZMVA 1NVSA 4O0TA 4Q9ZA 4IAYA 2XIKA 5EOBA 3SV0A 3UO5A 4HYSA 4O38A 3KCFA 4CKRA 2QOOA 2ITQA 3H10A 4KB8A 4O0SA 4Q5EA 3TT0A 5DMZA 2GNGA 1AQ1A 4XYFA 4AA5A 2OI4X 4AZFA 3MH2A 4QYYA 3Q52A 5AR8A 4QTDA 3CC6A 3FMMA 3F5PA 3D5XA 4KKEA 3KC3A 5A4TA 3F66A 5M4CA 4AQCA 3PVWA 2C3JA 3FSFA 4FMQA 4K77A 4RJ6A 3DB8A 4F9AA 5HD7A 4ZTLA 4S30A 2CJMA 3Q60A 5J79A 5K5NA 4UMRA 2YLFA 3QTXA 3R8UA 4ARKA 2WKMA 5DOSA 3RBWA 3DKFA 3DXPA 5AV1A 4PPAA 4R6VA 1H1QA 4ASEA 5JZJA 4BWKA 4O7LA 2OJ9A 3MA6A 1KWPA 3NYNA 3WE8A 1FQ1B 3NPCA 4OT6A 3UVRA 4PPBA 3UODA 2ONLA 3NCZA 1OIQA 3BHTA 1ZARA 5AAEA 4EH5A 4FT7A 4IBMA 3U6HA 5L3AA 3QKKA 4CKJA 5CVFA 3R9OA 2IZTA 4USFA 4DFXE 2UW7A 2ITVA 2YCQA 2UZBA 2VWYA 2HZ0A 3MW1A 1VYWA 4OT5A 5CSHA 4MXYA 4AZSA 2YCFA 4CFMA 2OG8A 4J8NA 1V0BA 2GMXA 2PK9A 3R1NA 4MEDA 3NCGA 3SA0A 1A06A 3FC1X 3JXWA 2CNUA 5BPYA 1IG1A 4QTEA 4GT5A 2CKOA 1FGIA 5AUYA 5K0XA 3ZO3A 4YC3A 3EL8A 3QTQA 3RGFA 5GZAA 2QHMA 1R39A 2CSNA 3MS9A 3NSZA 4YLJA 4OTWA 3ERKA 4ITHA 4AU8A 4QMQA 3WF6A 3RPSA 3FHIA 2VX1A 5AV4A 4C4FA 2WTDA 3TCPA 4MXXA 1GOLA 4AZVA 5LVLA 3VUIA 2BTSA 4FTJA 1AD5A 4OBQA 2HZNA 2XIYA 3OEZA 2HY81 4QMPA 2I0EA 3QBNA 1PXNA 3DZOA 2IVTA 4U3ZA 3E8CA 2R3NA 4AZEA 4YPSA 4BVUA 4M84A 3A2CA 3NLBA 4FG8A 1HOWA 2YM6A 4D1SA 2ITTA 4BKJA 2WQOA 5HO6A 4R3PA 4NCTC 5IQHA 5HG5A 3FPMA 3OMVA 4BCKA 1DAYA 2XIZA 4A9TA 1GJOA 4II5A 4DFLA 4HOKA 4TNDA 2W9FB 3JR1A 3FLYA 4FSQA 1MQBA 4GT3A 2OIDA 4Y5QA 4AW2A 4B8MA 3ZUUA 3ZMMA 4I6HA 4S34A 5EM7A 2QC6A 3EIDA 3MV5A 4E4XA 1PW2A 5IEYA 2KTYA 3QQUA 3PA5A 5EYMA 2C5YA 4RC3A 4UBAA 4MXCA 4LRKA 3A7HA 3O96A 3R2BA 5EQYA 3DB6A 1WAKA 4ANSA 5KO1A 3M1SA 2SRCA 4IC8A 1P5EA 3NUXA 4ZP5A 3UG2A 4YJUA 5ANOA 4ACMA 4AE6A 4B7TA 5EG3A 5JT2A 3NIEA 5I9UA 1OBDA 3ZUVA 3TG1A 4Q9SA 2IVSA 2WMUA 4KRCA 1YHSA 2OFVA 2W4JA 4IB5A 4AXAA 3LHJA 4M15A 4BR3A 3D7ZA 2X4ZA 3UC4A 5CU0A 2R5TA 2JITA 3BU5A 4L43A 4TWOA 4TXCA 4O7VA 5EOLA 2O0UA 4ZAUA 3TACA 5H8BA 1FVRA 1NVQA 4W4WA 4BRXA 4DGLC 5JN2A 2OF2A 3I6UA 4O1PA 3DK7A 3PVGA 5JZNA 3WF8A 4C4GA 4G6LA 4ACGA 2RFEA 1OIUA 3ORKA 2CGVA 3PJ2A 5EDRA 3Q9WA 4ANNA 3B8QA 3MH3A 5I9WA 2HWOA 3DFAA 4QMLA 5HX8A 1JBPE 4F09A 3ZYAA 5CEPA 4J98A 3R22A 5A6OA 4NM5A 1ZLTA 1REJA 2BRMA 2VX0A 3ENMA 4DG2E 3IGGA 5C4LA 3AC1A 2GSFA 4EK8A 4JBPA 3BLHA 3DNEA 4KSQA 5LJJA 4RRVA 4RSSA 4FIGA 4CV8A 2XUUA 2AYPA 2W1HA 4AAAA 3I1AA 3FE3A 2QG5A 4JDIA 3H30A 3LFBA 4PDOA 3ZRMA 2Z7LA 2PTKA 2WTKB 5GIOE 1XBAA 1OL1A 3IDPA 3MVHA 2UW6A 4YJTA 4D5KA 4R3RA 4E93A 1OZ1A 3OOMA 4QP6A 3C5IA 2V7OA 3RNIA 5CANA 3V8SA 2Z7QA 2GNFA 3DOGA 3LM5A 4QMTA 5EDQA 4FTTA 3FZPA 3PPKA 5ACKA 2IW8A 5CAUA 4HNIA 3GU7A 3FMHA 1LEWA 4EL9A 2ZMCA 4ZEGA 4AT5A 3DNDA 3ZRLA 3BU6A 3TTIA 4OTFA 1XH8A 3B2TA 2ZV2A 3KVXA 3VS7A 1IAJA 5CSWA 1J7IA 3FQEA 3P5KA 1I09A 4GK2A 4BIBA 3ALOA 3IW5A 1M52A 3MBLA 4GVJA 3TDWA 4EI4A 2V55A 3UO6A 5IG1A 2F49A 2VO6A 4JI9A 5A6NA 4NTTA 5BYYA 3PY0A 3H9FA 4GYGA 2OXYA 4S2ZA 2F9GA 2XK4A 1Y91A 3SKCA 2UZVA 5BQ0A 3BHYA 2R9SA 4JG8A 4OTIA 1XH5A 2J0IA 4HCUA 4EOKA 4MBJA 1Q8UA 4H3PA 3R7EA 4L53A 3JY0A 2W0JA 3BBWA 4TW9A 5LVOA 5EH0A 5E9EA 3ZDIA 4I94A 2Z7RA 2BAQA 3MSSA 3P7AA 3KK9A 2WQMA 4RLKA 4D58A 2XP2A 3CGFA 5HD4A 3ORLA 2PSQA 4BL1A 1VJYA 2UZEA 4FV8A 4YJPA 4BBFA 4L6QA 1VR2A 3SW4A 4GL9A 3LFSA 1JKLA 2RL5A 4PDPA 4K9YA 3DTCA 1Z57A 3NUUA 3LM0A 2C3LA 3FL5A 4AW5A 4AZTA 4CYJA 4EC8A 4ORKA 1GY3A 4JVGA 1U5QA 2XJ2A 5IUGA 4AN3A 3Q2MA 3OHTA 1E9HA 3DJ5A 4R77A 4S31A 5E8XA 1ZOGA 5J87A 4NIFA 4ERKA 4NM3A 4C4HA 4L52A 4TN6A 2ZV9A 4TZRA 5ITAA 2J0LA 4FOCA 4YTIA 2W9ZB 2NNWB 5M09A 2IVUA 4L44A 4IXPA 1ZOEA 4RJ7A 3UP7A 4BDIA 3QZFA 4FT5A 4IZ7A 3SRVB 4BYJA 4O7YA 1ZYSA 3RNYA 5IA1A 4C4EA 2WMXA 4DGGA 5CENA 4WBOA 1JLUE 3AGMA 1XH7A 4UZHA 4YPDA 5AP1A 3HAVA 3OCTA 4Y5HA 3EJ1A 5DRDA 3MIAA 4G2FA 5I5ZA 4EOSA 5EI6A 4FV9A 4F1TA 3L9PA 4QO9A 4I5HA 3QLGA 4D1XA 2ITNA 1LPUA 1NVRA 3F61A 3QRTA 4J52A 5D10A 2XKDA 1IAHA 4ITIA 5HVYA 3BI6A 3I81A 5L6WL 3U4WA 5KKRC 3ORPA 3DLSA 3RM6A 2JDRA 2Y7JA 4ANBA 1OGUA 2EWAA 1KOBA 4QPMA 5HBJA 2XNEA 3QQLA 3VIDA 2XRUA 2UW4A 5CY3A 4FZAB 1Q97A 3QYWA 2QOBA 2Q0NA 2CGUA 2YM7A 5E7RA 4ACDA 1H1RA 3SRVA 1OB3A 5AR2A 2DWBA 4JAJA 5LQFA 2RSVA 4AW1A 4I1ZA 4R7IA 1FBNA 5C4KA 2UUEA 2PZPA 2E9VA 1SVGA 4ITJA 4QNAA 2C69A 4L45A 3DBDA 3R7VA 4O7TA 3QF9A 4ZSJA 2PVYA 3VUKA 3PIZA 1PMNA 3ZLWA 4F70A 5DBXA 3LXPA 3ROYA 2JIVA 4WT6A 2H8HA 5DR6A 2Y9QA 2V22A 3GB2A 3GENA 5IH5A 4O0WA 4XLVA 3NRMA 1FOTA 1TKIA 3CJFA 4GS6A 3ZZWA 4L42A 3L8PA 1OPKA 4A4LA 4M0ZA 4XCUA 4GKIA 1XJDA 3QXPA 4AP7A 1WBOA 5FLFA 2YJSA 3UMXA 4BDJA 4V04A 4JQ8A 3UOJA 1PXOA 4IMYA 5CQWA 1CMKE 5TT7A 3VRYA 3IPHA 5K4IA 2P2HA 4S32A 4F7NA 1QMZA 3HL7A 2CCIA 3R02A 2YLEA 4O0YA 3C4ZA 3CP9A 3S95A 5JFWA 1PYEA 2X6DA 4CLJA 3BYSA 3ZCLA 4DAWA 3TM0A 2GPHA 1OL6A 3V04A 3DPKA 3FBVA 3BRBA 3LJ0A 3W2PA 4FSMA 4U45A 1MUOA 2JFMA 1QPEA 3OY1A 3EZRA 3P1AA 4U44A 5AUWA 3R9RA 2QLQA 4FKGA 4I93A 3O7LD 3HA8A 3F2NA 2G2IA 5E1SA 3FXWA 3RP9A 4HJOA 1Q5KA 3S00A 3VS6A 1CKIA 1WZYA 4C0TA 4IM0A 5CLPA 2BIKB 3R1YA 5AADA 1OITA 4FKWA 3EFLA 3QX2A 4OW8A 4BGHA 5C8MA 4AOIA 3ODZX 4RVLA 3QAME 1R0EA 5BVNA 1U54B 5KMJA 3HLLA 4RX8A 4EWQA 4IDTA 3TL8A 4F7SA 4ONAA 4QYGA 4OTRA 4QMWA 3UOKA 4ZY6A 5IZFA 4GUEA 3RVGA 3JVRA 2ERZE 4YJVA 3ORIA 2B9FA 3S2PA 1WBNA 1R78A 3CKWA 2HZIA 3MJ1A 1XR1A 4QMUA 1T45A 4FKVA 2OSCA 3FZOA 3HDMA 4YZ9A 4BDCA 3FKOA 4BDKA 2C1BA 4FV5A 1YKRA 4QMXA 3LXLA 3IGOA 1WBSA 4RJ4A 2YM4A 2J0KA 3R7OA 3PP1A 2G2FA 3FI3A 2QOIA 2F57A 4FTLA 3AC8A 4C35A 3U54A 5KMOA 4XBUA 2VD5A 2ZVAA 4PL4A 3U4UA 5DR9A 2YHVA 4NFNA 3BYMA 4BFMA 1M17A 5CF6A 5CEOA 5K3YA 3ZC6A 1U54A 3HP2A 4N57A 3KXNA 1MRYA 1KE6A 1VZOA 3A8XA 3CSVA 2XVDA 4EH7A 3E64A 5HCYA 4FA2A 4D55A 2VTNA 2BKZA 3NUSA 4IH8A 4X6RA 4YBJA 2XJ1A 4MCVA 1L8TA 5EKNA 5LOHA 3GCQA 1MQ4A 4M12A 3FY0A 4FNYA 2JAVA 3UQGA 3LMHA 4Z7HA 2RG6A 3IW8A 3DJ7A 2IPXA 3FMNA 3UP2A 5IH4A 3KFAA 1TQMA 1V0OA 3Q6WA 2PE1A 2C6EA 3OXIA 4C3FA 1Q3WA 3REPA 4Z16A 3OW3A 3G5DA 4O86A 2J5FA 1O9UA 2GNJA 4IIRA 4IAFA 3V3VA 4QOXA 3HMOA 2CN8A 2G9XA 2PVKA 3KQ7A 3SXRA 4YJNA 3ORXA 3PXKA 2V5QA 4KBCA 4DT9A 3VBWA 3MFRA 1OIRA 2P33A 5L2WA 1CDKA 1L3RE 2O8YA 4AT4A 4BKZA 4X2FA 4FNXA 2XEYA 1FINA 1IA9A 2WB8A 2UZDA 2WU6A 4FEUA 2PMOX 1F5QA 1XBBA 1CM8A 3I7CA 2BDWA 4XRLA 3TDVA 3ZH8A 4PPCA 1CTPE 4AGUA 1UU3A 4BC6A 4KKHA 3NW5A 4PTCA 4IX3A 3ORMA 1B39A 2CKQA 3OUKA 3HMMA 1UWHA 2V62A 3PWDA 3R63A 4DH7A 4JIKA 4K0YA 2WGJA 3CCNA 1JQHA 3ROCA 2PMLX 2ZJWA 3RK9A 3IW7A 4AX8A 2R3JA 3C7QA 3EB0A 4D1ZA 5CQUA 3FDNA 5BUJA 4XHKB 4FV6A 3DV3A 3R01A 4J53A 5M55A 4ASDA 5HIBA 5LVPA 3GCVA 4EQMA 3HUCA 5GHVA 2AC5A 4J95A 4EYJA 1A48A 1Q8WA 4V0GA 4KUJA 3O71A 4ENXA 3UZRA 2Z7SA 4Y72A 3H0ZA 4W9XA 4UYAA 3ZDUA 4D2RA 2XK9A 5E8VA 4M68A 5J9LA 3VUMA 2NPQA 2XKFA 1XWSA 3SXSA 2J9MA 2YZAA 4UALA 4OGRA 5IA5A 5CT7A 5IDNA 2BCJA 4IDVA 4BICA 4DFZE 5CU2A 2IN6A 4LFIA 3WF9A 3ITZA 3ZONA 1Q24A 3GU5A 5K4JA 4Y95A 5CAVA 3ZO1A 5FBNC 4DH5A 2PVMA 5JKGA 3IQ7A 5DN3A 2BVAA 3CQWA 4QMOA 3G33A 2UW8A 3L9MA 4CTBA 4GG7A 4BTKA 2J0JA 4EK6A 4Y46A 4ZY5A 2QOCA 2YZLA 1Q99A 2VWWA 2QOHA 5B2MA 3FMKA 3QQGA 1CSNA 1AGWA 2XYNA 3MVJA 3FMLA 2WTJA 5GJGA 5BVWA 4EOPA 3A7GA 1JWHA 1T46A 4GMYA 4O6LA 3BEGA 3WE4A 4CT1A 5BVOA 3DLZA 4QRCA 3CXWA 1YWVA 1WBPA 3DBEA 3C0GA 2WFYA 2QO2A 1YDTE 2XS0A 3U87A 1FGKA 3AC3A 3MDYA 2WIPA 2VTTA 2W1FA 3ORNA 3AMAA 4WO5A 3MH1A 5T6KA 3DKGA 2YITA 1EH4A 4FTCA 4O0XA 4BB4A 1XBCA 4MF1A 4UMTA 4XG8A 3R9DA 3SQQA 4N0SA 5EQPA 2BRHA 4FIJA 4JR7A 3R9HA 1IA8A 3HV6A 3R6XA 4QTCA 4RIOA 2VN9A 1XKKA 4YTFA 4JDJA 3FYJX 5M51A 3QRKA 3BWJA 2JBPA 4FVRA 3U6JA 4HVDA 4UEUA 1UU8A 4NJDA 3VULA 4JLCA 1YXUA 4O7ZA 3R1QA 5TKDA 5KBRA 4CD0A 4K1BA 4GK3A 2Q0BA 2EU9A 4N6ZA 5E8ZA 4BI0A 1H26A 1H1SA 2OF4A 5DH3A 4QP3A 5CVHA 3SHEA 3QX4A 4BWXA 3OUNB 5AP7A 4F1MA 5HEZA 1YHVA 4OBOA 3VBVA 3BX5A 1KE7A 3MN3A 4FTAA 2R3HA 5BMMA 4EK3A 2EB3A 2XNBA 3LFQA 4YR8A 1JKKA 4DGNA 3C51A 4IACA 2GHMA 2QHNA 4O27B 4L01A 4QMMA 3VQUA 1ZRZA 3D5UA 4FYNA 3WI6A 3CQEA 3VBYA 3VO3A 5FBOA 4BTFA 2W5AA 4EOLA 3P7CA 4LV5A 3W2QA 2XCKA 4PMSA 4XEYA 3UPZA 3MIYA 2FYSA 5E92A 4PTEA 3ATSA
chains in the Genus database with same CATH superfamily
2IJMA 2CNVA 4R5YA 2R3PA 3JYAA 3WOWA 4O7NA 3AMYA 3PP0A 1OM1A 2OXDA 2GDOA 3RPVA 3UC3A 4DH1A 4I0RA 4Q5HA 5ETCA 4E6QA 2VWIA 4I21A 2VTOA 2A4LA 5ICPA 2GFCA 3F5UA 3OC1A 3BCEA 3TTJA 3A8WA 4I92A 4QPSA 4R1VA 3ZEPA 4QP4A 3GOKA 4IZ5A 3W2CA 3AQVA 2FSMX 5CVGA 4RIWB 2J4ZA 3FAAA 2FSLX 4OTHA 4RA5A 3ZFYA 4IVCA 3N4UA 3QC9A 4QYFA 4XV9A 3FI8A 3NNUA 3FMEA 4MK0A 4U0IA 3Q9XA 3DT1A 4FRFA 1GIIA 4USDA 5FEDA 5IA2A 4TNBA 4FGBA 4RJ5A 5A9UA 4CLIA 4M0YA 4N6YA 2VTIA 3U6IA 2C5NA 3KULA 3BGQA 4EUTA 4J8MA 3R00A 3AD6A 3CLYA 2F7XE 3MESA 4BJJA 5JMSA 3COKA 2JKOA 4LL0A 3UIXA 4DLIA 4YTCA 4D2PA 1R0PA 4DHFA 3PA3A 5T3QA 4HZSA 4IEBA 5L2QA 2BKKA 3Q53A 2JKQA 3HAMA 1ZYJA 4LM5A 1XO2B 2R3IA 3BLQA 4D4VA 4YJRA 1W83A 4APPA 4F08A 3E62A 2WU7A 3H3CA 4NUSA 4QP8A 4E5WA 2I0HA 4RG0A 3DKCA 3HV4A 4O1OA 4E4LA 4E20A 4ASXA 2OH4A 4J97A 1GIJA 4R7BA 2GCDA 4FKSA 5A4LA 3EN6A 4V05A 2Q83A 3W8LA 4O7WA 4MBIA 4DDIA 1PHKA 4CFFA 4NSTA 1SM2A 1JKSA 2PVNA 3C0IA 4FI1A 5A46A 3HRBA 2JIIA 4RIXB 3LCDA 4K6ZA 3VQHA 2ETRA 4IX6A 4EH9A 1YHWA 4YSJA 3MTFA 3OBJA 3QWJA 1Q8YA 4M8TA 3ZFXA 4G5PA 4K2RA 1OVEA 2ZM4A 5A3XA 4DHZA 2R3RA 4E6CA 3LFAA 4TYJA 3WBLA 3QUPA 3LKMA 4NH1A 1JKTA 2ZDUA 5AP6A 4S33A 3OWPA 1PKDA 2OGVA 4N4SA 5E8YA 3RWQA 4WOVA 1Q8ZA 4FV0A 3RCDA 2YM5A 4W8EA 4M97A 3UVQA 4MXAA 3PXYA 4I0SA 3UNZA 3EHAA 2VTQA 5IMEA 4XUFA 4X7QA 3UQCA 3NAXA 4DFBA 4E26A 2B52A 4H39A 2XH5A 3CPBA 3BQCA 1JPAA 5CS6A 1J3HA 2VAGA 3OF0A 5HO8A 3P4KA 5IUHA 4YZCA 2IO6A 4PDSA 5H3QA 3SX9A 2YIYA 3U9NA 3PIYA 4KIKB 1UA2A 4ZTRA 4L3JA 4GV1A 1UNHA 3POOA 2R7IA 3OWKA 5EM6A 2OIQA 4UMQA 4V01A 5FG8A 5B2KA 4MHAA 4D2SA 2OH0E 3D5WA 4FK6A 2C5XA 4BKYA 2C0OA 5DVRA 2B9HA 4ZK5A 4FZ7A 3ZLYA 3QRIA 4IZYA 1JSTA 2WMBA 4M3QA 4U81A 3Q5ZA 4BIDA 4NM7A 1ATPE 4YHTA 5I3OA 5CZHA 1OUKA 5BUEA 1J7LA 3S4QA 2DYLA 3D2IA 2C6KA 1URWA 3OFMA 4A9SA 4CQGA 1M14A 3CR0A 5J8IA 5FEEA 4XG6A 1UV5A 2BUJA 2JFLA 4PTGA 4U42A 1OECA 4JRVA 3TNQB 3RM7A 2X0OA 3TNWA 3ZS5A 3RMFA 4KIKA 1OGYA 3NIZA 4DT8A 4KNBA 5D41A 3GCSA 4ZY4A 3E5AA 3ELJA 4APCA 5LCKA 4AXFA 5KKRB 3K2LA 3ORZA 3I60A 4IB0A 5M53A 1Y57A 4TTHB 5AP2A 5AV2A 1Q41A 5CXZA 3QKLA 5KHXA 3IW4A 3QCQA 4XH6A 2UW5A 2WZJA 2VGPA 4G16A 4F0GA 3PPJA 3QC4A 4U3YA 3NYVA 4IWDA 3SD0A 1GZ8A 1YOMA 5EKOA 4ZSGA 4L7SA 3IK3A 5CASA 2VNWA 1HCKA 3PJ8A 4ZTSA 5JEBA 2OJFE 2WIHA 4F7JA 5IA4A 1Y8GA 2OK1A 5L8JA 4EJNA 4ZLZA 4RZVA 4BZNA 3Q4CA 1DI9A 4PMMA 4BDHA 4EWHA 1YRPA 5HVJA 3OT3A 3G15A 2R0UA 4C3PA 5E8SA 3RHKA 1GZOA 2Y4IC 4I41A 3NNVA 3BHUA 4IFCA 4AQKA 1TQIA 4DEGA 3S1HA 3KF4A 5M06A 4YHJA 4KS7A 4O0VA 1BMKA 4CVAA 5HTIA 3F3VA 1RE8A 4XP0A 4DA5A 3C9WA 4FTOA 2J0MB 4G17A 1SYKA 4BBMA 3NYXA 3JUHA 3R04A 3D94A 1DI8A 2X0QA 2QCSA 2R3LA 3MB6A 3WIKA 4JL9A 2B54A 3SW7A 4AUAA 1PXMA 2OXXA 4GVAA 4DEBA 3QFVA 4F1OA 3QLFA 5AAGA 4EUUA 3PZEA 4P2KA 4RX5A 3D5VA 5DA3A 1KUTA 4DF3A 4IVBA 3LFDA 1Z9XA 4HYIA 3LLAA 3ANQA 4FTMA 3TUCA 2RFSA 4FEXA 3GU6A 2X7OA 3MB7A 3Q6UA 4MTAA 4LMUA 3JPVA 4XP3A 3EH9A 4P5QA 5GIPE 3KU2A 4MNEB 2H6DA 4JG6A 3OCBA 2QOLA 5GZ8A 3KMMA 5HORA 3W55A 2CKEA 1U4DA 4DE4A 4GSBA 2IVVA 3QYZA 5F1ZA 3VJNA 4CYIA 5LCJA 4O2ZA 2XK3A 1J1BA 3GQIA 3H0YA 3MH0A 4FSUA 3O23A 2VO3A 2YWPA 4I22A 2EXCX 3WYYA 2WAJA 5A4CA 3FKNA 5EYDA 3PVBA 5EK7A 3JVSA 4WD5A 4YJSA 4D0XA 1W8CA 4ZSAA 4LV7A 4RFZA 5E90A 4Z3VA 4G3GA 2YAKA 3NEWA 4CFWA 3FLQA 3BV2A 3ZXZA 5EQEA 2XM8A 4IVDA 1QL6A 4IHPA 5AIKA 5KE0A 3F2RA 1ZYCA 2RGPA 3BIZA 4JS8A 4D4RA 3UJGA 2IZSA 2VGOA 3KXZA 3O17A 2R3FA 1CKJA 1UKIA 1IR3A 3I0OA 2QU5A 4EHGA 4YSMA 4DTAA 3F3UA 3OVVA 3UIMA 3BV3A 3L9NA 3QCSA 1OKVA 2E9UA 5GZ9A 3TWJA 4A9UA 5JSMA 4XBRA 2XKCA 5CI6A 5I9XA 4BY9E 4O7SA 1Y6BA 2YIRA 2YA9A 4Y73A 2BZJA 1J7UA 2OLCA 2X2KA 3QTIA 4MH7A 3KA0A 4EYMA 1XH4A 1H07A 3QTZA 3PY3A 1M2QA 3OCSA 3UYTA 2RF9A 2XIXA 3NR9A 4GYIA 4XMOA 4JBQA 5CX9A 2PVHA 2WD1A 3OEFX 3UVPA 1U46A 3LLTA 4UXLA 4RPVA 5KMNA 3TEIA 3GQLA 3AD4A 3WF5A 4BZDA 2VX3A 3QD2B 2R3KA 1PMUA 4UWYA 3RAWA 2WTCA 2GS2A 3WILA 3ZZEA 1OBGA 4GIIA 2B9IA 4E8AA 3GFEA 4FL3A 4F6SA 5F94A 5J5SA 4JBOA 1ST4A 1F3MC 3D4QA 1GZNA 4M67A 1Q4LA 1G8AA 1H27A 2YCRA 2R7BA 4G31A 3RAHA 2UVXA 4Y85A 4E3CA 2YWVA 3KIOC 2J7TA 3TMOA 2OZOA 1OI9A 2ONLC 1H01A 2I0VA 4EH2A 2C47A 2PY3A 1NW1A 3ULIA 5FEQA 2XRWA 1KOAA 3HVCA 4C37A 2WTVA 2WEIA 3R0TA 2VO0A 3COIA 5BX0A 5LWNA 3GFWA 3T9IA 4UWCA 1K2PA 4AE9A 4ZSLA 3H9RA 5LVNA 2NRYA 4EBVA 3UO4A 2XB7A 4ZTHA 5KX8A 1P2AA 3F7ZA 2W1IA 3O2MA 4F0IA 2C6TA 2WTIA 4TRLA 1SMHA 5IA3A 2J50A 1H25A 3M42A 4JG7A 2CHLA 4EQCA 5AP4A 2JD5A 2F4JA 4J99A 4CSVA 1Q8TA 1SVHA 4G1WA 5I4NA 1BI7A 1KV1A 3HKOA 2GS7A 3DZQA 2VV9A 2YIWA 5D1JA 5HZNA 2W99B 2XNPA 4H05A 5JFSA 2HXLA 5DT3A 4AG8A 4DEHA 5M4FA 2WNTA 3RZBA 4GRBA 3N9XA 4JX3A 5ANIA 2C0IA 4YLKA 1UU7A 2JDSA 3PUFC 2H9VA 3FLSA 3ENHA 5DFPA 4CEGA 4TKSA 2CGXA 5IF1A 3KK8A 1ZYDA 3PWYA 3EQCA 3BPRA 3P9JA 3LXNA 1W98A 1B6CB 2FH9A 2IW6A 5LMAA 3HV7A 3V8WA 4J96A 3IDBA 4FZFB 4BDAA 3UZTA 4EJ7A 2OO8X 4FR4A 2CDZA 3O8PA 1YWNA 4WSQA 3KRRA 3DK6A 5E91A 3W32A 4X3FC 1FVVA 5BVDA 4HGEA 1OPJA 3NDMA 3P5JC 2R3MA 2QNJA 4ACCA 4K11A 5D7AA 2X8IA 4XG7A 4MUQA 4RZWA 4D28A 3OBGA 1BUHA 1PYXA 2HWPA 1Y8YA 3KGAA 4JNWA 1Q61A 3K54A 3KF7A 4FBXA 1Q62A 4L3PA 3Q04A 4HVHA 1YVJA 1XQZA 3FZTA 5TO8A 4A4XA 4EKKA 4O82A 4DHIB 5TR6A 3VBTA 5M08A 4AXEA 3R8MA 2BFXA 3Q4TA 3TI1A 3ET7A 3QL8A 4GKHA 2C5VA 3TIZA 4UB7A 5H8GA 3VHKA 1QPDA 4BHZA 3P23A 3G51A 4IW0A 5AEPA 5JRQA 3VBQA 4EH3A 1WCCA 1B38A 3GVUA 3SAYA 1REKA 3DCVA 4HCTA 2I40A 3CY3A 3GCPA 3LPBA 4L9IA 4DEAA 3V5JA 4L46A 4AN9A 2BAKA 4YC6A 5DT4A 1WVYA 2UV2A 3THBA 4I23A 2PVRA 4ZOGA 1YI4A 3QZHA 4RJ8A 2VTSA 3GT8A 4BCQA 2JLDA 4FTKA 2HW6A 2LGCA 3RKBA 4OR5A 5D11A 2WMSA 4YZMA 2JC6A 4FKRA 4ZTNA 4RBLA 4EHVA 2UZNA 4O4FA 2FSTX 3GGFA 5DPVA 3UDBA 4WBBB 4PP7A 3OT8A 2DUVA 3U9CA 1WBTA 3VNTA 4BCIA 1UKHA 3R21A 4P4CA 3RPOA 1M7QA 2G01A 4NTSA 2J6MA 3OCGA 5ANDA 4CFNA 4D9UA 5HO7A 5M56A 4NZWB 3PXQA 4OTPA 2HIWA 4DCAA 1P14A 2W17A 1YDRE 3T9TA 4YZDA 3QQHA 5IQBA 1YXSA 3C4CA 2YABA 4CFVA 4UWBA 2QU6A 3E8DA 3ZBXA 4EK4A 4UN0C 1A9UA 4CT2A 3ZUTA 2HXQA 4IZAA 4UV0A 3VW6A 4F9YA 2QO9A 2UZUE 4YMJA 2HW7A 3C4WA 2XBAA 3HGKA 4IC7A 4MD8E 4RIYB 4QYEA 5HE0A 5C27A 3O7LB 3QHRA 3VUHA 3W0RA 4BCMA 4DDGA 2P4IA 3D2KA 3QCYA 4NKSA 4F99A 2BDFA 4DG3E 2PUUA 3MA3A 3AC4A 1UNLA 5FRIA 2ZOQA 3VF9A 2XAOA 4YNEA 3EQGA 2WMQA 1NY3A 4D5HA 3FZRA 4FL2A 3BLRA 2XK6A 2XEZA 2Y8OA 2VTLA 3NW7A 3FKLA 2GNLA 3QTWA 4CCUA 4OAUC 3FI2A 1FMOE 2JKMA 4JQ7A 1I44A 2J2IB 4BYIA 4RVKA 5IQIA 3QRJA 4I5CA 4WHZA 1JOWB 3AD5A 4QQJA 2HYYA 3POZA 3L8VA 5CF4A 3NX8A 3AG9A 3T8OA 2X6EA 2PUNA 1G5SA 1WBWA 3DBCA 4B6LA 4M7IA 2FB8A 3FSKA 4GFOA 4YGAA 2C6DA 3N4VA 3QUDA 4ZZOA 5A54A 5AR4A 1Y6AA 1JVPP 4MNFA 3HYHA 4QP9A 1PRYA 3EKKA 3LFFA 3C4FA 4CXAA 4C4JA 4YC8A 5LARA 1O6KA 5L6PA 2PVLA 3LFEA 5IQCA 2QO7A 4ZMFA 3I0QA 5FQDC 4GG5A 2HY0A 3IS5A 2VRXA 2AC3A 3F3TA 4QYHA 4R3CA 4BDGA 4E1ZA 1P4FA 3HDNA 4XG9A 5G6VA 5B2LA 4AA0A 4YZNA 1KE5A 4QDEA 1ZZ2A 4FEVA 3KXMA 5T68A 3P79A 2FA2A 2Z8CA 4PMPA 4UX9A 3LZBA 2ETMA 4MD9E 4Z9LA 3TNPC 4ZLYA 2OZAB 2Z2WA 5HG7A 3D15A 4HW7A 1DS5A 3OTUA 2O2UA 4IVAA 4LQMA 4X21A 4JR3A 3MTLA 2ITYA 3F3WA 1ZXEA 3GNIB 3UIBA 4A07A 3NMUF 3UBDA 3IW6A 3EN4A 3EN5A 1PXJA 2WQEA 2NP8A 3COMA 3KXGA 3PSBA 4HCVA 3RK5A 2PL0A 3F88A 4MBLA 3E8NA 4BBEA 2WEVA 3OS3A 2PU8A 4EQUA 3CIKA 3S3IA 4F65A 3PG1A 5KCVA 1BX6A 4FIEA 4RGJA 3BU3A 3VF8A 1GIHA 3BGPA 3QZIA 4AA4A 4UMUA 4U7ZA 1V1KA 4HGSA 5LMKA 4FSNA 1X8BA 5BMSA 1H28A 2GHLA 5J9YA 5L2TA 2PZYA 3EOCA 3R8ZA 5CU6A 4CTCA 4U6RA 2PWLA 4UZDA 2R3OA 2OZAA 4G3FA 4D0WA 3P08A 4X2NA 2KULA 3VJOA 4XLIA 4YO4A 2O64A 4HNFA 4HPTE 2FO0A 2XK8A 1YI6A 3ZO4A 3NUPA 4BZOA 1CKPA 3QGYA 2ZV7A 2ITPA 3WZDA 2EUFB 4C8BA 2BDJA 3WYXA 3QA0A 4QTBA 4ACHA 2Y0AA 4C33A 2WHBA 2W96B 1PMEA 3GBZA 2I6LA 4RMZA 4WSYA 3NNWA 2IW9A 4M13A 4MX9A 3A7FA 3L1SA 5KZ0A 5CYIA 2YACA 4FNZA 1M2PA 4KA3A 4GUBA 3R7UA 4EKLA 3DBFA 2XAMA 2C6MA 4NW5A 3N4TA 4TPTA 3LIJA 5CTPA 3NGAA 5KBQA 1KE9A 4GH2A 4JRNA 3VAPA 5ETFA 3O50A 4JOAA 4AOTA 5JFVA 3ZM4A 4C36A 5KHWA 4FKOA 3DDPA 3LOKA 2HCKA 2B55A 5HOAA 2A98A 4X3JA 3SGCA 3AKJA 1FVTA 4A7CA 2YN8A 1QCFA 5J9ZA 3GOPA 3R7YA 3R71A 3MFTA 3EFKA 2F7EE 3FY2A 4MWIA 4OBPA 4ANLA 5A4QA 3GU8A 5BNJA 5DI1A 4F6WA 2NYAA 4FSWA 2H34A 3K5UA 2GNHA 3OWLA 4KSPA 5F20A 4IAZA 3MPMA 4PUZA 4XP2A 3V5LA 4HGLA 4TYHB 4CMTA 4W4VA 2WELA 4C62A 4I5PA 5FP6A 4EBWA 2CNQA 4O4BB 3D9VA 5JGBA 5CF5A 4KBKA 3NVKI 4A4OA 3PIXA 5KMMA 3BE2A 2W5HA 3RALA 1TVOA 5AMNA 5BYZA 2GQSA 2X9FA 4FC0A 4LRMA 4MXOA 5AUTA 2HZ4A 2P2IA 3LFCA 4EZ3A 2CPKE 5L2IA 3FYKX 4YHFA 1G8JA 5ANJA 1JAMA 5GNKA 5AP3A 4DLJA 2QOFA 2J90A 3W2RA 4ALUA 3EL7A 5AAFA 5HU9A 1BL7A 3NW6A 4FT0A 4QQCA 3CE3A 4BI2A 4TYHA 2YM3A 5FUTA 1OKWA 2J51A 4F4PA 4DHJA 5K0KA 5BV3A 4EORA 5HVKA 4MD7E 1H1PA 2WOUA 4NW6A 3R28A 3QD0A 3QA8A 5CEIA 4AFJA 4OAVB 3FPQA 4YLLA 2Y4IB 3VW8A 4AT3A 4CGAA 2B53A 2YDJA 3V01A 5IKWA 4C02A 5HLNA 2GHGA 4IANA 4M69B 5HBHA 2BFYA 2YM8A 1RDQE 4GFMA 4LOPA 3ZSGA 4DBNA 4XX9A 1PJKA 3ETAA 4CRSA 3TZ7A 4LGGA 2P0CA 5ANKA 4O4CA 4J7BA 2UZWE 1BL6A 3QTRA 2XCHA 2YCSA 4ZS0A 2RFDA 1YOJA 1XH6A 2XBJA 4PL3A 3V6RA 3PSCA 1FPUA 2BAJA 2C0TA 2Z60A 2B1PA 4NCTA 4RVTA 3V5QA 5B7VA 1JSVA 2PVJA 2OBJA 3QWKA 4C4IA 2X7FA 5I9VA 1O6LA 2IZUA 1Q3DA 1VYZA 4MVFA 1H8FA 4RC4A 4L3LA 4OTQA 4RWIA 3TKHA 3QQJA 3FHRA 4DFNA 3MY5A 4ERWA 1E1XA 3GC8A 4IADA 4I4FA 4KIPA 2UZLA 3LCOA 3V5TA 2CLXA 3NFGB 4O2PA 3W33A 5CEKA 5IQGA 2V0DA 5FDXA 2G15A 5JQ8A 3LE6A 4FTIA 3T3VA 3GUBA 4GCJA 4FOBA 3BLAA 3PSDA 5AM6A 4DEIA 4WA9A 5DNRA 1GNGA 2Y4PA 3DS6A 5KMLA 3ATTA 3BBTB 4FE2A 4LGDA 3KN6A 4FZDB 3NUAA 3QTUA 5BVKA 2FGIA 4IWOA 4ZSEA 4CRLA 5FDPA 3ZXTA 3MY0A 5B0XA 4AS0A 1YXVA 3PA4A 5EI2A 2GTNA 2ERKA 4LG4A 1PXPA 1SNUA 2W1CA 3SDJA 5EW9A 1WBVA 3V51A 1TFFA 1G8KA 5H8EA 5IQEA 1Z5MA 3DAJA 3EFWA 5C9CA 4C58A 3B2WA 2X2LA 2R4BA 2X4FA 4PNIA 5AX3A 4X6QC 5FXRA 1OMWA 4MF0A 3ZBFA 3R8VA 5HIDA 2PZRA 2VTPA 3C1XA 3R1SA 4RIWA 3EQRA 2VWVA 4MWHA 3WZUA 2IZRA 2WXVA 2A19B 2XZSA 4F9BA 2QURA 3AKKA 4FUYA 2XYUA 3PFYA 5IUIA 1URCA 2G1TA 4PMTA 5CXHA 3CKXA 3KRJA 4G34A 4G9CA 4EOQA 2BHHA 3DAKA 3ID6C 4GJ2A 4IM2A 2B0QA 3ZLXA 2BZIB 2EXEA 4TWNA 4PWNA 3C4EA 3TNIA 1IRKA 1STCE 3EQIA 3PJCA 4KIQA 4OTDA 2VTRA 2OJJA 5EHOA 2Y6OA 3L9LA 4JDHA 1NXKA 3EWHA 3DBQA 4HYHA 3UG1A 4FYOA 2WMTA 1YXXA 4CMUA 5IA0A 4Z55A 4JBVA 5AA9A 1YDSE 4GU6A 4JQEA 2XF0A 2C3IB 4UXQA 4BGQA 5CAPA 1H08A 3L8XA 4QP1A 5D9HA 3GP0A 4I24A 1BI8A 3EFJA 4GIHA 3MWUA 2J5EA 1JNKA 3A4OX 2FVDA 4ZZMA 3D14A 3FQSA 3LW0A 3V6SA 4BDFA 3A7JA 3E88A 4C3RA 4FSYA 5DEYA 4E6AA 3MVMA 5FM2A 5H9BA 2B4SB 3LAUA 3PYYA 5EHLA 4EOJA 5M4IA 4B0GA 3F5XA 4PY1A 4RIXA 3LMGA 4J71A 4N70A 4FIHA 4E7WA 3EMGA 5CALA 4YZBA 4U43A 5AJQA 4QQTA 3SLSA 3AC2A 5HCZA 3VUDA 2C30A 2P3GX 1ZY5A 4WG3A 5DEWA 2CCHA 2YERA 2RG5A 5IDPA 3IG7A 3I5ZA 3R8PA 4O7RA 1V0PA 4AWIA 2X9EA 2GFSA 5FGKA 4QMVA 3BGZA 3A60A 4XNEA 4EZ7A 3TZ8A 4D2TA 4BHNA 3HNGA 1ST0A 4ZLOA 2VWXA 3HEGA 2C5OA 2W7XA 1WFCA 3EN9A 4FEQA 3EN7A 3V8TA 4BGGA 4CZYB 2CMWA 3A4PA 5HG8A 1DAWA 2E2BA 1H4LA 4HVGA 4UMPA 3II5A 4D4SA 3KY2A 2GTMA 4H1JA 2HOGA 4FG9A 3O8TA 5CSPA 5KNJA 3FLZA 4IQ6A 4DGMA 4U8ZA 5J7BA 3AT2A 2BZHB 4IFGA 5DYJA 5EM8A 4LDTA 2ACXA 5AM7A 4EHEA 2E9PA 2GQRA 1OUYA 3PG3A 3OD6X 4I6BA 4ZS4A 2UZTA 4ZJVA 3BYVA 3FL4A 5LXMA 3HA6A 1YW2A 5AR5A 1KSWA 3C4XA 4EHZA 5HQ0A 1H24A 5IQDA 2WMWA 2REIA 1OL7A 3KXHA 3QQKA 4AGWA 2CKPA 5BYLA 3GI3A 2AUHA 5EI8A 5J7HA 2JDTA 5IEVA 3TKUA 3E3PA 4LUDA 4JXFA 4X3FB 2WMRA 2PE2A 3FMJA 1RQQA 3GXLA 3QXOA 3IOKA 4KS8A 1R1WA 5KMKA 3KKVA 1ZMWA 3ZM9A 4F78A 3PXZA 3AMBA 5JQ5A 5ETAA 1WVXA 5CNOA 4FG7A 5HKMA 3RK7A 1PKGA 3E8EA 3HX4A 2PVFA 4TYEA 3W2OA 5CAOA 1IASA 3BYUA 2C68A 4ZJJA 3RTPA 3I5NA 5D7VA 2ZDTA 2C6OA 2X0PA 3NAYA 1RW8A 1BLXA 4UYNA 1QPJA 3LXKA 4OUCA 4K18A 3NZ0A 4MKCA 4L00A 5A14A 3F69A 3F9NA 4O0UA 3P0MA 3NVMB 5M57A 4EOOA 3R8LA 2R3QA 5GINE 5C03A 2QKWB 5KZIA 3BHVA 2RKUA 2WQBA 4IB1A 4X3FA 4AGDA 4QMNA 4FSRA 4ANOA 3FWQA 1ZYLA 3C50A 3O8UA 5AWMA 3RINA 1GZKA 2YIXA 1W0XC 2X0GA 1H00A 1J1CA 2OJGA 4WKQA 3TZ9A 3VS3A 4BF2A 3FXXA 4E5BA 3DY7A 3BQRA 4CFXA 2X39A 2ZMDA 2XALA 2OW3A 3ZU7A 4BCPA 3CS9A 5CU3A 3VHEA 4DC2A 5LVMA 3KEXA 1PXLA 3U51A 4CZTA 3ZSHA 3C13A 5JH6A 4DEDA 4LUEA 2QI8A 3SOAA 3OROA 2C6LA 2HELA 3EYGA 4WG4A 4ZTMA 3G90X 4FEWA 5AUUA 4XG3A 1LP4A 5HBEA 3ZO2A 3D0EA 4RT7A 2VU3A 1OKYA 3KN5A 5E8UA 3DA6A 4IAAA 3KXXA 1XHAA 4BDDA 1K3AA 2UW9A 4IX5A 4KWPA 1H0WA 2A0CX 4I4EA 5DRBA 3LQ5A 5HHWA 3AKLA 3FEGA 4A06A 1PXIA 4YP8A 3K5VA 5DGZA 3VS4A 3WF7A 3W1FA 5AIRA 4OLIA 4FTRA 3LCSA 3TXOA 4HZRA 1UNGA 3OP5A 4IB3A 4NK9A 5C01A 3R30A 1NA7A 2RFNA 4C61A 2ITOA 2PUPA 4JMQA 2ZB1A 3VRZA 5EW3A 3RJCA 4ZTQA 4KIOA 4BI1A 5M44A 1S9IA 2X2MA 3MFUA 2VTHA 5HG9A 4ALVA 4CKIA 5M07A 3AGLA 2FSOX 5IPJA 4E5AX 3HV3A 3CQUA 4MNEA 3EQFA 3PLSA 3UOHA 5FD2A 3FZ1A 1YOLA 5AUXA 3TJDA 4NL0A 3TUDA 4I0TA 4L7FA 4WNKA 3RCJA 2QODA 3G6HA 4XJ0A 2Y6MA 3Q4UA 5E8TA 2XARA 1MRUA 5E1EA 3C0HA 3I79A 3UIUA 5DR2A 3DTWA 3CTQA 3H9OA 3U55A 4H36A 5HTCA 4FUXA 4TYGA 5I3RA 3GC0A 3LCTA 5D12A 4FF8A 2VTAA 2E9NA 2A1AB 4PF4A 5HU3A 3TZMA 2YAAA 4BCNA 5C1QB 3E7OA 2F7ZE 5L2SA 4XOZA 4CQEA 5FTGA 2JIUA 3CJGA 2R64A 3NYOA 1XH9A 4EEVA 1K9AA 2WOTA 4MQ1A 3Q4ZA 5I9ZA 3BZ3A 4E73A 4DH3A 4YTHA 2YDKA 2I1MA 4B8LA 4FV2A 1UVRA 5HCXA 3ULZA 3D83A 4QP7A 4FV7A 1PMVA 4FT9A 4FK3A 3PTGA 4O91A 5F4NA 4WIHA 4G6OA 3P78A 3LJ2A 4BDBA 2VNYA 5EYKA 4FKPA 4IAKA 4CCBA 3DU8A 3QD4A 5E8WA 4DTKA 3OXZA 4D2VA 2VWUA 4R7HA 4ANMA 4IE9A 3SVVA 1BYGA 4FL1A 5BUIA 2C3KA 2YEXA 3UMWA 4ASZA 4BCFA 4C2WA 3PLAE 3W0SA 4AXDA 4Y83A 3HZTA 3LQ8A 4O21A 5CSVA 5BVEA 4C59A 5GJDA 3HRFA 1M2RA 4DINA 4RQKA 4FT3A 3SXFA 4TL0A 2JBOA 2JGZA 4NIFB 4U79A 4ALWA 5F9EA 4M66A 4RX7A 4F7LA 5J1WA 3ACKA 4WUAA 4Z7GA 2XK7A 5I0BA 3TUBA 3TV6A 3BHHA 5AP0A 3DK3A 2BRBA 4MXZA 5DE2A 2YIQA 1YXTA 3O0GA 4NM0A 3TV4A 4DITA 3HMIA 5CEMA 1PF8A 1UWJA 3VUTA 3NUNA 3R2YA 3TN8A 2XM9A 3ZOSA 3EQPA 1QPCA 5IEXA 2OWBA 4FSTA 3PXRA 2QLUA 3FC2A 3PJ3A 5L4QA 1VLRA 3V5WA 4EH4A 3KB7A 3JY9A 2C1AA 2OU7A 4RFMA 5HE3A 4G3CA 4AGCA 3AT3A 4JDKA 3MY1A 4XS2A 4IAIA 3FZSA 4O22A 4FODA 4MQ2A 3IECA 3BEAA 3E93A