2GNJA

Pka three fold mutant model of rho-kinase with y-27632
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTIGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIKVADFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Structural analysis of protein kinase A mutants with Rho-kinase inhibitor specificity
pubmed doi rcsb
source organism Bos taurus
total genus 110
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gnjA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gnjA02
5H3QA 3TUBA 4QQCA 3QD3A 1ZYDA 5FD2A 5HGIA 2X6EA 2XBAA 1JWHA 1RJBA 3OEZA 4AA5A 2ITVA 4Y95A 3NSZA 5FP5A 1UU3A 3O0GA 5CEQA 3E8NA 5HTBA 3RNIA 1EH4A 2IPXA 4YBJA 4U7ZA 4IADA 1CTPE 3RZFA 5DEYA 5IQHA 4OW8A 3ZSIA 3VUHA 3GFEA 4QYFA 3CTJA 1HCLA 3VS3A 4BCFA 4FL2A 5LXMA 3E88A 4QP9A 2X2LA 4I1ZA 2OIBA 4I6FA 4DEGA 5CANA 2R3RA 3CTQA 3EQFA 1OB3A 3I5ZA 3G5DA 4CYIA 2IW9A 3NYVA 5HU9A 1A9UA 3C4CA 4FV9A 5CEOA 2V55A 3EN7A 5GJDA 3W10A 3R71A 3Q4TA 3W2QA 3ULIA 1E9HA 3R1QA 4GJ2A 3ATTA 2XNOA 2HY0A 3GNIB 2GHLA 2X7GA 3KXNA 4M14A 4M12A 3TJDA 3W1FA 4AZFA 2DQ7X 4PWNA 4IX5A 2UW0A 4H3BA 2ZJWA 5IQCA 3E63A 3V8TA 1BYGA 5A4TA 3A7IA 3ZTXA 3KFAA 1BX6A 4BCNA 5GIOE 2OXYA 5JN2A 2UW7A 2R3NA 4I92A 4K6ZA 3UODA 5CAOA 2XM9A 2CCHA 4QP3A 5GJFA 1J7LA 4YJUA 4GU9A 4C8BA 3I0QA 2IZTA 3GOKA 1STCE 4S33A 5AA8A 4LMUA 1YHVA 2C69A 1H00A 4NH1A 3RGFA 2WAJA 3ZFYA 1SYKA 3LOKA 4WBOA 4IX4A 5IA0A 3RALA 4U8ZA 4DGNA 3OOMA 2YCFA 4FKJA 1M7QA 4DF3A 5CENA 3HV7A 2J0MB 1ZOHA 2XK4A 3A8WA 1CMKE 2PE2A 2EWAA 2ZMCA 4CZUA 4BN1A 2C5OA 2JDRA 4L7SA 4HJOA 3FL4A 5EI6A 3EFLA 4C36A 2Q83A 4FZ7A 2IWIA 3HNGA 5EYCA 3CPCA 1M2RA 2IN6A 4EOPA 3KN5A 5CXHA 4MBLA 2GFCA 3QTWA 3KVXA 5DGZA 2PPQA 3BZ3A 4GFGA 3U6JA 2Y4IB 4XRLA 3D83A 4C3FA 2QI8A 4FSRA 4IAYA 5CU3A 3GU8A 5T3QA 4MCVA 4IAIA 5AP5A 5J79A 4IBMA 3NYNA 3EH9A 1JVPP 4AFJA 4C34A 2BIYA 5FP6A 4ZTNA 5FXQA 2O3PA 4XNEA 5I5ZA 3MFTA 1FQ1B 5FRIA 4EOIA 4DAWA 2RG5A 4QP2A 4ZSJA 5J87A 3MY5A 4FIFA 4JDHA 1M7NA 4I6BA 5DNRA 4FEWA 4H05A 2RG6A 4FK6A 3TZ7A 4CMOA 2HWPA 2BRHA 2BZHB 4R1YA 2HY81 5ETFA 2UUEA 3DB8A 3SV0A 3B8RA 2UZBA 1UU9A 1DM2A 1ZYLA 5CU2A 3WF6A 5M44A 5CI7A 2WQNA 4F1TA 4ERWA 2GNLA 4FTTA 2BRMA 4EZ7A 4ZEGA 4FL1A 1S9IA 3QHRA 4KSQA 4ARKA 1BKXA 2WPAA 5EKNA 1IEPA 5EQYA 3E92A 3R2YA 4IJPA 4U97A 4DG0E 3NR9A 4ASXA 4O7TA 3O7LD 3NLBA 4L3LA 4OR5A 3AXWA 4CFUA 4FSTA 2FSLX 3C0HA 3EKKA 3H30A 5B2LA 4D0XA 4YC8A 2WMUA 5L2TA 4CFMA 3ZLSA 4QQJA 3W2CA 2EU9A 1K3AA 3I79A 2VN9A 1YXTA 3NAXA 5CLPA 4YHJA 5J9YA 4R77A 4DFBA 5E1EA 2W1FA 4H3QA 4GK4A 2OK1A 3MDYA 3L8PA 1MRYA 4YC3A 1VYWA 4LI5A 5E8ZA 4O2ZA 1OKWA 3A60A 2C3JA 4LV8A 4Y83A 4OTGA 4QTDA 4KIPA 3IW8A 5LARA 1OL6A 4AN9A 2XNEA 3D5UA 2Z7RA 5L2SA 4GUBA 1WAKA 3E62A 3QCQA 4EK6A 3O8UA 4JOAA 4MD7E 3MVLA 4X6RA 1ZWSA 2R3KA 2OJGA 3NW7A 3PY3A 4JT3A 5HIEA 5EQPA 4DTKA 5AUYA 4EHZA 4O7SA 4ZMFA 3Q52A 3SD0A 2ITWA 1H0VA 3LE6A 3PE2A 1NVSA 2YM5A 1V0BA 4FKOA 2WU7A 4RJ5A 3OD6X 5DVRA 3QYZA 5EFQA 4EKKA 2FB8A 2WTVA 4H36A 5HE3A 3QCXA 3VW6A 4F1MA 4KABA 3GCSA 2E9VA 5EI8A 5LVMA 4KIOA 2OGVA 4CFWA 5KMMA 2W1HA 4I3ZA 4JR7A 3S3IA 3K5VA 2R64A 3DAKA 5EHLA 4IZ7A 4F0FA 4FG7A 5JH6A 4BDDA 3W2RA 4X2KA 1ZYCA 2WMWA 4TYEA 3ZBFA 2B9JA 3DCVA 3L8SA 3P7AA 4IZ5A 3RINA 4PF4A 1GZOA 4RWIA 1PMEA 3CIKA 1H0WA 2VTNA 2YIXA 3SOAA 5C4LA 4RIXB 2BR1A 4YUQA 2OZAB 3OXIA 5AUZA 5CI6A 3FSFA 2W1ZA 4WBBB 2O8YA 4PV0A 2F7ZE 4KIKB 4FTLA 3Q5IA 4ZTLA 3UIUA 4DEEA 3D7TA 2W1DA 4RX9A 4F6SA 5IH4A 2IVSA 4DBNA 2X8IA 2YACA 2B4SB 2YIQA 3HDNA 4WRGA 2HENA 2HK5A 5HNIX 1ZMWA 2VTIA 4FODA 4CG9A 1TQMA 1JPAA 2JDTA 2W17A 3UGCA 2V5QA 4X21A 4QMMA 3DXPA 2WEIA 3AC1A 3Q2MA 4I0TA 3VS2A 5AP3A 3SLSA 3MFSA 3PVGA 5AR2A 4OAUC 4AGCA 5KMIA 2OZOA 4YSMA 1DAYA 3F7WA 2XK6A 3UOHA 4J99A 4BR3A 5CAVA 1UNLA 4M0ZA 5IEVA 3N4UA 2JEDA 1YDTE 5CSHA 1XH8A 4L44A 1XH6A 4J8NA 4ITIA 1FMKA 5ANIA 4ASDA 2YEXA 2Y9QA 3FY2A 4DH3A 4OAVB 2YITA 1KE5A 3D14A 2CNUA 4U43A 4P7EA 2NRYA 5F95A 1QPDA 5KMLA 1H1RA 1V0OA 4NM7A 2WOTA 2JKQA 2XP2A 3E3PA 5DN3A 2VWWA 5BNJA 2J5EA 1ZY4A 4EH5A 4BICA 3F5PA 3DBQA 2FUMA 1OIQA 4C59A 5C8KA 2C3IB 4M84A 1GJOA 4TT7A 4TYIA 3ZU7A 4J1RA 4TYHA 1O9UA 3JS2A 4FYOA 1KOBA 5CY3A 1F3MC 2J2IB 5TT7A 4RWLA 2CKQA 4FBXA 2WMVA 2I0YA 2WZJA 5CTPA 2JDOA 3PXZA 2EXCX 4IWQA 4ONAA 5AV4A 1YXUA 3Q9ZA 4QMYA 3ACJA 3OC1A 3QA0A 4R7IA 4YC6A 4FI1A 3R9OA 3UO4A 5HZNA 4HGEA 3UNKA 3UQCA 5E8TA 1U5RA 3UO5A 3OS3A 5KCVA 5DT4A 3G0EA 4FT9A 4RVKA 2XKFA 3H0ZA 3PRFA 4M15A 3UVRA 3R7YA 3SOCA 2HYYA 4O0RA 5K3YA 3WF7A 3LFFA 3SRVA 4ZJIA 3F6XA 2DS1A 4CCBA 4F7LA 1V1KA 4NCTA 5BMSA 5KX8A 2EB2A 2BIKB 4MF1A 3UZRA 5FGKA 2C3KA 3IGGA 3BYSA 4NFNA 5DT0A 3S0OA 3G33A 2HCKA 4UMQA 3SW4A 1OI9A 4D1ZA 3R8VA 4NW5A 4ZIMA 3EFKA 5HX8A 3IOPA 4FT5A 4YJTA 3QKKA 2PYWA 2KTYA 5A4QA 1O6KA 5DI1A 3KREA 2QURA 3AC2A 2G2IA 4LUDA 3BE2A 4UYAA 1WBSA 2X2MA 3ANQA 3MN3A 4HNFA 4LRMA 3T8OA 3ID6C 3AGMA 4GYIA 2ACXA 4OTPA 1GIJA 5H9BA 5AWMA 1VR2A 3WIKA 2I0HA 4FTRA 2GNFA 4E6DA 4E4MA 5CU0A 4ZMEA 4O1OA 4ZTSA 4EH4A 4W8DA 4GVAA 4N4SA 5A4EA 3QTQA 2XBJA 4AS0A 4C33A 5CAQA 3EN4A 3UP7A 1M17A 1TQIA 4I24A 2QOIA 3TZMA 3IPHA 4L3PA 4V0GA 4K33A 4ACGA 4GIIA 5DMZA 4E5BA 4IEBA 1IASA 3PE1A 4ZTMA 3OCBA 4EOMA 3R83A 5F94A 3IO7A 4R8QA 4YJSA 4I6HA 1R39A 4NZWB 2VX1A 4FV7A 4YTCA 3ZRLA 4FSZA 3UIMA 3HA6A 3FLSA 4U40A 5CSWA 3UBDA 2GTMA 4WSYA 3KRXA 3O51A 3QZGA 2GFSA 3ZBXA 1Q8TA 4G6LA 4DLIA 2PUNA 2ZDTA 2I0EA 1FMOE 3BHVA 2W5AA 4I21A 4XOYA 3R02A 1CSNA 4H1MA 4AW0A 2UZDA 5D9HA 3SX9A 2P3GX 3HMPA 5L6OA 2GDOA 2XKCA 3LM0A 5L2QA 1NT2A 4Q9ZA 2UVYA 5KHXA 3O17A 1QL6A 1ZOEA 2AYPA 3R01A 3D7ZA 4GG7A 3DBFA 4NT4A 4TZRA 3V5WA 3GC8A 2DYLA 2VWVA 5DR2A 3F61A 2XZSA 3DLSA 4I41A 2OBJA 4I23A 4UMRA 4FTQA 2CGUA 4YZMA 3LPBA 3DDPA 3IDBA 2G15A 2PWLA 2J0KA 4PP7A 3C5IA 3WZJA 5B2MA 2BZIB 2C5YA 1MRUA 2ITOA 2R3HA 5CQWA 4WG5A 3V5QA 3ZLYA 3MFRA 5J9LA 5CEPA 4DT9A 5AUUA 3NUYA 4BDEA 4BCMA 5IEYA 3FPMA 4FYNA 4JDIA 1GZ8A 2ITXA 2Z8CA 4OLIA 5HCXA 2OH0E 2VGOA 4FTOA 1PW2A 4Z3VA 3CKXA 5HORA 3ZDUA 3QHWA 4RVTA 1PMVA 5BUJA 5K4IA 4C4JA 5M53A 2G2HA 1BI8A 3IOKA 4D4YA 2BRNA 5IU2A 1PKGA 4FIJA 4GK2A 4RX7A 5HIBA 3EN9A 4H1JA 3KXZA 4U80A 3QU0A 2J6MA 3O2MA 3ZM4A 4PQNA 4WUAA 4GKIA 4TWPA 1J91A 4AX8A 4UMTA 5KBQA 2FO0A 5FDXA 3NUAA 3ZRMA 3BLHA 3EJ1A 3NRMA 4O86A 2IO6A 5AV1A 4YPSA 3R1SA 4R7HA 3K3JA 3QFVA 3U4WA 4C2WA 5KMOA 4AT3A 3PIYA 5HD7A 5EDPA 4C3RA 1Y8GA 3HMIA 4G3FA 4ALUA 4FTIA 2PMLX 1CKIA 1GIHA 3TUCA 4C38A 3QTRA 3C51A 3DKOA 4BZDA 4D55A 5FQDC 1XH4A 3LMHA 3H4JA 4TNDA 1UU7A 3QTIA 4FSQA 5FWKK 5ETIA 5L8JA 1M52A 2A27A 3RI1A 3AT3A 5CU6A 2WMXA 4F9CA 4NTSA 4HGTA 5JSMA 5B2KA 3LVPA 3FI4A 2XS0A 5JT2A 3BYVA 4NWMA 2J5FA 4OBQA 3CQEA 3FLWA 4PTEA 4NM0A 4UYNA 3ZC5A 3OTUA 4FV6A 4MF0A 2WGJA 4C61A 4F64A 1J7UA 2YDKA 2C5VA 4FKGA 3VHKA 4F9BA 5LMKA 3COHA 4DEBA 1YW2A 5AAFA 1KSWA 3D4QA 4RQKA 4ACMA 2FYSA 3MFUA 4HYHA 4KKEA 4F0GA 3ZDIA 2FSOX 5E8WA 2IZSA 2X8DA 4BKYA 1P4OA 4FTKA 2NRUA 4D58A 2JAMA 2VNYA 1OKVA 3C0IA 3LCOA 2PE1A 1CKJA 2BDJA 2YHVA 4IDVA 2QCSA 4RJ6A 4ANOA 4TWCA 3VBVA 5KNJA 4O82A 4ZXTA 3R8PA 5KHWA 4L01A 4FGBA 5GZ8A 3ZUVA 5I9UA 1Y8YA 1YI3A 1YQJA 4TYGA 4PMPA 3COKA 2QODA 4NFMA 5K0XA 3GU5A 4CFXA 5IQBA 3L9MA 4O91A 4FTJA 3RCDA 2PVHA 3DFCB 3I0OA 4AZTA 2XNNA 4L3JA 4QMNA 3FMLA 2YA9A 5AP1A 3HAVA 1BL6A 3NS9A 4IFGA 5I3OA 2XNMA 4BCOA 2LGCA 4EHGA 4F4PA 4GSBA 1JOWB 3ZSHA 3ELJA 3TTIA 2W5HA 4O38A 4CLJA 4FEXA 3QRTA 2X6DA 3EN6A 4RPVA 5FTOA 4XP3A 2BHHA 4BBEA 4BB4A 3KMWA 4HYUA 1LP4A 1PY5A 5HVJA 4R3PA 5IG1A 3I5NA 4AUAA 4QPAA 4C4IA 4C4EA 4JG7A 3PSCA 4L00A 3LCSA 5IKWA 3MGYA 3BHUA 4L7FA 2H34A 3UP2A 4BZNA 4BCIA 5CU4A 3LIJA 1YOJA 3HUCA 5CQUA 3SRVB 3CSVA 2OJFE 1T45A 3BLQA 4V05A 3KEXA 4BDGA 4Z7HA 2J9MA 4LL0A 4YLLA 3TM0A 3VS6A 5I9YA 2QNJA 4FKTA 1KOAA 5DFPA 4B8MA 2PMOX 3HP5A 1ZYJA 2YISA 4H58A 3RAIA 4KRCA 3FZTA 3ZS5A 3DBCA 3S95A 2ITZA 3NNWA 4GFMA 4CQGA 1W8CA 3SKCA 2PVYA 2QOCA 5CF4A 3EL7A 3TDVA 5HBEA 4ITJA 4PTCA 4DA5A 2JDVA 3KVWA 3PYYA 3OMVA 4G9RA 4NUSA 3ZRKA 3IECA 1RE8A 3CD3A 3ALNA 4BCKA 3LFDA 2CDZA 3T9IA 3NNXA 3NAYA 3PJ2A 3EFWA 5CSXA 3LLTA 3NUUA 4IZAA 3CP9A 3TG1A 1OL5A 2ZV7A 3MB6A 4LG4A 4F9WA 3ACKA 1M2QA 2BZKB 3FMDA 2BTSA 4G3CA 4AW1A 1W83A 2VWBA 4D2PA 1WBOA 3OOGA 3PLSA 4FIGA 3UE4A 2PVRA 4RIOA 3QC9A 4YJOA 3H9RA 4PL3A 4RJ4A 5EK7A 1PHKA 1IA9A 5ITAA 2YCQA 3JY0A 3SXFA 3R2BA 5J7HA 2OFUA 1PXMA 3ORXA 2ZV2A 3LAUA 2HZNA 1PRYA 4O0XA 1NVRA 5AFVA 4XHKB 3F3ZA 3KY2A 2QG5A 2W5BA 4HNIA 2FH9A 2V62A 4IDTA 5AX9A 4I4EA 4IZYA 4F99A 2X1NA 3D15A 3TIYA 3Q2JA 5EM8A 3EQCA 3VS5A 2RFNA 4Y85A 2UZOA 2ITPA 2VTSA 2YM7A 3KRJA 3QRKA 2RF9A 4C4FA 5D41A 2OKRA 3GBZA 1YWRA 3EWHA 3FLYA 1YOMA 3A7GA 4X2JA 3HRFA 3ZO4A 1YXVA 4RC4A 2F2UA 2WHBA 1R0PA 5K4JA 3WZKA 4DGMA 3TNWA 4OGRA 2R5TA 3ODZX 4P2KA 3MA6A 4D4RA 4DFXE 4OTRA 4DTAA 3IK3A 3BHHA 3WIGA 3Q5ZA 3SHEA 3MH0A 5IF1A 3UMWA 3P23A 4XOZA 2O2UA 4FV4A 2YIYA 4FVQA 3UYTA 5EM7A 1FGKA 4TY1A 3G15A 3OW4A 5AADA 1QMZA 3MS9A 4D9TA 4YHTA 4ID7A 4FG8A 4ZTQA 4A9SA 4AGWA 3AT4A 4J71A 5HQ0A 4X0MA 4F63A 4KB8A 2O5KA 5JQ5A 2C1BA 3QD4A 5JFWA 5GINE 2X9EA 4LUEA 3NUPA 4K2RA 4QTBA 2YM4A 2C1AA 2ZM1A 4MX9A 2WTDA 2XA4A 1PJKA 5CSPA 4KRDA 3LCDA 4FUYA 5CVHA 3OF0A 4E4NA 2W1GA 3AC8A 3II5A 4FT0A 5JFXA 2YDJA 2RGPA 1OM1A 2REIA 4G34A 2CKEA 3ZLWA 4FA2A 3B8QA 2Z7LA 3MESA 1G3NA 4L8MA 1KV1A 4IVAA 4FZ6A 2HXQA 3ZO2A 2VWXA 3PVWA 1ZAOA 4RIXA 5FG8A 1H25A 2OZAA 5EDQA 5HG9A 3V5JA 4A9RA 5GJGA 5CSVA 3R7VA 5AV0A 5H8GA 5DYJA 5CF5A 1WCCA 5HNGA 3DK3A 4MBIA 2VX0A 1YHSA 3FZRA 1YWNA 1P2AA 2C6IA 3JY9A 4YTFA 2X2KA 5HO8A 5LOHA 2QHNA 1H1QA 3FQHA 4IANA 3R21A 1OPJA 3QQFA 4J98A 1GAGA 1TKIA 4G3EA 3U9CA 5EOLA 3U51A 2IW6A 4PMMA 4I22A 1Q3WA 3FHRA 4EBWA 2BFYA 4TXCA 1U54B 3QGWA 3RHKA 3G9LX 3WI6A 4F6UA 5FEEA 5A4CA 3IQ7A 4Y8DA 3NZ0A 4A7CA 2Z7QA 5I9ZA 4UXQA 3FXZA 3UTOA 4DGLC 3VBTA 1ZARA 4E4LA 4AT5A 3C9WA 3QQJA 4YTHA 3R9RA 5J95A 2Y0AA 1RQQA 2GSFA 3BLRA 4H39A 5D7VA 3QRUA 2P2IA 4Z16A 3BWJA 5HO7A 5AMNA 3BU3A 4JR3A 4NL0A 1JSTA 3CR0A 3FPQA 2BUJA 1BLXA 1U46A 4ZLOA 4EUTA 4PDOA 3F2RA 3OWPA 3AMBA 1Q8WA 3R7IA 2GNHA 4U0IA 4BWPA 5EOBA 3ITZA 3LXNA 4YSJA 1M2PA 2PVFA 4FTAA 3RP9A 3HEGA 2JDSA 3VUDA 4D5HA 3VS0A 4C0TA 4DGOA 3ZOSA 3E8DA 3GC0A 4FOCA 5HKMA 2JIIA 3W16A 2WNTA 4UY9A 5HI2A 4BFMA 2EVAA 3PRIA 3EB0A 2W06A 4P5QA 1B6CB 4PDPA 3ZH8A 4CRLA 2QU6A 3VJNA 3D94A 1NA7A 4EZ5A 2WEVA 2HZIA 3KRRA 3HA8A 2ETRA 4JG8A 4IB1A 4Q2AA 4CKRA 2VTJA 3HRCA 3ODYX 3OUKA 2P0CA 2LAVA 2XB7A 3DY7A 2JBPA 1B39A 2ITQA 4K0YA 3MW1A 3OP5A 4QMXA 3PJ8A 4CFVA 5A14A 5HLNA 3JUHA 4Y72A 4GL9A 2C0IA 3C1XA 2YAAA 4NJ3A 4NIFB 4FSMA 4YNOA 3VUTA 5BPYA 2PULA 3CTHA 5DLSA 4IB5A 3K3IA 2WQOA 2W4OA 1Q99A 4APCA 1AQ1A 3RK5A 5AV2A 3QC4A 3BX5A 4ZJJA 2GHGA 4YTIA 3KKVA 5FEQA 4MKCA 4N0SA 2ZAZA 4U6RA 4QYEA 4EQCA 3DB6A 1OPLA 2VWZA 3C5UA 3P78A 4HVGA 3ORLA 5M09A 3EZVA 3SC1A 4BIBA 4OTQA 4MWHA 4QOXA 3FAAA 4E73A 4XP2A 5C8MA 4CV8A 1ZOGA 2VAGA 2VTMA 4HYSA 3UVPA 5L8KA 4BYJA 1E1VA 3ZMMA 3ZC6A 2QU5A 3WYXA 5EW3A 5DWRA 4ZSAA 4CQEA 1Q8UA 3PG3A 4ZOGA 4QNYA 5LMAA 4AGUA 3ZO3A 3UDBA 4XV9A 3E7VA 3LW0A 3DA6A 4I5HA 4L42A 3LZBA 2W1IA 3HKOA 4PP9A 1JQHA 1GZNA 4FVPA 4TYJA 4BZOA 2IZUA 5LCJA 3DOGA 3O8TA 3FKNA 2PL0A 2XMYA 3ORMA 4FZFB 4QP1A 2QO2A 3NYOA 1O6YA 2GU8A 4HCVA 5KZ0A 5LVOA 3EOCA 3SDJA 3RZBA 2OI4X 1Q97A 4S34A 3TL8A 3CBLA 2J0JA 4UV0A 2VO0A 5HOAA 1A48A 4D0WA 2HELA 2XRWA 3ENMA 3O96A 2E9UA 4E26A 3Q3BA 2RKUA 1HOWA 3OXZA 2XIXA 4OUCA 2QOLA 4IWOA 4IMYA 2QR7A 3RPRA 3SXSA 4AACA 4WOVA 4C4GA 4JRNA 3MBLA 4O2PA 4ANSA 4E6QA 3P5KA 2YABA 4IH8A 2I7QA 4I5MA 4IAFA 3SXRA 2OSCA 4MAOA 4W4XA 3TZ9A 4C62A 2J4ZA 4RSSA 4C58A 2YJRA 2QKWB 5JFVA 4XX9A 4DN5A 3VBXA 3LFSA 1TVOA 3MY1A 3LXPA 1R78A 3G90X 5IUHA 3UOJA 4ZY5A 2E9NA 4FTUA 1XBBA 2C5NA 2XCHA 4J95A 3PJ3A 3LMIA 4IC7A 3LCKA 5ANKA 2B1PA 2CPKE 4KA3A 2OF2A 2R2PA 5E92A 5BMMA 2GQSA 2B9HA 2UVXA 3GCUA 3H9OA 3HV5A 3V01A 5IA4A 3OWKA 4WKQA 4C4HA 3PUPA 4M8TA 1I44A 2GNJA 2XIRA 3G51A 4U5JA 3JYAA 2UW3A 3NMUF 4FEVA 3FDNA 4JS8A 4FF8A 4FTNA 3UMXA 1TQPA 2YFXA 4ZK5A 4RIYB 4DLJA 2A2AA 4HVSA 4EC8A 5FM2A 1KE7A 3I81A 2BVAA 4D9UA 1VZOA 3EQHA 4D2VA 3ATSA 2B52A 3LJ1A 2E2BA 1KV2A 3G6HA 4PNKA 3PLAE 2QOFA 4DFNA 2W96B 4R3RA 4ZSGA 2Q0NA 2X4ZA 5TE0A 4MH7A 1KE9A 2OXDA 2RSVA 5EW8A 3LFEA 5C03A 4YO4A 4ZLYA 3U6IA 4JIAA 3MTLA 5IMEA 4D28A 1H01A 5HCYA 3QZIA 4MXXA 2JGZA 5EW9A 3KXMA 4QTCA 4JBOA 3LXKA 4IWDA 3OCGA 5JKGA 2WB8A 1OKZA 2ZYBA 2NO3A 4NW6A 3ZUUA 3IW6A 2QOHA 2BRBA 4U42A 4DH8A 1FBNA 4Y73A 5CS6A 3V5TA 1OKYA 2C6LA 3F5GA 5F1ZA 1O6LA 4DG2E 2B0QA 3LQ8A 1SNXA 4K9YA 4JG6A 2W05A 5ETCA 3P08A 4BDIA 4IFCA 4XG7A 3MPMA 2JIVA 4K77A 4GV1A 4RVMA 1YI6A 2GS6A 4IVBA 3ZCLA 3GCVA 2OLCA 2J90A 3MIYA 4ZZMA 3UQGA 2B9FA 3AC4A 4PPCA 4R78A 3DQWA 2Y7JA 1YI4A 3ENHA 3DJ5A 3PIXA 4G5JA 4X2NA 4W8EA 1MRVA 4RZWA 3U87A 2ZM3A 2WXVA 3VW8A 2VTRA 3DQXA 2JLDA 2EXMA 5AV3A 1FPUA 4IC8A 3HZTA 5H8EA 4Z55A 2F7XE 4GW8A 1Y6AA 5E91A 4UMPA 5L2WA 2WMTA 3A61A 2W9ZB 3QALE 3UO6A 3UOLA 4D4SA 3QUPA 3R1YA 3C7QA 4F0IA 1WBPA 1PF8A 4DYMA 1PMUA 1SVEA 4Q5EA 4WO5A 4E8AA 4LV5A 2QHMA 3I7CA 5HE0A 4AZSA 3GOPA 3PXQA 4UWCA 3DKFA 5TF9A 5C9CA 4AQCA 3Q96A 4EK8A 4JI9A 3IGOA 2EUFB 3BV2A 3FLNC 4FNZA 1J3HA 5DBXA 3QYWA 5J8IA 2QLUA 4C37A 5F9EA 3P79A 4LGHA 4RRVA 3QQLA 5B0XA 4FKVA 5HG7A 4F9YA 2X39A 3SVVA 2UZEA 3G9NA 3BGQA 4YGAA 3WZDA 2OF4A 3O7LB 5HNBA 4USEA 3PP0A 2BTRA 3KK8A 5L6WL 5HVKA 2CKOA 4CRSA 5M4CA 2WOUA 4N57A 1YXSA 3GC9A 3FLQA 5DR6A 4AW5A 2HIWA 3AOXA 4JX7A 3VWAA 5IDNA 1ZRZA 4EJ7A 2IZRA 3TWJA 3ROCA 4D2WA 2XUUA 3NPCA 2WMBA 4J97A 3Q6WA 4NKAA 2PVJA 3QKLA 5IEXA 5A9UA 4I94A 5E90A 4EH9A 5KO1A 2JBOA 5HG5A 2F9GA 4E4XA 5LQFA 3HUBA 2VZ6A 1IG1A 3D5XA 1H07A 2ONLC 5HEZA 3K54A 3RMFA 1YVJA 3TIZA 5JEBA 1WMKA 4ZZOA 3P0MA 1SM2A 2NNWB 3BU5A 3U8WA 4KWPA 3R8ZA 5FLFA 2P2HA 3BBTB 3LMGA 3DBEA 4V04A 4B7TA 3Q60A 4BHZA 3FMEA 3DZOA 5AP4A 1BL7A 2F7EE 4FSYA 3IDCA 4NTTA 5CEKA 1GY3A 3W32A 3MJ2A 4M13A 3P4KA 4X3JA 4AF3A 5ICPA 4AG8A 3DK7A 4CNHA 1FVTA 3RAWA 3CJFA 5EQEA 4QMPA 3VULA 3FKOA 1Q3DA 4B9DA 5J7BA 2UVZA 4FVRA 4KD1A 2YDIA 2PUIA 1SVGA 3BBWA 5AUXA 1YDSE 4ZTRA 3HL7A 3PXRA 3PVUA 3IW7A 4O7YA 3SAYA 2OIQA 3NWWA 4XG3A 3DU8A 3KCFA 4MXAA 4MEDA 1QPEA 2VD5A 5D12A 5BVOA 5GZAA 1RW8A 2C0TA 4TPTA 3VUMA 4QYHA 4E1ZA 2UZVA 3KXHA 3D9VA 4F09A 2FSMX 2XJ1A 2WQMA 3OXTA 5BQ0A 2R3MA 3BV3A 3HLLA 3FI8A 4O83A 4LOOA 5BVEA 1H24A 5FEDA 4OTWA 4MD9E 4ANNA 3ZFXA 3U6HA 3KB7A 4JDKA 3PIZA 3PY0A 3DKGA 1W0XC 1QPJA 3MJ1A 5HTCA 3TUDA 1A06A 4XV2A 2PU8A 2G9XA 4NEUA 4QPSA 3R9DA 1WZYA 3GVUA 4XLVA 2WTCA 1LUFA 3H3CA 3JVSA 4NKSA 4WRSA 3EZRA 4AP7A 3ERKA 4JBPA 4O27B 5CEMA 4EYJA 4TRLA 1YDRE 5A54A 3VHEA 2RFSA 4G3GA 3VIDA 2JKOA 3R0TA 4FX3A 4C3PA 3WF8A 3MSSA 4XG2A 5C27A 1CM8A 4LMNA 5DRDA 2QO7A 4D1XA 3TNHA 1MQ4A 4I4FA 4JXFA 3LKMA 5AEPA 1SZMA 3FMKA 4FKLA 3A4PA 5AUWA 5EYMA 3NIEA 5HG8A 3PA4A 3NW5A 4ZJVA 5EH0A 4JJRA 3KN6A 3MYGA 1R1WA 4QP8A 4HGLA 2ZVAA 3KL8A 2WMRA 4FSWA 3DJ7A 5E9EA 4KBKA 3R8UA 2WIHA 4YJQA 3W2SA 4CT1A 2GNGA 4AA0A 4WNMA 3FUPA 4MXZA 5HESA 4Q5HA 4YHFA 4RGJA 4O7WA 3H9FA 3FMHA 4AXAA 3KULB 5HBHA 2B53A 4QO9A 1WBWA 4EL9A 3FWQA 5M56A 5DE2A 3Q04A 3NVKI 4RIWB 3QA8A 1WBNA 4QD6A 5GZ9A 4ANQA 4BDFA 4RJ3A 2I1MA 4FKWA 3TNQB 5CAPA 4E93A 2J7TA 3DT1A 5KMKA 3V3VA 4R3CA 4U41A 4XG9A 3PXYA 1OITA 5CEIA 1ZZ2A 2SRCA 4QRCA 3ZO1A 4BWKA 4D2SA 4QYGA 3CXWA 2QOBA 4BCPA 2YCRA 4O7RA 1XQZA 4ITHA 5AUTA 5CNNA 3LLAA 4M0YA 3BRBA 3TCPA 4E5AX 2XJ0A 3OY3A 4TW9A 4YZNA 3QXOA 1PXOA 3RM6A 2B54A 3E8EA 4PTGA 3BYUA 4O7VA 4K8AA 2YM6A 3PG1A 1LR4A 4CVAA 3VN9A 4PUZA 4C2VA 3NYXA 2QONA 4C02A 2IVUA 4BKZA 2XKDA 4IW0A 4EI4A 2YERA 4AW2A 4CT2A 4XV3A 3RJCA 3UG1A 3ZSGA 5AIKA 3ZONA 4EJNA 1U54A 4F6WA 3QTSA 2J51A 1SVHA 2Y6OA 4FEUA 4DFUA 1OIUA 1H4LA 2ZMDA 4R1VA 4AOTA 4PDSA 2OFVA 4WT6A 3ORIA 3RPOA 4IWPA 3VS4A 2R3LA 2W1CA 2ITUA 4GT4A 4XH6A 5HHWA 3PZEA 4EKLA 4PPBA 5J9ZA 5JQ8A 4PDYA 4A4LA 3JPVA 3FZOA 1ZLTA 4DINA 4TWNA 3BELA 3MB7A 2WQEA 1PXLA 3AD6A 4GFOA 4K1BA 1R3CA 3ORPA 2OWBA 5D10A 2CMWA 3KRWA 4FSUA 4FT3A 3P7CA 3W8LA 4AAAA 2GQRA 1JBPE 1WVXA 3OROA 3PTGA 5E7RA 3R9HA 2ZB0A 3ORKA 5CNOA 2XCKA 3RWQA 5ANDA 2XM8A 3GQLA 2R3IA 3L8XA 5BVDA 2V7OA 3CQWA 3OG7A 3RPSA 4HYIA 4NU1A 4XUFA 4RWKA 3KF7A 4ALVA 3FHIA 3TV6A 2BRGA 3PWDA 4PMTA 2X7OA 1GIIA 2P55A 2RIOA 3ZFMA 4GG5A 4HZRA 3OVVA 5TKDA 4UN0C 4O6EA 4O7ZA 4RC3A 2QD9A 3FXXA 2XK3A 2PZ5A 4K18A 1WVWA 3F3WA 3KRLA 3R7OA 3FSKA 4JAJA 4I20A 2BALA 5E8SA 4GRBA 2JFMA 4NIFA 3HV4A 3PA5A 4ACDA 4DEHA 3GCPA 2Z2WA 4J52A 4WNKA 4O22A 2XK9A 3LFQA 1KUTA 3AG9A 3R7GA 2VV9A 2WQBA 3D2KA 4TKSA 2EB3A 2CGWA 2GHMA 3GQIA 2C0OA 3P7BA 4EH3A 4HVDA 4G2FA 3BHYA 4FT7A 3VUGA 4E5WA 3FQSA 5AX3A 1GZKA 1M14A 4LGDA 3QGYA 4WNOA 1YWVA 3JVRA 5LVLA 2XJ2A 3Q9XA 1URCA 3FMJA 3L1SA 1CDKA 5JGAA 4I93A 1UVRA 2R0UA 2W4JA 4LRKA 4RJ7A 5M57A 2UZWE 3NUSA 4RA4A 2O64A 4YR8A 4YZCA 2VTHA 4BDCA 4W9XA 1OUKA 4IIRA 2OU7A 4EH6A 4WUNA 5IPJA 3G2FA 5E1SA 5AAGA 5KZIA 2BMCA 4FKUA 3IG7A 1B38A 4R5SA 4G6NA 4M69B 4KUJA 4A9YA 1OBGA 3MH2A 3MY0A 5T68A 4KINA 3VF9A 3EYGA 1IAHA 2ZDUA 3WOWA 2BILB 4U9AA 1OL2A 2YIWA 2JKMA 3LQ3A 5LMBA 4L67A 3EQDA 4DG3E 3Q4ZA 4PL4A 5IH5A 2CNQA 4IAKA 4PL5A 5AA9A 4UMUA 4M67A 4TL0A 2PVKA 3KU2A 5A6NA 5G1XA 4BDHA 2GS7A 4YLJA 5HU3A 4AWIA 4YMJA 2YZLA 3SGCA 4FIIA 3E3BX 4DTBA 2XIZA 5L6PA 3L9LA 3D5WA 2QO9A 5BYZA 4EK3A 2R3FA 5EG3A 5A46A 3JR1A 1S9JA 1XBAA 3R63A 2ETKA 5HICA 4GVJA 5CVFA 4DITA 1XKKA 3AD5A 4QQTA 4X2FA 4IB0A 3HYHA 1UKIA 3V6SA 2VO7A 4Q9SA 1LEZA 3GU7A 3HGKA 3BEGA 4B99A 1WFCA 3F5UA 5JZJA 2HW7A 3NDMA 2V22A 3HDMA 4U79A 4JRVA 1OPKA 2C6EA 3QWKA 4PRJA 3A7JA 2WD1A 1K9AA 2Q0BA 2VO6A 3MV5A 4II5A 4XEYA 4PX6A 3TT0A 4APPA 2R3PA 3H10A 3TKHA 1IA8A 1UKHA 3L9NA 4MXYA 4QP7A 5M55A 2VWYA 3QBNA 2BFXA 3CPBA 4BL1A 2RL5A 4BGHA 2YJSA 3QAME 3HV6A 4GUEA 3Q4UA 5CALA 1YOLA 3NGAA 3S1HA 3FEGA 3GT8A 2BCJA 3AC3A 5D1JA 3EMGA 2ZM4A 5ANJA 1AGWA 5IMXA 3EQRA 3DGKA 4XG4A 4RIYA 5IA2A 4CTCA 2YZAA 5H2UA 3V51A 3FZSA 3QQKA 2XIYA 2YM3A 1YKRA 4NJDA 4FV3A 2CJMA 3PVBA 3WZEA 5KE0A 3GGFA 5DT3A 4EOLA 4CKIA 2CLXA 2VX3A 1BMKA 3W18A 1PKDA 3DS6A 2C47A 4WG3A 5CXZA 2BKKA 2F57A 3WILA 3AD4A 4A9UA 2CNVA 4M68A 1VYZA 4IXPA 3UC4A 4DT8A 1T46A 4G17A 1Q62A 2R7BA 5FTQA 5M06A 3FBVA 3LCTA 3A62A 1PXIA 1U5QA 4S32A 4EWHA 2WELA 2O0UA 3R28A 3RK7A 3NCGA 4PPAA 4BY9E 3ANRA 3VF8A 5A6OA 1XH9A 5L2IA 1OBDA 3PWYA 3TTJA 4EOKA 2WFYA 1UWJA 1XH7A 3A8XA 4I5CA 5DHJA 2PHKA 4BCQA 4GK3A 4ZAUA 4A4OA 4BGQA 3RVGA 5C8NA 4ZS4A 2OO8X 2W7XA 1UNHA 5BYLA 5HE1A 2UW9A 3OW3A 4BI1A 4EOOA 4AA4A 2UZTA 2HAKA 2CCIA 3PXFA 4JNWA 5HVYA 3D0EA 5DH3A 5L3AA 4QTEA 5IA3A 5E8VA 5I9WA 2OJJA 3NW6A 4RC2A 4U3ZA 1V0PA 3I6UA 4XMOA 3HX4A 4EYMA 5CYIA 3NIZA 4O84A 1OIRA 3QD2B 5JZNA 3AMAA 3LFNA 2QC6A 3Q9YA 3UC3A 2X7FA 2HZ0A 3O71A 3CS9A 2E9OA 3Q9WA 4MHAA 4R7BA 3L9PA 4XYFA 2ESMA 4EQMA 3VQHA 1KE8A 5LCKA 4FTMA 3CQUA 2ZV8A 3BE9A 3C4FA 4QMOA 1PYEA 3FI2A 5CAUA 4RVLA 3GXLA 4X2GA 5GNKA 1DAWA 4O0WA 5C26A 5IZFA 2QKRA 3E64A 5I9VA 3OTVA 2UW6A 3MTFA 5FBOA 1JSVA 4U3YA 3TI1A 2OJ9A 4CMTA 2WTKC 5L8LA 2PUUA 4BI0A 1F0QA 3FI3A 3QXPA 2PK9A 2VTTA 2X8EA 4XBUA 4FZDB 3UPZA 4IM3A 4FIHA 1DI9A 5JGBA 1DS5A 4WG4A 1OMWA 4G1WA 3PA3A 1XR1A 4M66A 3VRYA 5ACBC 4L9IA 2YLFA 3R8MA 3DZQA 4FG9A 5KUPA 3IS5A 2QOKA 2VO3A 3PJCA 3O8PA 3KGAA 2C30A 4EK5A 4YP8A 1JSUA 1AD5A 3RAHA 1NXKA 3ROYA 4RX8A 4YPDA 4E20A 4F08A 3CE3A 3MVHA 2QR8A 2Y6MA 3P1AA 4HGSA 4RT7A 3DK6A 4BIDA 4RX5A 3TV4A 3G0FA 4BBFA 2GS2A 5AR3A 4LOPA 3F82A 4FL3A 3F88A 3OWJA 4KIQA 4BGGA 4L68A 3TKIA 2BAKA 3TEIA 4BDJA 2OW3A 2PSQA 3BYOA 4CZTA 5M4UA 3ETAA 4O0UA 5IQGA 3LM5A 3PPJA 3UIXA 3ZEWA 4ZZNA 3AQVA 2AUHA 2ETMA 3PSDA 3MI9A 3UZPA 2BAQA 5KKRC 3C13A 3TKUA 4AZVA 3FJQE 4W4WA 3EKNA 4YO6A 2VRXA 3RNYA 3QCSA 5DRBA 2G2FA 5K0KA 5EHYA 4C7TA 2JITA 4OT5A 4RJ8A 4ZP5A 2XH5A 1PXKA 3Q6UA 4EONA 3BKBA 2VU3A 3FMNA 4A4XA 3TNPC 2VUWA 2QOOA 4AOJA 4F7NA 4U81A 4EH7A 1URWA 4JQEA 3BQRA 4OTDA 1IRKA 3QLFA 4YJPA 4XLIA 4D2TA 2F2CB 3C4WA 3F69A 2R9SA 4JBQA 4CSVA 2KULA 1CKPA 1Z5MA 2CKPA 2J50A 3HECA 3DDQA 4DFLA 4IM2A 3VAPA 5FM3A 4MQ1A 4X3FC 3FE3A 4FC0A 4GEOA 5HIDA 5IQAA 3LFBA 2FSTX 2CHLA 1U59A 4IACA 1G8AA 4KNBA 4FNYA 3ORTA 2PVNA 4A06A 2XYUA 5EI2A 3OZ6A 1KWPA 4QP4A 5TOZA 3P86A 5AP2A 4BIEA 4BTMA 3B2TA 3BWFA 1UU8A 2GQGA 3LJ0A 1YRPA 1W82A 2O63A 4QYYA 3BYMA 5HLPA 2WTKB 4O0SA 5JMSA 3DNEA 3QD0A 4LM5A 5AUVA 4E6CA 4L43A 3OCSA 4OBPA 4JL9A 1H1PA 4YNEA 5CT0A 1GOLA 5FBNC 5AM7A 2C6TA 2WTIA 2XEYA 3OT3A 4UEUA 1REJA 3KXGA 4DFZE 4FGRA 4IAAA 4YJNA 1ATPE 5EHOA 3ZZWA 4O6LA 4P4CA 4ASZA 4EHVA 4GKHA 3TXOA 4QMWA 5ACKA 3RM7A 3DKCA 3DLZA 5CZIA 3P9JA 4YLKA 4CFNA 2HZ4A 4JAIA 5C1QB 3OCTA 4DEDA 4AT4A 4ACHA 5EKOA 4MYGA 3U4UA 2QOQA 5LWNA 5KMNA 4FTCA 4MTAA 4O7NA 1OL7A 2CN8A 4E6AA 2X9FA 3Q53A 5I0BA 2QG7A 2ZV9A 2WTJA 3RKBA 1WVYA 2BHEA 3ALOA 4UB7A 3MPTA 5D11A 2WO6A 4ZS0A 2ONLA 3V8SA 4DCEA 4OTFA 4ZY6A 3GU6A 1JKTA 2YLEA 4G16A 4M97A 4UBAA 5I3RA 3TDWA 4LRJA 3F2NA 4S30A 2AC5A 5HO6A 5BYYA 1H26A 4EC9A 3KMMA 2AC3A 3KCKA 2UW8A 2P33A 3EQGA 5KKRB 1HCKA 3KULA 1JNKA 4RG0A 4BDKA 3FXWA 4ENYA 3GCQA 5C01A 4JQ8A 2R0IA 4RIWA 5B7VA 5BVNA 2XK7A 3FYJX 4XG6A 4H3PA 2G01A 3HMNA 3VRZA 4AZWA 5GIPE 1ZMUA 3ZM9A 4M7IA 3CC6A 4HW7A 3PSBA 4UXLA 2YCSA 3BPRA 5IA1A 3CGFA 2YM8A 2H9VA 3R9NA 2G1TA 4RQVA 1H8FA 4FE2A 3UVQA 1FVVA 3GI3A 3WYYA 1H28A 4GT3A 3OT8A 2YWVA 1UV5A 3LXLA 4FR4A 4KKGA 3W2PA 4ERKA 1RDQE 1ZYSA 4X3FB 3RHXA 2C6MA 3FQEA 3TACA 4CKJA 4LOQA 3VQUA 2FA2A 1PXNA 3R00A 4G3DA 4BHNA 5I9XA 2IJMA 2UZUE 2DUVA 2X0GA 4EHEA 3MH1A 1FGIA 2ERKA 4L6QA 3VBYA 4UALA 3E87A 1UWHA 4GT5A 3I6WA 3CD8A 1MUOA 1BI7A 4HCTA 5JGDA 1XJDA 3C4XA 3KA0A 4DFYA 3NUXA 4BDBA 3I1AA 1R0EA 1LEWA 3F2AA 5AP0A 3POOA 3R7UA 4D2RA 4OTIA 3I4BA 5TR6A 4ZLZA 3NVMB 4BYIA 1BUHA 2HW6A 1GNGA 4I5PA 5CX9A 4QMSA 3RTPA 3UNJA 3EN5A 4FICA 1REKA 4TWOA 3DAJA 2PZYA 4BKJA 2UZNA 5HE2A 4E7WA 3F3UA 3MWUA 2VWIA 1VJYA 3QUDA 4RFMA 3NNVA 1Q24A 3F3TA 3V5PA 3CCNA 1SMHA 3VO3A 3PDTA 3GFWA 5I4NA 5K5NA 5IISA 2CGXA 4HZSA 1FVRA 5GHVA 4AFEA 5HLWA 4RBLA 4AE6A 3NCZA 4A9TA 3VJOA 2ITTA 4FKSA 2C6OA 1H1SA 2NP8A 3DFAA 4HOKA 5H8BA 4JDJA 2JD5A 2WMSA 2OJIA 4L45A 3S2PA 3TNIA 5ANEA 4LYNA 1J1BA 5M08A 4EUUA 4GCJA 1W98A 5D7AA 2W0JA 3M11A 2R7IA 4QT1A 1Q4LA 3ZHPC 3E8CA 4QMVA 2W99B 3CY2A 4IX3A 3R7EA 4FV0A 4PMSA 4FEQA 4MQ2A 4QMTA 3BU6A 3IKAA 4DHFA 4GS6A 2IG7A 3RCJA 1JKLA 1KE6A 1ZMVA 3OBGA 5IDPA 4B4LA 4FKQA 4GYGA 2PVMA 3PP1A 2R4BA 2ITYA 2NPQA 3PZHA 2EXEA 2OICA 1YHWA 4UX9A 4V01A 1MQBA 2C3LA 3V6RA 1WBVA 2VTPA 3WE8A 4EOJA 4YZBA 3LHJA 2W1EA 3ORZA 4I0RA 4D5KA 4DBXA 3D2IA 1OUYA 4TTHB 3T3VA 4OT6A 4ENXA 3FKLA 3RPVA 2PUPA 3BEAA 4Y5HA 4C35A 4DH5A 4D1SA 5DEWA 3DBDA 3NUNA 5E8YA 3EYHA 2O65A 4FV1A 3UNZA 2GTNA 3SQQA 4K11A 1UNGA 2YIRA 5J5TA 4O1PA 5F20A 4O0TA 3ZUTA 4ZY4A 5IQIA 4M69A 4CG8A 3Q32A 5BX0A 4KBCA 2XNBA 4F7JA 4FSNA 3UG2A 5HTIA 2XKEA 3HAMA 4TN6A 4MWIA 2PZIA 3EFJA 2ZB1A 3UYSA 2CN5A 3GB2A 1APME 3OBJA 3QF9A 4CV9A 3EIDA 2IVVA 4IB3A 1W84A 3C4ZA 3BQCA 2PTKA 3NEWA 5E8UA 3LJ2A 3DJ6A 2FVDA 4EH8A 3UZTA 4GMYA 3IDPA 4QMLA 4BCJA 4WHZA 4EOSA 5AR7A 3OY1A 2A1AB 1Z57A 1ND4A 1IR3A 4CEGA 3W55A 4NYEA 3U54A 5JK3A 3MVMA 2BDWA 4FV8A 3R8LA 3ZEPA 4M3QA 1Y6BA 5HD4A 4EZ3A 2JIUA 3VUIA 2VTOA 3LFCA 2A19B 4KS8A 4AN2A 1G5SA 3R30A 4R5YA 3F66A 2WMAA 2Z60A 3QZHA 4BTJA 3TV7A 1QCFA 4NM5A 1H1WA 3G6GA 3ZZEA 4J8MA 2P4IA 3O23A 3QLGA 2OXXA 1ERKA 3IW4A 5AR4A 3WE4A 1OZ1A 4EK4A 4O81A 2PVLA 4BBMA 2GCDA 4UZHA 4GU6A 5AM6A 4QQ5A 4IQ6A 2BPMA 4QPMA 5LWMA 3QL8A 1Z9XA 3QRIA 3EQIA 2H6DA 4MNEA 1Q8ZA 2PZRA 2I0VA 3QX2A 3A7HA 5J1WA 2C5XA 4AZEA 3K2LA 4A07A 1YXXA 2J0IA 3CKWA 5E4HA 3L8VA 1OGUA 3NX8A 3C4EA 5IH6A 3RK9A 5E8XA 3AT2A 2JKKA 4W4VA 3VBWA 5IQEA 5BUEA 2W4KA 5CWZA 5TO8A 5LJJA 1ZXEA 2BAJA 4PY1A 3FL5A 4EWQA 4DGGA 4DEIA 1Y91A 1XBCA 3R1NA 3D5VA 3U55A 1W7HA 3R22A 3GUBA 1H08A 3RBWA 3ZYAA 5ANGA 3FY0A 5J5SA 5EM5A 4P5ZA 4FNWA 1J7IA 5EM6A 4L46A 3FC1X 4FV2A 4MNFA 3KK9A 3PXKA 3JXWA 4E3CA 3IONA 5BVFA 1PYXA 2Y8OA 2HOGA 4S31A 2Y4PA 5LVPA 3AGLA 4DCAA 4IHPA 3S00A 2WU6A 4ZTHA 2RFDA 4EH2A 4GIHA 4CXAA 5BVKA 4NSTA 3CLYA 3M42A 3HMOA 5F4NA 3S4QA 2ERZE 4WSQA 3KC3A 3A99A 4ORKA 2W9FB 1MP8A 4HVHA 3U9NA 3VUKA 1Q8YA 2GMXA 4NCTC 3A4OX 2R3QA 3QTXA 3LFAA 5T6KA 4RZVA 2UZLA 4W4YA 3KMUA 2R3GA 4S2ZA 3QX4A 4FKRA 3EHAA 3R04A 3TN8A 4ANMA 5LVNA 4QMZA 3BHTA 2HWOA 3VC4A 4AGDA 4F7SA 2B7AA 2UW4A 4Y46A 3UPXA 3AC5A 3VBQA 5KBRA 4IE9A 4JIKA 4CTBA 3UJGA 1U4DA 2FGIA 3WF9A 4XJ0A 3HRBA 4L52A 3D7TB 1XWSA 2OG8A 2YAKA 4DC2A 3BGPA 3FV8A 2XNPA 4JBVA 4JVGA 1UA2A 4U45A 5DPVA 5IQFA 3QRJA 2PE0A 4IJ9A 4X7QA 5JFSA 5M4FA 3VNTA 5AP6A 5G6VA 1WBTA 2X4FA 3MPAA 4QTAA 4CD0A 4F9AA 4DH1A 2E9PA 4GJ3A 1K2PA 2WKMA 4JLCA 4LGGA 3W8QA 1VEBA 4IAZA 4RWJA 4B8LA 5HX6A 2J0LA 4QP6A 4NM3A 3B2WA 3FMMA 5FDPA 3V8WA 1Y57A 4FMQA 4MD8E 4EOQA 3ZXZA 2WIPA 3HP2A 3WBLA 3MIAA 4PNIA 4N6YA 2QQ7A 4FNXA 2IW8A 1P14A 4O0YA 1Q41A 3SG9A 3E7OA 5JRSA 2YN8A 1XH5A 5HCZA 4I6QA 5BVWA 2I6LA 4BTKA 3AMYA 1H27A 3COMA 4O0VA 5AP7A 3VS1A 4BC6A 3OUNB 3CEKA 4UZDA 4B0GA 4C57A 4UWYA 2A4LA 3BIZA 2JAVA 2XF0A 3A2CA 3MA3A 2BKZA 4TYHB 4ALWA 2F49A 3HMMA 3T3UA 1XHAA 1PXPA 2WTWA 4AN3A 4ANBA 2QLQA 3A7FA 3HVCA 3KQ7A 3VS7A 1P5EA 4FZAB 4LFIA 3SA0A 2OH4A 1L3RE 5AIRA 2VNWA 3WARA 5CF8A 3FZ1A 2OIDA 4O96A 4CGAA 4RA5A 1SNUA 5AJQA 4B6LA 4CYJA 4TNBA 3GU4A 3N9XA 5CASA 3TZ8A 2DWBA 1FOTA 3R6XA 4RLKA 3W33A 2C6DA 1X8BA 2R3JA 3ORNA 4YU2A 5M07A 5K9IA 3Q4CA 4BCGA 3DXNA 3GC7A 4U44A 3EL8A 3UQFA 2XK8A 3LQ5A 3F5XA 3KF4A 3FZPA 5IUIA 3ZXTA 5FUTA 2UV2A 4FV5A 1FINA 4BVUA 4CZYB 3DNDA 4FKPA 4F65A 2VTQA 4RFYA 5IUGA 3CY3A 1G8SA 4J7BA 3I7BA 5ETAA 2PZPA 1LPUA 4UWBA 1E1XA 4WD5A 3QKMA 5DOSA 4EORA 4YBKA 5DR9A 4WA9A 1XO2B 2XEZA 4YZ9A 4W9WA 2XRUA 3OEFX 5AAEA 3QTUA 5DA3A 4X6QC 2VTLA 3F3VA 3HV3A 4F1OA 1IAJA 3BGZA 2YWPA 2VWUA 4KS7A 3SW7A 5DIAA 4YZDA 5AR8A 4MK0A 5M4IA 3O50A 1L8TA 5AR5A 4MXCA 4BCHA 3QTZA 4OBOA 1J1CA 4GH2A 2H8HA 4N6ZA 4XP0A 4DEAA 3F9NA 3PJ1A 4Z9LA 1JAMA 5DG5A 5IQDA 2C6KA 5A3XA 4I0SA 4WNPA 3FLZA 3OHTA 3IW5A 4FIEA 3RWPA 3DAEA 4EQUA 3PPKA 4HCUA 1OIYA 1ZZLA 2B55A 3QUEA 4G5PA 3F7ZA 3QWJA 4XBRA 3KXXA 4V0GB 4BWXA 5K5XA 2VTAA 3ET7A 3BI6A 3UIBA 1JLUE 1F5QA 4JQ7A 2GNIA 2HXLA 3THBA 1PXJA 4XV1A 5EYDA 5J1VA 3C0GA 4HVIA 1JKKA 3N4VA 5FTGA 1OECA 3R73A 1OVEA 3CJGA 3FC2A 4EEVA 4F70A 2WMQA 1ZY5A 1OL1A 4IVDA 4KSPA 3N4TA 4MBJA 5EDRA 5LMKC 3I60A 4J53A 4MNEB 5ANOA 4FUXA 4KAOA 5CVGA 1NVQA 2RFEA 4XS2A 1NY3A 3PFQA 2C4GA 4HPUE 3UOKA 1Q61A 4MXOA 4FK3A 4NK9A 3T9TA 5C4KA 4Z7GA 4AE9A 4RLLA 3N51A 4IM0A 2GPHA 1I09A 2C68A 2X81A 3E93A 4RMZA 4BDAA 4BI2A 3NNUA 3H0YA 3W2OA 3PY1A 4USDA 4AOIA 4USFA 4G9CA 4CCUA 2BROA 3VVHA 4ANLA 4QMQA 4AU8A 4LQMA 5CT7A 4ASEA 3E5AA 2UW5A 2A0CX 2R3OA 4CLIA 3OFMA 2I40A 3RPYA 3TJCA 3DXQA 4WIHA 4DE4A 2PMIA 3POZA 2IVTA 3MH3A 3SG8A 1PMNA 2QVSE 3WF5A 4L53A 2XIKA 4KKHA 5JRQA 3EQBA 4J96A 3M2WA 5A4LA 3K5UA 2F4JA 3PPZA 5BUIA 4OTHA 3C50A 3RAKA 3DTWA 2BDFA 2H96A 3MVJA 4BF2A 5M51A 3OWLA 2PMNX 4FOBA 4YURA 2ITNA 2XVDA 3GEQA 2PY3A 4QNAA 1NW1A 4IVCA 4EBVA 2CSNA 3QQGA 4X3FA 2XNGA 3QQUA 4KBAA 4CMUA 2V7AA 4LL5A 4XRJA 1JKSA 3V04A 4O7LA 4ZSLA 3QQHA 5CF6A 4D4VA 3DPKA 3EQPA 4RFZA 4O21A 4XCUA 2JC6A 1DI8A 3DV3A 4R6VA 4G31A 2V0DA 4ZSEA 3BCEA 3ZLXA 3FYKX 3COIA 5L4QA 2Z02A 3DTCA 1Q5KA 3ULZA 4CFFA 4FKIA 4QMUA 2ZOQA 5KMJA 4G6OA 2JFLA 3QZFA 5EYKA 3V5LA 4DH7A 2Z7SA 1P4FA 2BZJA 4HPTE 5CZHA 5HBJA 4BRXA 3WZUA 4MVFA 4XG8A 4N70A 4KIKA 4IX6A 2VGPA 5FXSA 2CLQA 4Y5QA 3QCYA 3CGOA 5IA5A 4YJRA 1QPCA 2XYNA 3GENA 3REPA 4ACCA 3GP0A 4BTFA 4JX3A 5FXRA 3M1SA 2B9IA 4YJVA 4P90A 2CGVA 2Y4IC
chains in the Genus database with same CATH superfamily
5H3QA 3TUBA 4QQCA 3QD3A 1ZYDA 5FD2A 5HGIA 2X6EA 2XBAA 1JWHA 1RJBA 3OEZA 4AA5A 2ITVA 4Y95A 3NSZA 5FP5A 1UU3A 3O0GA 5CEQA 3E8NA 5HTBA 3RNIA 1EH4A 2IPXA 4YBJA 4U7ZA 4IADA 1CTPE 3RZFA 5DEYA 5IQHA 4OW8A 3ZSIA 3VUHA 3GFEA 4QYFA 3CTJA 1HCLA 3VS3A 4BCFA 4FL2A 5LXMA 3E88A 4QP9A 2X2LA 4I1ZA 2OIBA 4I6FA 4DEGA 5CANA 2R3RA 3CTQA 3EQFA 1OB3A 3I5ZA 3G5DA 4CYIA 2IW9A 3NYVA 5HU9A 1A9UA 3C4CA 4FV9A 5CEOA 2V55A 3EN7A 5GJDA 3W10A 3R71A 3Q4TA 3W2QA 3ULIA 1E9HA 3R1QA 4GJ2A 3ATTA 2XNOA 2HY0A 3GNIB 2GHLA 2X7GA 3KXNA 4M14A 4M12A 3TJDA 3W1FA 4AZFA 2DQ7X 4PWNA 4IX5A 2UW0A 4H3BA 2ZJWA 5IQCA 3E63A 3V8TA 1BYGA 2X0QA 5A4TA 3A7IA 3ZTXA 3KFAA 1BX6A 4BCNA 5GIOE 2OXYA 5JN2A 2UW7A 2R3NA 4I92A 4K6ZA 3UODA 5CAOA 2XM9A 2CCHA 4QP3A 5GJFA 1J7LA 4YJUA 4GU9A 4C8BA 3I0QA 2IZTA 3GOKA 1STCE 4S33A 5AA8A 4LMUA 1YHVA 2C69A 1H00A 4NH1A 3RGFA 2WAJA 3ZFYA 1SYKA 3LOKA 4WBOA 4IX4A 5IA0A 3RALA 4U8ZA 4DGNA 3OOMA 2YCFA 4FKJA 1M7QA 4DF3A 5CENA 3HV7A 2J0MB 1ZOHA 2XK4A 3A8WA 1CMKE 2PE2A 2EWAA 2ZMCA 4CZUA 4BN1A 2C5OA 2JDRA 4L7SA 4HJOA 3FL4A 5EI6A 3EFLA 4C36A 2Q83A 4FZ7A 2IWIA 3HNGA 5EYCA 3CPCA 1M2RA 2IN6A 4EOPA 3KN5A 2A98A 5CXHA 4MBLA 2GFCA 3QTWA 3KVXA 5DGZA 2PPQA 3BZ3A 4GFGA 3U6JA 2Y4IB 4XRLA 3D83A 4C3FA 2QI8A 4FSRA 4IAYA 5CU3A 3GU8A 5T3QA 4MCVA 4IAIA 5AP5A 5J79A 4IBMA 3NYNA 3EH9A 1JVPP 4AFJA 4C34A 2BIYA 5FP6A 4ZTNA 5FXQA 2O3PA 4XNEA 5I5ZA 3MFTA 1FQ1B 5FRIA 4EOIA 4DAWA 2RG5A 4QP2A 4ZSJA 5J87A 3MY5A 4FIFA 4JDHA 1M7NA 4I6BA 5DNRA 4FEWA 4H05A 2RG6A 4FK6A 3TZ7A 4CMOA 2HWPA 2BRHA 2BZHB 1G8JA 4R1YA 2HY81 5ETFA 2UUEA 3DB8A 3SV0A 3B8RA 2UZBA 1UU9A 1DM2A 1ZYLA 5CU2A 3WF6A 5M44A 5CI7A 2WQNA 4F1TA 4DDGA 4ERWA 2GNLA 4FTTA 2BRMA 4EZ7A 4ZEGA 4FL1A 1S9IA 3QHRA 4KSQA 4ARKA 1BKXA 2WPAA 5EKNA 1IEPA 5EQYA 3E92A 3R2YA 4IJPA 4U97A 4DG0E 3NR9A 4ASXA 4O7TA 3O7LD 3NLBA 4L3LA 4OR5A 3AXWA 4CFUA 4FSTA 2FSLX 3C0HA 3EKKA 3H30A 5B2LA 4D0XA 4YC8A 2WMUA 5L2TA 4CFMA 3ZLSA 4QQJA 3W2CA 2EU9A 1K3AA 3I79A 2VN9A 1YXTA 3NAXA 5CLPA 4YHJA 5J9YA 4R77A 4DFBA 5E1EA 2W1FA 4H3QA 4GK4A 2OK1A 3MDYA 3L8PA 1MRYA 4YC3A 1VYWA 4LI5A 5E8ZA 4O2ZA 1OKWA 3A60A 2C3JA 4LV8A 4Y83A 4LDTA 4OTGA 4QTDA 4KIPA 3IW8A 5LARA 1OL6A 4AN9A 2XNEA 3D5UA 2Z7RA 5L2SA 2AEGA 4GUBA 1WAKA 3E62A 3QCQA 4EK6A 3O8UA 4JOAA 4MD7E 3MVLA 4X6RA 1ZWSA 2R3KA 2OJGA 3NW7A 3PY3A 4JT3A 4DDIA 5HIEA 5EQPA 4DTKA 5AUYA 4EHZA 4O7SA 4ZMFA 3Q52A 3SD0A 2ITWA 1H0VA 3LE6A 3PE2A 1NVSA 2YM5A 1V0BA 4FKOA 2WU7A 4RJ5A 3OD6X 5DVRA 3QYZA 5EFQA 4EKKA 2FB8A 2WTVA 4H36A 5HE3A 3QCXA 3VW6A 4F1MA 4KABA 3GCSA 2E9VA 3AKKA 5EI8A 5LVMA 4KIOA 2OGVA 4CFWA 5KMMA 2W1HA 4I3ZA 4JR7A 3S3IA 3K5VA 2R64A 3DAKA 5EHLA 4IZ7A 4F0FA 4FG7A 5JH6A 4BDDA 3W2RA 4X2KA 1ZYCA 2WMWA 4TYEA 3ZBFA 2B9JA 3DCVA 3L8SA 3P7AA 4IZ5A 3RINA 4PF4A 1GZOA 4RWIA 1PMEA 3CIKA 1H0WA 2VTNA 2YIXA 3SOAA 5C4LA 4RIXB 2BR1A 4YUQA 2OZAB 3OXIA 5AUZA 5CI6A 3FSFA 2W1ZA 4WBBB 2O8YA 4PV0A 2F7ZE 4KIKB 4FTLA 3Q5IA 4ZTLA 3UIUA 4DEEA 3D7TA 2W1DA 4RX9A 4F6SA 5IH4A 2IVSA 4DBNA 2X8IA 2YACA 2B4SB 2YIQA 3HDNA 4WRGA 2HENA 2HK5A 5HNIX 1ZMWA 2VTIA 4FODA 4CG9A 1TQMA 1JPAA 2JDTA 2W17A 3UGCA 2V5QA 4X21A 4QMMA 3DXPA 2WEIA 3AC1A 3Q2MA 4I0TA 3VS2A 5AP3A 3SLSA 3MFSA 3PVGA 5AR2A 4OAUC 4AGCA 5KMIA 2OZOA 4YSMA 2ZFYA 4AXFA 1DAYA 3F7WA 2XK6A 3UOHA 4J99A 4BR3A 5CAVA 1UNLA 4M0ZA 5IEVA 3N4UA 2JEDA 1YDTE 5CSHA 1XH8A 4L44A 1XH6A 4J8NA 4ITIA 1FMKA 5ANIA 4ASDA 2YEXA 2Y9QA 3FY2A 4DH3A 4OAVB 2YITA 1KE5A 3D14A 2CNUA 4U43A 4P7EA 2NRYA 5F95A 1QPDA 5KMLA 1H1RA 1V0OA 4NM7A 2WOTA 2JKQA 2XP2A 3E3PA 5DN3A 2VWWA 5BNJA 2J5EA 1ZY4A 4EH5A 4BICA 3F5PA 3DBQA 2FUMA 1OIQA 4C59A 5C8KA 2C3IB 4M84A 1GJOA 4TT7A 4TYIA 3ZU7A 4J1RA 4TYHA 2IEWA 1O9UA 3JS2A 4FYOA 1KOBA 5CY3A 1F3MC 2J2IB 5TT7A 4RWLA 2CKQA 4FBXA 2WMVA 2I0YA 2WZJA 5CTPA 2JDOA 3PXZA 2EXCX 4IWQA 4ONAA 5AV4A 1YXUA 3Q9ZA 4QMYA 3ACJA 3OC1A 3QA0A 4R7IA 4YC6A 4FI1A 3R9OA 3UO4A 5HZNA 4HGEA 3UNKA 3UQCA 5E8TA 1U5RA 3UO5A 3OS3A 5KCVA 5DT4A 4I6LA 3G0EA 4FT9A 4RVKA 2XKFA 3H0ZA 3PRFA 4M15A 3UVRA 3R7YA 3SOCA 2HYYA 4O0RA 5K3YA 3WF7A 3LFFA 3SRVA 4ZJIA 3F6XA 2DS1A 4CCBA 4F7LA 1V1KA 4NCTA 5BMSA 5KX8A 2EB2A 2BIKB 4MF1A 3UZRA 5FGKA 2C3KA 3IGGA 3BYSA 4NFNA 5DT0A 3S0OA 3G33A 2HCKA 4UMQA 3SW4A 1OI9A 4D1ZA 3R8VA 4NW5A 4ZIMA 3EFKA 5HX8A 3IOPA 4FT5A 4YJTA 3QKKA 2PYWA 2KTYA 5A4QA 1O6KA 5DI1A 3KREA 2QURA 3AC2A 2G2IA 4LUDA 3BE2A 4UYAA 1WBSA 2X2MA 3ANQA 3MN3A 4HNFA 4LRMA 3T8OA 3ID6C 3AGMA 4GYIA 2ACXA 4OTPA 1GIJA 5H9BA 5AWMA 1VR2A 3WIKA 2I0HA 4FTRA 2GNFA 4E6DA 4E4MA 5CU0A 4ZMEA 4O1OA 4ZTSA 4EH4A 4W8DA 3BL9A 4GVAA 4N4SA 5A4EA 3QTQA 2XBJA 4AS0A 4C33A 5CAQA 3EN4A 3UP7A 1M17A 1TQIA 4I24A 2QOIA 3TZMA 3IPHA 4L3PA 4V0GA 4K33A 4ACGA 4GIIA 5DMZA 4E5BA 4IEBA 1IASA 3PE1A 4ZTMA 3OCBA 4EOMA 3R83A 5F94A 3IO7A 4R8QA 4YJSA 4I6HA 1R39A 4NZWB 2VX1A 4FV7A 4YTCA 3ZRLA 4FSZA 3UIMA 3HA6A 3FLSA 4U40A 5CSWA 3UBDA 2GTMA 4WSYA 3KRXA 3O51A 3QZGA 2GFSA 3ZBXA 1Q8TA 4G6LA 4DLIA 2PUNA 2ZDTA 2I0EA 1FMOE 3BHVA 2W5AA 4I21A 4XOYA 3R02A 1CSNA 4H1MA 4AW0A 2UZDA 5D9HA 3SX9A 2P3GX 3HMPA 5L6OA 2GDOA 2XKCA 3LM0A 5L2QA 1NT2A 4Q9ZA 2UVYA 5KHXA 3O17A 1QL6A 1ZOEA 2AYPA 3R01A 3D7ZA 4GG7A 3DBFA 4NT4A 4TZRA 3V5WA 3GC8A 2DYLA 2VWVA 5DR2A 3F61A 2XZSA 3DLSA 4I41A 2OBJA 4I23A 4UMRA 4FTQA 2CGUA 4YZMA 3LPBA 3DDPA 3IDBA 2G15A 2PWLA 2J0KA 4PP7A 3C5IA 3WZJA 5B2MA 2BZIB 2C5YA 1MRUA 2ITOA 2R3HA 5CQWA 4WG5A 3V5QA 3ZLYA 3MFRA 5J9LA 5CEPA 4DT9A 5AUUA 3NUYA 4BDEA 4BCMA 5IEYA 3FPMA 4FYNA 4JDIA 1GZ8A 2ITXA 2Z8CA 4OLIA 5HCXA 2OH0E 2VGOA 4FTOA 1PW2A 4Z3VA 3CKXA 5HORA 3ZDUA 3QHWA 4RVTA 1PMVA 5BUJA 5K4IA 4C4JA 5M53A 2G2HA 1BI8A 3IOKA 4D4YA 2BRNA 5IU2A 1PKGA 4FIJA 4GK2A 4RX7A 5HIBA 3EN9A 4H1JA 3KXZA 3O5AA 4U80A 3QU0A 2J6MA 3O2MA 3ZM4A 4PQNA 4WUAA 4GKIA 4TWPA 1J91A 4AX8A 4UMTA 5KBQA 2FO0A 5FDXA 3NUAA 3ZRMA 3BLHA 3EJ1A 3NRMA 4O86A 2IO6A 5AV1A 4YPSA 3R1SA 4R7HA 3K3JA 3QFVA 3U4WA 4C2WA 5KMOA 4AT3A 3PIYA 5HD7A 5EDPA 4C3RA 1Y8GA 3HMIA 4G3FA 4ALUA 4FTIA 2PMLX 1CKIA 1GIHA 3TUCA 3AKLA 4C38A 3QTRA 3C51A 3DKOA 4BZDA 4D55A 5FQDC 1XH4A 3LMHA 3H4JA 4TNDA 1UU7A 3QTIA 4FSQA 5FWKK 5ETIA 5L8JA 1M52A 2A27A 2XAOA 3RI1A 3AT3A 5CU6A 2WMXA 4F9CA 4NTSA 4HGTA 5JSMA 5B2KA 3LVPA 3FI4A 2XS0A 5JT2A 3BYVA 4NWMA 2J5FA 4OBQA 3CQEA 3FLWA 4PTEA 4NM0A 4UYNA 3ZC5A 3OTUA 4FV6A 4MF0A 2WGJA 4C61A 4F64A 1J7UA 2YDKA 2C5VA 4FKGA 3VHKA 4F9BA 5LMKA 3COHA 4DEBA 1YW2A 5AAFA 1KSWA 3D4QA 4RQKA 4ACMA 2FYSA 3MFUA 4HYHA 4KKEA 4F0GA 3ZDIA 2FSOX 5E8WA 2IZSA 2X8DA 4BKYA 1P4OA 4FTKA 2NRUA 4D58A 2JAMA 2VNYA 1OKVA 3C0IA 3LCOA 2PE1A 1CKJA 2BDJA 2YHVA 4IDVA 2QCSA 4RJ6A 4ANOA 4TWCA 3VBVA 5KNJA 4O82A 4ZXTA 3R8PA 5KHWA 4L01A 4FGBA 5GZ8A 3ZUVA 5I9UA 1Y8YA 1YI3A 1YQJA 4TYGA 4PMPA 3COKA 2QODA 4NFMA 5K0XA 3GU5A 4CFXA 5IQBA 3L9MA 4O91A 4FTJA 3RCDA 2PVHA 3DFCB 3I0OA 4AZTA 2XNNA 4L3JA 4QMNA 3FMLA 2YA9A 5AP1A 3HAVA 1BL6A 3NS9A 4IFGA 5I3OA 2XNMA 4BCOA 2LGCA 4EHGA 4F4PA 4GSBA 1JOWB 3ZSHA 3ELJA 3TTIA 2W5HA 4O38A 4CLJA 4FEXA 3QRTA 2X6DA 3EN6A 4RPVA 5FTOA 4XP3A 2BHHA 4BBEA 4BB4A 3KMWA 4HYUA 1LP4A 1PY5A 5HVJA 4R3PA 5IG1A 3I5NA 4AUAA 4QPAA 4C4IA 4C4EA 4JG7A 3PSCA 4L00A 3LCSA 5IKWA 4QDEA 3MGYA 3BHUA 4L7FA 2H34A 3UP2A 4BZNA 4BCIA 5CU4A 3LIJA 1YOJA 3HUCA 5CQUA 3SRVB 3CSVA 2OJFE 1T45A 3BLQA 4V05A 3KEXA 4BDGA 4Z7HA 2J9MA 4LL0A 4YLLA 3TM0A 3VS6A 5I9YA 2QNJA 4FKTA 1KOAA 5DFPA 4B8MA 2PMOX 3HP5A 4BJJB 1ZYJA 2YISA 4H58A 3RAIA 4KRCA 3FZTA 3ZS5A 3DBCA 3S95A 2ITZA 3NNWA 4GFMA 4CQGA 1W8CA 3SKCA 2PVYA 2QOCA 5CF4A 3EL7A 3TDVA 5HBEA 4ITJA 4PTCA 4DA5A 2JDVA 3KVWA 3PYYA 3OMVA 4G9RA 4NUSA 3ZRKA 3IECA 1RE8A 3CD3A 3ALNA 4BCKA 3LFDA 2CDZA 3T9IA 3NNXA 3NAYA 3PJ2A 3EFWA 5CSXA 3LLTA 3NUUA 4IZAA 3CP9A 3TG1A 1OL5A 2ZV7A 3MB6A 4LG4A 4F9WA 3ACKA 1M2QA 2BZKB 3FMDA 2BTSA 4G3CA 4AW1A 1W83A 2VWBA 4D2PA 1WBOA 3OOGA 3PLSA 4FIGA 3UE4A 2PVRA 4MUQA 4RIOA 3QC9A 4YJOA 3H9RA 4PL3A 4RJ4A 5EK7A 1PHKA 1IA9A 4AXEA 5ITAA 2YCQA 3JY0A 3SXFA 3R2BA 5J7HA 2OFUA 1PXMA 3ORXA 2ZV2A 3LAUA 2AQXA 2HZNA 1PRYA 4O0XA 1NVRA 5AFVA 4XHKB 3F3ZA 3KY2A 2QG5A 2W5BA 4HNIA 2FH9A 2V62A 4IDTA 5AX9A 4I4EA 4IZYA 4F99A 2X1NA 3D15A 3TIYA 3Q2JA 5EM8A 3EQCA 3VS5A 4O4EA 2RFNA 4Y85A 2UZOA 2ITPA 2VTSA 2YM7A 3KRJA 3QRKA 2RF9A 4C4FA 5D41A 2OKRA 3GBZA 1YWRA 3EWHA 3FLYA 1YOMA 3A7GA 2NYAA 4X2JA 3HRFA 3ZO4A 1YXVA 4RC4A 2F2UA 2WHBA 1R0PA 5K4JA 3WZKA 4DGMA 3TNWA 4OGRA 2R5TA 3ODZX 4P2KA 3MA6A 4D4RA 4DFXE 4OTRA 4DTAA 3IK3A 3BHHA 3WIGA 3Q5ZA 3SHEA 3MH0A 5IF1A 3UMWA 3P23A 4XOZA 2O2UA 4FV4A 2YIYA 4FVQA 3UYTA 5EM7A 1FGKA 4TY1A 3G15A 3OW4A 5AADA 1QMZA 3MS9A 4D9TA 4YHTA 4ID7A 4FG8A 4ZTQA 4A9SA 4AGWA 3ML1A 3AT4A 4J71A 5HQ0A 4X0MA 4F63A 4KB8A 2O5KA 5JQ5A 2C1BA 3QD4A 5JFWA 5GINE 2X9EA 4LUEA 3NUPA 4K2RA 4QTBA 2YM4A 2C1AA 2ZM1A 4MX9A 2WTDA 2XA4A 1PJKA 5CSPA 4KRDA 3LCDA 4FUYA 5CVHA 3OF0A 4E4NA 2W1GA 3AC8A 3II5A 4FT0A 5JFXA 2YDJA 2RGPA 1OM1A 2REIA 4G34A 2CKEA 3ZLWA 4FA2A 1ST0A 3B8QA 2Z7LA 3MESA 1G3NA 4L8MA 1KV1A 4IVAA 4FZ6A 2HXQA 3ZO2A 2VWXA 3PVWA 1ZAOA 4RIXA 5FG8A 1H25A 2OZAA 5EDQA 5HG9A 3V5JA 4A9RA 5GJGA 5CSVA 3R7VA 5AV0A 5H8GA 5DYJA 5CF5A 1WCCA 5HNGA 3DK3A 4MBIA 2VX0A 1YHSA 3FZRA 1YWNA 1P2AA 2C6IA 3JY9A 4YTFA 2X2KA 5HO8A 5LOHA 2QHNA 1H1QA 3FQHA 4IANA 3R21A 1OPJA 3QQFA 4J98A 1GAGA 3P5JC 1TKIA 4G3EA 3U9CA 5EOLA 3U51A 2IW6A 4PMMA 4I22A 1Q3WA 1W2CA 3FHRA 4EBWA 2BFYA 4TXCA 1U54B 3QGWA 3RHKA 3G9LX 3WI6A 4F6UA 5FEEA 5A4CA 3IQ7A 4Y8DA 3NZ0A 4A7CA 2Z7QA 5I9ZA 4UXQA 3FXZA 3UTOA 4DGLC 3VBTA 1ZARA 4E4LA 4AT5A 3C9WA 3QQJA 4YTHA 3R9RA 5J95A 2Y0AA 1RQQA 2GSFA 3BLRA 4H39A 5D7VA 3QRUA 2P2IA 4Z16A 3BWJA 5HO7A 5AMNA 3BU3A 4JR3A 4NL0A 1JSTA 3CR0A 3FPQA 2BUJA 1BLXA 1U46A 4ZLOA 4EUTA 4PDOA 3F2RA 3OWPA 3AMBA 1Q8WA 3R7IA 2GNHA 4U0IA 4BWPA 5EOBA 3ITZA 3LXNA 4YSJA 1M2PA 2PVFA 4FTAA 3RP9A 3HEGA 2JDSA 3VUDA 4D5HA 3NFFB 3VS0A 4C0TA 4DGOA 3ZOSA 3E8DA 3GC0A 4FOCA 5HKMA 2JIIA 3W16A 2WNTA 4UY9A 5HI2A 4BFMA 2EVAA 3PRIA 3EB0A 2W06A 4P5QA 1B6CB 4PDPA 3ZH8A 4CRLA 2QU6A 3VJNA 3D94A 1NA7A 4EZ5A 2WEVA 2HZIA 3KRRA 3HA8A 2ETRA 4JG8A 4IB1A 4Q2AA 4CKRA 2VTJA 3HRCA 3ODYX 3OUKA 2P0CA 2LAVA 2XB7A 1TZDA 3DY7A 2JBPA 1B39A 2ITQA 4K0YA 3UDSA 3MW1A 3OP5A 4QMXA 3PJ8A 4CFVA 5A14A 5HLNA 3JUHA 4Y72A 4GL9A 3W0RA 2C0IA 3C1XA 2YAAA 4NJ3A 4NIFB 4FSMA 4YNOA 3VUTA 5BPYA 2PULA 3CTHA 5DLSA 4IB5A 3K3IA 4FRFA 2WQOA 2W4OA 1Q99A 4APCA 1AQ1A 3RK5A 5AV2A 3QC4A 3BX5A 4ZJJA 2GHGA 4YTIA 3KKVA 5FEQA 4MKCA 4N0SA 2ZAZA 4U6RA 4QYEA 4EQCA 4JMQA 3DB6A 1OPLA 2VWZA 3C5UA 3P78A 4HVGA 3ORLA 5M09A 3EZVA 3SC1A 4BIBA 4OTQA 4MWHA 4QOXA 3FAAA 4E73A 4XP2A 5C8MA 1XMMA 4CV8A 2XANA 1ZOGA 2VAGA 2VTMA 4HYSA 3UVPA 5L8KA 4BYJA 1E1VA 3ZMMA 3ZC6A 2QU5A 3WYXA 5EW3A 5DWRA 4ZSAA 4CQEA 1Q8UA 3PG3A 4ZOGA 4QNYA 5LMAA 4AGUA 3ZO3A 3UDBA 4XV9A 3E7VA 3LW0A 3DA6A 4I5HA 4L42A 3LZBA 2W1IA 3HKOA 4PP9A 1JQHA 1GZNA 4FVPA 4TYJA 4BZOA 2IZUA 5LCJA 3DOGA 3O8TA 3FKNA 2PL0A 2XMYA 3ORMA 4FZFB 4QP1A 2QO2A 3NYOA 1O6YA 2GU8A 4HCVA 5KZ0A 5LVOA 3EOCA 3SDJA 3RZBA 2OI4X 1Q97A 4S34A 3TL8A 3CBLA 2J0JA 4UV0A 2VO0A 5HOAA 1A48A 4D0WA 2HELA 2XRWA 3ENMA 3O96A 2E9UA 4E26A 3Q3BA 2RKUA 1HOWA 3OXZA 2XIXA 4OUCA 2QOLA 4IWOA 4IMYA 2QR7A 3RPRA 3SXSA 4AACA 4WOVA 4C4GA 4JRNA 3MBLA 4O2PA 4ANSA 4E6QA 3P5KA 2YABA 4IH8A 2I7QA 4I5MA 4IAFA 3SXRA 2OSCA 4MAOA 4W4XA 3TZ9A 4C62A 2J4ZA 4RSSA 4C58A 2YJRA 2QKWB 5JFVA 4XX9A 4DN5A 3VBXA 3LFSA 1TVOA 3MY1A 3LXPA 1R78A 3G90X 5IUHA 3UOJA 4ZY5A 2E9NA 4FTUA 1XBBA 2C5NA 2XCHA 4J95A 3PJ3A 3LMIA 4IC7A 3LCKA 5ANKA 2B1PA 2CPKE 4KA3A 2OF2A 2R2PA 5E92A 5BMMA 2GQSA 2B9HA 2UVXA 3GCUA 3H9OA 3HV5A 3V01A 5IA4A 3OWKA 4WKQA 4C4HA 3PUPA 4M8TA 1I44A 2GNJA 2XIRA 3G51A 4U5JA 3JYAA 2UW3A 3NMUF 4FEVA 3FDNA 4JS8A 4FF8A 4FTNA 3UMXA 1TQPA 2YFXA 4ZK5A 4RIYB 4DLJA 2A2AA 4O4BB 4HVSA 4EC8A 5FM2A 1KE7A 3I81A 2BVAA 4D9UA 1VZOA 3EQHA 4D2VA 3ATSA 3UDTA 2B52A 3LJ1A 2E2BA 1KV2A 3G6HA 1TFFA 4PNKA 3PLAE 2QOFA 4DFNA 2W96B 4R3RA 4ZSGA 2Q0NA 2X4ZA 5TE0A 4MH7A 1KE9A 2OXDA 2RSVA 4O4CA 3LFEA 5EW8A 5C03A 4YO4A 4ZLYA 4JIAA 3U6IA 3MTLA 5IMEA 4D28A 1H01A 5HCYA 3QZIA 4MXXA 2JGZA 5EW9A 3KXMA 4QTCA 4JBOA 3LXKA 4IWDA 3OCGA 5JKGA 2WB8A 1OKZA 2ZYBA 2NO3A 4NW6A 3ZUUA 3IW6A 2QOHA 2BRBA 4U42A 4DH8A 1FBNA 3AKJA 4Y73A 5CS6A 3V5TA 1OKYA 2C6LA 3F5GA 5F1ZA 1O6LA 4DG2E 2B0QA 3LQ8A 1SNXA 4K9YA 4JG6A 2W05A 5ETCA 3P08A 4BDIA 4IFCA 4XG7A 3MPMA 2JIVA 4K77A 4GV1A 4RVMA 1YI6A 2GS6A 4IVBA 3ZCLA 3GCVA 2OLCA 2J90A 3MIYA 4ZZMA 3UQGA 2B9FA 3AC4A 4PPCA 4R78A 3DQWA 3VONA 2Y7JA 1YI4A 3ENHA 3DJ5A 3PIXA 4G5JA 4X2NA 4W8EA 1MRVA 4RZWA 3U87A 2ZM3A 2WXVA 3VW8A 2VTRA 3DQXA 2JLDA 2EXMA 5AV3A 1FPUA 4IC8A 3HZTA 5H8EA 4Z55A 2F7XE 4GW8A 1Y6AA 5E91A 4UMPA 5L2WA 2WMTA 3A61A 2W9ZB 3QALE 3UO6A 3UOLA 4D4SA 3QUPA 3R1YA 3C7QA 4F0IA 1WBPA 1PF8A 4DYMA 1PMUA 1SVEA 4Q5EA 4WO5A 4E8AA 4LV5A 2QHMA 3I7CA 5HE0A 4AZSA 3GOPA 3PXQA 4UWCA 3DKFA 5TF9A 5C9CA 4AQCA 3Q96A 4EK8A 4JI9A 3IGOA 2EUFB 3BV2A 3FLNC 4FNZA 1J3HA 5DBXA 3QYWA 5J8IA 2QLUA 4C37A 5F9EA 3P79A 4LGHA 4RRVA 3QQLA 5B0XA 4FKVA 5HG7A 4F9YA 2X39A 3SVVA 2UZEA 3G9NA 3BGQA 4YGAA 3WZDA 2OF4A 3O7LB 5HNBA 4USEA 3PP0A 2BTRA 3KK8A 5L6WL 5HVKA 2CKOA 4CRSA 5M4CA 2WOUA 4N57A 1YXSA 1VLRA 3GC9A 3FLQA 5DR6A 4AW5A 2HIWA 1OGYA 3AOXA 4JX7A 3VWAA 5IDNA 1ZRZA 4EJ7A 2IZRA 3TWJA 3ROCA 4D2WA 2XUUA 3NPCA 2WMBA 4J97A 3Q6WA 4NKAA 2PVJA 3QKLA 5IEXA 5A9UA 4I94A 5E90A 4EH9A 5KO1A 2JBOA 5HG5A 2F9GA 4E4XA 5LQFA 3HUBA 2VZ6A 1IG1A 3D5XA 1H07A 2ONLC 5HEZA 3K54A 3RMFA 1YVJA 3TIZA 5JEBA 1WMKA 4ZZOA 3P0MA 1SM2A 2NNWB 3BU5A 3U8WA 4DHIB 4KWPA 3R8ZA 5FLFA 2P2HA 3BBTB 3LMGA 3DBEA 4V04A 4B7TA 3Q60A 4BHZA 3FMEA 3DZOA 4BJJA 5AP4A 1BL7A 2F7EE 4FSYA 3IDCA 4NTTA 5CEKA 1GY3A 3W32A 3MJ2A 4M13A 3P4KA 4X3JA 4AF3A 5ICPA 4AG8A 3DK7A 4CNHA 1FVTA 3RAWA 3CJFA 5EQEA 4QMPA 3VULA 3FKOA 1Q3DA 4B9DA 5J7BA 2UVZA 4FVRA 4KD1A 2YDIA 2PUIA 1SVGA 3BBWA 5AUXA 3PFYA 1YDSE 4ZTRA 3HL7A 3PXRA 3PVUA 3IW7A 4O7YA 3SAYA 2OIQA 3NWWA 4XG3A 3DU8A 3KCFA 4MXAA 4MEDA 1QPEA 2VD5A 5D12A 5BVOA 5GZAA 1RW8A 2C0TA 4TPTA 3VUMA 4QYHA 4E1ZA 2UZVA 3KXHA