4YTIA

Discovery of vx-509 (decernotinib): a potent and selective janus kinase (jak) 3 inhibitor for the treatment of autoimmune disease
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
289
structure length
284
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of VX-509 (Decernotinib): A Potent and Selective Janus Kinase 3 Inhibitor for the Treatment of Autoimmune Diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
total genus 102
structure length 284
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ytiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ytiA01
3A60A 3O50A 4AZTA 4O6EA 3LFNA 4L9IA 3FV8A 3UQFA 2IVVA 5DBXA 5C03A 2JKOA 2WQBA 3WE4A 2YM6A 2QR7A 2XH5A 3OS3A 3AOXA 1H4LA 4IDVA 4C4HA 4EOPA 2DWBA 3GVUA 4QMUA 3ZC5A 4EL9A 5C26A 3V6SA 2XCKA 4W9WA 1WBOA 3AMYA 4KD1A 1NVQA 3MY5A 5AV1A 2QOOA 5A4TA 3PPJA 5EHOA 1GZKA 2O5KA 4J52A 2PZRA 3F2NA 2VTAA 4LRJA 3LMGA 5EDRA 5F95A 2XIZA 5JFXA 3F7WA 5ANDA 3KRRA 3DB8A 4MWIA 4J8NA 4D2WA 5HIDA 5F9EA 4OTWA 3W2CA 3A4PA 4X2NA 2QHNA 4V04A 1FGIA 3SQQA 4ZY5A 3EFKA 5FP6A 2C6KA 1OIUA 4C4JA 1G5SA 2UW3A 3EMGA 3SW7A 3ZMMA 5IEXA 4LOOA 3SXRA 5FXQA 5LVLA 1YOMA 3OCSA 2B54A 3LJ0A 4MXOA 5HVJA 4EHEA 3R7IA 1UVRA 3TKUA 1YOJA 2C5NA 2IWIA 3P78A 4L7SA 3MDYA 3ZBXA 4D0WA 3VS4A 5DI1A 4AOJA 4K33A 4NYEA 2R2PA 3LJ1A 5CI6A 4MAOA 1H8FA 1KV2A 3PWYA 2P4IA 3WF5A 4BCPA 4NKSA 4FKJA 4KIOA 4I24A 3DJ5A 3Q04A 3GFEA 1YDTE 3KRXA 4L45A 1WVXA 3VF8A 3D5XA 2YWVA 2CSNA 4BIBA 3O96A 4UMRA 2PVNA 4C4EA 1XBCA 1ZYLA 4GMYA 4QP4A 1WBWA 4IZ5A 3EN4A 2FH9A 3VQHA 1WVWA 1OIYA 2WU7A 4JVGA 4TT7A 4NU1A 5AIKA 1PXJA 2YACA 4I41A 3L8SA 4M8TA 4ZY4A 3RPOA 2QC6A 5K0KA 1SVEA 3FZ1A 5LMAA 3IW5A 4ZZMA 3VC4A 2OI4X 4PWNA 4DGGA 2WU6A 4R3PA 4WNKA 1SNUA 3PXQA 4G17A 3TTIA 4CTCA 2C6OA 1J1BA 5DMZA 1DS5A 4FIFA 3VUHA 1EH4A 2UZLA 3WZJA 3AC2A 3BHUA 4QT1A 2IN6A 5KHWA 2HK5A 4IB3A 3R01A 3LXLA 4AT4A 4PDYA 1JKKA 3UO4A 3CR0A 4XG4A 2EVAA 4MH7A 3JS2A 4AX8A 3QLFA 4Z9LA 2ZV2A 4FNXA 4MD8E 4ITIA 4IZYA 4IB5A 4QPSA 3SAYA 4IVDA 4RRVA 4FKOA 4PMSA 4TYEA 4BDIA 4C3RA 2GMXA 4HVGA 3ORPA 3K3IA 4FTIA 1PMUA 1UWJA 3DBDA 4ZJJA 1DM2A 2VU3A 2ZB1A 1T46A 4QMTA 1ZY4A 2WTKC 4RBLA 3NUPA 2XCHA 1Z9XA 2F2CB 3QX4A 4X21A 3IDBA 3R9NA 1J7LA 2VWVA 4MNEB 3U54A 1Q61A 4EH3A 2YIQA 4AGCA 5AV0A 4O0YA 1W98A 5E1EA 3ZRKA 4X2FA 3E3PA 2ERKA 3HECA 3KULA 4P5QA 1UNLA 3ORMA 4JS8A 3UVPA 3UP2A 2QURA 3CEKA 3D7ZA 3MJ2A 4APCA 4XRJA 3G6HA 2OF4A 4ZLZA 3C5IA 4H39A 2BCJA 4NCTC 5AAGA 1OB3A 3EQRA 3LE6A 3PSDA 2W06A 4FA2A 4FG7A 3RBWA 2W1GA 3F6XA 3GOPA 5AADA 3HA6A 5JFWA 3BE9A 3FMNA 3SHEA 1U46A 3PLSA 2VNYA 4KRDA 4F08A 4LFIA 5KNJA 4FTLA 4DH3A 3VBQA 3LMHA 3JVSA 1P4OA 3QZFA 4YSJA 4FVQA 2X7GA 4DH1A 2PVRA 5LCJA 3I60A 4OUCA 5CSWA 2XJ1A 2FSTX 5HE2A 2XK8A 2ZB0A 3LLTA 3PJ3A 5DT0A 5E1SA 1WBSA 5EQYA 2QI8A 2XRUA 3K5VA 3FZPA 2A0CX 1E1XA 1W82A 4BYIA 5EI2A 2B9JA 5A54A 3MH2A 4AZVA 4OTPA 2XIKA 2BALA 4FSNA 3F3TA 5BNJA 3R7OA 3KK9A 2BKKA 4LYNA 5G6VA 5KZ0A 4AZSA 4EUUA 2BIKB 3T3VA 4F7JA 1JOWB 1ZYJA 2BDFA 4ID7A 3S95A 4X6QC 5AJQA 4DN5A 3FQHA 4UALA 4USDA 2ZJWA 1BMKA 2R64A 3R9HA 2CLXA 3W33A 1DAYA 1JVPP 3ZS5A 3C4ZA 4ANNA 4FZ7A 2QCSA 2YM5A 5EK7A 2OICA 4WA9A 5E92A 4AWIA 2FGIA 3HYHA 4HGSA 5BX0A 3CPBA 1YOLA 1TKIA 2GNIA 2GHLA 2AC3A 4NJDA 3F3UA 2VN9A 2IO6A 4RLKA 4GYGA 2C5VA 5FDXA 4D2VA 4DG3E 4YC6A 2C5XA 1XH8A 4QP3A 5EKOA 3NSZA 3PXZA 4Q5EA 3CIKA 4DH8A 2XK7A 4EZ3A 4AA0A 1GZNA 4ZEGA 5LWMA 2FYSA 4UMTA 4RJ5A 3VQUA 4DEEA 1WMKA 3GFWA 3F9NA 4YJQA 4EOJA 4YZMA 3NCGA 2BKZA 3PIYA 3PFQA 3V01A 3G0FA 4PNIA 3TV6A 4YMJA 4KWPA 3LAUA 4HJOA 3ANQA 4KSPA 4QP2A 4ALVA 4Q9ZA 2ONLC 3MBLA 3QQGA 3U8WA 5I9YA 3D4QA 4FSUA 4CMTA 4FV7A 4M97A 4LUEA 3ZBFA 1WBVA 3I81A 4FIGA 5M4FA 4RVKA 2GS2A 3QHWA 4U42A 3IO7A 3CTJA 4JRVA 1RQQA 2UVZA 2VWYA 4J53A 3EFLA 4RIXB 3ZUVA 2YCQA 3D5UA 4FKPA 3BV3A 4XH6A 5DOSA 5HG7A 3W2SA 3R7EA 3R73A 3HV4A 2EU9A 1CTPE 3FMJA 3TNPC 5KHXA 4P7EA 4GT4A 1FMKA 3FDNA 3FPQA 5BPYA 1XH9A 4O7LA 4DITA 2EXEA 3TZ8A 3NVMB 1VZOA 4O84A 4XG9A 3RWPA 2X7OA 2E2BA 3MW1A 4AN2A 2Y4PA 4IM2A 4C33A 3MA6A 4OTFA 4YLKA 1DI8A 2YDKA 2YA9A 3H4JA 4FV2A 4Z7GA 4G1WA 4D1SA 5AUUA 3UJGA 5KX8A 5ETFA 5H9BA 2CKPA 2XKFA 3VBXA 3MN3A 5HVYA 2GNGA 4MHAA 4ZZNA 2KULA 4IC8A 2X4ZA 2IVSA 3A7JA 3OCBA 5AR5A 3RGFA 4A7CA 4FEXA 2W99B 3BU5A 4KRCA 3R02A 4FEWA 4FKQA 3LKMA 4IXPA 3LCOA 3PVBA 5LOHA 3R22A 3DK3A 4USFA 4AOTA 2X2KA 3IW6A 2IVUA 3R8ZA 2WMVA 4HCUA 5CT0A 3TCPA 2Z7RA 4W8DA 2JIVA 2QOHA 3BYMA 3SXSA 4BTJA 4BZNA 2IVTA 4MXYA 4X3FA 3Q2JA 3U9CA 3E92A 3EKKA 3G9LX 4RC4A 4RIYA 4MKCA 4D1XA 3TZ9A 4L3LA 5EW3A 4FSZA 4DTKA 3RPVA 3UQCA 5G1XA 5BYLA 3O8TA 5IH5A 1O9UA 1A48A 4IEBA 1H1QA 4AUAA 4BIEA 5AAFA 4C38A 2VNWA 4EH7A 4L01A 4MBJA 3V51A 3E63A 3OW4A 1H1RA 4QNAA 4O7ZA 2WMAA 4R6VA 3FMMA 3HGKA 2ITNA 4CYJA 5M07A 4MF1A 4BHNA 3ODYX 3COIA 2QOKA 2W96B 3AXWA 4LV5A 3CTHA 3IOPA 1NY3A 4FE2A 3E62A 3R9RA 3R1SA 1K9AA 4QTDA 2WMBA 2IG7A 2XK9A 4KA3A 1H25A 5A6NA 2BFYA 4A9SA 4ASZA 4L53A 4EOLA 4ZTNA 3QTZA 4AA5A 3JY0A 4JDIA 5LMBA 1OM1A 1VYZA 3E7VA 3ZM9A 4I5PA 2HIWA 2C3IB 4ZTSA 4D2PA 1APME 4IX6A 4I3ZA 2ITYA 4K1BA 2CJMA 3QTUA 3VBTA 1NXKA 4EWQA 4BVUA 4IAFA 4PTCA 2XNMA 4F1OA 3KMMA 5IA3A 3FE3A 4M0YA 4RQVA 4U97A 5EQEA 4EZ5A 3DJ7A 3HUBA 5IQAA 1VJYA 3JPVA 4JG8A 5FBNC 4JBQA 2JD5A 3SOAA 4GFOA 3LVPA 3FPMA 3RINA 3MV5A 2XF0A 3LXKA 4LGGA 3FMEA 5D11A 4EOSA 3DBEA 4C7TA 4C4IA 3R1QA 5ANKA 4CRLA 4U44A 3MS9A 4I5MA 3QUDA 4CFNA 1BL7A 4AZEA 3F5XA 4Z3VA 4MBLA 4ANBA 4MQ1A 4HZRA 3ZSIA 3Q53A 2OJ9A 4E8AA 4EK8A 2YIYA 4OBPA 4PL3A 1PXLA 5IZFA 3VN9A 5I9UA 4J71A 3TJCA 3TNWA 1YDRE 5FDPA 4C4GA 4FX3A 2GFSA 5FXSA 2ZAZA 4FT0A 3QXOA 2HXLA 2B4SB 4EQUA 3ZZWA 4F9BA 2VWIA 2X81A 5IQIA 2R3KA 4BBFA 2I40A 2R3OA 2UZUE 2R3RA 3O8PA 3I0QA 4IX5A 4JOAA 4EK5A 4EZ7A 2RG5A 3NUXA 4D9TA 4RVTA 3W10A 4L6QA 3U9NA 3DKOA 3EN6A 4C4FA 4JR3A 1PMEA 2HYYA 4GK4A 4A4OA 2GQGA 4AACA 3DBCA 4FUYA 5AUTA 1OECA 3TG1A 4XP3A 2JDRA 3ZU7A 4EYMA 4C58A 5CAOA 4JG6A 2B52A 2C0IA 3QHRA 3LW0A 4H3PA 2W5HA 4IM3A 4YNOA 5F20A 3KY2A 4UB7A 2BHHA 2VTNA 4PL5A 4YZBA 3FBVA 3E7OA 1XJDA 5GJDA 4OAVB 1P2AA 4C57A 4AN3A 4U0IA 4FT9A 2BZKB 2ITOA 3EFWA 1RJBA 4OW8A 3D14A 4IIRA 4IAIA 3P1AA 3A8WA 2HWPA 3GCVA 2GS7A 4AT5A 4IH8A 4L42A 4L67A 3UIMA 3CTQA 2NRYA 4HYIA 4UYAA 5DR6A 2G2HA 5L8LA 1FBNA 4GKIA 1UWHA 2VTLA 5D1JA 1OL5A 4RIWA 4ZTLA 2BAKA 5IPJA 3S4QA 2Q0NA 3W32A 2HXQA 4FBXA 3PA5A 5LARA 2YCRA 5J9LA 2OH4A 3NR9A 4TNDA 5EG3A 3FSKA 3Q4TA 5HE0A 3E8EA 5HO6A 3LZBA 5CU6A 4MNFA 2PE1A 1FVTA 4F70A 5CANA 3BU3A 3SC1A 4BTMA 3CXWA 4EH5A 2OJJA 1QPDA 3EYHA 3MVMA 3LCTA 4PY1A 5DRDA 1V0OA 4A9UA 2P3GX 3COMA 2BIYA 3TWJA 1OI9A 3EQHA 3VHEA 3WI6A 4ASEA 1FMOE 3DAKA 4AGDA 4UN0C 2E9UA 4ZTQA 3TNIA 2UZWE 3D7TA 2YHVA 4MEDA 2OW3A 5C8NA 1RW8A 5I9WA 4V0GA 2G2IA 2X9FA 2QODA 5JZJA 3BELA 3DFAA 4L00A 4CFVA 2BPMA 2ZV7A 2C30A 1IEPA 3JXWA 4RFMA 4JXFA 2CNVA 3QYZA 3RZFA 2PVLA 3NX8A 4O0VA 2O2UA 1NVSA 4TY1A 3C4FA 5CEPA 4ZMFA 1IRKA 3GC8A 3HUCA 2YZLA 3MFUA 4TN6A 5CI7A 2VX1A 4FYNA 3CGFA 1YVJA 5JK3A 2CNUA 3ZLYA 3SD0A 4GW8A 4YU2A 3DZQA 3AC1A 3GU6A 4MQ2A 1GIJA 2WMQA 4B4LA 4BR3A 4G5JA 4QYHA 4IFCA 4L52A 1OKVA 4O0TA 2OK1A 4P5ZA 3QCSA 3OF0A 3S2PA 2CKOA 3POOA 4OAUC 3OWLA 1OL1A 4RJ6A 4MD9E 4I0TA 3ZLXA 4IVBA 1OPJA 4FG9A 4LL5A 4XOYA 1GNGA 2BZIB 4WNPA 5IF1A 4F64A 5CSHA 4NK9A 4JX7A 3PSBA 4XCUA 4F1TA 4V05A 3VS7A 3NUYA 1OUYA 1XR1A 2QVSE 3SKCA 4YC8A 4FKVA 3MPAA 4JIAA 2R3IA 1OPKA 4NH1A 4CG8A 3BZ3A 4K77A 5EM8A 4NZWB 4NJ3A 4RA5A 4XG3A 4DTAA 4ERKA 5C8KA 2OJIA 4JL9A 2J7TA 5E8VA 4C34A 5HTIA 4RT7A 1YHSA 4GK3A 1R0PA 5DR2A 4OTGA 3R71A 2R3FA 2J0JA 5C27A 3KU2A 2PK9A 2PMIA 3ET7A 2UZBA 3BYVA 3PVGA 4ZOGA 3RP9A 5J9ZA 1IASA 4PUZA 4U6RA 5GZ9A 3IONA 2XNPA 4M12A 1R0EA 4EKKA 5L8JA 3FAAA 4LOPA 2Z7QA 2VTQA 2Z2WA 4YJOA 4ZLYA 3LFFA 2HY0A 1Y91A 2IZSA 2YLFA 1RDQE 3NUNA 4RZWA 5E8UA 3BEGA 3NW6A 3R9OA 4FTKA 3ZXZA 4QP7A 4W4XA 3D9VA 2WB8A 2WMSA 4EHVA 3PUPA 3Q32A 1B39A 4FTMA 1GZ8A 3FZOA 4R7IA 4YZ9A 5E91A 2HZ4A 1L3RE 3HAMA 4RX8A 1YI3A 4EH4A 2A27A 4KIQA 5FG8A 5HD7A 1ATPE 4DA5A 5GHVA 4EYJA 3AD4A 3PYYA 3ZHPC 4CLJA 5B2KA 4D4VA 4WKQA 5EW8A 2VO7A 3QRUA 3RKBA 3OWPA 4D4YA 1XH7A 4PDSA 1UKHA 3NWWA 5AR4A 5TF9A 4F7NA 4CQEA 2A19B 3MFTA 4CKRA 1QCFA 2ZM4A 4YZDA 4DLJA 3IGOA 3WZUA 4BCFA 2YZAA 3A62A 1V0PA 4LM5A 2C4GA 3FWQA 4J97A 3FZSA 3DT1A 2QOLA 3D2IA 4Q9SA 5CSXA 3TIYA 2GNJA 5A4CA 5JMSA 3BBTB 4F6UA 5ETAA 2C3LA 4S32A 4RWLA 5AR3A 3OT3A 5EHLA 2H8HA 3KULB 2J0LA 2O65A 3K54A 4ANOA 2G15A 2HWOA 2JDOA 2GPHA 4V01A 3PVWA 3ZSHA 3VUKA 4JT3A 3KMWA 4W4VA 2V7AA 2BRMA 1OBDA 3LQ8A 5IQCA 1ZZLA 3QF9A 4HW7A 3TV4A 3BKBA 5IQGA 1ZOEA 3CLYA 5EI6A 4M69A 3ORLA 4IBMA 5ANIA 3I6WA 3MYGA 1O6KA 4E1ZA 1RE8A 5C1QB 4MD7E 2X1NA 4QMOA 1E9HA 3TZMA 4DF3A 5HESA 4WNMA 2WFYA 3QCYA 3HMOA 4EK4A 4G3CA 3HV3A 4ZS0A 2AUHA 1DAWA 3UPZA 4AN9A 4P2KA 3HZTA 4PRJA 4R8QA 4GS6A 3I5ZA 5EYKA 2QOCA 1K3AA 1U4DA 3MTFA 2JEDA 3C5UA 5EHYA 3ZTXA 5AAEA 1U5QA 5HVKA 3KXHA 5E8WA 3OUKA 3QQJA 2YABA 4G2FA 3H0YA 4I22A 1H0VA 4CZTA 4HYHA 3NNUA 3UIUA 2VRXA 3GU7A 5M4CA 3LQ5A 2GQSA 5AFVA 2BRBA 2RSVA 1PMNA 5T3QA 2GTNA 4L43A 4R5YA 2RFEA 3KKVA 2JIIA 3NLBA 4CXAA 4KBCA 1XH5A 3G6GA 4ANLA 2PVJA 5HEZA 4P90A 3LFCA 5IA0A 4PP7A 3WF9A 4ASXA 1H07A 2W0JA 3SRVB 3UQGA 1YXUA 5HU3A 3WBLA 5I5ZA 4ONAA 3A4OX 4FZDB 1IA9A 1BUHA 3CQEA 4D2RA 3S1HA 4NTTA 4ZTMA 5M09A 2Y8OA 1OIRA 3DPKA 4U41A 1GAGA 1Y8YA 3DLSA 4G9CA 4YUQA 3FKNA 4FTOA 3LFBA 3PVUA 3QTXA 3U6JA 1MRYA 5HNGA 3ZLSA 4DCEA 4HVDA 3ZH8A 2VTRA 2UW8A 2C6MA 3E87A 2QU6A 2XIYA 3UOKA 4YBJA 3ZEWA 1KOBA 4U80A 4YTFA 2VTIA 4JBVA 2XBJA 3PE2A 4M14A 4MNEA 1GJOA 2GSFA 4RIXA 5AX9A 4ZJIA 3U87A 4CT2A 4FGRA 3ORXA 3BE2A 3WARA 2R9SA 4GVJA 3PRIA 3FLSA 4Y5QA 5EM6A 4U7ZA 3HAVA 5CNOA 4LRMA 2WTDA 2VTPA 3SW4A 2BRGA 2JKMA 1QPCA 3PSCA 3SVVA 2H34A 4UWCA 3E8DA 3A7GA 3DU8A 3HX4A 5DLSA 4AP7A 5I9ZA 4O7VA 3UZRA 1O6YA 1UA2A 2WMTA 5D9HA 3G2FA 4OTQA 1URWA 5GZAA 4WOVA 4FT3A 5DRBA 5KMJA 1JQHA 1KE7A 4BRXA 5F1ZA 2CGWA 5IQEA 2IZRA 3Q5IA 3VRZA 3RVGA 2QKWB 4QMVA 4YR8A 3DNEA 3WE8A 4TWCA 4AAAA 3BYSA 3NNWA 3PXYA 4QNYA 4LG4A 2WTVA 4DFZE 3NVKI 2B9IA 5CZHA 1OKZA 4X6RA 2OJFE 3O17A 5AP2A 4LGDA 1Q3WA 3OXTA 3AD5A 3OEFX 3VBWA 3PXKA 2R0IA 3LHJA 2GTMA 4QTBA 2WO6A 3IKAA 3DAJA 2VTMA 5CNNA 3WF7A 3R8PA 2ITPA 2J9MA 1OBGA 1LPUA 2R7BA 2UZNA 3QCXA 3FUPA 4JDJA 2XK6A 4OR5A 4BDEA 4EHGA 3LMIA 2QD9A 5AP4A 4O2PA 2LAVA 4FEVA 3E93A 4JAJA 5I0BA 4O7SA 5K5XA 3VNTA 4YTCA 4USEA 4QOXA 1KUTA 3LFDA 2X2LA 2GS6A 3R21A 3OT8A 4FMQA 4C61A 4F9CA 4R7HA 2WHBA 3KFAA 2CGXA 3CD8A 3GNIB 4AG8A 4FSTA 4DFYA 2XEZA 3M42A 3EN5A 3PLAE 2IPXA 4O7YA 2OJGA 1I09A 2UZTA 4C2VA 1ZLTA 4GG7A 5D12A 1SZMA 4BCHA 4M13A 3VUGA 2WTWA 3DXNA 4ZLOA 2ESMA 2X4FA 5DE2A 3PZEA 3MWUA 3R1NA 3BYOA 3UG1A 5FUTA 5DIAA 4HZSA 3R28A 4FGBA 4HVSA 5HE1A 4XBUA 5M53A 4ZAUA 5J5TA 5HKMA 2UV2A 5JH6A 2RKUA 3EQGA 4BDGA 3Q4ZA 3F82A 3W18A 1FINA 4D28A 5BUEA 4GEOA 1JSUA 2CMWA 5CAPA 4FVPA 3RHXA 1WBTA 3R1YA 4QMPA 4DC2A 1PYEA 3EJ1A 4DGNA 4EOQA 2VO0A 5HX8A 4BDCA 3PY3A 3NUAA 3FI8A 1PRYA 3Q4CA 2IW6A 4QQJA 3R7UA 2UVYA 4FV3A 2Y4IC 4FV4A 3QGWA 5T68A 3KCFA 4I5CA 4FL3A 3JUHA 3JY9A 4ZSEA 5TR6A 3G90X 4BCQA 1O6LA 3BHTA 3NIEA 4I94A 2YISA 4LRKA 2AC5A 4BI2A 3ID6C 4R7BA 2G9XA 3MESA 1ZY5A 1FGKA 3A7HA 3FHIA 3UBDA 3N51A 4AW5A 5AV3A 2PUPA 2OGVA 4FT5A 4DFUA 4ALUA 4DYMA 3BX5A 5E90A 3SRVA 4HOKA 2VO3A 3GCUA 3ZO3A 4QMXA 2REIA 2FO0A 5D10A 5BVEA 5DVRA 4ZP5A 4XG2A 3B8QA 4U3ZA 3F3VA 4O2ZA 3OFMA 3Q6WA 1BYGA 2JDVA 3RK9A 3QGYA 4FSQA 1H26A 2PVHA 4O82A 2VZ6A 4DCAA 2W1ZA 3UYTA 3QWJA 3G5DA 4TYJA 3VS2A 2OXXA 5AMNA 3UG2A 4U9AA 3TZ7A 3V8TA 2W1IA 1KE8A 5HO8A 4QTEA 2WNTA 3HMIA 3IQ7A 3RM6A 1LP4A 2F2UA 1OITA 4BDJA 5HBJA 3ATSA 4QMZA 5EI8A 4F0IA 5HX6A 4L46A 3MPTA 3H30A 3QRTA 4MYGA 1H00A 2F7XE 4O0SA 4CYIA 1MRUA 3GGFA 1MP8A 4FTUA 4Y95A 4OBOA 4R1VA 4CLIA 4EH6A 4JQ8A 4MXCA 4MK0A 1VEBA 4M84A 4L68A 5FGKA 3BEAA 4BDHA 1PXNA 2RFDA 1JSVA 2X39A 3LXPA 4BI1A 5L2IA 2O63A 4X3FC 3W2QA 1J7UA 1FOTA 3BLRA 3OWKA 4KS8A 4MTAA 5E8TA 4FF8A 5M08A 1YRPA 3EYGA 2DS1A 3GC7A 2X8EA 3HMPA 3R6XA 4ZTRA 3SX9A 5I9VA 1PY5A 3M11A 4QMLA 4CTBA 4EOKA 5CF8A 1YHWA 4G3GA 4MXZA 1H0WA 3AD6A 3FMDA 1ZXEA 4E3CA 3T9TA 5J79A 3NW7A 4EWHA 5HZNA 2Y6OA 2Q0BA 3KN5A 4FI1A 5H2UA 2BTRA 3TUDA 3DTWA 2C3JA 4OGRA 4CSVA 5LJJA 2XUUA 3FMHA 5J87A 5LVPA 2Y9QA 2BZJA 4UBAA 2PULA 3OXZA 4XG7A 4CZYB 4YJUA 5KMIA 2W7XA 5A9UA 2XJ0A 2PWLA 3Q3BA 3VJNA 2ITWA 2JLDA 3ZYAA 3QD4A 3EL7A 2ITTA 3A7FA 2PZ5A 3OY3A 4XYFA 4AXAA 3GEQA 3QRIA 5TOZA 5FM3A 4FKSA 4N0SA 4PTGA 4AW1A 3KCKA 5KMMA 4I21A 5JQ5A 5HLWA 1G3NA 4KSQA 5JN2A 5GINE 3CP9A 4XLVA 4J8MA 5HI2A 4BI0A 2BFXA 3SA0A 4TRLA 4J96A 2E9PA 4I23A 3BRBA 4ENXA 3TV7A 2R3NA 2UW7A 1TQPA 2XEYA 1J7IA 2H96A 1SYKA 4LUDA 4C0TA 3BI6A 2ONLA 1OL2A 4WNOA 4LMNA 3Q2MA 4KNBA 2FA2A 3UOJA 5A6OA 3DQXA 3LIJA 4GV1A 2RG6A 3CQUA 4E6DA 4G3FA 3DGKA 3ROCA 4FSMA 3UC3A 4AS0A 3N4VA 4O83A 1G8AA 4DEBA 2AYPA 3EN7A 4GCJA 3OXIA 3P23A 3Q60A 3MGYA 4JBPA 4L8MA 4TZRA 5ITAA 3NMUF 5CAVA 2C0TA 5IISA 3MFSA 4I1ZA 2DQ7X 1ZYCA 4G6OA 4IC7A 4KIKB 4XBRA 5DPVA 2NNWB 5CXZA 4C62A 4E6CA 3OC1A 4V0GB 4FV6A 3EL8A 5BUJA 5KMNA 2QOFA 3GI3A 3BLQA 1XBAA 4ZXTA 2PE0A 2A4LA 3O23A 4F0FA 4X0MA 1M7NA 1UV5A 3CSVA 3W55A 3F88A 5CAUA 2W4OA 5H8EA 3LFSA 5AUXA 4I93A 2OXDA 2WQOA 4ANSA 1KWPA 2J4ZA 4C59A 4IWOA 4TXCA 3L1SA 5HIBA 2J90A 2C68A 4AT3A 3NYXA 2V62A 3AC8A 4NT4A 3BHVA 3VUDA 4PV0A 4DT9A 2R3QA 1M14A 3KF4A 1KE9A 2W17A 2ITXA 4PMTA 3OBJA 5J7BA 3R7YA 1UU8A 4GRBA 2C5OA 4EI4A 2RF9A 4RC2A 4YJTA 2PVFA 4B6LA 4IB1A 5BUIA 5HG5A 3DCVA 4W4YA 4DFXE 4F09A 2WTCA 1WAKA 5E8ZA 4I5HA 4DG2E 3NIZA 4DFNA 4DLIA 3IW4A 3AT3A 4II5A 4XV2A 2FUMA 2QLUA 2YAKA 2PYWA 1Q99A 3PG1A 3EFJA 1U54B 3DQWA 1CMKE 4GFMA 3BV2A 4M68A 4YJRA 4N6YA 2PMOX 4C3FA 5I3RA 4DE4A 2BUJA 3KXMA 3E8CA 2RFNA 3LFEA 1NW1A 3QTSA 4G6LA 4O7RA 5A4QA 4HPTE 4EOMA 5AEPA 1YXTA 1XQZA 2WD1A 3FSFA 4M7IA 5IUIA 3UE4A 4ZSAA 2W5AA 3F2AA 3FJQE 3DKGA 3E64A 4AGUA 3M1SA 4TTHB 4TWNA 4EH9A 4RWKA 5HOAA 1H28A 3TDWA 3FXWA 4G31A 4XG8A 3QALE 3QD0A 3HDNA 3V04A 3CBLA 4FC0A 4KB8A 4IVCA 5AP6A 4BDDA 2ITZA 3W2PA 1IAJA 4QYGA 3JR1A 2E9NA 3WF8A 3GENA 3GCQA 1REKA 2QQ7A 2W1HA 4QMWA 3BHYA 3F5GA 4O27B 4QTCA 5DGZA 2YAAA 3CD3A 4IQ6A 3KXNA 4AW2A 5A4LA 5J5SA 4DH5A 3GC9A 4IJPA 1KSWA 2ETRA 4X2KA 5ETIA 4FYOA 5GJFA 2CKQA 3HKOA 2YM8A 3HLLA 4PMPA 3RAWA 4YLJA 3VBYA 2YDJA 3QYWA 5KKRB 1PKDA 5ETCA 3C9WA 2YITA 3UNJA 3TUCA 3FYJX 4XUFA 3MSSA 1B38A 3CGOA 2FSOX 4IX4A 5B7VA 3EQIA 2UUEA 4JQ7A 5FEQA 5FLFA 2J2IB 4RG0A 5H8BA 4UYNA 1H1WA 4BDKA 3NW5A 5FEEA 2CPKE 3BBWA 2WQNA 4AE6A 2G01A 3QQHA 4KABA 4R3CA 4IJ9A 2OG8A 3VAPA 3ZSGA 2VGPA 5HLNA 1ZZ2A 5CYIA 4EC8A 4WG4A 5A3XA 1XH6A 1JBPE 3R8UA 3FKOA 2OZOA 2WMUA 4X2GA 4BGGA 2OZAA 4KUJA 4WG3A 1OIQA 5JEBA 3KQ7A 3LOKA 2C47A 1Y6BA 5H8GA 2ETKA 3L8XA 4OTRA 4B7TA 1Q8YA 3AMAA 4YC3A 2ITUA 4LOQA 2GNFA 3HA8A 3H10A 3BCEA 5BQ0A 1SVHA 1KE6A 1OKYA 3PA4A 3EZRA 4DFBA 4CKIA 2X6DA 4WO5A 3WILA 2XM8A 3M2WA 4DHFA 5LMKA 5CTPA 4FIJA 1QMZA 2XVDA 1P4FA 3FC2A 4OLIA 4PPAA 2C6EA 1OKWA 2XRWA 3QLGA 4JR7A 4MBIA 5CF4A 5HNIX 3LM5A 4TPTA 2IZUA 3QD2B 4IANA 2WKMA 1PXMA 1OMWA 2UW5A 2VTTA 3G51A 4YZCA 4YNEA 2X8IA 4U79A 5L4QA 3DBQA 5AX3A 5JRSA 4QYEA 3NPCA 4FZAB 3FZTA 2PVMA 1Q4LA 3WYYA 4F6SA 4FV5A 3RCJA 3I1AA 3OW3A 5J1WA 3F5UA 4EBWA 4EJNA 4BC6A 1DI9A 4K9YA 4MWHA 5ANOA 3ENHA 4PMMA 4EORA 4A4LA 2JFMA 5AA8A 3EB0A 2HCKA 4QMMA 4H58A 5EM5A 4LI5A 2XS0A 5BVWA 2OWBA 5HG9A 3ZC6A 4YO4A 4XX9A 3CY2A 4GKHA 2YEXA 3WZEA 2BHEA 2OZAB 2W4KA 4Z55A 4D2SA 5BYYA 1ND4A 3GUBA 3TUBA 4CMOA 3I7CA 2WQEA 2BROA 3AC4A 3ZOSA 3RZBA 5CEQA 1YW2A 3O0GA 5IQBA 4ZZOA 4RPVA 3FLNC 2QHMA 4JIKA 4F0GA 3GOKA 3P7AA 3E3BX 2UW9A 3JVRA 5KMLA 4EONA 2YN8A 4UY9A 4FODA 2PVYA 3NZ0A 4NL0A 4FOBA 4IAYA 4O86A 4ZSJA 5CU4A 3NNXA 1BI7A 1BX6A 4O38A 4EBVA 1LR4A 1XH4A 4RWIA 1QPEA 2VWBA 5GNKA 4CT1A 1PKGA 4E5BA 2XJ2A 2GNHA 2DUVA 3VO3A 3Q5ZA 4G34A 1H27A 1MQ4A 4NIFB 3RAHA 4BZDA 1U59A 3KA0A 3PY0A 4F65A 5HHWA 2ERZE 1M17A 2Z7LA 4YP8A 2JIUA 4DEIA 4OT6A 5CY3A 3RK7A 2Q83A 2OF2A 3BPRA 2UW6A 2YIRA 4WHZA 1IAHA 3KXGA 3LFAA 4QPAA 5FEDA 3QTRA 3TKHA 4UXLA 3R63A 3WOWA 5FTQA 2WMXA 3AMBA 2C1AA 2XNOA 3DLZA 3K3JA 4AZWA 4PPBA 2YLEA 3CCNA 5IA5A 4E4XA 4E5AX 4Z16A 4BDFA 4DGLC 5KBQA 2XNGA 3HL7A 5JFSA 4F4PA 3Q52A 4FIEA 3VULA 1R39A 1Y57A 4BB4A 1PXKA 3LPBA 5E7RA 5BMMA 2KTYA 4BKJA 2B0QA 3UNKA 5IU2A 1E1VA 4KKHA 3DKCA 5K5NA 3HV7A 3CPCA 1BL6A 2CHLA 3IW8A 5HE3A 3FC1X 3R8MA 5KBRA 4H1MA 3UMWA 5E4HA 5L3AA 4AOIA 1Q8UA 3C0IA 5CQUA 5TKDA 3U4WA 1Q62A 2O64A 3QFVA 4IM0A 4LGHA 4GFGA 4LV8A 4QTAA 3FL4A 2QG7A 4PP9A 1B6CB 4LQMA 2W9ZB 4IHPA 4EUTA 2I0HA 4ZS4A 5HO7A 4QP1A 1MQBA 2GCDA 1P5EA 2UZOA 3QC9A 2XNNA 5IDPA 4YGAA 4ALWA 3RHKA 4R77A 4ANQA 3W16A 4FNZA 2CGUA 3F3ZA 4MXXA 3Q96A 4G3EA 5C9CA 3PIXA 1PYXA 2B7AA 4RFYA 3PA3A 5CENA 3OD6X 4L7FA 4ACCA 2QLQA 4O1OA 2IW8A 2XZSA 3GQLA 4L3JA 4G16A 4RGJA 2V7OA 2F7ZE 3DKFA 3H9RA 4FKTA 3U4UA 5AR8A 1JPAA 2JBPA 3OHTA 2CLQA 4E4LA 2G1TA 5B2LA 5CX9A 3KRJA 3Q9YA 3TN8A 4C35A 3QRJA 4FSRA 5KKRC 4E26A 3QTWA 4H1JA 4M66A 1M2RA 5AP3A 2W5BA 3OG7A 5CU2A 5A4EA 2HW6A 4JX3A 3AT2A 4DBNA 4Y72A 1YDSE 4NTSA 4KKGA 3LXNA 5IUHA 3ZXTA 4RVMA 4FUXA 4UXQA 2V0DA 5LVMA 4GT3A 4JQEA 4YO6A 2E9OA 3ROYA 4NW5A 5JFVA 3ULZA 1NT2A 3SV0A 5HD4A 4A9TA 2J0MB 3ACKA 1W0XC 4I4EA 4IW0A 4HVIA 1PF8A 4YTHA 3VS0A 1OVEA 4FKLA 3FLYA 4BCGA 4I20A 1YWVA 1GZOA 2PZIA 2R7IA 1A9UA 2BZHB 4FSWA 4EQMA 1REJA 4HGEA 3P08A 4ACHA 4KKEA 2XKDA 5TE0A 1WBNA 2VUWA 4M0ZA 4WT6A 4CGAA 3V3VA 4WUAA 4ARKA 3D2KA 4QYYA 3RAIA 3ZRMA 4PL4A 2OIBA 3ANRA 4WSYA 3RAKA 2WAJA 2QOQA 3PJ1A 4N6ZA 4RIYB 5CZIA 2JFLA 3RTPA 3SG8A 4TWPA 3V5TA 1YXSA 4RJ8A 2R3JA 4F9AA 4XS2A 3K5UA 5F4NA 4BWXA 5GZ8A 1K2PA 2DYLA 2HW7A 2C6LA 1S9JA 2VD5A 3Q9XA 4NUSA 3R8VA 3UNZA 3F61A 1H01A 4TYHB 4RX5A 5C01A 5ANGA 3I0OA 5IMXA 5AP7A 4RJ7A 5CF6A 3KVWA 5K9IA 1VYWA 3WZDA 2ZM1A 3QXPA 4FTCA 4I6HA 4ZSGA 3RPYA 3V5LA 3MH0A 2UZVA 3AQVA 3TDVA 3QTQA 4W4WA 5FXRA 3E88A 4DINA 4K8AA 4EK3A 5K0XA 2B1PA 3EH9A 3A7IA 3L9LA 1YI4A 3IPHA 1P14A 4XP2A 3D7TB 4GIHA 4HNFA 3O8UA 2SRCA 5DA3A 4ENYA 1A06A 2PMLX 1F0QA 2W1EA 4H36A 5HBHA 4FV1A 5CEMA 1AQ1A 4J1RA 1GOLA 4XP0A 3UMXA 2R3LA 2ZM3A 3NYVA 4EH8A 2XMYA 5E9EA 2WMRA 1Q97A 2P2IA 3S0OA 4J98A 1S9IA 2JKKA 4O0XA 4F1MA 3O71A 5JZNA 4PQNA 2OIQA 4AQCA 5CEOA 3SG9A 4G9RA 4U81A 5IDNA 3THBA 4K11A 4MXAA 4ACMA 2QOBA 5DNRA 4O7NA 5CAQA 3CC6A 3ZZEA 2HOGA 4E4MA 3GCSA 1J1CA 2Z8CA 1H1PA 4ZTHA 3UPXA 3QAME 3OOGA 3EKNA 4JNWA 2VWWA 1LEZA 3QRKA 3FQEA 3QKKA 1CKJA 3D5VA 4U3YA 4EH2A 1OL6A 4YZNA 4ANMA 5IG1A 3I6UA 4D5KA 1Z57A 1YWRA 2O8YA 3OY1A 3DOGA 1OPLA 1ZWSA 2ZYBA 3FHRA 3UP7A 4E6AA 2WIPA 3ALNA 3IOKA 5DT3A 5HORA 4RVLA 3ELJA 3DXPA 5I9XA 3F69A 3KC3A 3OEZA 5C8MA 2QR8A 4FV0A 4EOIA 3HP2A 3HV6A 4ASDA 3MTLA 4BTFA 3P5KA 2PTKA 3N4UA 1IR3A 1ZOHA 4ITHA 1HCKA 4C02A 4HCTA 2OLCA 4C37A 4DEGA 5J8IA 2GDOA 5BVKA 4F99A 4X3JA 1BI8A 5IQHA 5ACKA 2XA4A 3TACA 4PNKA 2LGCA 4H3QA 4J95A 5E8SA 4GIIA 4F7SA 3NUUA 3F3WA 4BKYA 2HENA 4XJ0A 2QU5A 3ODZX 1Q8TA 3R9DA 5JGBA 4FK6A 4IWQA 3C1XA 4PPCA 2BDWA 2XKCA 4Y85A 3ZDIA 4BDAA 3RI1A 4UMPA 4QP8A 2EWAA 5T6KA 4DBXA 5DYJA 5AV4A 4FV9A 2C1BA 5D7AA 3V8WA 3T9IA 1Q3DA 4O6LA 4CFFA 3A8XA 1XBBA 3HRFA 3C4WA 4DGOA 1H1SA 4F9YA 4LMUA 4OTHA 4QMYA 5LCKA 3R83A 4ORKA 4HYUA 3QD3A 3DB6A 4U45A 1UNGA 3KREA 4FKIA 3QQKA 5IKWA 2QOIA 4ITJA 3ZUUA 1PW2A 2HAKA 1Q5KA 1UU7A 2EB3A 5AWMA 3MB7A 4NFNA 1CSNA 3R04A 1JSTA 4YTIA 1UU3A 2J51A 3P9JA 2C3KA 1IA8A 4XV1A 2XK3A 5DFPA 5J9YA 1VR2A 2YDIA 3ETAA 4IWPA 5EFQA 4CMUA 4JAIA 4BCMA 3NS9A 4TYHA 4I6BA 5EW9A 4EC9A 3NDMA 4FK3A 3I4BA 3ORKA 1CDKA 1PXIA 3PJ2A 2BMCA 2O0UA 4FL1A 2BDJA 3CE3A 1BLXA 2XP2A 3MIYA 3MI9A 3D83A 3QL8A 1W8CA 2B53A 4JI9A 2CCIA 2XIRA 3W2OA 4C3PA 4RJ3A 4CEGA 4QYFA 5AIRA 4EOOA 5M06A 2W1FA 3KRLA 2WIHA 3OROA 3VRYA 3FLWA 1YI6A 3O2MA 3TTJA 2BAJA 3PXFA 1MUOA 3H9OA 4YPSA 3OCTA 3IG7A 3KMUA 2R5TA 2B9FA 2PZYA 2GQRA 4FTTA 2XYNA 3I7BA 3KRWA 1STCE 3E5AA 2XNBA 2Z60A 4O21A 4O96A 4S33A 4UMQA 3KN6A 4XEYA 5ANEA 4I92A 3MY0A 3VHKA 3VWAA 5LWNA 4ZMEA 3VS6A 2PUIA 2QNJA 5M51A 3ZUTA 2E9VA 3MVHA 3H9FA 3O7LB 2PUNA 1ZAOA 3ZEPA 1SM2A 2OH0E 3BGZA 4A06A 4B0GA 2V5QA 4QP6A 4NM5A 1V0BA 2WTKB 2R4BA 2RIOA 3TIZA 4CFUA 2ZDTA 2P33A 1LEWA 3RMFA 4WD5A 1OZ1A 3PG3A 2WTIA 4IVAA 5BYZA 2WPAA 3RNYA 4QMNA 1PMVA 4WSQA 5TO8A 3U51A 2NRUA 3EIDA 3ZFXA 3ZONA 5A14A 1R78A 4WUNA 1J3HA 4MX9A 5L8KA 2GHGA 2NPQA 3EQFA 1JAMA 1M7QA 3DNDA 4IMYA 3AC5A 4D58A 1JNKA 1ZOGA 2OFUA 3NNVA 3VS3A 4KBAA 4BCKA 2QONA 4FTAA 5FRIA 2HZNA 1Z5MA 3FQSA 1I44A 4QP9A 4CV9A 4BKZA 4E73A 3IECA 4BBMA 3FEGA 4JRNA 2ZMDA 4NKAA 5F94A 5GIPE 3UTOA 4GUBA 3PJ8A 3C4XA 2YJSA 4FT7A 2ZV8A 4EKLA 5JKGA 5AP0A 4D0XA 2UW0A 3CJFA 3FXXA 3LQ3A 4G5PA 4YHTA 4RMZA 1TVOA 4BF2A 2P0CA 1HCLA 5AP5A 2FB8A 4I6QA 4PF4A 4YBKA 4KAOA 3MIAA 5B2MA 4BCIA 2VTOA 3H3CA 4CFMA 5CLPA 1H24A 3EQDA 4FVRA 4HGLA 5FM2A 5ACBC 3T3UA 4JJRA 2X7FA 2Z02A 4L44A 3MH3A 4XV9A 4U43A 4RC3A 2JAVA 5CU3A 3UC4A 2P55A 1FQ1B 3QKLA 2XM9A 4B99A 1ZMUA 3FY2A 5EYCA 3WYXA 4D9UA 3LLAA 4XG6A 1KOAA 2F4JA 3B2TA 3DAEA 4DG0E 4TNBA 2OO8X 3ZCLA 3ZO4A 3UZTA 3COHA 1CKPA 3ENMA 3R00A 3R0TA 4CFWA 4Y83A 5L2QA 3Q4UA 3PRFA 5LVOA 4IX3A 4EJ7A 2X6EA 3II5A 4D55A 4FG8A 4N70A 4D4RA 3DFCB 4QQ5A 3CKXA 5DH3A 3W2RA 3DTCA 3OOMA 3OMVA 4FEQA 4GYIA 1OL7A 2YJRA 3GU8A 4YPDA 1R3CA 3SOCA 4FZ6A 3WF6A 2V22A 3GC0A 3VVHA 5AA9A 2X2MA 3PDTA 2EXMA 5IUGA 4KBKA 3POZA 3BGQA 4I0SA 4I4FA 3PXRA 4JLCA 4KINA 5AP1A 4BL1A 4IFGA 3PJCA 4K6ZA 2C0OA 4NFMA 4A07A 3VS1A 1M2QA 2WMWA 2PE2A 3WIGA 1PJKA 3U55A 4D4SA 3PPZA 4NCTA 4ACGA 3HVCA 3QBNA 1YHVA 1KV1A 3VUTA 2RFSA 1YQJA 1Q8ZA 4GH2A 4UEUA 4M15A 1ZARA 2JAMA 3UGCA 2VTHA 2O3PA 4DEDA 3BHHA 4NM7A 2YM4A 3DV3A 1OGUA 1PXOA 2B55A 3C51A 5EYDA 3OTVA 4BTKA 5BVDA 5M4UA 5LQFA 3C0HA 3A61A 3F66A 4M67A 5EOLA 3OTUA 4CKJA 1LUFA 5CQWA 3SGCA 4FKUA 3HNGA 1NVRA 4IAKA 4P4CA 4C8BA 3P7CA 4X3FB 1W84A 1GY3A 2WQMA 2WEVA 2I6LA 4IE9A 5FTOA 3VIDA 4O0UA 3DK7A 4W8EA 4WIHA 4YJVA 4E7WA 1YXXA 2H9VA 4FICA 1V1KA 3HRBA 3NAYA 5IA4A 4ZK5A 5ANJA 4NW6A 3OWJA 3QC4A 5JGDA 3Q9ZA 3CJGA 3QQFA 4QRCA 3TNHA 4CG9A 3EOCA 1XHAA 1JWHA 4G3DA 3D15A 4H3BA 5AR7A 4IB0A 5CWZA 5TT7A 1UKIA 3ZM4A 3FKLA 2JBOA 4O0RA 1ERKA 4X7QA 3TXOA 2R0UA 3KEXA 3UYSA 3QCQA 5HTCA 3R2YA 5FQDC 4QO9A 4O81A 5I3OA 5IH4A 1WVYA 1BKXA 4DT8A 2Y0AA 4MCVA 2VX0A 4UZHA 3CQWA 3VW8A 2NO3A 4IAZA 2CN8A 2QO7A 5AM7A 5CSPA 2EUFB 2J0IA 3HEGA 3KXZA 5M56A 3VF9A 4BCOA 2BRHA 3L9PA 4E4NA 4IZ7A 1ZMVA 2W1DA 3FY0A 3MB6A 4EQCA 1XKKA 3I5NA 4FKRA 5BMSA 2BAQA 3R30A 5CSVA 4BDBA 3UODA 3AGMA 4A9RA 4E6QA 5CASA 3COKA 1Q41A 2J5EA 2ZDUA 1YWNA 4XMOA 4Y46A 3DS6A 4TYIA 4AW0A 5E8YA 1OUKA 4PDOA 3U6IA 4UX9A 2WTJA 1YKRA 2VWZA 4D1ZA 3QWKA 3PWDA 1Y8GA 3RWQA 1WCCA 3DZOA 5I4NA 3UZPA 2CCHA 3GXLA 2PUUA 3OVVA 3S3IA 5JSMA 4NWMA 4Y73A 3PPKA 4FIHA 4E5WA 5FTGA 3K2LA 2XB7A 4GJ2A 2XBAA 4QMSA 4RJ4A 2VTJA 1L8TA 4S2ZA 4PTEA 4FV8A 4DFLA 1TQIA 3ZLWA 5K4IA 2Y4IB 3O51A 2UZEA 4RIOA 4CQGA 5KMOA 5KO1A 3U6HA 4FEUA 3AGLA 5D41A 5CF5A 2J5FA 2QKRA 1X8BA 4O7TA 5AUYA 3DY7A 2OXYA 4BWKA 5DR9A 4ZJVA 1MRVA 3KF7A 5LXMA 3B8RA 3DK6A 4BCNA 3D94A 4YJNA 4D5HA 5KUPA 4O7WA 2VO6A 3ITZA 3B2WA 3NAXA 4GU9A 3UOHA 3ZFYA 3QTIA 2BILB 4O1PA 5DT4A 4FNWA 1XWSA 2F9GA 4ACDA 2R3HA 3LCDA 3V5WA 2EXCX 3GQIA 3A2CA 4Y8DA 5CVGA 3VBVA 5HU9A 1WBPA 2W9FB 1PXPA 5FBOA 3GP0A 5HLPA 3C0GA 3RPSA 5DN3A 2PVKA 3PE1A 4RQKA 4AFEA 3HMNA 4BGHA 2ZOQA 5HG8A 5HNBA 4GVAA 4BICA 3C4CA 3SXFA 1SVGA 3G15A 3UO6A 5B0XA 2OFVA 2YCSA 3DBFA 3MA3A 3P79A 4ZIMA 3FI3A 3VJOA 3NYOA 1ZMWA 5DHJA 5KMKA 5KCVA 5C4LA 3EHAA 4GG5A 3R7VA 2JGZA 2WOUA 2ITVA 4F9WA 4GSBA 2J0KA 3I79A 5EQPA 2BRNA 2OBJA 4A9YA 2IJMA 4K2RA 5A46A 4J99A 2JC6A 4H05A 1SMHA 3CKWA 5K4JA 2I1MA 3LM0A 4TWOA 3RJCA 1JLUE 3EN9A 3C13A 4CD0A 4E93A 2PL0A 3KB7A 3OP5A 2BVAA 3FLQA 2CDZA 3WZKA 2PZPA 4MF0A 1SNXA 4NM0A 4RIWB 2VV9A 2I7QA 5AUWA 3N9XA 1H08A 4YJPA 4L3PA 3MVJA 4FKWA 2WGJA 2QO2A 4D2TA 1U5RA 4HNIA 4TKSA 3BLHA 2I0YA 4ERWA 5BVNA 3TI1A 4S31A 2ZV9A 4GJ3A 5HIEA 1W7HA 4N4SA 2J6MA 1PHKA 3ACJA 3MH1A 4MVFA 4AF3A 5K3YA 2OSCA 4BWPA 3GCPA 3QA0A 3L9MA 2C69A 2I0EA 4FL2A 4U8ZA 5M44A 5LMKC 4HYSA 5EKNA 4BHZA 3BQCA 3ORNA 5AV2A 3UOLA 4A4XA 3ZRLA 5HICA 2PPQA 3GT8A 3P0MA 4N57A 3IS5A 4UV0A 4XLIA 5EOBA 2CGVA 1Q8WA 4DEAA 1F3MC 2JITA 3ORTA 4HCVA 2CNQA 5EM7A 3V5JA 4APPA 3BIZA 2Y6MA 4Y5HA 3V8SA 1GIIA 2WXVA 4RSSA 3NUSA 4UWYA 3NYNA 5IQDA 2CKEA 5GJGA 4HGTA 5C4KA 4EK6A 4RWJA 3HMMA 3TEIA 4M3QA 3O7LD 4PX6A 2OKRA 2YCFA 3IK3A 3FMLA 5HCYA 5JRQA 4XHKB 2IW9A 1JKLA 4CFXA 2C6DA 3QZHA 3VS5A 1GIHA 1IG1A 3ULIA 4JDHA 2WZJA 3TM0A 5EDPA 3WIKA 3RPRA 5HGIA 2A1AB 3HDMA 2XNEA 3PIZA 3DDPA 5AUVA 5HTBA 3REPA 4Z7HA 3L8VA 3KL8A 4FTJA 2QO9A 3GBZA 3NCZA 4YLLA 2F49A 4GT5A 4O0WA 2ETMA 4YHJA 3VUMA 3QA8A 3FLZA 4LL0A 4R3RA 3P86A 5DEYA 3QX2A 3W8LA 3EZVA 4BYJA 4B8MA 1FVVA 3AG9A 4WG5A 4EEVA 2UZDA 5DWRA 4IACA 4YHFA 3RK5A 2G2FA 4WBOA 1F5QA 2HY81 3OBGA 2Y7JA 4W9XA 4O91A 3PP0A 3D5WA 5L2WA 2YM3A 3R2BA 4S30A 3S00A 3EQPA 3R8LA 5GIOE 3FZRA 5FD2A 4DTBA 3FI2A 3BWJA 3MVLA 3PP1A 4CZUA 4DGMA 5HCZA 2UVXA 4QQTA 4ZY6A 1YXVA 1M52A 3HV5A 3GB2A 2VWXA 4RFZA 2GNLA 3QUEA 4RX9A 5HBEA 4IWDA 3KGAA 3G0EA 1Y6AA 2XKEA 3NGAA 4QPMA 4J7BA 4FZFB 4S34A 5DEWA 4BY9E 2YWPA 2PSQA 4PDPA 2RGPA 1AD5A 4R78A 2V55A 4RZVA 4AGWA 2YM7A 3CY3A 1W83A 3SDJA 3P4KA 5KZIA 3MPMA 3RCDA 3F7ZA 1T45A 5KE0A 3A99A 3UVQA 4B8LA 5AR2A 2F7EE 4OTIA 5CEIA 4AA4A 3EQBA 3HRCA 3RALA 5M4IA 3HP5A 2ACXA 3G9NA 3FI4A 3Q6UA 2XIXA 5FP5A 4F6WA 4C36A 2PY3A 1G8SA 3QZIA 5D7VA 3UIBA 5LVNA 2RL5A 2WELA 4AU8A 2R3MA 3UDBA 4IZAA 4KIKA 4NM3A 4KIPA 2XYUA 5CVHA 1TQMA 2HELA 3OCGA 1ZYDA 4FTNA 4XOZA 4CCUA 3SLSA 3TL8A 5JGAA 4Q5HA 5L2SA 2R3GA 4TYGA 2YIWA 1ZYSA 4GK2A 2FVDA 4CCBA 4B9DA 5CU0A 5J1VA 1ZRZA 3LJ2A 5AM6A 4GUEA 4AFJA 2B9HA 4I6FA 4UMUA 3C7QA 2WEIA 3F5PA 3OZ6A 2EB2A 5CS6A 3PY1A 4XNEA 3VW6A 1WFCA 3ZO2A 4FOCA 4F63A 3QUPA 4BGQA 3IGGA 5BVFA 5CALA 5EH0A 4BBEA 3TJDA 3W8QA 4EHZA 4AZFA 3ALOA 5J7HA 1XO2B 4FKGA 2FSLX 4IDTA 4YJSA 5DG5A 4WBBB 2ZMCA 3L9NA 2I0VA 3Q9WA 3BWFA 1HOWA 3H0ZA 3JYAA 5M57A 2PU8A 5ICPA 4UWBA 5JQ8A 1AGWA 3MFRA 1QPJA 3OUNB 4IAAA 3TKIA 2OU7A 2JDSA 5JT2A 2VGOA 2CN5A 3MY1A 4UZDA 3L8PA 3PTGA 4DEHA 4BFMA 4U5JA 3ERKA 4HPUE 5L6OA 1JKSA 3EQCA 4OT5A 5HCXA 2FSMX 5L6WL 4GL9A 3FMKA 4FTQA 4F7LA 3ZFMA 4FR4A 3FYKX 4FTRA 4R5SA 4QMQA 5IEYA 4U40A 4IADA 2GFCA 1URCA 2P2HA 3MJ1A 4JDKA 2JKQA 3BQRA 3UIXA 2C6TA 4BIDA 4FIIA 2W05A 3LFQA 2R3PA 3V5PA 3UVRA 3FL5A 4K0YA 5M55A 2NP8A 3C50A 4GU6A 5IQFA 3BU6A 4RA4A 2WOTA 4FNYA 1CM8A 3LCKA 1U54A 1Q24A 4WRSA 3E8NA 2X9EA 2BR1A 5CEKA 3KXXA 4OTDA 3KVXA 3IDCA 1J91A 4TW9A 3F2RA 5AUZA 3ORIA 3N4TA 4K18A 3NEWA 2XK4A 3IDPA 3T8OA 3RM7A 3EWHA 4NEUA 3W1FA 4O22A 3QZGA 2PHKA 2VAGA 4C2WA 2PMNX 4X2JA 1FPUA 2Z7SA 3DJ6A 4WRGA 2GHMA 3GU5A 3AT4A 5L2TA 2YERA 4OBQA 3QKMA 1JKTA 1UU9A 5IMEA 1CKIA 5EDQA 4M69B 5IA2A 3D0EA 2BTSA 2IZTA 2J50A 3RNIA 2H6DA 5IA1A 4YURA 2JDTA 4QD6A 2YIXA 3C4EA 3ZDUA 5HQ0A 4AE9A 2ZVAA 1WZYA 4R1YA 4RX7A 1FVRA 3LCSA 5CXHA 2W1CA 2HZ0A 3PZHA 4JBOA 2C6IA 2GU8A 4QQCA 3FXZA 1R1WA 2VWUA 1NA7A 2X8DA 4ZSLA 5BVOA 3CS9A 1QL6A 1UNHA 4FSYA 5CT7A 3TNQB 3DDQA 2C5YA 3QU0A 4XRLA 5EYMA 5J95A 3DA6A 3TT0A 4G6NA 4KS7A 4DAWA 2VX3A 4YSMA 5FWKK 5H3QA 3QQLA 4BZOA 4CVAA 4RLLA 3GU4A 4BCJA 4CRSA 2W4JA 4XV3A 1M2PA 3IW7A 5L6PA 2F57A 3P7BA 3BYUA 5IH6A 4E20A 4NIFA 2OIDA 5E8XA 4CV8A 3BGPA 2ITQA 4I0RA 3ORZA 5IEVA 4Q2AA 3R7GA 2A2AA 4DH7A 3QQUA 3VUIA 4JG7A 2UW4A 3V5QA 4HVHA 3NRMA 4NSTA 4CNHA 4TL0A 5CVFA 2HZIA 3ZO1A 3ATTA 3AC3A 2VTSA 3G33A 3DXQA 2X0GA 3V6RA 2QG5A 3KK8A 4BN1A 3UO5A 2YFXA 1KE5A
chains in the Genus database with same CATH superfamily
3A60A 3O50A 4AZTA 4O6EA 3LFNA 4L9IA 3FV8A 3UQFA 2IVVA 5DBXA 4AXEA 5C03A 2JKOA 2WQBA 3WE4A 2YM6A 4O4FA 2QR7A 2XH5A 3OS3A 3AOXA 1H4LA 4IDVA 4C4HA 4EOPA 2DWBA 3GVUA 4QMUA 3ZC5A 4EL9A 5C26A 3V6SA 2XCKA 4W9WA 5BV3A 1WBOA 3AMYA 4KD1A 1NVQA 3MY5A 5AV1A 2QOOA 5A4TA 3PPJA 5EHOA 1GZKA 2O5KA 4J52A 2PZRA 3F2NA 2VTAA 4LRJA 3LMGA 5EDRA 5F95A 2XIZA 5JFXA 3F7WA 5ANDA 3KRRA 3DB8A 4MWIA 4J8NA 4D2WA 5HIDA 5F9EA 4OTWA 3W2CA 3A4PA 4X2NA 2QHNA 4V04A 1FGIA 3SQQA 4ZY5A 3EFKA 5FP6A 2C6KA 1OIUA 4C4JA 1G5SA 2UW3A 3EMGA 3SW7A 3ZMMA 5IEXA 4LOOA 3SXRA 5FXQA 5LVLA 1YOMA 3OCSA 2B54A 3LJ0A 4MXOA 5HVJA 4EHEA 3R7IA 1UVRA 3TKUA 1YOJA 2C5NA 2IWIA 3P78A 4L7SA 3MDYA 3ZBXA 4D0WA 3VS4A 5DI1A 4AOJA 4K33A 4NYEA 2R2PA 3LJ1A 5CI6A 4MAOA 1H8FA 1KV2A 3PWYA 2P4IA 3WF5A 4BCPA 4NKSA 4FKJA 4KIOA 4I24A 3DJ5A 3Q04A 4AXDA 3GFEA 1YDTE 3KRXA 4L45A 1WVXA 3VF8A 3D5XA 2YWVA 2CSNA 4BIBA 3O96A 4UMRA 2PVNA 4C4EA 1XBCA 1ZYLA 4GMYA 4QP4A 1WBWA 4IZ5A 3EN4A 2FH9A 3VQHA 1WVWA 1OIYA 2WU7A 4JVGA 4TT7A 4NU1A 5AIKA 1PXJA 2YACA 4I41A 3L8SA 4M8TA 4ZY4A 3RPOA 2QC6A 5K0KA 1SVEA 3FZ1A 5LMAA 3IW5A 4ZZMA 3VC4A 2OI4X 4PWNA 4DGGA 2WU6A 4R3PA 4WNKA 1SNUA 3PXQA 4G17A 3TTIA 4CTCA 2C6OA 1G8JA 1J1BA 4F78A 5DMZA 1DS5A 4FIFA 3VUHA 1EH4A 2UZLA 3WZJA 3AC2A 3BHUA 4QT1A 2IN6A 5KHWA 2HK5A 4IB3A 3R01A 3LXLA 4AT4A 4PDYA 1JKKA 3UO4A 3CR0A 4XG4A 2EVAA 4MH7A 2IF8A 3JS2A 4AX8A 3QLFA 4Z9LA 2ZV2A 4FNXA 4MD8E 4ITIA 4IZYA 4IB5A 4QPSA 3SAYA 4IVDA 4RRVA 4FKOA 4PMSA 4TYEA 4BDIA 4C3RA 2GMXA 4HVGA 3ORPA 3K3IA 4FTIA 1PMUA 1UWJA 3DBDA 4ZJJA 1DM2A 2VU3A 2ZB1A 1T46A 4QMTA 1ZY4A 2WTKC 4RBLA 3NUPA 2XCHA 1Z9XA 2F2CB 3QX4A 4X21A 3IDBA 3R9NA 1J7LA 2VWVA 4MNEB 3U54A 1Q61A 4EH3A 2YIQA 4AGCA 5AV0A 4O0YA 1W98A 5E1EA 3ZRKA 4X2FA 3E3PA 2ERKA 3HECA 3KULA 4P5QA 1UNLA 3ORMA 4JS8A 3UVPA 3UP2A 2QURA 3CEKA 3D7ZA 3MJ2A 4APCA 4XRJA 3G6HA 2OF4A 4ZLZA 3C5IA 4H39A 2BCJA 4NCTC 5AAGA 1OB3A 3EQRA 3LE6A 3PSDA 2W06A 4FA2A 4FG7A 3RBWA 2W1GA 3F6XA 2AQXA 3GOPA 5AADA 3HA6A 5JFWA 3BE9A 3FMNA 3SHEA 1U46A 3PLSA 2VNYA 4KRDA 4F08A 4LFIA 5KNJA 4FTLA 4DH3A 3VBQA 3LMHA 3JVSA 1P4OA 3QZFA 4YSJA 4FVQA 2X7GA 4DH1A 2PVRA 5LCJA 3I60A 4OUCA 5CSWA 2XJ1A 2FSTX 5HE2A 2XK8A 2ZB0A 3LLTA 3PJ3A 5DT0A 5E1SA 1WBSA 5EQYA 2QI8A 2XRUA 3K5VA 3FZPA 2A0CX 1E1XA 1W82A 4BYIA 5EI2A 2B9JA 5A54A 3MH2A 4AZVA 4OTPA 2XIKA 2BALA 4FSNA 3F3TA 5BNJA 3R7OA 3KK9A 2BKKA 4LYNA 5G6VA 5KZ0A 4AZSA 4EUUA 2BIKB 3T3VA 4F7JA 1JOWB 1ZYJA 2BDFA 4ID7A 3S95A 4X6QC 5AJQA 4DN5A 3FQHA 4UALA 4USDA 2ZJWA 1BMKA 2R64A 3R9HA 2CLXA 3W33A 1DAYA 1JVPP 3ZS5A 3C4ZA 4ANNA 4FZ7A 2QCSA 2YM5A 5EK7A 2OICA 4WA9A 5E92A 4AWIA 2FGIA 3HYHA 4HGSA 5BX0A 3CPBA 1YOLA 1TKIA 2GNIA 2GHLA 2AC3A 4NJDA 3F3UA 2VN9A 2IO6A 4RLKA 4GYGA 2C5VA 5FDXA 4D2VA 4DG3E 4YC6A 2C5XA 1XH8A 4QP3A 5EKOA 3BL9A 3NSZA 3PXZA 4Q5EA 3CIKA 4DH8A 2XK7A 4EZ3A 4AA0A 1GZNA 4ZEGA 5LWMA 2FYSA 4UMTA 4RJ5A 3VQUA 4DEEA 1WMKA 3GFWA 3F9NA 4YJQA 4EOJA 4YZMA 3NCGA 2BKZA 3PIYA 3PFQA 3V01A 3G0FA 4PNIA 3TV6A 4YMJA 4KWPA 3LAUA 4HJOA 3ANQA 4KSPA 4QP2A 4ALVA 4Q9ZA 2ONLC 3MBLA 3QQGA 3U8WA 5I9YA 3D4QA 4FSUA 4CMTA 4FV7A 4M97A 4LUEA 3ZBFA 1WBVA 3I81A 4FIGA 5M4FA 4RVKA 2GS2A 3QHWA 4U42A 3IO7A 3CTJA 4JRVA 1RQQA 2UVZA 2VWYA 4J53A 3EFLA 4RIXB 3ZUVA 2YCQA 3D5UA 4FKPA 3BV3A 4XH6A 5DOSA 5HG7A 3W2SA 4DDIA 3R7EA 3R73A 3HV4A 2EU9A 1CTPE 3FMJA 3TNPC 5KHXA 4P7EA 4GT4A 1FMKA 3FDNA 3FPQA 5BPYA 1XH9A 4O7LA 4DITA 2EXEA 3TZ8A 3NVMB 1VZOA 4O84A 4XG9A 3RWPA 2X7OA 2E2BA 3MW1A 4AN2A 2Y4PA 4IM2A 4C33A 3MA6A 4OTFA 4YLKA 1DI8A 2YDKA 2YA9A 3H4JA 4FV2A 4Z7GA 4G1WA 4D1SA 5AUUA 3UJGA 5KX8A 5ETFA 5H9BA 2CKPA 2XKFA 3VBXA 3MN3A 5HVYA 2GNGA 4MHAA 4ZZNA 4QEBA 2KULA 4IC8A 2X4ZA 2IVSA 3A7JA 3OCBA 5AR5A 3RGFA 4A7CA 4FEXA 2W99B 3BU5A 4KRCA 3R02A 4FEWA 4FKQA 3LKMA 4IXPA 3LCOA 3PVBA 5LOHA 3R22A 3DK3A 4USFA 4AOTA 2X2KA 3IW6A 4BJJB 2IVUA 3R8ZA 2WMVA 4HCUA 5CT0A 3TCPA 2Z7RA 4W8DA 2JIVA 2QOHA 3BYMA 3SXSA 4BTJA 4BZNA 2IVTA 4MXYA 4X3FA 1W2CA 3Q2JA 3U9CA 3E92A 3EKKA 3G9LX 4RC4A 4RIYA 4MKCA 4D1XA 3TZ9A 4L3LA 5EW3A 4FSZA 4DTKA 3RPVA 3UQCA 5G1XA 5BYLA 3O8TA 5IH5A 1O9UA 1A48A 4IEBA 1H1QA 4AUAA 4BIEA 5AAFA 4C38A 2VNWA 4EH7A 4L01A 4MBJA 3V51A 3E63A 3OW4A 1H1RA 4QNAA 4O7ZA 2WMAA 4R6VA 3FMMA 3HGKA 2ITNA 4CYJA 4AAYA 4MF1A 4BHNA 3ODYX 3COIA 2QOKA 2W96B 3AXWA 4LV5A 4MUQA 3CTHA 3IOPA 1NY3A 4FE2A 3E62A 3R9RA 3R1SA 1K9AA 4QTDA 2WMBA 2IG7A 2XK9A 4KA3A 1H25A 5A6NA 2BFYA 4A9SA 4ASZA 4L53A 4EOLA 4ZTNA 3QTZA 4AA5A 3JY0A 4JDIA 5LMBA 1OM1A 1VYZA 3E7VA 3ZM9A 4I5PA 2HIWA 2C3IB 4ZTSA 4D2PA 1APME 4IX6A 4I3ZA 2ITYA 4K1BA 2CJMA 3QTUA 3VBTA 1NXKA 4EWQA 4BVUA 4IAFA 4PTCA 2XNMA 4F1OA 3KMMA 5IA3A 3FE3A 4M0YA 4RQVA 4U97A 5EQEA 4EZ5A 3DJ7A 3HUBA 5IQAA 1VJYA 3JPVA 4JG8A 5FBNC 4JBQA 2JD5A 3SOAA 4GFOA 3LVPA 3FPMA 3RINA 3MV5A 2XF0A 3LXKA 4LGGA 1XMMA 3FMEA 5D11A 4EOSA 3DBEA 4C7TA 4C4IA 3R1QA 5ANKA 4CRLA 3KIOC 4U44A 3MS9A 4I5MA 3QUDA 4CFNA 1BL7A 4AZEA 3F5XA 4Z3VA 4MBLA 4ANBA 4MQ1A 4HZRA 3ZSIA 3Q53A 2OJ9A 4E8AA 4EK8A 2YIYA 4OBPA 4PL3A 1ST0A 1PXLA 5IZFA 3VN9A 5I9UA 4J71A 3TJCA 3TNWA 1YDRE 5FDPA 4C4GA 4FX3A 2GFSA 5FXSA 2ZAZA 4FT0A 3QXOA 2HXLA 2B4SB 4EQUA 3ZZWA 4F9BA 2VWIA 2X81A 5IQIA 2R3KA 4BBFA 2I40A 2R3OA 2UZUE 2R3RA 3O8PA 3I0QA 4IX5A 4JOAA 4EK5A 4EZ7A 2RG5A 3NUXA 4D9TA 4RVTA 3W10A 4L6QA 3U9NA 3DKOA 3EN6A 4C4FA 4JR3A 1PMEA 2HYYA 4GK4A 4A4OA 2GQGA 4AACA 3DBCA 4FUYA 5AUTA 1OECA 4O4BB 4XP3A 2JDRA 3TG1A 3ZU7A 4C58A 4EYMA 4JG6A 4DHJA 2B52A 2C0IA 3QHRA 3LW0A 4H3PA 2W5HA 4IM3A 4YNOA 5F20A 3KY2A 4UB7A 2BHHA 2VTNA 4PL5A 4YZBA 3FBVA 3E7OA 1XJDA 5GJDA 4OAVB 1P2AA 4C57A 4AN3A 4U0IA 4FT9A 2BZKB 2ITOA 3EFWA 1RJBA 4OW8A 3D14A 4IIRA 4IAIA 3P1AA 3A8WA 2HWPA 3GCVA 2GS7A 4AT5A 4IH8A 4L42A 4L67A 3UIMA 3CTQA 2NRYA 4HYIA 4UYAA 5DR6A 2G2HA 5L8LA 1FBNA 4GKIA 1UWHA 2VTLA 5D1JA 1OL5A 4RIWA 2AEGA 4ZTLA 2BAKA 5IPJA 3S4QA 2Q0NA 3W32A 2HXQA 4FBXA 3PA5A 5LARA 2YCRA 5J9LA 2OH4A 3NR9A 4TNDA 5EG3A 3FSKA 3Q4TA 5HE0A 3E8EA 5HO6A 3LZBA 5CU6A 4MNFA 2PE1A 1FVTA 4F70A 5CANA 3BU3A 3SC1A 4BTMA 3CXWA 4EH5A 2OJJA 1QPDA 3EYHA 3MVMA 3LCTA 4PY1A 5DRDA 1V0OA 4A9UA 2P3GX 3COMA 2BIYA 4O4EA 1OI9A 3EQHA 3TWJA 3VHEA 3WI6A 1FMOE 3DAKA 4AGDA 4ASEA 2E9UA 4UN0C 4DDGA 4ZTQA 3TNIA 2UZWE 3D7TA 2YHVA 4MEDA 3NFFB 2OW3A 5C8NA 1RW8A 5I9WA 4V0GA 3W0OA 2G2IA 2X9FA 2QODA 5JZJA 3BELA 3DFAA 4L00A 4CFVA 2BPMA 2ZV7A 2C30A 1IEPA 3JXWA 4RFMA 4JXFA 2CNVA 3QYZA 3RZFA 2PVLA 3NX8A 4O0VA 2O2UA 1NVSA 4TY1A 3C4FA 5CEPA 4ZMFA 1IRKA 3GC8A 3HUCA 2YZLA 3MFUA 4TN6A 5CI7A 2VX1A 4FYNA 3CGFA 1YVJA 5JK3A 2CNUA 3ZLYA 3SD0A 4GW8A 4YU2A 3DZQA 3AC1A 3GU6A 4MQ2A 1GIJA 2WMQA 4B4LA 4BR3A 4G5JA 4QYHA 4IFCA 4L52A 1OKVA 4O0TA 2OK1A 4P5ZA 3QCSA 3OF0A 3S2PA 2CKOA 3POOA 4OAUC 3OWLA 1OL1A 4RJ6A 4MD9E 4I0TA 3ZLXA 4IVBA 1OPJA 4FG9A 4LL5A 4XOYA 1GNGA 2BZIB 4WNPA 5IF1A 4F64A 5CSHA 4NK9A 4JX7A 3PSBA 4XCUA 4F1TA 4V05A 3VS7A 3NUYA 1OUYA 1XR1A 2QVSE 3SKCA 4YC8A 4FKVA 3MPAA 4JIAA 2R3IA 1OPKA 4NH1A 4CG8A 1XMLA 3BZ3A 4K77A 5EM8A 4NZWB 4NJ3A 4RA5A 4XG3A 4DTAA 4ERKA 5C8KA 2OJIA 4JL9A 2J7TA 5E8VA 4C34A 5HTIA 4RT7A 1YHSA 4GK3A 1R0PA 5DR2A 4OTGA 3R71A 2R3FA 2J0JA 5C27A 3KU2A 2PK9A 2PMIA 3ET7A 2UZBA 3BYVA 3PVGA 4ZOGA 3RP9A 5J9ZA 1IASA 4PUZA 4U6RA 5GZ9A 3IONA 2XNPA 4M12A 1R0EA 4EKKA 5L8JA 3FAAA 4LOPA 2Z7QA 2VTQA 2Z2WA 4YJOA 4ZLYA 3LFFA 2HY0A 1Y91A 2IZSA 2YLFA 1RDQE 3NUNA 4RZWA 5E8UA 3BEGA 3NW6A 3R9OA 4FTKA 3ZXZA 4QP7A 4W4XA 3D9VA 2WB8A 2WMSA 4EHVA 3PUPA 3Q32A 1B39A 4FTMA 1GZ8A 3FZOA 4R7IA 4YZ9A 5E91A 2HZ4A 1L3RE 3HAMA 4RX8A 1YI3A 4EH4A 2A27A 4KIQA 5FG8A 5HD7A 1ATPE 4DA5A 5GHVA 4EYJA 3AD4A 3PYYA 3ZHPC 4CLJA 5B2KA 4D4VA 4WKQA 5EW8A 2VO7A 3QRUA 4O4CA 3OWPA 3RKBA 4D4YA 1XH7A 4PDSA 1UKHA 3NWWA 5AR4A 5TF9A 4F7NA 4CQEA 2A19B 3MFTA 4CKRA 1QCFA 2ZM4A 4YZDA 4DLJA 3IGOA 3WZUA 4BCFA 2YZAA 3A62A 1V0PA 4LM5A 2C4GA 3FWQA 4J97A 3FZSA 3DT1A 2QOLA 3D2IA 4Q9SA 5CSXA 3TIYA 2GNJA 5A4CA 5JMSA 3BBTB 4F6UA 5ETAA 2C3LA 4S32A 4RWLA 5AR3A 3OT3A 5EHLA 2H8HA 3KULB 2J0LA 2O65A 3K54A 4ANOA 2G15A 2HWOA 2JDOA 2GPHA 4V01A 3PVWA 3ZSHA 3VUKA 4JT3A 3KMWA 4W4VA 2V7AA 2BRMA 1OBDA 3LQ8A 5IQCA 1ZZLA 3QF9A 4HW7A 3TV4A 3BKBA 5IQGA 1ZOEA 3CLYA 5EI6A 4M69A 3ORLA 4IBMA 5ANIA 3I6WA 3MYGA 1O6KA 4E1ZA 1RE8A 5C1QB 4MD7E 2X1NA 4QMOA 1E9HA 3TZMA 4DF3A 5HESA 4WNMA 2WFYA 3QCYA 3HMOA 4EK4A 4G3CA 3HV3A 4ZS0A 2X0QA 4FJVA 2AUHA 1DAWA 3P5JC 3UPZA 4AN9A 4P2KA 4JMQA 3HZTA 4PRJA 4R8QA 4GS6A 3I5ZA 5EYKA 2QOCA 1K3AA 1U4DA 3MTFA 2JEDA 3C5UA 5EHYA 3ZTXA 5AAEA 1U5QA 5HVKA 3KXHA 5E8WA 3OUKA 3QQJA 2YABA 4G2FA 3H0YA 4I22A 1H0VA 4CZTA 4HYHA 3NNUA 3UIUA 2VRXA 3GU7A 5M4CA 3LQ5A 2GQSA 5AFVA 2BRBA 2RSVA 1PMNA 5T3QA 2GTNA 4L43A 4R5YA 2RFEA 3KKVA 2JIIA 3NLBA 4CXAA 4KBCA 1XH5A 3G6GA 4ANLA 2PVJA 5HEZA 4P90A 3LFCA 5IA0A 4PP7A 3WF9A 4ASXA 1H07A 2W0JA 3SRVB 3UQGA 1YXUA 5HU3A 3WBLA 5I5ZA 4DHIB 4ONAA 3A4OX 4FZDB 1IA9A 1TFFA 1BUHA 3CQEA 4D2RA 3S1HA 4NTTA 4ZTMA 5M09A 2Y8OA 1OIRA 3DPKA 4U41A 1GAGA 1Y8YA 3DLSA 4G9CA 4YUQA 3FKNA 4FTOA 3LFBA 3PVUA 3QTXA 3U6JA 1MRYA 5HNGA 3ZLSA 4DCEA 4HVDA 3ZH8A 2VTRA 2UW8A 2C6MA 3E87A 2QU6A 2XIYA 3UOKA 4YBJA 3ZEWA 1KOBA 4U80A 4YTFA 2VTIA 4JBVA 2XBJA 3PE2A 4M14A 4MNEA 1GJOA 2GSFA 4RIXA 5AX9A 4ZJIA 3U87A 4CT2A 4FGRA 3ORXA 3BE2A 3WARA 2R9SA 2IEWA 3PRIA 4GVJA 3FLSA 4Y5QA 5EM6A 4U7ZA 3HAVA 5CNOA 4LRMA 2WTDA 2VTPA 3SW4A 2BRGA 2JKMA 1QPCA 3PSCA 3SVVA 2H34A 4UWCA 3E8DA 3A7GA 3DU8A 3HX4A 5DLSA 4AP7A 5I9ZA 4O7VA 3UZRA 1O6YA 1UA2A 2WMTA 5D9HA 3G2FA 4OTQA 1URWA 5GZAA 4WOVA 4FT3A 5DRBA 5KMJA 1JQHA 1KE7A 4BRXA 5F1ZA 2CGWA 5IQEA 2IZRA 3Q5IA 3VRZA 3RVGA 2QKWB 4QMVA 4YR8A 3DNEA 3WE8A 4TWCA 4AAAA 3BYSA 3NNWA 3PXYA 4QNYA 4LG4A 2WTVA 4DFZE 3NVKI 2B9IA 5CZHA 1OKZA 4X6RA 2OJFE 3O17A 5AP2A 4LGDA 1Q3WA 3OXTA 3AD5A 3OEFX 3VBWA 3PXKA 2R0IA 3LHJA 2GTMA 4QTBA 2WO6A 3IKAA 3DAJA 2VTMA 5CNNA 3WF7A 3R8PA 2ITPA 2J9MA 1OBGA 1LPUA 2R7BA 2UZNA 3QCXA 3FUPA 4JDJA 2XK6A 4OR5A 4BDEA 4EHGA 3LMIA 2QD9A 5AP4A 4O2PA 2LAVA 4FEVA 3E93A 4JAJA 5I0BA 4O7SA 5K5XA 3VNTA 4YTCA 4USEA 4QOXA 1KUTA 3LFDA 2X2LA 2GS6A 3R21A 3OT8A 4FMQA 4C61A 4F9CA 4R7HA 2WHBA 3KFAA 2CGXA 3CD8A 3GNIB 4AG8A 4FSTA 4DFYA 2XEZA 3M42A 3EN5A 3PLAE 2IPXA 4O7YA 2OJGA 1I09A 2UZTA 4C2VA 1ZLTA 4GG7A 5D12A 1SZMA 4BCHA 4M13A 3VUGA 2WTWA 3DXNA 4ZLOA 2ESMA 2X4FA 5DE2A 3PZEA 3MWUA 3R1NA 3BYOA 3UG1A 5FUTA 5DIAA 4HZSA 3R28A 4FGBA 4HVSA 5HE1A 4XBUA 5M53A 4ZAUA 5J5TA 5HKMA 2UV2A 5JH6A 2RKUA 3EQGA 4BDGA 3Q4ZA 3F82A 3W18A 1FINA 4D28A 5BUEA 4GEOA 1JSUA 2CMWA 5CAPA 4FVPA 3RHXA 1WBTA 3R1YA 4QMPA 4DC2A 1PYEA 3EJ1A 4DGNA 4EOQA 2VO0A 5HX8A 4BDCA 3PY3A 3NUAA 3FI8A 1PRYA 3Q4CA 2IW6A 4QQJA 3R7UA 2UVYA 4FV3A 2Y4IC 4FV4A 3QGWA 5T68A 3KCFA 4I5CA 4FL3A 3JUHA 3JY9A 4ZSEA 5TR6A 3G90X 4BCQA 1O6LA 3BHTA 3NIEA 4I94A 2YISA 4LRKA 2AC5A 4BI2A 3ID6C 4R7BA 2G9XA 3MESA 1ZY5A 1FGKA 3A7HA 3FHIA 3UBDA 3N51A 4AW5A 5AV3A 2PUPA 2OGVA 4FT5A 4DFUA 4ALUA 4DYMA 3BX5A 5E90A 3SRVA 4HOKA 2VO3A 3GCUA 3ZO3A 4QMXA 2REIA 2FO0A 5D10A 5BVEA 5DVRA 4ZP5A 4XG2A 3B8QA 4U3ZA 2ZFYA 3F3VA 4O2ZA 3OFMA 3Q6WA 1BYGA 2JDVA 3RK9A 3QGYA 4FSQA 1H26A 2PVHA 4O82A 2VZ6A 4DCAA 2W1ZA 3UYTA 3QWJA 3G5DA 4TYJA 3VS2A 2OXXA 5AMNA 3UG2A 4U9AA 3TZ7A 3V8TA 2W1IA 1KE8A 5HO8A 4QTEA 2WNTA 3HMIA 3IQ7A 3RM6A 1LP4A 2F2UA 1OITA 4BDJA 5HBJA 3ATSA 4BJJA 4QMZA 5EI8A 4F0IA 5HX6A 4L46A 3MPTA 3H30A 3QRTA 4MYGA 1H00A 2F7XE 4O0SA 4CYIA 1MRUA 2XALA 3GGFA 1MP8A 4FTUA 4Y95A 4OBOA 4R1VA 4CLIA 4EH6A 4JQ8A 4MXCA 4MK0A 1VEBA 4M84A 4L68A 5FGKA 3BEAA 4BDHA 1PXNA 2RFDA 4AXCA 1JSVA 2X39A 3LXPA 4BI1A 5L2IA 2O63A 4X3FC 3W2QA 1J7UA 1FOTA 3BLRA 3OWKA 4KS8A 4MTAA 5E8TA 4FF8A 5M08A 1YRPA 3EYGA 2DS1A 3GC7A 2X8EA 3HMPA 3R6XA 4ZTRA 3SX9A 5I9VA 1PY5A 3M11A 4QMLA 4CTBA 4EOKA 5CF8A 3W0RA 3ML1A 1YHWA 4G3GA 4MXZA 1H0WA 3AD6A 3FMDA 1ZXEA 4E3CA 3T9TA 5J79A 3NW7A 4EWHA 5HZNA 2Y6OA 2Q0BA 3KN5A 4FI1A 5H2UA 2BTRA 3TUDA 3DTWA 2C3JA 4OGRA 4CSVA 5LJJA 2XUUA 3FMHA 5J87A 5LVPA 2Y9QA 2BZJA 4UBAA 2PULA 3OXZA 4XG7A 4CZYB 4YJUA 5KMIA 2W7XA 5A9UA 2XJ0A 2PWLA 3Q3BA 3VJNA 2ITWA 2JLDA 3ZYAA 3QD4A 3EL7A 2ITTA 3A7FA 2PZ5A 3OY3A 4XYFA 4AXAA 3GEQA 3QRIA 5TOZA 5FM3A 4FKSA 4N0SA 4PTGA 4AW1A 3KCKA 5KMMA 4I21A 5JQ5A 5HLWA 1G3NA 4KSQA 5JN2A 5GINE 3CP9A 4XLVA 4J8MA 5HI2A 4BI0A 2BFXA 3SA0A 4TRLA 4J96A 2E9PA 4I23A 3BRBA 4ENXA 3TV7A 2R3NA 2UW7A 1TQPA 2XEYA 1J7IA 2H96A 1SYKA 4LUDA 4C0TA 3BI6A 2ONLA 1OL2A 4WNOA 4LMNA 3Q2MA 4KNBA 2FA2A 3UOJA 5A6OA 3DQXA 3LIJA 4GV1A 2RG6A 3CQUA 4E6DA 4G3FA 3DGKA 2NYAA 3ROCA 4FSMA 3UC3A 4AS0A 3N4VA 5CAOA 4O83A 1G8AA 4DEBA 2AYPA 3EN7A 4GCJA 3OXIA 3P23A 3Q60A 3MGYA 4JBPA 4L8MA 4TZRA 5ITAA 3NMUF 5CAVA 2C0TA 5IISA 3MFSA 4I1ZA 2DQ7X 1ZYCA 4G6OA 4IC7A 4KIKB 4XBRA 5DPVA 2NNWB 5CXZA 4C62A 4E6CA 3OC1A 4V0GB 4FV6A 3EL8A 5BUJA 5KMNA 2QOFA 3GI3A 3BLQA 1XBAA 4ZXTA 2PE0A 2A4LA 3O23A 4F0FA 4X0MA 1G8KA 1M7NA 1UV5A 3CSVA 3W55A 3F88A 5CAUA 2W4OA 5H8EA 3LFSA 5AUXA 4I93A 2OXDA 2WQOA 4ANSA 3UDSA 1KWPA 2J4ZA 4C59A 4IWOA 4TXCA 3L1SA 5HIBA 2J90A 2C68A 4AT3A 2X0PA 3NYXA 2V62A 3AC8A 4NT4A 3BHVA 3VUDA 4PV0A 4DT9A 3BL7A 2R3QA 1M14A 3KF4A 1KE9A 2W17A 2ITXA 4PMTA 3OBJA 5J7BA 3R7YA 1UU8A 4GRBA 2C5OA 4EI4A 2RF9A 4RC2A 4YJTA 2PVFA 4B6LA 4IB1A 5BUIA 5HG5A 3DCVA 4W4YA 4DFXE 4F09A 2WTCA 1WAKA 5E8ZA 4I5HA 4DG2E 3NIZA 4DFNA 4DLIA 3IW4A 3AT3A 4II5A 4XV2A 2FUMA 2QLUA 2YAKA 2PYWA 1Q99A 3PG1A 3EFJA 1U54B 3DQWA 1CMKE 4GFMA 3BV2A 4M68A 4YJRA 4N6YA 2PMOX 4C3FA 5I3RA 4DE4A 2BUJA 3KXMA 3E8CA 2RFNA 3LFEA 1NW1A 3QTSA 4G6LA 4O7RA 5A4QA 3AKLA 4HPTE 4EOMA 5AEPA 1YXTA 1XQZA 2WD1A 3FSFA 4M7IA 5IUIA 3UE4A 4ZSAA 2W5AA 3F2AA 3FJQE 3DKGA 3E64A 4AGUA 3M1SA 1TZDA 4TTHB 4TWNA 4EH9A 4RWKA 5HOAA 1H28A 3TDWA 3FXWA 4G31A 4XG8A 3QALE 3QD0A 3HDNA 3V04A 3CBLA 4FC0A 4KB8A 4IVCA 5AP6A 4BDDA 2ITZA 3W2PA 1IAJA 4QYGA 3JR1A 2E9NA 3WF8A 3GENA 3GCQA 1REKA 2QQ7A 2W1HA 4QMWA 3BHYA 3F5GA 4O27B 4QTCA 5DGZA 2YAAA 3CD3A 4IQ6A 3KXNA 4AW2A 5A4LA 5J5SA 4AQKA 4DH5A 3GC9A 4IJPA 1KSWA 2ETRA 4X2KA 5ETIA 4LDTA 4FYOA 5GJFA 2CKQA 3HKOA 2YM8A 3HLLA 4PMPA 3RAWA 4YLJA 3VBYA 2YDJA 3QYWA 5KKRB 1PKDA 5ETCA 3C9WA 2YITA 3UNJ