2GNJA

Pka three fold mutant model of rho-kinase with y-27632
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTIGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIKVADFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Structural analysis of protein kinase A mutants with Rho-kinase inhibitor specificity
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 110
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gnjA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gnjA02
1JKKA 2WMQA 4U3YA 2R9SA 4IFCA 1Z9XA 3DLZA 3DZQA 5CNNA 5D12A 2UV2A 2PZYA 4R78A 3UG2A 2EXEA 3NW5A 2KTYA 4FV4A 4XS2A 3PVGA 2PY3A 3KF4A 3NYXA 1PKDA 2WOTA 4RX9A 4M97A 4FF8A 4BR3A 4YHFA 1M7NA 2W17A 5HCZA 3I60A 4GYGA 1NVRA 4M3QA 4XG6A 2C0IA 3EN4A 5CY3A 5F20A 4KUJA 4M8TA 4RA5A 4I3ZA 4O81A 4IJ9A 4UN0C 3OVVA 2VWUA 3L9MA 3L8SA 3MFUA 1YOLA 2QC6A 2QCSA 3FMEA 2C6KA 3NIEA 4ZTNA 4QMOA 2W05A 3EYGA 4UWCA 2OJ9A 1ZWSA 1YI4A 1O9UA 3K2LA 3DDPA 4UMUA 3CJGA 3PY1A 4AW2A 2PVFA 3IONA 5HIBA 3R04A 2CLXA 3LVPA 3FJQE 4IDTA 2W96B 1S9JA 4XP2A 3T8OA 3QTWA 4PL4A 4M84A 2F4JA 4IB0A 4C2WA 5AFVA 1VZOA 2ZV8A 1KE8A 1ZRZA 2WTCA 2UZUE 3P4KA 3IW8A 3QFVA 5HX8A 1V0PA 3QX4A 3W2RA 2BDFA 4PDOA 2WMTA 3R7EA 4DG0E 4AWIA 3ORXA 4MXAA 2ZB0A 3TACA 4F70A 4JG8A 2B7AA 2QOLA 4F65A 4TY1A 2BHEA 3ZH8A 5AUXA 4BI0A 3QZIA 1R3CA 4JBVA 2YDJA 3BQCA 4GIIA 1XQZA 1LR4A 4PL5A 1IG1A 1PXOA 5ETCA 4WUNA 3UNJA 3ZZEA 3ID6C 2IVTA 1OKYA 4L53A 3BX5A 4FT9A 4YU2A 1KWPA 3IW5A 3EIDA 3I5ZA 3LM5A 1IAJA 4MD7E 4O0UA 5LVMA 3E8EA 4QMZA 2ZV7A 4XUFA 4FSZA 3IW6A 5C8KA 3HZTA 1UU7A 3DJ7A 5C9CA 2PUUA 3TL8A 5HTCA 2J9MA 4IH8A 4NTTA 2DWBA 4DC2A 3QQJA 3AT2A 4UYAA 5K3YA 5F94A 5CI6A 3ZXTA 5K5NA 4YC8A 2B54A 4RC3A 2WQEA 1V1KA 5AM6A 3UTOA 2JIUA 2B9IA 4FZ7A 4PPAA 3EZRA 3U4WA 2QKWB 4KB8A 4WBBB 3H0ZA 5L2IA 1OMWA 4J97A 4G6NA 2NP8A 2YJSA 3RCDA 1PRYA 4I5MA 1SM2A 1ZZLA 4DBXA 1OI9A 3TJCA 4QPMA 3QQGA 1B6CB 3VAPA 2XJ2A 3VJNA 3ETAA 3SQQA 4LMUA 3UPZA 3UIUA 3PIZA 5E9EA 5CXHA 4ZTSA 2QKRA 2XZSA 4YPDA 3WBLA 5IEXA 3KCFA 5EG3A 4FV6A 2HAKA 4TWNA 3I6WA 2B53A 4U42A 4OLIA 5HGIA 3RZFA 5FXSA 2PVRA 4PTEA 1P5EA 4DYMA 3V04A 4X2GA 2RG6A 5EM5A 4X3FC 2HZ4A 1GZNA 3DB8A 4I20A 4J7BA 4CFVA 2OZOA 2QOOA 4OTFA 4D55A 5L2TA 3HP5A 3I79A 3KL8A 4WG4A 2OO8X 5DR2A 3BLRA 1X8BA 3LFCA 1YOMA 2XNMA 4G3CA 4YPSA 2NNWB 1APME 2XIZA 3FKOA 4FKIA 3QHWA 5A4QA 2CJMA 2ETMA 3AMBA 4IXPA 5CF8A 3BBWA 3ZC6A 2XNBA 2I0YA 2I40A 4BL1A 5M07A 1ZYLA 2GDOA 3NUUA 3VRYA 5M57A 4USDA 4R3CA 5CYIA 3EQPA 4RJ5A 2WEVA 2WMXA 3DBFA 1XBCA 1Z57A 2FH9A 3BE2A 4JVGA 2W1HA 3E87A 4GUEA 4ZTMA 2QO2A 4E6DA 5CZIA 4A9UA 2G1TA 2IG7A 2P55A 2H6DA 3POOA 4FC0A 4ENXA 2GQGA 4HW7A 4Z7GA 5JZNA 4OTIA 3R9NA 4E8AA 3UIBA 3OOGA 3PXFA 4I0SA 3LJ2A 3QRIA 4L68A 5T6KA 1PXIA 5HCYA 1W0XC 3MY5A 4HCUA 4FG7A 3AT4A 3DAJA 2A27A 3OC1A 3OXTA 4U97A 4PRJA 3TNWA 4BKYA 2E2BA 5AAEA 2GS7A 2X9FA 4KRDA 2OICA 1LEWA 2ITPA 2VX0A 5A4LA 2IVVA 3D83A 4IZ7A 4Y8DA 1H1RA 4UALA 3KF7A 3R0TA 3UVRA 2J0JA 5LXMA 4N4SA 3QHRA 3FXXA 2AC5A 4LRKA 1ZXEA 4P5ZA 5EW8A 1P4OA 4NH1A 5CAOA 5HX6A 3NYOA 3SG9A 3DFCB 3V5PA 2GNJA 2G9XA 2VWYA 2UW6A 2Y6MA 4YZNA 4V0GA 3C13A 3SG8A 5KHXA 3ZRKA 3VS1A 4II5A 3ORMA 5AUTA 4ANQA 4XG9A 5LMBA 4FYNA 3A8WA 5KHWA 2GHMA 3R7UA 3D14A 5IA1A 1F0QA 3LCTA 4PY1A 3E8CA 2ITWA 2XKDA 5AMNA 3PPZA 4FKSA 1QL6A 4GMYA 3NNWA 3ZUTA 4F63A 5HI2A 4U8ZA 4U44A 4BDAA 4IAKA 4LOOA 4B4LA 4DHFA 4CGAA 2GMXA 4RGJA 4IWQA 3FDNA 4DEDA 3ZEPA 2HXLA 3PSBA 2Z7QA 3FZSA 5CF6A 3PYYA 1XBBA 3G9LX 3TTJA 2WNTA 3CTJA 1ZAOA 2YLFA 3PRFA 4QOXA 4Y5QA 5JRQA 4YJPA 2WQMA 4KBAA 5KUPA 5IKWA 2PZIA 4ZSAA 3MW1A 5JFSA 4FTMA 3MV5A 4G6OA 4ZIMA 5L8LA 5LVNA 4YBJA 3LMIA 4LG4A 3ALNA 3W8LA 4EKLA 2ZB1A 3QTRA 4TPTA 2YIXA 3ZOSA 5A14A 5CT0A 4M15A 4WNPA 5IA3A 1UNHA 5IH6A 2J51A 3QLGA 4LMNA 2HIWA 3ERKA 3VBVA 3E92A 3ZCLA 4O96A 1UA2A 2PULA 4EJ7A 3Q5IA 2UW9A 3V3VA 4TN6A 2YERA 3ZEWA 2XYNA 4XMOA 3FMMA 2EXCX 5FBNC 4PDYA 3U6HA 1XH6A 4JR7A 5AV4A 3LCKA 4A9RA 5FP6A 4DH3A 4RX5A 3VUHA 2H34A 4YO6A 4O27B 4S31A 2CGXA 2PZ5A 1URCA 3MGYA 2OH4A 3ZTXA 2BZJA 2VTNA 4QQCA 4YMJA 3OY1A 4CRLA 5C4KA 2RSVA 1JKLA 4K11A 4JLCA 4P7EA 4FT3A 2YZAA 4R7HA 4I93A 5HICA 3R7YA 3ZO1A 4UV0A 4CG9A 1FVTA 3HVCA 3F3VA 3RWPA 3LFAA 2XKEA 3O51A 3PA3A 2C3KA 3QZGA 4S33A 3W10A 4ACDA 1FMOE 3BBTB 2R7IA 3K3IA 4O0RA 3Q3BA 4TT7A 3DQWA 1YDRE 1H00A 4ZEGA 2R5TA 1WMKA 2R3PA 2XMYA 3ZU7A 3FZTA 4FL3A 2CLQA 1PHKA 5M53A 4MF1A 1PXLA 2JGZA 2YHVA 5M4UA 2QOFA 2WTWA 3QCSA 4F6SA 3LFFA 3OMVA 5LMKC 4PDPA 3D9VA 4XV9A 4ZTQA 3C4WA 5CU3A 5BVEA 3Q4ZA 4E4LA 1ZZ2A 2R3OA 2PUNA 2O5KA 3ROCA 3FQHA 3UGCA 5CU2A 4F9AA 4OTRA 2R3QA 3RJCA 2YIWA 1IAHA 3VUTA 3IDCA 3GU6A 3D0EA 4WBOA 4MXXA 3FI8A 4A9TA 3W2PA 3MFSA 3COIA 3NX8A 4F9YA 3SDJA 4ANNA 1JQHA 5CZHA 1Q97A 2JDSA 4QMXA 5CSVA 5HLNA 3F61A 4AF3A 2ZVAA 3FC2A 3KCKA 4OUCA 3MSSA 2WU6A 4FSRA 4IX3A 4XV2A 3SHEA 4GRBA 2Z7LA 4I92A 4NIFA 3LCDA 4E4XA 5AADA 2BMCA 3EQHA 3E5AA 3F3WA 3ELJA 3LE6A 2XRWA 3KMUA 4ITJA 1JPAA 1ZMVA 3I0QA 5DN3A 3ACJA 5JMSA 3AMAA 1BYGA 3VQHA 3TV7A 3VWAA 5AAGA 3AMYA 2YIRA 2W7XA 5JFVA 2SRCA 4FTAA 4AW0A 2YCSA 4EQMA 5CEKA 3TNQB 4LGHA 4FKLA 1XWSA 4HGLA 1H1QA 1CKIA 1BL7A 4O0WA 1WBPA 4I4FA 4ASDA 1CMKE 2H9VA 2HXQA 2IVUA 3H10A 5E1SA 3VRZA 2NRUA 5HG8A 2XVDA 3ZBFA 1DAWA 4TZRA 3RP9A 1UWJA 3O8UA 3FZRA 1H25A 4M14A 3EQGA 3V8TA 2VWWA 3KMMA 1M2QA 4M0ZA 3VW8A 1G5SA 2VTLA 1PMUA 3WYXA 3CQUA 2HZIA 2OIBA 1J7LA 4O7ZA 1WFCA 2XP2A 4NM7A 4IJPA 4RVMA 1ZY4A 4HGSA 2IVSA 1M14A 4PNKA 3Q60A 2P33A 2VWVA 3EYHA 4GL9A 5FEQA 4BYIA 2BTSA 2IN6A 2J0KA 2X6EA 3EQFA 2Y4IB 4V01A 5CLPA 3VJOA 3RAIA 3MDYA 2IW6A 3KXNA 3WZDA 3SXSA 3TZ8A 4FZAB 4F9CA 2WXVA 5DE2A 3EWHA 3UVPA 5J1WA 3IQ7A 4QMQA 4ACMA 2OZAA 3MTFA 3OBJA 3T3VA 4QQTA 5AUUA 3PSCA 3FXZA 4BWXA 4LUDA 3OTUA 5BUIA 1YXTA 2BAKA 2REIA 2BTRA 3ZRLA 4BCPA 3TUDA 4IW0A 2PVMA 4QNYA 1QPEA 2QOQA 4M69A 5EQYA 1VR2A 1M7QA 2C3JA 3FAAA 5EQEA 4HVSA 3E3BX 3O8PA 4FTNA 3EHAA 3OUNB 3LXKA 3BV3A 4JX7A 4TTHB 1DI8A 2WGJA 3KU2A 4HPUE 4NCTC 3W32A 3R8VA 4ZMEA 5M06A 4TWOA 4AOJA 4F99A 3KXMA 1REJA 5K0KA 4B0GA 4NZWB 3FLZA 3S3IA 3ZC5A 4E20A 3B2WA 4E6QA 4CG8A 3BU3A 4WNMA 3QZHA 3Q5ZA 5DBXA 2W9FB 2C47A 2QLUA 4EOJA 4LV8A 3PP1A 5A54A 2PHKA 4D28A 2J0IA 4PQNA 4YJTA 4L44A 4MQ1A 4ZSLA 4D0XA 3D2IA 2RFEA 4XV3A 3HRFA 3OW4A 3AGLA 3MFRA 1KE5A 4CCBA 4RX8A 4RIWA 2ITOA 4KAOA 2EUFB 2JDVA 4YGAA 3UOLA 1ZOGA 3DJ5A 4HVGA 3KK8A 4BI2A 2FGIA 4L8MA 4FSMA 4EEVA 4Z55A 3C9WA 2C3IB 1MP8A 4I5CA 2OKRA 3D2KA 1Q8YA 3FMJA 2F49A 2OJIA 4R77A 4FL2A 3PPJA 3PP0A 4WHZA 1NW1A 5EM8A 2OXDA 2YA9A 2X6DA 3Q6WA 1OPLA 3UIXA 4ZLZA 5EYKA 3PY3A 4Q9SA 2JFMA 4AW1A 4L43A 4YJNA 4C4EA 4JAIA 5C01A 3D7ZA 4ID7A 1V0BA 4RJ3A 2WMUA 4QT1A 2HWPA 5HESA 4EJNA 4CKRA 5JQ5A 2ITXA 2VTHA 3EN6A 3VNTA 3GFEA 3T9TA 3RBWA 4MNFA 4QMVA 2J0MB 4C0TA 4D5KA 5IU2A 3KY2A 4M7IA 2R3FA 3PVUA 3ZZWA 3NEWA 4IC8A 4XRLA 4DTAA 5M55A 2DYLA 4H3PA 3U51A 4GCJA 3PIYA 3FLYA 2CKEA 4L3JA 2B9FA 5ANDA 2JKKA 4YTHA 5KE0A 2FSOX 3QQKA 2OXXA 5HKMA 4IE9A 5CENA 5LCJA 5L2SA 4FSYA 5L6WL 2PYWA 1GIJA 4BHNA 4GVAA 1Q8TA 3BGPA 3PVWA 4XH6A 4M12A 4AGWA 5JZJA 3JXWA 4IM3A 5BVOA 2X39A 3AC3A 5IQBA 3RPOA 3VBXA 3OCBA 3DPKA 4CTCA 4DH5A 5JSMA 1TQIA 3N4UA 4R8QA 4CMOA 3MFTA 3MS9A 2Y6OA 5HU9A 4AACA 4L46A 4NFMA 5CVFA 5M08A 4AA4A 5A4EA 4FIJA 4FZFB 4FKVA 4BTJA 5I0BA 4N0SA 4ZZOA 4IFGA 1NY3A 1ZMUA 2W1IA 1QPCA 2XNPA 4EH7A 3LFSA 3VW6A 2PE2A 2F7EE 3BPRA 4NJDA 3UNZA 4I6BA 4V0GB 4D2WA 5KNJA 4BGQA 4H05A 3CTHA 2BZKB 3OWLA 3PLSA 4EHVA 2ZDUA 4C36A 2BIYA 5K4JA 4LGDA 3NYVA 4O7VA 5LWMA 5GIOE 2BAQA 2VZ6A 2IZRA 5LOHA 4W9XA 3FLQA 1ZLTA 2PUPA 3NNVA 5DRDA 1YI6A 4EHEA 4QMWA 3LLTA 4I23A 5DVRA 4U41A 2WEIA 3GOKA 4B8MA 2UW8A 3VS4A 3GQLA 3FI3A 3V8SA 4YUQA 5M4IA 3KMWA 2UW7A 3ZDUA 3FMKA 2WO6A 3DXPA 4DEAA 4IBMA 3R9DA 2EVAA 3ORZA 4BDGA 2ZM4A 4ERKA 1OIRA 3KVWA 5J9LA 2OJGA 3AD4A 5TO8A 5CEIA 2Y8OA 2BVAA 3ZHPC 4O0YA 3HV6A 4E5AX 3D5XA 3DXQA 4BDDA 1BL6A 4FZ6A 3A7HA 4EOLA 3R1YA 5EYDA 2PUIA 4FIIA 4EBWA 5DR6A 4YTCA 2R3GA 4MXOA 3ZLWA 3HL7A 3HV5A 4OTDA 1H27A 2B52A 4APPA 4GJ2A 3WF8A 2XEZA 4C34A 4DCEA 3FXWA 5G6VA 4QMTA 4MYGA 2VTSA 3S95A 5EHOA 3K5UA 2IO6A 4FIEA 4NKAA 5LVLA 5CI7A 3CGFA 3I7CA 4KBCA 3ZM4A 5E8UA 2I0VA 3QXOA 2BILB 3A7FA 4OW8A 2PZRA 3C4XA 4R3PA 5EDPA 1W84A 5TOZA 4OGRA 2YAAA 4AE9A 2PWLA 1G8AA 1PXPA 5AR4A 4NUSA 4TYHA 2Z2WA 4GIHA 3TKHA 5KX8A 1T45A 4HCVA 4J52A 1OPJA 4GFGA 4EH6A 4BDIA 1LUFA 4TRLA 1OBDA 5F9EA 4X2KA 5DT0A 3F3TA 3VBTA 4G5PA 5CQWA 5HOAA 3BHTA 4FNXA 4RIYA 1RDQE 3QLFA 2Z02A 3EKKA 4FVQA 5KKRB 5IEYA 3DGKA 1ZMWA 4IWPA 3TNHA 1WBTA 2XBJA 1GIHA 4CFNA 2X1NA 3DB6A 5CVHA 2XIXA 2XCHA 3DJ6A 3ORTA 2F7ZE 3I4BA 3WF7A 3ZFXA 1LPUA 5ANEA 4FTRA 5LVPA 4RJ8A 5HBEA 4FV7A 5KCVA 1CTPE 2QR8A 4MTAA 5ETFA 2JLDA 3E7OA 4FG8A 4O7SA 1UKHA 3OROA 3HUCA 3ODZX 2X7FA 3O7LD 4LRMA 3RNIA 3RPVA 1J3HA 3ZUUA 4EC8A 2BRNA 2XBAA 4BDFA 1URWA 4CFFA 5IPJA 4CFUA 1MRYA 4G3EA 4L3LA 4UWBA 3R63A 5BVFA 4ORKA 3DV3A 1Q8UA 2UW5A 4FTIA 3I1AA 4BIBA 4OAVB 3Q2MA 4GG7A 5ANKA 1YOJA 4LYNA 3E88A 3MPMA 4TYEA 4ACCA 1YRPA 4GFOA 3MN3A 4NW5A 3P79A 5I9UA 2UW4A 3NVKI 3R2BA 4QP7A 2X2LA 5DGZA 1R78A 2C5OA 3RI1A 1JSTA 2GPHA 2XK3A 1BKXA 2BFYA 2P2IA 4O83A 4NIFB 4IWDA 4JQ8A 3MB6A 4U0IA 2Z8CA 4WNKA 2OH0E 2YWVA 3MPAA 2QLQA 4AOTA 1WVXA 4E4MA 3GU4A 1F3MC 5IG1A 5JQ8A 2J2IB 4YHTA 4EORA 5HBHA 1GJOA 2YZLA 2OJFE 4JXFA 3F66A 4IX6A 4YSJA 3V5LA 3HV4A 4FV8A 4IQ6A 5M56A 4G3DA 4KINA 4M67A 2W4OA 4I6HA 4RIXA 4BCQA 4FTUA 2JFLA 3O23A 3A2CA 3DKOA 3R00A 5E8TA 4D0WA 4O38A 5E8WA 3V6RA 5EYCA 4O7LA 3DZOA 1NXKA 2ITVA 3P08A 4J1RA 5IDPA 5IEVA 2JBPA 3QX2A 5L4QA 3PPKA 3FI4A 4EH5A 3ZFYA 5I9XA 3ENMA 2OBJA 1E1VA 5FDPA 4NSTA 1OL7A 3BYSA 3E93A 5HLWA 2UZBA 3UQFA 3F2RA 2GNIA 2VO7A 3IW7A 4X3FA 4FIHA 5E8YA 4FKRA 3LXLA 3QA8A 3EQCA 5FBOA 1FINA 4C59A 5JFWA 5HG9A 4DGNA 1JKTA 3RPYA 1WVWA 4B99A 3M1SA 5EM6A 4NWMA 2W0JA 5AWMA 4PMPA 2R3HA 1W8CA 3ZO3A 4AW5A 1GZKA 4EHZA 5ETIA 1EH4A 2UZLA 3QAME 4KKEA 5AV0A 4H58A 5AR7A 5K9IA 5KMMA 2ZV2A 3HMOA 2YIQA 4QQ5A 2OZAB 2ITTA 3KA0A 5ACBC 3UO4A 2ZM3A 3OEZA 5AA9A 1RW8A 3EQRA 3TG1A 4EUUA 4C4FA 3W2CA 3NSZA 1OITA 2F57A 3HAVA 4G34A 4C58A 2QHMA 4H3QA 4PP7A 2ZDTA 2ITYA 4M69B 1XH4A 3QTXA 4FV1A 5F4NA 4ZAUA 1YWVA 1UVRA 5IA5A 4FSNA 3VBYA 5KMNA 3LJ0A 3ZUVA 1BUHA 2QD9A 1OIUA 3FYKX 3R6XA 1JKSA 4QYHA 3PXZA 4WG3A 3ORKA 4CFWA 1YI3A 4D1SA 2P2HA 4GT4A 5IUIA 4IX4A 3PLAE 4NTSA 1A9UA 3CE3A 3G6GA 3BZ3A 4I22A 3Q9XA 2W1FA 2JDOA 4RJ4A 5H2UA 4DFYA 3F3UA 3FHIA 2GHGA 3UODA 5JKGA 4P90A 1Q3DA 2ZMCA 2BRHA 3G15A 3DBDA 4ZTRA 5A4TA 4PWNA 2W9ZB 2O2UA 3HV7A 3IPHA 4HVDA 3VUIA 4IC7A 4ALUA 3E8DA 3GENA 4RIWB 4U45A 4DLIA 5C1QB 3RHKA 4CKIA 3BEAA 3MH1A 4UMTA 3N51A 3ODYX 1OKVA 3BYUA 3R9RA 5AIKA 4B6LA 4XG4A 4TWCA 5J87A 3TN8A 4KS7A 4C4IA 4ITIA 5KMKA 1BI7A 4L01A 3FV8A 5CSPA 1DS5A 5HQ0A 1DAYA 4R1VA 4GEOA 5AX9A 5I9WA 4C3FA 3HYHA 2UVYA 2VTRA 4BKJA 4IWOA 5CAPA 2CNVA 2Q83A 5D9HA 4CCUA 5FQDC 1OBGA 3DCVA 4EUTA 3CPCA 5AP3A 4CQGA 2JDTA 2C6MA 2ERKA 4TW9A 5L3AA 4J8NA 3TTIA 2BDWA 2QONA 4ANSA 2R3NA 3FE3A 3PG3A 4GT5A 4KD1A 1Q99A 1YXVA 3AG9A 5BX0A 1KE7A 3ZSIA 2Z60A 4QP8A 4CV8A 5GJFA 4CYIA 3GOPA 1ZYJA 4AZSA 3MWUA 4GW8A 3RPSA 5DLSA 2YDIA 4CZUA 2J5FA 4EZ5A 2GCDA 3HMMA 3LQ3A 2W1DA 2CSNA 2WMRA 2IWIA 4JQ7A 3RGFA 4EWHA 4LI5A 5AP7A 3BYMA 5BMMA 3IO7A 4F6UA 3U87A 3RK9A 3ORPA 2RGPA 2FYSA 5D7VA 1SMHA 1XH8A 2V5QA 5AIRA 1JAMA 4ZK5A 3UOHA 4IB5A 4ALVA 5JN2A 5IQDA 1GZ8A 2HY0A 3OWJA 3Q52A 1JSVA 3UMWA 3PXYA 3QC9A 2UZDA 1UU9A 5FEEA 4KSPA 4X7QA 4NL0A 4RVTA 4FK3A 5JGBA 2ETRA 4WT6A 3U6IA 3IS5A 4HVIA 3BYVA 4FKTA 4G3FA 4EYJA 4XJ0A 4JBPA 1ZY5A 4D5HA 1SNXA 4O7NA 2PE0A 4FICA 2OU7A 1LEZA 4FVRA 2XK9A 1I44A 2WMAA 5B2MA 4WNOA 4FK6A 4DN5A 3MH2A 4X6RA 4RC4A 1R0EA 4HJOA 2FSLX 2FO0A 4O7TA 4O91A 5I5ZA 4AT4A 3SGCA 3M2WA 5JK3A 3FMDA 4R5YA 2VO3A 3A7IA 4KKGA 4Z3VA 2W1GA 1TQMA 4FOCA 4LUEA 5FM3A 5DRBA 5HORA 3SOAA 4C7TA 3KN6A 4WG5A 1YHSA 4XOZA 4IAZA 3JVSA 5CVGA 4MEDA 5LMKA 1HCLA 4YHJA 3C51A 3EH9A 4QP4A 4I5PA 5DEYA 4Z16A 4BIEA 2XNGA 2AUHA 2ZYBA 4C62A 1SNUA 3A7JA 3OOMA 2QOIA 2X4FA 3PUPA 4MWIA 3SC1A 4BGHA 3MIYA 4RIOA 1NVQA 5EKOA 2OXYA 4MX9A 5B0XA 3DTWA 5BVKA 3GGFA 3FY2A 3I5NA 1XJDA 3EQIA 2NPQA 4YZMA 3P7AA 4YR8A 2WTDA 2YM7A 5FM2A 1OIQA 5KBQA 4LFIA 4ASZA 1OM1A 1Q8ZA 4UWYA 4UBAA 3TKUA 4MBIA 4O22A 5AX3A 3G9NA 4U40A 4E5WA 2OK1A 2OSCA 1OUKA 2PMOX 3VS7A 3W2QA 1A06A 3WI6A 4BN1A 5HD7A 4F08A 5FTGA 3HEGA 3CP9A 2OFUA 2WU7A 3G6HA 3DBQA 4MXYA 5JT2A 3VVHA 4U7ZA 2OF2A 5AR3A 5HO6A 3BLQA 4AZEA 4C3RA 5A9UA 2J5EA 1KUTA 3C4FA 2JIVA 3BV2A 1YDTE 1AQ1A 1K2PA 3LFEA 4F09A 5J5SA 1JLUE 2ITNA 2R7BA 3EFWA 4Q5HA 3FMLA 3TKIA 1OVEA 1U46A 4MCVA 4CLJA 3AC4A 3FHRA 3R21A 5FEDA 1MRUA 4TKSA 2PL0A 2C30A 3DDQA 4LOPA 4FL1A 2VO0A 4ACGA 3G5DA 4X3JA 1WBOA 4TYHB 3LQ5A 1H0WA 4YJVA 5B7VA 5HTBA 2O63A 1ZYSA 2XJ1A 4UXLA 1O6KA 5D11A 4J96A 4FV5A 4RIYB 2I7QA 2OI4X 4ZXTA 3QCQA 5IUHA 2V0DA 5I3OA 2QG7A 2G01A 4FV2A 1RJBA 5EW3A 3VS0A 3BGZA 3BRBA 5EOLA 3WE4A 3ZLSA 3CGOA 5CEOA 2Y0AA 3HECA 2FSMX 5IH4A 1OGUA 1Q4LA 3SXFA 1OKZA 5ETAA 3DU8A 4GYIA 3C5UA 3O17A 4YLKA 3R9HA 3BLHA 5D10A 3A60A 5HNBA 2FSTX 4FI1A 4F7LA 5E92A 3PDTA 4G31A 4O1OA 2O0UA 4BDBA 3RM7A 4I24A 4PV0A 1J7IA 5D1JA 5HBJA 1KE6A 1WAKA 4QTEA 3BYOA 2RG5A 2OGVA 4YP8A 2I1MA 4FTLA 3ZBXA 3NRMA 5DPVA 4NCTA 2UW3A 3HLLA 4XG3A 3KVXA 5CSXA 2XUUA 4CVAA 3FPQA 4AG8A 4WA9A 2PZPA 1W83A 3SRVA 2W4KA 5HE2A 4H36A 3FL4A 4XV1A 4NW6A 4A4OA 5AP4A 2BDJA 3NUPA 3QTIA 2BZIB 4FMQA 5L8JA 3RNYA 3VBQA 5BYYA 3B2TA 4QP1A 5CEPA 1GAGA 4O1PA 3EFLA 4IZYA 1OECA 1GOLA 3CIKA 4N6ZA 2B1PA 5IQIA 4D9UA 2P0CA 4KBKA 3FBVA 4IM0A 2ZOQA 4WD5A 2C4GA 5CF4A 3UBDA 3PE1A 4FG9A 4RIXB 4A9YA 3GUBA 3QQFA 4MBJA 3JYAA 3Q53A 5DIAA 4EH9A 3GCQA 3R8MA 2NO3A 4DEBA 2BCJA 3OF0A 4IIRA 3GT8A 3II5A 3L1SA 3MBLA 5DWRA 3DK3A 3ATTA 3TV4A 3V6SA 1Y57A 2W1ZA 3F2AA 4XBRA 3Q96A 2IPXA 4FNWA 4F4PA 3VIDA 1FMKA 4W4WA 1Q61A 2CCHA 4X3FB 5TE0A 4LQMA 4IAYA 5BVDA 4ZP5A 5GINE 4K8AA 4L52A 3ZYAA 4Y85A 4S32A 3HDNA 4QTBA 4O7YA 1K3AA 4RJ6A 4F6WA 5AA8A 4J8MA 3QGWA 5LMAA 5A4CA 4Y5HA 1H07A 2XK6A 2C0OA 5AR8A 1J1BA 4YLLA 4FKPA 3TJDA 1SZMA 5CALA 2GS2A 3TNIA 1XO2B 3NNXA 3PWYA 3R83A 3DLSA 4C4HA 4DBNA 2BR1A 4F0FA 4FUYA 4HYHA 4QYYA 3NIZA 3AGMA 1VEBA 3QRKA 4OTPA 3CEKA 4K33A 1QPJA 4QP6A 2V22A 3L8PA 4QP9A 4C02A 3CC6A 4TL0A 4EZ7A 1CSNA 3TZ9A 2VGOA 3ANQA 4FGBA 3UZTA 3HAMA 2NRYA 4KIKA 4OT6A 4KIOA 1WBVA 4APCA 5I9YA 5BNJA 3EZVA 5TF9A 3QA0A 4JIKA 3IGGA 3U54A 3PTGA 3A7GA 4MH7A 4OR5A 4BFMA 3E8NA 2JDRA 3CPBA 3OT8A 3QUPA 4QMUA 1E9HA 2Y7JA 3OWPA 3BE9A 3FZPA 4BB4A 5DR9A 1A48A 2B9HA 4ZLOA 3EJ1A 3GC9A 3ULIA 4M13A 1UU3A 3QD0A 4QMMA 2R3JA 2VTAA 5L2QA 4U6RA 2JC6A 5CU6A 3PWDA 3UO6A 2GNFA 3NVMB 4MD9E 2IJMA 1Q3WA 5EK7A 2BALA 3SW7A 2YLEA 5IA2A 2AYPA 2IZTA 2C5YA 3ITZA 4RWJA 4O84A 5CANA 3C4ZA 4DH1A 5EW9A 1U5QA 3RAWA 1OPKA 2B4SB 3LIJA 2QR7A 3EQBA 1RQQA 3H0YA 3KFAA 3LZBA 3BHUA 3W1FA 3P0MA 4EBVA 4AZFA 4V05A 2PMIA 3QKMA 3KGAA 4CNHA 5H3QA 2BFXA 4U43A 3OCGA 3IECA 4QPSA 4DFXE 1YWNA 4S30A 3RMFA 2C69A 5IQEA 3EL7A 1IA9A 4ZS4A 2HZ0A 4ZJJA 4YBKA 2JAMA 2R4BA 4MAOA 4QRCA 4EK5A 2C6LA 3RINA 3RHXA 4KS8A 3TV6A 5GZ9A 1PF8A 5KZIA 4UB7A 1UV5A 2E9PA 4HCTA 4YSMA 1OIYA 4A4XA 5FTOA 2HZNA 3CSVA 1STCE 5ANJA 4BCJA 1Q62A 3L9PA 3QC4A 4HNFA 3ZLYA 2XIYA 3NCZA 3CY2A 5I3RA 3E63A 4DTBA 3KRRA 2XYUA 2VTTA 2VU3A 5HG5A 2C0TA 5EDQA 5KMLA 4MK0A 3OT3A 4O0SA 3CR0A 4XLIA 4N57A 2ACXA 3TWJA 2ITUA 4XG2A 4EK8A 5CXZA 5ITAA 4EOIA 4Y95A 4NYEA 3QQUA 4YJOA 1NT2A 5HU3A 4U81A 3QALE 1WBSA 1YVJA 2VO6A 3MYGA 5T3QA 3M42A 3VUDA 4WIHA 2R3LA 4RVLA 3VHKA 3AD6A 4YZCA 2WQNA 3DAEA 3OCTA 4K77A 3VUGA 4EH2A 2PVJA 4FTTA 4BDHA 3QRUA 4FSWA 4U80A 4XP3A 5IH5A 4AT5A 1IR3A 1G8SA 1TKIA 4RZWA 3QD4A 3KULA 4WSQA 4AGDA 5E8XA 3OS3A 3C5IA 2YCQA 4NM0A 4NK9A 5AUZA 3WILA 2P4IA 1YDSE 3H9FA 3UPXA 1J1CA 2JAVA 2PVYA 3RK7A 3V5QA 1Y8YA 1Y91A 3BI6A 4FE2A 4R1YA 2BKKA 2YM8A 3OBGA 4AX8A 4DGLC 3D5WA 2RKUA 4XOYA 5IQHA 3SV0A 5CAVA 5CQUA 4CYJA 2I0EA 4E6CA 1J7UA 1FGKA 4CMTA 4DE4A 4U9AA 4BBEA 3HRCA 2YM3A 4PPBA 4UY9A 5A6OA 3OG7A 2X7OA 3CQWA 3PA5A 3U8WA 4BICA 1W7HA 4DEGA 3VF9A 2IW9A 4CLIA 3NMUF 3MPTA 5AR2A 2CMWA 2W5HA 2XF0A 5GZAA 2YN8A 3TZ7A 3IDBA 4BDCA 4XG7A 2O3PA 5DFPA 4ZLYA 4IB1A 1PXJA 1SVGA 1YXXA 3HRBA 3UDBA 4EWQA 3LMHA 2VWZA 4RVKA 5GIPE 4JG6A 3O7LB 4KKHA 1IEPA 4GU9A 4ASEA 4D2RA 1KOBA 3FLWA 3QTQA 4ERWA 3P9JA 3B8RA 2PE1A 4NM5A 3DKGA 2C6EA 2R0UA 4J99A 1VJYA 5AJQA 5DT3A 5AUYA 4GK2A 3TZMA 3GNIB 4UX9A 2UZNA 4KA3A 5GHVA 5LVOA 2JIIA 3IDPA 3EQDA 4ZJIA 3SW4A 3GC0A 4JAJA 4LM5A 4X0MA 3CS9A 4PF4A 1FVVA 3D7TA 3GU8A 2WMVA 4CSVA 4R5SA 5JFXA 4ZOGA 4AE6A 2ONLC 1OKWA 4GJ3A 3BCEA 5KMIA 2CKPA 3LLAA 4WO5A 1QMZA 4W4VA 4BDJA 3E7VA 5IUGA 1Y6AA 2OJJA 4BCNA 5JGDA 1XR1A 2OFVA 3JR1A 1DI9A 3Q6UA 4JDHA 4BCKA 2C6TA 3OEFX 4DEIA 2YCFA 3E3PA 4JRVA 1NVSA 3KC3A 2OG8A 3NNUA 5EH0A 4HVHA 4D2TA 2JKQA 2YAKA 3F5GA 3MB7A 1H28A 1M2RA 4GH2A 4AOIA 3VS3A 4YO4A 3CY3A 3FI2A 2QVSE 3G2FA 4L7FA 3IW4A 4C4GA 5CU4A 3SLSA 5C27A 3MVJA 1ND4A 3KXZA 5T68A 5CAQA 3VS2A 4XBUA 4FV3A 1KV1A 4JS8A 4IZ5A 1WBNA 5DOSA 3NAXA 4L45A 5CSWA 4AN3A 2ETKA 4ACHA 3DA6A 3ZDIA 4BZNA 1J91A 4KRCA 1QCFA 3BELA 1PXKA 1H08A 3ZRMA 4I6FA 5DG5A 4F1OA 2Z7RA 2XJ0A 5DA3A 3LOKA 3NUYA 2V55A 3R8UA 2XK7A 3O50A 3DKFA 5C8MA 1W82A 3KREA 1Z5MA 3F7WA 1U54A 3HGKA 3ORNA 1PMVA 3UP2A 4BF2A 3MA6A 3MJ2A 3EN9A 4F9WA 3DNDA 2ITZA 3QYWA 3WZUA 1OZ1A 5FWKK 3PZEA 4KIQA 1Q24A 4R7IA 4FSQA 3COMA 1U5RA 3E64A 3LHJA 5HE1A 2ZM1A 3NW7A 4BCFA 5H9BA 2B9JA 3L8XA 4LV5A 2BROA 3SRVB 3UNKA 2FVDA 2GTMA 2XK8A 3LKMA 4FEVA 3QCYA 5B2KA 3H3CA 4D58A 2RFDA 4A7CA 4DAWA 3BIZA 5FLFA 3QQLA 3LMGA 2BRBA 3B8QA 3DT1A 3RCJA 1P14A 2XH5A 3ATSA 3BU5A 1PMEA 4XHKB 4IACA 4F0IA 3QCXA 4EOSA 1R1WA 5IA0A 5HE0A 1Q5KA 1H0VA 3BWJA 4K18A 4EOQA 3GQIA 4QYEA 3C4EA 3K54A 4H3BA 2C6IA 3PJ3A 4FKGA 3LW0A 5DMZA 2RL5A 3CKXA 3COKA 3EOCA 3UC3A 3VQUA 3R2YA 3ZXZA 3DNEA 2WIHA 4X2FA 4E3CA 4EQCA 2X8EA 4UMRA 5C8NA 4USEA 5ACKA 4EH4A 5J7HA 3JS2A 5EYMA 4X6QC 2XCKA 4W9WA 4XRJA 1YKRA 4DF3A 3DK7A 1YWRA 4CZTA 5JEBA 5DT4A 4Q5EA 3A4PA 4F7JA 2O65A 3C7QA 1K9AA 5HZNA 3LCOA 5L2WA 2J0LA 4F1TA 5HLPA 3NUAA 5EI2A 2W06A 4E1ZA 4P4CA 3R8PA 3P5KA 2VTJA 4YZ9A 5LCKA 3SOCA 2W5AA 4AAAA 5EKNA 5KO1A 3JUHA 3R02A 3TUCA 1B38A 3EN5A 3QL8A 3C0IA 2X0GA 4R3RA 3ORIA 4AXAA 4IANA 4FNYA 4RWIA 4HZRA 4I21A 2XM8A 4RC2A 2WMBA 2VTQA 5HO8A 4D2SA 3CBLA 3LAUA 1HCKA 3C0HA 3Q9ZA 4GKHA 3P23A 3AQVA 4DH7A 4WRGA 4K2RA 2WHBA 4RFZA 2C5XA 3LFBA 2XKCA 4ZSJA 2R3KA 3TDVA 4J71A 4QNAA 4HPTE 5ANGA 4JOAA 5IDNA 3DQXA 3UE4A 4O2ZA 4FBXA 1YHWA 3NCGA 1REKA 4MWHA 3VBWA 3TXOA 4BRXA 2UVZA 4DCAA 2WB8A 5J5TA 1M2PA 5GJGA 3UZPA 2J6MA 4GT3A 3BHHA 4A06A 2X8IA 4F7SA 1PY5A 4KIKB 3SKCA 3QWKA 3R7GA 4E6AA 1VYWA 2VNYA 3FQSA 3R1SA 3QTZA 2YM4A 4GG5A 2H8HA 3KRJA 4EOKA 4D4RA 4L67A 2CGWA 2QU6A 2VTIA 4RJ7A 2HOGA 5HCXA 5AP0A 3R7VA 3R1NA 4O0XA 5HHWA 2HK5A 2C1AA 5CX9A 4OTWA 2VN9A 5L6PA 3OW3A 4YLJA 5DH3A 5BVNA 4DG2E 4GV1A 4BHZA 3C4CA 5HG7A 3FMNA 5A6NA 2B0QA 4L7SA 3KRLA 2WPAA 3D4QA 4DA5A 4C38A 2F7XE 2J7TA 3KN5A 4IAFA 1UWHA 4UZDA 5J7BA 1PMNA 4MXCA 4G3GA 3OXZA 3W8QA 4AZVA 2BIKB 4RMZA 3TI1A 3V5WA 3GI3A 3FEGA 4F0GA 5JRSA 4Y73A 5CF5A 4FV0A 4W8DA 5A46A 5J1VA 3CXWA 4CEGA 2XS0A 3MVHA 4QTAA 3KKVA 1DM2A 3FL5A 1H26A 4JIAA 4QMYA 4OBQA 5C4LA 3JY9A 4AQCA 2DS1A 3IOPA 4JDIA 4NEUA 2ERZE 2W99B 4MQ2A 4E73A 5KBRA 4MVFA 4D9TA 2X9EA 2CNQA 4YJUA 3WIKA 3EFJA 2PVLA 5DHJA 5I9ZA 2EU9A 2RF9A 3AC2A 3OFMA 4JL9A 4U79A 3FZOA 4HYSA 3SAYA 2XKFA 5M44A 3OWKA 5H8GA 5EI8A 3W55A 3LPBA 1OL2A 2YFXA 4ITHA 3BGQA 5KZ0A 4QO9A 5JH6A 3PFQA 4RLLA 5D7AA 4C61A 3Q9YA 2HY81 3QYZA 2CDZA 2C6DA 3FPMA 2WTKC 1JWHA 2VWXA 1IASA 4BYJA 4EOPA 4B9DA 1WBWA 3ET7A 3TUBA 3OD6X 4J98A 4DGOA 2O64A 1IA8A 3ENHA 4EOOA 3QQHA 3MJ1A 4C4JA 3H9OA 3U4UA 3ZSHA 2BHHA 1UU8A 3LQ8A 4IVBA 3QTUA 4RQVA 4RLKA 3L9NA 4O82A 2QODA 3SVVA 1BLXA 3C1XA 3JY0A 4G17A 4AFEA 5E4HA 4RT7A 2VUWA 1PXNA 3GCVA 3KULB 3LFNA 3SXRA 4AZTA 4FIGA 3O2MA 2QU5A 1BX6A 3PY0A 3HA8A 3RALA 5L6OA 2G2HA 3Q4UA 2FB8A 3R7IA 3BHVA 3EKNA 3S0OA 2YM5A 3OZ6A 2EWAA 5AP6A 3LXPA 4FUXA 4OTHA 3F9NA 4E5BA 2EB2A 3O71A 4HGTA 4IAIA 4BBFA 4A07A 1IRKA 1ZOEA 4O6EA 2C5NA 5E91A 5ICPA 3HA6A 3VN9A 1FBNA 2QNJA 1FQ1B 2VAGA 2X2MA 4ENYA 3S00A 3FSKA 4O2PA 5IISA 2OLCA 4MBLA 3ZM9A 2VGPA 4GVJA 3O0GA 2F9GA 5LARA 3RWQA 1XKKA 4OTQA 3U9NA 5EI6A 1H1PA 1SVHA 2J50A 5IMXA 1GIIA 4FTCA 4JNWA 4YJRA 5I4NA 4MXZA 3UOKA 4TXCA 2PK9A 3H9RA 1GNGA 4CMUA 1WCCA 4JDJA 4FEXA 2G15A 1U4DA 4PNIA 2J4ZA 3G33A 1TQPA 5CAUA 2JBOA 5FG8A 3U55A 1KOAA 3GFWA 4PMMA 5E1EA 3PVBA 3MI9A 1O6YA 4IVAA 1TVOA 5CWZA 4JQEA 4D2VA 4GFMA 3BWFA 5BYLA 4FV9A 4C57A 3MESA 3UJGA 5J8IA 4A9SA 4BTMA 2ITQA 3DY7A 4CKJA 5LWNA 2VWBA 3OCSA 3KXGA 4FKOA 4QYGA 4AA5A 4UEUA 2F2CB 5AAFA 3JPVA 4CZYB 2YIYA 4PL3A 3DTCA 4HOKA 3D7TB 3ALOA 4C33A 3F5XA 4FNZA 2G2FA 3MIAA 2UVXA 3GCUA 5CT7A 2R3MA 2QG5A 2YISA 2WAJA 3RAHA 4YTFA 5BMSA 1AGWA 4AGUA 2CNUA 2IZSA 5GJDA 5TT7A 3FY0A 3R8ZA 3POZA 4BBMA 4PPCA 4UXQA 5K4IA 1H1SA 4MNEA 4YZDA 1P4FA 3CQEA 4FIFA 4EKKA 3Q2JA 4AFJA 3FWQA 3QKLA 3QF9A 4FT5A 5J95A 2Y4IC 3V01A 2BZHB 3MH0A 3FLNC 3FZ1A 4HGEA 4I5HA 3D5VA 2EB3A 1T46A 4ZSEA 2BPMA 3LFDA 3WARA 4HNIA 1L3RE 4O0TA 3UP7A 4N70A 4CRSA 4JBOA 3TNPC 2VV9A 3A8XA 1E1XA 4ZTHA 4EZ3A 4RA4A 5ANIA 4CFMA 5EFQA 3GU5A 1H8FA 2CN8A 3Q4CA 4DFZE 1XH7A 2G2IA 4GU6A 1L8TA 5E7RA 3MVLA 2ZAZA 3P1AA 3HP2A 3VC4A 3NUNA 2QQ7A 4IAAA 2Q0BA 3V5JA 1S9IA 2F2UA 4W4XA 3ZO2A 2RFNA 4AN9A 4PMTA 3P78A 4J95A 2R2PA 3Q04A 3WZJA 5M4FA 4ZY6A 4USFA 3WOWA 5BYZA 3U9CA 1MQ4A 1U54B 4FZDB 4R6VA 4H1MA 1CKJA 2QO9A 5F1ZA 2EXMA 3R71A 1XHAA 2WTIA 3PRIA 5L8KA 3ZFMA 1GZOA 4DT8A 3KB7A 4EK6A 2V7OA 3D94A 2VWIA 2BAJA 3R7OA 3W33A 3MY0A 5HEZA 2V7AA 4JI9A 4YNEA 5B2LA 3EL8A 5FRIA 2HWOA 2OWBA 4EQUA 4XNEA 2P3GX 3PJ8A 3G0FA 2HW6A 4LOQA 2OF4A 3GC7A 4MHAA 3ULZA 1SVEA 5AEPA 4KNBA 2WTVA 3QKKA 3PXRA 3T9IA 4GKIA 4CQEA 4FKQA 5ANOA 2VX1A 4EOMA 3F7ZA 4FT0A 2YABA 3PZHA 4BGGA 3EN7A 3OHTA 4N6YA 3QUEA 2PMNX 2A4LA 2R3RA 1Y6BA 4YTIA 5TR6A 3ZSGA 4D2PA 2WQBA 3VUKA 2GHLA 3W2SA 4Z7HA 3IK3A 3V5TA 4DH8A 2YWPA 2UZWE 3PJCA 5BVWA 3LJ1A 4PTCA 3QRJA 2QOBA 3GXLA 2A0CX 4CTBA 3UG1A 3ZONA 5K0XA 5I9VA 4GK4A 2CN5A 5HTIA 3FKLA 3COHA 3C50A 3BQRA 4L42A 3RPRA 1MQBA 3ACKA 4BCOA 4L9IA 4BZDA 5CTPA 1OB3A 2KULA 2WTKB 2RFSA 2W1CA 4M68A 4JX3A 1RE8A 4PDSA 4X2JA 3MY1A 4RSSA 2RIOA 1WZYA 3E62A 4JBQA 4DLJA 4QQJA 3NUSA 4S34A 3RVGA 2W1EA 3FC1X 2W4JA 4EYMA 4W8EA 3F3ZA 4XG8A 3OTVA 4AGCA 4EK3A 4Z9LA 2UW0A 3QZFA 5FDXA 4E93A 2X81A 2QOKA 2E9VA 2J90A 2JD5A 2PVHA 4H1JA 3AC8A 3W2OA 2HENA 4L6QA 3HMIA 2GFSA 4FYOA 1ZYDA 3PJ2A 5J79A 4TWPA 5IQCA 4L00A 3IOKA 3GP0A 4XEYA 2DQ7X 2GQSA 4NFNA 4RQKA 2WD1A 1UNGA 2VRXA 4BCMA 2QOCA 3HMPA 3HUBA 3EFKA 4WOVA 2H96A 3C0GA 3DFAA 3QD2B 4XX9A 2WELA 4BKZA 3R28A 1QPDA 4X21A 1HOWA 1NA7A 3F69A 3DBEA 5EHLA 3AT3A 1PKGA 3LFQA 4GK3A 4FTQA 5DYJA 3O96A 4FTKA 4IX5A 3A61A 4TNBA 5IF1A 3H4JA 4YNOA 1MUOA 3NR9A 3F88A 5BQ0A 2DUVA 3TM0A 2HW7A 2A2AA 2GNGA 3A62A 3P86A 4D4SA 2XEYA 5HNIX 4ARKA 2JKOA 2GTNA 3DAKA 5AM7A 3AOXA 3PSDA 2FUMA 4B7TA 3D5UA 4ZZNA 1OL5A 1JOWB 3BU6A 3QUDA 4HYIA 4FEWA 4IVDA 3R73A 4DFLA 3G90X 1JSUA 1PW2A 3FLSA 4JG7A 2PPQA 2XK4A 1G3NA 2YCRA 4DT9A 3IKAA 4I0RA 3WZKA 4DGGA 1YHVA 2LGCA 2VNWA 3GVUA 5DEWA 4E4NA 5GZ8A 4J53A 3NGAA 4FKUA 3VULA 4C3PA 4K9YA 5FGKA 1YXSA 5LQFA 4PUZA 4RX7A 2BKZA 3GBZA 5C03A 3RTPA 2IZUA 5G1XA 1XH5A 3AC5A 3MVMA 1ZARA 2HCKA 4KWPA 5CEQA 4QYFA 3ZLXA 5J9YA 2YDKA 3UOJA 3AC1A 3WIGA 2E9UA 4JDKA 4CT1A 4EHGA 1JVPP 1V0OA 5F95A 5BUJA 1Y8GA 3DKCA 3PJ1A 4IHPA 4HYUA 3OXIA 2UZTA 3KRWA 5J9ZA 1LP4A 4WUAA 4C35A 5K5XA 3UQCA 4PX6A 4NU1A 3NZ0A 4G1WA 4P2KA 5D41A 2E9NA 3VS5A 4L3PA 4E7WA 5EHYA 5EOBA 4AN2A 2UUEA 4I94A 3U6JA 1ATPE 4FSUA 4ANOA 4DG3E 3K5VA 4IZAA 5CNOA 4FGRA 3A4OX 5HVKA 3HMNA 2Y9QA 3OP5A 4BC6A 2C6OA 4ZS0A 5DNRA 2PVNA 1P2AA 4QPAA 4TNDA 4BWPA 4XCUA 2ONLA 4BCHA 3F2NA 2WIPA 1AD5A 2X7GA 3DXNA 3UVQA 4EI4A 5JGAA 4PTGA 5M4CA 1YQJA 1FPUA 3DK6A 4FTOA 4IMYA 4K0YA 4TYIA 5AP2A 2XB7A 4QMLA 3NDMA 4ZTLA 3UYSA 2BRMA 2HELA 4RZVA 1OUYA 1XH9A 4P5QA 4YC3A 3NS9A 4B8LA 5KKRC 4AT3A 4BTKA 2WQOA 4S2ZA 1PXMA 3H30A 4Y83A 3WZEA 3CJFA 4QMPA 3RK5A 3GU7A 4XLVA 4FTJA 4NT4A 4ZSGA 3WYYA 1GY3A 1KE9A 4RFYA 1FOTA 4CV9A 1KV2A 2WOUA 3HKOA 4IVCA 3P7BA 1I09A 4I41A 1YW2A 3WF9A 3F6XA 5IA4A 1O6LA 3Q32A 2PVKA 3QD3A 5EM7A 2LAVA 4D4VA 1CKPA 3WE8A 4ANLA 4YURA 4I6QA 4WRSA 1UNLA 3W18A 5CU0A 3BKBA 1FVRA 3R22A 2WMWA 4LL5A 5E8ZA 3QU0A 4QMSA 3FSFA 1R39A 2JKMA 4MF0A 3GB2A 1ERKA 4EL9A 2OW3A 3CTQA 4XP0A 1WVYA 5IQGA 3UC4A 3NUXA 5EDRA 2YACA 3I0OA 1JBPE 3IGOA 4RWLA 2YM6A 3LXNA 5E8SA 5FP5A 3RZBA 2I6LA 2WKMA 4F1MA 5M51A 4F9BA 5AV1A 4QP3A 4BCGA 1H4LA 4WSYA 1PYXA 2WTJA 5CSHA 3W16A 3LCSA 3PG1A 4Y46A 5AR5A 4EONA 4BTFA 3O8TA 4JR3A 4WKQA 1H01A 5BPYA 3JVRA 1ZOHA 4DFBA 4AA0A 1FGIA 1M17A 1OL1A 3Q9WA 4FT7A 4G16A 4NKSA 4QP2A 3QBNA 4ASXA 3KQ7A 2GNHA 4D1ZA 4JJRA 4QTDA 4Q9ZA 2XNOA 5AV3A 4G6LA 4YC6A 4XYFA 2ZV9A 3EMGA 5CEMA 4FEUA 2UZEA 3R1QA 4RFMA 4IM2A 4CT2A 5FUTA 5M09A 4FOBA 2JEDA 2XIKA 4BIDA 4YJSA 2Y4PA 2X2KA 2C68A 3V51A 2VTOA 4KIPA 4CD0A 4R7BA 3GEQA 2CPKE 2IW8A 4I1ZA 2YITA 3NLBA 4M0YA 3G51A 3T3UA 4AZWA 3AXWA 3N9XA 2OIDA 3MH3A 4MNEB 3MTLA 5H8EA 4ZY5A 2ZJWA 4A4LA 2UZVA 4FKWA 4GS6A 5IMEA 1W98A 4U5JA 4CFXA 4DINA 3KRXA 5HIEA 1U59A 3UZRA 2ESMA 3R8LA 1UKIA 4RPVA 5FXQA 4C37A 3VF8A 4DFNA 1SYKA 3DOGA 3QRTA 4TYJA 5AP5A 4D1XA 3WF5A 5HVJA 4DGMA 4EK4A 4QD6A 4HZSA 2CHLA 5AV2A 2CKQA 3F82A 2VTMA 4MD8E 5IZFA 3ZMMA 3S4QA 5FTQA 4YZBA 3GCSA 3F5UA 2QURA 3KXHA 2XNEA 5FXRA 3L8VA 2HYYA 2OIQA 3R30A 4ALWA 3TIYA 3GCPA 2WMSA 4EC9A 1R0PA 3G0EA 2XNNA 5AUVA 4G2FA 3RAKA 4DTKA 3PXKA 2R0IA 3NAYA 2CCIA 5HE3A 3NPCA 2ZMDA 1H24A 3CD8A 3OUKA 2GU8A 3UMXA 4AUAA 2QI8A 4KSQA 4RRVA 4OT5A 2JITA 3GC8A 4E26A 4G9CA 3A99A 3KEXA 2PMLX 3RM6A 1OL6A 3S1HA 2QHNA 1BI8A 3THBA 2PU8A 4V04A 3ZO4A 3EB0A 5CS6A 2VD5A 4ZZMA 4BDKA 4RG0A 3ORLA 5TKDA 4NM3A 4FR4A 3NW6A 4PP9A 3S2PA 4O7WA 2XA4A 3CD3A 4AS0A 4IADA 5EQPA 1KSWA 3HV3A 4BCIA 5E8VA 4FEQA 2XM9A 2CGVA 2PTKA 3PA4A 3FYJX 4BDEA 1JNKA 4O6LA 3TEIA 3R9OA 5C26A 2BRGA 3CLYA 3UYTA 3VS6A 4LL0A 4M66A 3QWJA 3IG7A 3SX9A 1F5QA 2V62A 3ANRA 4H39A 4BVUA 2PSQA 3D15A 4Q2AA 3FMHA 4GUBA 5HVYA 5AUWA 2QOHA 5BUEA 4Y72A 4D4YA 4YJQA 2A1AB 5HIDA 5HO7A 3BEGA 5IQAA 2WZJA 2B55A 3VHEA 2UZOA 3PIXA 4JRNA 1YXUA 2XIRA 4IEBA 4OBPA 3RKBA 2GS6A 5LJJA 3FKNA 4ZJVA 2GQRA 4I4EA 3F5PA 3WF6A 4UZHA 4BI1A 4ANBA 2W5BA 2FA2A 3DBCA 4KABA 2O8YA 1B39A 1ZYCA 4ANMA 3KXXA 3MA3A 4C2VA 4DFUA 3HX4A 2QO7A 2AC3A 4DITA 1Q8WA 2GNLA 3QXPA 3FQEA 5A3XA 4RBLA 4QTCA 3V8WA 1CDKA 3SA0A 4O0VA 4W4YA 5KMJA 5HNGA 2X4ZA 4U3ZA 1H1WA 4PMSA 4JT3A 5GNKA 5IQFA 3AD5A 2A19B 3KK9A 4DEHA 4FKJA 4G5JA 2R64A 3TIZA 2C5VA 1XBAA 3N4VA 1CM8A 3REPA 3QTSA 4BY9E 2Q0NA 3I6UA 4C8BA 4X2NA 3N4TA 4K6ZA 4OAUC 5KMOA 2I0HA 1Q41A 4UYNA 3SD0A 1M52A 3DS6A 4MKCA 3L9LA 2VX3A 2X8DA 2YJRA 3I81A 3TDWA 3NYNA 2E9OA 2GFCA 4FSTA 3CCNA 2R3IA 1BMKA 4GSBA 4OTGA 4BZOA 4CXAA 4UMPA 5HD4A 3ZS5A 3HDMA 4IDVA 2VTPA 4FVPA 3UQGA 1PYEA 2YEXA 4UMQA 4F7NA 3PXQA 2Z7SA 4ZY4A 4G9RA 4EH3A 4ZMFA 3LM0A 4BWKA 4DEEA 4O86A 2C3LA 3UIMA 4FA2A 3I7BA 2CGUA 4LGGA 4QMNA 3UO5A 4IB3A 4K1BA 4OBOA 2C1BA 3HNGA 2GSFA 3P7CA 3VUMA 3M11A 4AP7A 2WFYA 3TT0A 4I0TA 3NWWA 4FX3A 2BUJA 3FUPA 4F64A 3Q4TA 4O21A 1VYZA 3CKWA 3ROYA 3TCPA 3VO3A 2CKOA 4LRJA 3QGYA 4ONAA 4O7RA 3R01A 5AP1A 3BHYA 5DI1A 1MRVA 3PE2A 2XRUA 4TYGA 4NJ3A 5CASA 5E90A 1PJKA 4AU8A 4FODA 4EH8A 5FD2A 4RWKA 3K3JA 5H8BA 3OY3A
chains in the Genus database with same CATH superfamily
1JKKA 2WMQA 4U3YA 2R9SA 4IFCA 1Z9XA 3DLZA 3DZQA 5CNNA 2XANA 5D12A 2UV2A 2PZYA 4R78A 3UG2A 2EXEA 3NW5A 2KTYA 4FV4A 4XS2A 3PVGA 2PY3A 3KF4A 3NYXA 1PKDA 2WOTA 4RX9A 4M97A 4DHJA 4FF8A 4BR3A 4YHFA 1M7NA 2W17A 5HCZA 3I60A 4GYGA 1NVRA 4M3QA 4XG6A 2C0IA 3EN4A 5CY3A 4I6LA 5F20A 4KUJA 4M8TA 4RA5A 4I3ZA 4O81A 4IJ9A 4UN0C 3OVVA 3O5AA 2VWUA 3L9MA 3L8SA 3MFUA 1YOLA 2QC6A 2QCSA 3FMEA 2C6KA 3NIEA 4ZTNA 4QMOA 2W05A 3EYGA 4UWCA 2OJ9A 1ZWSA 1YI4A 1O9UA 3K2LA 3DDPA 4UMUA 3CJGA 3PY1A 4AW2A 2PVFA 3IONA 5HIBA 3R04A 2CLXA 3LVPA 3FJQE 4IDTA 2W96B 1S9JA 4XP2A 3T8OA 3QTWA 4PL4A 4M84A 2F4JA 4IB0A 4C2WA 5AFVA 1VZOA 2ZV8A 1KE8A 1ZRZA 2WTCA 2UZUE 3P4KA 3IW8A 3QFVA 5HX8A 1V0PA 3QX4A 3W2RA 2BDFA 4PDOA 2WMTA 3R7EA 4DG0E 4AWIA 3ORXA 4MXAA 2ZB0A 3TACA 4F70A 4JG8A 2B7AA 2QOLA 4F65A 4TY1A 2BHEA 3ZH8A 5AUXA 4BI0A 3QZIA 1R3CA 4JBVA 2YDJA 3BQCA 4GIIA 1XQZA 1LR4A 4PL5A 1IG1A 1PXOA 5ETCA 4WUNA 3UNJA 3ZZEA 3ID6C 2IVTA 1OKYA 4L53A 3BX5A 4FT9A 4YU2A 1KWPA 3IW5A 3EIDA 3I5ZA 3LM5A 1IAJA 4MD7E 4O0UA 5LVMA 3E8EA 4QMZA 2ZV7A 4XUFA 4FSZA 3IW6A 5C8KA 3HZTA 1UU7A 3DJ7A 5C9CA 2PUUA 3TL8A 5HTCA 2J9MA 4IH8A 4NTTA 2DWBA 4DC2A 3QQJA 3AT2A 4UYAA 5K3YA 5F94A 5CI6A 3ZXTA 5K5NA 4YC8A 2B54A 4RC3A 2WQEA 1V1KA 5AM6A 3UTOA 2JIUA 2B9IA 4FZ7A 4PPAA 3EZRA 3U4WA 2QKWB 4KB8A 4WBBB 3H0ZA 5L2IA 1OMWA 4J97A 4G6NA 2NP8A 2YJSA 3RCDA 1PRYA 4I5MA 1SM2A 1ZZLA 4DBXA 1OI9A 3TJCA 4QPMA 3QQGA 1B6CB 3VAPA 2XJ2A 3VJNA 3ETAA 3SQQA 4LMUA 3UPZA 3UIUA 3PIZA 5E9EA 5CXHA 4ZTSA 2QKRA 2XZSA 4YPDA 3WBLA 5IEXA 3KCFA 5EG3A 4FV6A 2HAKA 4TWNA 3I6WA 3W0RA 2B53A 4U42A 4OLIA 5HGIA 3RZFA 5FXSA 2PVRA 4PTEA 1P5EA 4DYMA 3V04A 4X2GA 2RG6A 5EM5A 4X3FC 2HZ4A 1GZNA 3DB8A 4I20A 4J7BA 4CFVA 2OZOA 2QOOA 4OTFA 4D55A 5L2TA 3HP5A 3I79A 3KL8A 4WG4A 2OO8X 5DR2A 3BLRA 1X8BA 3LFCA 1YOMA 2XNMA 4G3CA 4YPSA 2NNWB 1APME 2XIZA 3FKOA 4FKIA 3QHWA 5A4QA 2CJMA 2ETMA 3AMBA 4IXPA 5CF8A 3BBWA 3ZC6A 2XNBA 2I0YA 2I40A 4BL1A 5M07A 1ZYLA 2GDOA 3NUUA 3VRYA 5M57A 4USDA 4R3CA 5CYIA 3EQPA 4RJ5A 2WEVA 2WMXA 3DBFA 1XBCA 1Z57A 2FH9A 3BE2A 4JVGA 2W1HA 3E87A 4GUEA 4ZTMA 2QO2A 4E6DA 5CZIA 4A9UA 2G1TA 2IG7A 2P55A 2H6DA 3POOA 4FC0A 4ENXA 2GQGA 4HW7A 4Z7GA 5JZNA 4OTIA 3R9NA 4E8AA 3UIBA 3OOGA 3PXFA 4I0SA 3LJ2A 3QRIA 4L68A 5T6KA 1PXIA 5HCYA 1W0XC 3MY5A 4HCUA 4FG7A 4ZMFA 3AT4A 3DAJA 2A27A 3OC1A 3OXTA 4U97A 4PRJA 3TNWA 4BKYA 2E2BA 5AAEA 2GS7A 2X9FA 4KRDA 2OICA 1LEWA 2ITPA 2VX0A 5A4LA 2IVVA 3D83A 4IZ7A 4Y8DA 1XMLA 1H1RA 4UALA 3KF7A 3R0TA 3UVRA 2J0JA 5LXMA 4N4SA 3QHRA 3FXXA 2AC5A 4LRKA 1ZXEA 4P5ZA 5EW8A 1P4OA 4NH1A 5CAOA 5HX6A 3NYOA 3SG9A 3DFCB 3V5PA 2GNJA 2G9XA 2VWYA 2UW6A 2Y6MA 4YZNA 4V0GA 3C13A 3SG8A 5KHXA 3ZRKA 3VS1A 4II5A 3ORMA 5AUTA 4ANQA 4XG9A 5LMBA 4FYNA 3A8WA 5KHWA 2GHMA 3R7UA 3D14A 5IA1A 1F0QA 3LCTA 4PY1A 3E8CA 2ITWA 2XKDA 5AMNA 3PPZA 4FKSA 1QL6A 4GMYA 3NNWA 3ZUTA 4F63A 5HI2A 4U8ZA 4U44A 4BDAA 4IAKA 4LOOA 4B4LA 4DHFA 4CGAA 2GMXA 4RGJA 4IWQA 3FDNA 4DEDA 3ZEPA 2HXLA 3PSBA 2Z7QA 3FZSA 5CF6A 3PYYA 1XBBA 3G9LX 3TTJA 2WNTA 3CTJA 1ZAOA 2YLFA 3PRFA 4QOXA 4Y5QA 5JRQA 4YJPA 2WQMA 4KBAA 5KUPA 5IKWA 2PZIA 4ZSAA 3MW1A 1W2CA 5JFSA 4FTMA 3MV5A 4G6OA 4ZIMA 5L8LA 5LVNA 4YBJA 3LMIA 4LG4A 3ALNA 3W8LA 4EKLA 2ZB1A 3QTRA 4TPTA 2YIXA 3ZOSA 5A14A 5CT0A 4M15A 4WNPA 5IA3A 1UNHA 5IH6A 2J51A 3QLGA 4LMNA 2HIWA 3ERKA 3VBVA 3E92A 3ZCLA 4O96A 1UA2A 2PULA 4EJ7A 3Q5IA 2UW9A 3V3VA 4TN6A 2YERA 3ZEWA 2XYNA 4XMOA 3FMMA 2EXCX 5FBNC 4PDYA 3U6HA 1XH6A 4JR7A 5AV4A 3LCKA 4A9RA 5FP6A 4DH3A 4RX5A 3VUHA 2H34A 4YO6A 4O27B 4S31A 2CGXA 2PZ5A 1URCA 3MGYA 2OH4A 3ZTXA 2BZJA 2VTNA 4QQCA 4YMJA 3OY1A 4CRLA 5C4KA 2RSVA 1JKLA 4K11A 4JLCA 4P7EA 4FT3A 2YZAA 4R7HA 4I93A 5HICA 3R7YA 3ZO1A 4DDGA 4UV0A 4CG9A 1FVTA 3HVCA 3F3VA 3RWPA 3LFAA 2XKEA 3O51A 3PA3A 2C3KA 3QZGA 4S33A 3W10A 4JMQA 4ACDA 1FMOE 3BBTB 2R7IA 3K3IA 4O0RA 3Q3BA 4TT7A 3DQWA 1YDRE 1H00A 4ZEGA 2R5TA 1WMKA 2R3PA 2XMYA 3ZU7A 3FZTA 4FL3A 2CLQA 1PHKA 5M53A 4MF1A 1PXLA 2JGZA 2YHVA 5M4UA 2QOFA 2WTWA 3QCSA 4F6SA 3LFFA 3OMVA 5LMKC 4PDPA 3D9VA 4XV9A 4ZTQA 3C4WA 5CU3A 5BVEA 3Q4ZA 4E4LA 1ZZ2A 2R3OA 2PUNA 2O5KA 3ROCA 3FQHA 3UGCA 5CU2A 4F9AA 4OTRA 2R3QA 3RJCA 2YIWA 1IAHA 3VUTA 3IDCA 3GU6A 3D0EA 4WBOA 4MXXA 3FI8A 4A9TA 3W2PA 3MFSA 3COIA 3NX8A 4F9YA 3SDJA 4ANNA 1JQHA 5CZHA 1Q97A 2JDSA 4QMXA 5CSVA 5HLNA 3F61A 4AF3A 2ZVAA 3FC2A 3KCKA 4OUCA 3MSSA 2WU6A 4FSRA 4IX3A 4XV2A 3SHEA 4GRBA 2Z7LA 4I92A 4NIFA 3LCDA 4E4XA 5AADA 2BMCA 3EQHA 3E5AA 3F3WA 3ELJA 3LE6A 2XRWA 3KMUA 4ITJA 1JPAA 1ZMVA 3I0QA 5DN3A 3ACJA 4DHIB 5JMSA 3AMAA 1BYGA 3VQHA 3TV7A 3VWAA 5AAGA 3AMYA 1G8JA 2YIRA 2W7XA 5JFVA 2SRCA 4FTAA 4AW0A 2YCSA 4EQMA 5CEKA 3TNQB 4LGHA 4FKLA 1XWSA 4HGLA 1H1QA 1CKIA 1BL7A 4O0WA 1WBPA 4DHZA 4I4FA 4ASDA 1CMKE 2H9VA 2HXQA 2IVUA 3H10A 5E1SA 3VRZA 2NRUA 5HG8A 2XVDA 3ZBFA 1DAWA 4TZRA 3RP9A 1UWJA 3O8UA 3FZRA 1H25A 4M14A 3EQGA 3V8TA 2VWWA 3KMMA 1M2QA 4M0ZA 3VW8A 1G5SA 2VTLA 1PMUA 3WYXA 3CQUA 2HZIA 2OIBA 1J7LA 4O7ZA 1WFCA 2XP2A 4NM7A 4IJPA 4RVMA 1ZY4A 4HGSA 2IVSA 1M14A 4PNKA 3Q60A 2P33A 2VWVA 3EYHA 4GL9A 5FEQA 4BYIA 2BTSA 2IN6A 2J0KA 2X6EA 3EQFA 2Y4IB 4V01A 5CLPA 3VJOA 3RAIA 3MDYA 2IW6A 3KXNA 3WZDA 3SXSA 3TZ8A 4FZAB 4F9CA 2WXVA 5DE2A 3EWHA 3UVPA 5J1WA 3IQ7A 4QMQA 4ACMA 2OZAA 3MTFA 3OBJA 3T3VA 4QQTA 5AUUA 3PSCA 3FXZA 4BWXA 4LUDA 3OTUA 5BUIA 1YXTA 2BAKA 2REIA 2BTRA 3ZRLA 4BCPA 3TUDA 4IW0A 2PVMA 4QNYA 1QPEA 2QOQA 4M69A 5EQYA 1VR2A 1M7QA 2C3JA 3FAAA 5EQEA 4HVSA 3E3BX 3O8PA 4FTNA 3EHAA 3OUNB 3LXKA 3BV3A 4JX7A 4TTHB 1DI8A 2WGJA 3KU2A 4HPUE 4NCTC 3W32A 3R8VA 4ZMEA 5M06A 4TWOA 4AOJA 4F99A 3KXMA 1REJA 5K0KA 4B0GA 4NZWB 3FLZA 3S3IA 3ZC5A 4E20A 3B2WA 4E6QA 4CG8A 3BU3A 4WNMA 2ZFYA 3QZHA 3Q5ZA 5DBXA 2W9FB 2C47A 2QLUA 4EOJA 4LV8A 3PP1A 5A54A 2PHKA 4D28A 2J0IA 4PQNA 4YJTA 4L44A 4MQ1A 4ZSLA 4D0XA 3D2IA 2RFEA 4XV3A 3HRFA 3OW4A 3AGLA 3MFRA 1KE5A 4CCBA 4RX8A 4RIWA 2ITOA 4KAOA 2EUFB 2JDVA 4YGAA 3UOLA 1ZOGA 3DJ5A 4HVGA 3KK8A 4BI2A 2FGIA 4L8MA 4FSMA 4EEVA 4Z55A 3C9WA 2C3IB 1MP8A 4I5CA 2OKRA 3D2KA 1Q8YA 3FMJA 2F49A 2OJIA 4R77A 4FL2A 3PPJA 3PP0A 4WHZA 1NW1A 5EM8A 2OXDA 2YA9A 2X6DA 3Q6WA 1OPLA 3UIXA 4ZLZA 5EYKA 3PY3A 4Q9SA 2JFMA 4AW1A 4L43A 4YJNA 4C4EA 4JAIA 5C01A 3D7ZA 4ID7A 1V0BA 4RJ3A 2WMUA 4QT1A 2HWPA 5HESA 4EJNA 4CKRA 5JQ5A 2ITXA 2VTHA 3EN6A 3VNTA 3GFEA 3T9TA 3RBWA 4MNFA 4QMVA 2J0MB 4C0TA 4D5KA 5IU2A 3KY2A 4M7IA 2R3FA 3PVUA 3ZZWA 3NEWA 4IC8A 4XRLA 4DTAA 5M55A 2DYLA 4H3PA 3U51A 4GCJA 3PIYA 3FLYA 2CKEA 4L3JA 2B9FA 5ANDA 2JKKA 4YTHA 5KE0A 5BV3A 2FSOX 3QQKA 2OXXA 5HKMA 4IE9A 5CENA 5LCJA 5L2SA 4FSYA 5L6WL 2PYWA 1GIJA 4BHNA 4GVAA 1Q8TA 3BGPA 3PVWA 4XH6A 4M12A 4AGWA 5JZJA 3JXWA 4IM3A 5BVOA 2X39A 3AC3A 5IQBA 3RPOA 3VBXA 3OCBA 3DPKA 4CTCA 4DH5A 5JSMA 1TQIA 3N4UA 4R8QA 4CMOA 3MFTA 3MS9A 2Y6OA 5HU9A 4AACA 4L46A 4NFMA 5CVFA 5M08A 4AA4A 5A4EA 4FIJA 4FZFB 4FKVA 4BTJA 5I0BA 1OGYA 4N0SA 4ZZOA 4IFGA 1NY3A 1ZMUA 2W1IA 1QPCA 2XNPA 4EH7A 3LFSA 3VW6A 2PE2A 2F7EE 3BPRA 4NJDA 3UNZA 4I6BA 4V0GB 4D2WA 5KNJA 4BGQA 4H05A 2BZKB 3CTHA 3OWLA 3PLSA 4EHVA 2ZDUA 4C36A 2BIYA 5K4JA 4LGDA 3NYVA 4O7VA 5LWMA 5GIOE 2BAQA 2VZ6A 2IZRA 5LOHA 4W9XA 3FLQA 1ZLTA 2PUPA 3NNVA 5DRDA 1YI6A 4EHEA 4QMWA 3LLTA 4I23A 5DVRA 4U41A 2WEIA 3GOKA 4B8MA 2UW8A 3VS4A 3GQLA 3FI3A 3V8SA 4YUQA 5M4IA 3KMWA 2UW7A 3ZDUA 3FMKA 2WO6A 3DXPA 4DEAA 4IBMA 3R9DA 2EVAA 3ORZA 4BDGA 2ZM4A 4ERKA 1OIRA 3KVWA 5J9LA 2OJGA 3AD4A 5TO8A 5CEIA 2Y8OA 2BVAA 3ZHPC 4O0YA 3HV6A 1ST4A 4E5AX 3D5XA 3DXQA 4BDDA 1BL6A 4FZ6A 3A7HA 4EOLA 3R1YA 5EYDA 2PUIA 3W0OA 4FIIA 3UDSA 4EBWA 5DR6A 4YTCA 2R3GA 4MXOA 3ZLWA 3HL7A 3HV5A 4OTDA 1H27A 2B52A 4APPA 4GJ2A 3WF8A 2XEZA 4C34A 4DCEA 3FXWA 5G6VA 4QMTA 4MYGA 4AXDA 2VTSA 3S95A 5EHOA 3K5UA 2IO6A 4FIEA 4NKAA 5LVLA 5CI7A 3AKLA 3CGFA 3I7CA 4KBCA 3ZM4A 5E8UA 2I0VA 3QXOA 2BILB 3A7FA 4OW8A 4AXCA 2PZRA 3C4XA 4R3PA 5EDPA 1W84A 5TOZA 4OGRA 2YAAA 4AE9A 2PWLA 1G8AA 1PXPA 5AR4A 4NUSA 4TYHA 2Z2WA 4O4DA 4GIHA 3TKHA 5KX8A 1T45A 4HCVA 4J52A 1OPJA 4GFGA 4EH6A 4BDIA 1LUFA 4TRLA 1OBDA 5F9EA 4X2KA 5DT0A 3F3TA 3VBTA 2AQXA 4G5PA 5CQWA 3BHTA 4FNXA 4RIYA 1RDQE 3QLFA 5HOAA 3EKKA 4FVQA 5KKRB 2Z02A 5IEYA 3DGKA 1ZMWA 4IWPA 3TNHA 1WBTA 2XBJA 1GIHA 4CFNA 2X1NA 3DB6A 5CVHA 2XIXA 2XCHA 3DJ6A 3ORTA 2F7ZE 3I4BA 3WF7A 3ZFXA 1LPUA 5ANEA 4FTRA 5LVPA 4RJ8A 5HBEA 4FV7A 5KCVA 1CTPE 2QR8A 4MTAA 5ETFA 2JLDA 3E7OA 4FG8A 4O7SA 1UKHA 3OROA 3HUCA 3ODZX 2X7FA 3O7LD 4LRMA 3RNIA 3RPVA 1J3HA 3ZUUA 4EC8A 2BRNA 2XBAA 4BDFA 1URWA 4CFFA 4O4BB 5IPJA 4CFUA 1MRYA 4G3EA 4L3LA 4UWBA 3R63A 5BVFA 4ORKA 3DV3A 1Q8UA 2UW5A 4FTIA 3I1AA 4BIBA 4OAVB 3Q2MA 4GG7A 5ANKA 1YOJA 4LYNA 3E88A 3MPMA 4TYEA 4ACCA 1YRPA 4GFOA 3MN3A 4NW5A 3P79A 5I9UA 2UW4A 3NVKI 3R2BA 4QP7A 2X2LA 5DGZA 1R78A 2C5OA 3RI1A 1JSTA 2GPHA 2XK3A 1BKXA 2BFYA 2P2IA 4O83A 4NIFB 4IWDA 4JQ8A 3MB6A 4U0IA 2Z8CA 4WNKA 2OH0E 2YWVA 3MPAA 2QLQA 4AOTA 1WVXA 4E4MA 3GU4A 1F3MC 5IG1A 5JQ8A 2J2IB 4YHTA 1TFFA 4EORA 5HBHA 1GJOA 2YZLA 2OJFE 4JXFA 3F66A 4IX6A 4YSJA 3V5LA 3HV4A 4FV8A 4IQ6A 5M56A 4G3DA 4KINA 4M67A 2W4OA 4I6HA 4RIXA 4BCQA 4FTUA 2JFLA 3O23A 3A2CA 3DKOA 3R00A 5E8TA 4D0WA 4O38A 5E8WA 3V6RA 5EYCA 4O7LA 3DZOA 1NXKA 2ITVA 3P08A 4J1RA 5IDPA 5IEVA 2JBPA 3QX2A 5L4QA 3PPKA 3FI4A 4EH5A 3ZFYA 5I9XA 3ENMA 2OBJA 1E1VA 5FDPA 4NSTA 1OL7A 3BYSA 3E93A 5HLWA 2UZBA 3UQFA 3F2RA 2GNIA 2VO7A 3IW7A 4X3FA 4FIHA 5E8YA 4FKRA 3LXLA 3QA8A 3EQCA 5FBOA 1FINA 4C59A 5JFWA 5HG9A 4DGNA 1JKTA 3RPYA 1WVWA 4B99A 3M1SA 5EM6A 4NWMA 2W0JA 5AWMA 4PMPA 2R3HA 1W8CA 3ZO3A 4AW5A 1GZKA 4EHZA 1XMMA 5ETIA 1EH4A 2UZLA 3QAME 4KKEA 5AV0A 4H58A 5AR7A 5K9IA 5KMMA 2ZV2A 3HMOA 2YIQA 4QQ5A 2OZAB 2ITTA 3KA0A 5ACBC 3UO4A 2ZM3A 3OEZA 5AA9A 4QDVA 1RW8A 3EQRA 3TG1A 4EUUA 4C4FA 3W2CA 3NSZA 1OITA 2F57A 3HAVA 4G34A 4C58A 2QHMA 4H3QA 4PP7A 2ZDTA 2ITYA 4M69B 1XH4A 3QTXA 4FV1A 5F4NA 4ZAUA 1YWVA 1UVRA 5IA5A 4FSNA 3VBYA 5KMNA 3LJ0A 3ZUVA 1BUHA 2QD9A 1OIUA 3FYKX 3R6XA 1JKSA 4QYHA 3PXZA 4WG3A 3ORKA 4CFWA 1YI3A 4D1SA 2P2HA 4GT4A 5IUIA 4IX4A 3PLAE 4NTSA 1A9UA 3CE3A 3G6GA 3BZ3A 4I22A 3Q9XA 2W1FA 2JDOA 4RJ4A 5H2UA 4DFYA 3F3UA 3FHIA 2GHGA 3UODA 5JKGA 4P90A 1Q3DA 2ZMCA 2BRHA 3G15A 3DBDA 4ZTRA 5A4TA 4PWNA 2W9ZB 2O2UA 3HV7A 3IPHA 1VLRA 4HVDA 3VUIA 4IC7A 4ALUA 3E8DA 3GENA 4RIWB 4U45A 4DLIA 5C1QB 3RHKA 4CKIA 3BEAA 3MH1A 4UMTA 3N51A 3ODYX 2XAOA 1OKVA 3BYUA 3R9RA 5AIKA 4B6LA 4XG4A 4TWCA 3W0SA 5J87A 3TN8A 4KS7A 4C4IA 4ITIA 5KMKA 1BI7A 4L01A 3FV8A 5CSPA 4BJJA 1DS5A 5HQ0A 1DAYA 4R1VA 4GEOA 5AX9A 5I9WA 4C3FA 3HYHA 2UVYA 2VTRA 4BKJA 4IWOA 5CAPA 2CNVA 2Q83A 5D9HA 4CCUA 5FQDC 3PUFC 1OBGA 3DCVA 4EUTA 3CPCA 5AP3A 4CQGA 2JDTA 2C6MA 2ERKA 4TW9A 5L3AA 4J8NA 3TTIA 2BDWA 2QONA 4ANSA 3W0NA 2R3NA 3FE3A 3PG3A 4GT5A 4KD1A 1Q99A 1YXVA 3AG9A 5BX0A 1KE7A 3BLAA 3ZSIA 2Z60A 4QP8A 4CV8A 5GJFA 4CYIA 3GOPA 1ZYJA 4AZSA 3MWUA 4GW8A 3RPSA 5DLSA 2YDIA 4CZUA 2J5FA 4EZ5A 2GCDA 3HMMA 3LQ3A 2W1DA 2CSNA 2WMRA 2IWIA 4JQ7A 3RGFA 4EWHA 4LI5A 5AP7A 3BYMA 5BMMA 3IO7A 4F6UA 3U87A 3RK9A 3ORPA 2RGPA 2FYSA 5D7VA 1SMHA 1XH8A 2V5QA 5AIRA 1JAMA 4ZK5A 3UOHA 4IB5A 4ALVA 5JN2A 5IQDA 1GZ8A 2HY0A 3OWJA 3Q52A 1JSVA 3UMWA 3PXYA 3QC9A 2UZDA 1UU9A 5FEEA 4KSPA 4X7QA 4NL0A 4RVTA 4FK3A 5JGBA 2ETRA 4WT6A 3U6IA 3IS5A 4HVIA 3BYVA 4FKTA 4G3FA 4EYJA 4XJ0A 4JBPA 1ZY5A 4D5HA 1SNXA 4O7NA 2PE0A 4FICA 2OU7A 1LEZA 4FVRA 2XK9A 1I44A 2WMAA 5B2MA 4WNOA 4FK6A 4DN5A 3MH2A 4X6RA 4RC4A 1R0EA 4HJOA 2FSLX 2FO0A 4O7TA 4O91A 5I5ZA 4AT4A 3SGCA 3M2WA 5JK3A 3FMDA 4R5YA 2VO3A 3A7IA 4KKGA 4Z3VA 2W1GA 1TQMA 4FOCA 4LUEA 5FM3A 5DRBA 5HORA 3SOAA 4C7TA 3KN6A 4WG5A 1YHSA 4XOZA 4IAZA 3JVSA 5CVGA 4MEDA 5LMKA 1HCLA 4YHJA 3C51A 3EH9A 4QP4A 4I5PA 5DEYA 4Z16A 4BIEA 2XNGA 2AUHA 2ZYBA 4C62A 1SNUA 3A7JA 3OOMA 2QOIA 2X4FA 3PUPA 4MWIA 3SC1A 4BGHA 3MIYA 4RIOA 1NVQA 5EKOA 2OXYA 4MX9A 5B0XA 3DTWA 5BVKA 3UDZA 3GGFA 3FY2A 3I5NA 1XJDA 3EQIA 2NPQA 4YZMA 3P7AA 4YR8A 2WTDA 2YM7A 5FM2A 1OIQA 5KBQA 4LFIA 4ASZA 1OM1A 1Q8ZA 4UWYA 3AKJA 4UBAA 3TKUA 4MBIA 4O22A 5AX3A 3G9NA 4U40A 4E5WA 2OK1A 2OSCA 1OUKA 2PMOX 3VS7A 3W2QA 1A06A 3WI6A 4BN1A 5HD7A 4F08A 5FTGA 3HEGA 3CP9A 2OFUA 2WU7A 3G6HA 3DBQA 4MXYA 5JT2A 3VVHA 4U7ZA 2OF2A 5AR3A 5HO6A 3BLQA 4AZEA 4C3RA 5A9UA 2J5EA 1KUTA 3C4FA 2JIVA 3BV2A 1YDTE 1AQ1A 1K2PA 3LFEA 4F09A 5J5SA 1JLUE 2ITNA 2R7BA 3EFWA 4Q5HA 3FMLA 3TKIA 1OVEA 1U46A 4MCVA 4CLJA 3AC4A 3FHRA 3R21A 5FEDA 1MRUA 4TKSA 2PL0A 2C30A 3DDQA 4LOPA 4FL1A 2VO0A 4ACGA 3G5DA 4X3JA 2XALA 1WBOA 4TYHB 3LQ5A 1H0WA 4YJVA 5B7VA 5HTBA 3UDTA 2O63A 1ZYSA 2XJ1A 4UXLA 3PFYA 1O6KA 5D11A 4J96A 4FV5A 4RIYB 2I7QA 2OI4X 4ZXTA 3QCQA 5IUHA 2V0DA 5I3OA 2QG7A 2G01A 4FV2A 1RJBA 5EW3A 3VS0A 3BGZA 3BRBA 5EOLA 3WE4A 3ZLSA 3CGOA 5CEOA 2Y0AA 3HECA 2FSMX 5IH4A 1OGUA 1Q4LA 3SXFA 1OKZA 5ETAA 3DU8A 4GYIA 3C5UA 3O17A 4YLKA 3R9HA 3BLHA 5D10A 3A60A 5HNBA 2FSTX 4FI1A 4F7LA 5E92A 3PDTA 4G31A 4O1OA 2O0UA 4BDBA 3RM7A 4I24A 4PV0A 1J7IA 5D1JA 5HBJA 1KE6A 1WAKA 4QTEA 3BYOA 2RG5A 2OGVA 4YP8A 2I1MA 4FTLA 3ZBXA 3NRMA 5DPVA 4NCTA 2UW3A 3HLLA 4XG3A 3KVXA 5CSXA 2XUUA 4CVAA 3FPQA 4AG8A 4WA9A 2PZPA 1W83A 3SRVA 2W4KA 5HE2A 4H36A 3FL4A 4XV1A 4NW6A 4A4OA 5AP4A 2BDJA 3NUPA 3QTIA 2BZIB 4FMQA 5L8JA 3RNYA 3VBQA 2XAMA 5BYYA 3B2TA 4QP1A 5CEPA 1GAGA 4O1PA 3EFLA 4IZYA 1OECA 1GOLA 3CIKA 4N6ZA 2B1PA 5IQIA 4D9UA 2P0CA 4KBKA 3FBVA 4IM0A 2ZOQA 4WD5A 2C4GA 5CF4A 3UBDA 3PE1A 4FG9A 4RIXB 4A9YA 3GUBA 3QQFA 4MBJA 3JYAA 3Q53A 5DIAA 4EH9A 3GCQA 3R8MA 2NO3A 4DEBA 2BCJA 3OF0A 4IIRA 3GT8A 3II5A 3L1SA 3MBLA 5DWRA 3DK3A 3ATTA 3TV4A 3V6SA 1Y57A 2W1ZA 3F2AA 4XBRA 3Q96A 2IPXA 4FNWA 4F4PA 3VIDA 1FMKA 4W4WA 1Q61A 2CCHA 4X3FB 5TE0A 4LQMA 4IAYA 5BVDA 4ZP5A 5GINE 4K8AA 3W0PA 4L52A 3ZYAA 4Y85A 4S32A 3HDNA 4QTBA 4O7YA 1K3AA 4RJ6A 4F6WA 5AA8A 4J8MA 3QGWA 5LMAA 5A4CA 4Y5HA 1H07A 2XK6A 2C0OA 5AR8A 1J1BA 4YLLA 4FKPA 3TJDA 1SZMA 5CALA 2GS2A 3TNIA 1XO2B 4QDEA 3NNXA 3PWYA 3R83A 3DLSA 4C4HA 4DBNA 2BR1A 4F0FA 4FUYA 4HYHA 4QYYA 3NIZA 3AGMA 1VEBA 3QRKA 4OTPA 3CEKA 4K33A 1QPJA