4G6OA

Crystal structure of the erk2
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
347
structure length
339
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the ERK2 complexed with E28
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
total genus 106
structure length 339
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4g6oA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4g6oA01
4JG6A 4LI5A 5LWMA 3O8UA 5TT7A 5BX0A 4HVSA 2CGWA 5IEYA 4WUNA 1ZWSA 3KN5A 4D28A 2P2IA 4GK3A 3PIYA 4GT3A 4BCQA 3QX4A 4MXZA 4LOQA 3RP9A 2VWYA 3QTRA 1XH8A 5AV1A 4RFYA 4Q5HA 5LMBA 2CKEA 5CU2A 4GV1A 3BYVA 4AAAA 4H3QA 5A6NA 1NVQA 4EK4A 1A9UA 2IJMA 1YI6A 2QKWB 3PLAE 5HLNA 5JQ8A 1ZY4A 4NCTA 4WA9A 1XH4A 4QMPA 4W8DA 4A06A 2UZUE 2IVTA 4BYJA 3NUPA 4O82A 1GIJA 4O0XA 4ASXA 2QR8A 5LMKC 4BCFA 5HD7A 1X8BA 4NT4A 4EKLA 5EM7A 1FOTA 2HK5A 4DTAA 3NNXA 3Q96A 3W2CA 3LXNA 3W2RA 5EM5A 5HCXA 2XB7A 5H2UA 3RI1A 4D2PA 4N70A 2WTWA 1YDTE 1TKIA 3F2AA 4QYGA 4X3FB 3OMVA 5DT0A 4DFBA 2YAAA 4RIXA 4F0GA 3GFEA 4GSBA 4IDTA 4N6ZA 4QRCA 5HU9A 2VN9A 3EFWA 1LP4A 3FZOA 3NUUA 4BB4A 4XG3A 4CT1A 5AAEA 5ANIA 4TRLA 3QHWA 3R9OA 4JR3A 2IWIA 4MHAA 4C4IA 2OZAA 3MFTA 3BRBA 4D55A 3DU8A 4L43A 4MH7A 4YMJA 1RE8A 5CVFA 4PMMA 5AJQA 4NJ3A 4RJ4A 3SXRA 3COMA 3FMDA 4A9YA 3O7LB 1XKKA 1VYZA 2O63A 3JYAA 1V0OA 1O6KA 5CZHA 4H1JA 4A4OA 1DM2A 2WB8A 5CEOA 5J87A 2ZV2A 1GOLA 4RIXB 3ZFXA 2YM4A 2VWZA 3FUPA 1BI7A 3TJDA 3D5WA 4IHPA 4AA0A 4YO4A 4NKAA 1PKGA 4DH3A 3DXPA 3P5KA 4XP3A 3TL8A 3SGCA 4BGGA 2FH9A 1GZNA 3QTWA 3E8DA 1XH6A 2F7XE 3EQHA 2XH5A 4IACA 5HU3A 5IQEA 2ITNA 2I6LA 1PKDA 4JBVA 4EYJA 2XIKA 4U43A 2PZIA 5KUPA 5C1QB 2BCJA 4GVAA 2QURA 2FO0A 3BBWA 3UE4A 4J8NA 2ONLC 3W2PA 1H07A 1J1CA 2W1EA 5AP3A 3OOMA 3MGYA 2VUWA 2C3JA 2OKRA 3IW5A 2PWLA 1XBAA 5L4QA 3ZOSA 4FTKA 3BQRA 3HAMA 3L9NA 2W96B 2PVHA 1JKKA 3BGZA 4J53A 3GUBA 3ODZX 4FVQA 4D1SA 4E5WA 5CF8A 4CG8A 3MBLA 2WTKB 1YI3A 4ZTNA 4K2RA 3FZRA 4XP0A 4C59A 4EZ5A 4O38A 3LCDA 4KAOA 2PUIA 2R9SA 4JJRA 5TR6A 3TI1A 3D5XA 3ZSGA 4ANQA 4ZEGA 4F65A 1SNXA 4AGCA 4EKKA 4KBAA 3WIKA 4NEUA 4L52A 3BI6A 4QP9A 2R3LA 3OTUA 5CWZA 4ZAUA 3W55A 2WTDA 3LQ8A 4FKTA 3QL8A 4ENXA 3UIUA 4AP7A 2GS2A 5HNIX 3Q2MA 3EN9A 4WIHA 4BDJA 1E9HA 1OGUA 2EXEA 2IW9A 4AXAA 4P5ZA 4JG8A 5HO6A 1ZMVA 2YIWA 3EMGA 4TPTA 3RM6A 4PDSA 5FM2A 3UYTA 4EK3A 2QI8A 3C9WA 4QP6A 4F9BA 4RX7A 4FV5A 3RAWA 5M4CA 4ANMA 4EOPA 3PXRA 3LLTA 3R71A 1IAJA 4E20A 4BDCA 3DZQA 4L01A 5AR2A 3S4QA 4ERWA 2Q0NA 1OB3A 4KIOA 3F2NA 4FIEA 2PL0A 1J7LA 2BRMA 4BDIA 3D15A 4LRJA 3F3TA 3UG1A 2CKQA 2WAJA 1BUHA 4IEBA 4GCJA 5DPVA 4BDBA 5AUVA 4BCHA 4ZLOA 3ZHPC 5M07A 3RZBA 1O9UA 2CGXA 3AT2A 2WQOA 3JY0A 3Q04A 4I23A 1WBTA 3DJ6A 2R4BA 1YXSA 4M8TA 5AIKA 4RFMA 3AXWA 2OBJA 4FSZA 1Q62A 3H9OA 1J3HA 3SXFA 4YJSA 3ORXA 4ZY5A 3W8QA 4J1RA 3PVUA 2QD9A 3Q9ZA 4CZTA 5HGIA 3PUPA 2ZYBA 2B0QA 4G6OA 3VUGA 5HTBA 3ZUUA 3QGWA 3QRJA 5AUZA 4GEOA 5KMMA 3D7TB 4JQEA 2UW5A 4FKLA 4BCJA 3OZ6A 1H01A 3RWQA 3GU7A 2C0OA 4RLLA 4S30A 5DG5A 5ACBC 2C5VA 3FXXA 4PNIA 2VNWA 5J1VA 3R2BA 1SNUA 3UP7A 2W5BA 4EQMA 2OXXA 4IJ9A 2W99B 4H3BA 4EI4A 2DQ7X 5BYLA 1BYGA 4EH3A 1PW2A 2O65A 4O1OA 4GJ2A 3I0OA 4DG3E 5HHWA 4HVHA 3GU8A 3R7YA 4CEGA 4RIOA 2VRXA 5C8NA 5DYJA 3I7CA 4IIRA 4D1XA 3RPOA 4GL9A 2B9JA 1LEWA 4JBPA 4QTCA 2XKFA 4ZS0A 3OC1A 4U44A 3ZO4A 5CU4A 2JITA 4M0ZA 2R3QA 2VTMA 3N4UA 4FNXA 3E7OA 3GBZA 4FSNA 1I09A 2RG6A 3LXKA 4FZ7A 2WEVA 4HOKA 2A4LA 2R3PA 3EYHA 4ITIA 5EW3A 3RK5A 4F1MA 2VX0A 5EYCA 1QPCA 2E9UA 4FI1A 4UV0A 4DT9A 3BU6A 3MPTA 4TWNA 3LJ2A 4D4SA 3LFQA 4EHZA 3G33A 5CXZA 4FEQA 3VUTA 5CZIA 5IUHA 1VJYA 4U40A 2ZDTA 1JKSA 4BWXA 5GJFA 3QKKA 3C13A 3NYNA 2QOOA 4CGAA 3ENMA 3QZIA 2X1NA 1U5RA 5F20A 4UWYA 4YSMA 3OTVA 4M14A 4NKSA 1GZOA 3EB0A 1H1RA 3FKLA 4HPTE 4YP8A 5D10A 5I9UA 4FSQA 4IAKA 4KIPA 3FMMA 4LOOA 2I0EA 4PX6A 3C1XA 2OZAB 5AP7A 1H1QA 4RWKA 5E8TA 4DH7A 3PA4A 5EYKA 4ZSGA 3IOKA 1F3MC 3EN5A 3VS0A 1Q8TA 4CFFA 4MNEA 4X6RA 5CSVA 3PDTA 2RSVA 4AN2A 3VUIA 4BCNA 2C6KA 4V0GB 1CKIA 4FA2A 1SZMA 3NNWA 3PRIA 4CFWA 3VBXA 4FZAB 3VUKA 5A14A 1GZKA 2OI4X 1Y91A 1P4FA 2QKRA 2VWBA 3R1QA 4I6QA 4NM0A 3FMEA 3QTXA 4OTWA 2XNEA 4FTAA 3GOKA 5CANA 5IQHA 2IN6A 4RIWA 4DTBA 1OITA 2GS7A 4WG5A 3L8PA 4GRBA 4YJOA 1QMZA 5K3YA 1FVRA 3EL8A 3D9VA 1UKHA 1PXIA 3ZEWA 1W0XC 3F2RA 1WVWA 3CGOA 3DB6A 3QLGA 4FV1A 5K0XA 2BFYA 4UX9A 3R73A 4C61A 3R1YA 4FE2A 5DH3A 4YSJA 1OKYA 4UMQA 3P86A 2VTLA 3FKNA 4U6RA 4II5A 5CSWA 5DBXA 4BCOA 1ND4A 3PP1A 1BX6A 4GFGA 5D12A 5I4NA 3ZLYA 5CF6A 1QPDA 1FBNA 1JLUE 1ZZ2A 5IA4A 3MA3A 3MIAA 3RPSA 3D7TA 3LM5A 4O27B 3VWAA 3GB2A 5M51A 3DB8A 4NL0A 4IWOA 4PL5A 5HIDA 1YHSA 5FTOA 1UWHA 3PA3A 5JQ5A 3LZBA 3S0OA 3O51A 1SM2A 4XEYA 4D2SA 2JGZA 5JFSA 3RCJA 1AGWA 3NLBA 2JIUA 2PUUA 4BDFA 5LMKA 3VJNA 5AUYA 4C35A 3P4KA 1KE6A 1LEZA 5HO7A 5BMSA 4ALUA 5CEIA 1DI8A 4HW7A 4YZNA 4G3CA 4MEDA 4C7TA 4I3ZA 2WMWA 3PE1A 5BVOA 3UNJA 3CTHA 4E4MA 3QWJA 2XEZA 3PJ1A 2BIKB 4FV3A 2P0CA 4MWIA 3IW4A 3Q2JA 2HIWA 1REJA 3ANRA 2YZLA 4LM5A 4A07A 1H0VA 4KWPA 1B6CB 3F5XA 4FSUA 4YC6A 5AV2A 2WMUA 4I5PA 2CMWA 4WSQA 4J8MA 3UOHA 1UA2A 4O7NA 4F7JA 2WMAA 4ZK5A 3SXSA 3H0YA 3PVGA 5DHJA 3VAPA 3KU2A 2CCHA 3CQUA 5GZAA 3KMMA 3R7IA 2C47A 5ANEA 4AZTA 5CT0A 4K0YA 3QC4A 3JVRA 2XJ2A 5J7BA 5GZ9A 5AR4A 3CKWA 1VZOA 3ORMA 2BUJA 3KULA 4BI1A 4Q9ZA 3VUHA 3FDNA 4IX5A 4Y46A 2PPQA 1FQ1B 5EH0A 5IQIA 5L8LA 4I6BA 4FK3A 3D83A 4WBOA 3WZKA 2IG7A 3OT3A 3QTQA 4O83A 2ZVAA 2PU8A 2PZRA 4XX9A 4EJNA 3C0HA 3F3VA 4FUXA 3MFSA 4ZTMA 5LWNA 4BL1A 4ACGA 4CFVA 2JAMA 4IAZA 4LMNA 3UJGA 4GW8A 2V5QA 4C4JA 4FKPA 3PY3A 4D4RA 4FKWA 5TF9A 4KSQA 5M55A 3KEXA 4TYHB 4OTFA 5IMXA 2JKKA 3HRFA 4O7WA 2BZJA 3FLWA 3IGOA 4EORA 3LFCA 4FYOA 1M14A 2CN8A 2HZIA 2JIIA 4JR7A 3V5WA 4AT3A 4M68A 3PA5A 3GFWA 3C0GA 5A4TA 2W4JA 1V0BA 4KIKA 5GHVA 2OO8X 2ETRA 4OTGA 1U46A 3ZFMA 3WF8A 3CQWA 3AQVA 4FVRA 1UV5A 2UZVA 4M7IA 1W7HA 2AUHA 2XKDA 4ZSAA 3O2MA 5AWMA 4CTBA 5KNJA 3U6IA 2PMIA 4DGNA 5J95A 5DN3A 3UMWA 3ZDUA 2R0UA 3I81A 3JY9A 4NTSA 3NR9A 4FSWA 3AC5A 2OJ9A 5DNRA 4NFMA 4AA4A 3NVKI 1M7QA 2V22A 2BFXA 4RJ6A 4BCIA 3FLNC 2CKPA 3LM0A 1OMWA 3EQDA 4YNEA 3QYZA 4D9UA 4CLJA 3FEGA 3OXIA 1DI9A 3CLYA 5IEVA 2EU9A 1WBWA 4I94A 4EOOA 3F5PA 3DLSA 3SV0A 4WOVA 5BYZA 4DEIA 1MRUA 4MXCA 2YEXA 2R3MA 2W4OA 4TNBA 3TUCA 5HTIA 3ORLA 4CCUA 2WMSA 2VO6A 4YR8A 2ACXA 3H4JA 2QOBA 4EH5A 3CEKA 4FT0A 5E8ZA 5FXRA 3TIZA 3FBVA 4YPDA 4FTMA 3QHRA 2BHHA 2ITPA 5AMNA 3TTIA 4ASDA 5D11A 5CSHA 3ZZEA 1U4DA 2G1TA 3CE3A 1UU8A 3K5UA 4GIHA 4L3PA 3C4XA 2UVYA 1HCKA 4R78A 3MH3A 2PMLX 4GUEA 5AUXA 2X7OA 3TJCA 3G6GA 1WMKA 2BPMA 1UNGA 3B8RA 3PLSA 4DFLA 2OICA 3QWKA 4C4GA 1ZOEA 4BICA 3LOKA 2GNLA 3UO5A 2FSLX 2ZMCA 3E8CA 4C02A 5L6OA 4L45A 2QO2A 1YWNA 4D2VA 3B2TA 4E6DA 3H0ZA 5CNOA 2UZWE 4H1MA 3JUHA 5IDNA 1L3RE 5KZ0A 5CY3A 4B7TA 4IVAA 3AG9A 4WRGA 4CT2A 2CHLA 4HGEA 5JFXA 1EH4A 2PMOX 3LFSA 5BVKA 1ATPE 3FXWA 2BHEA 3Q4UA 4ZY6A 4JAIA 4UZDA 3T3VA 3NUAA 5CAOA 3EZRA 2J4ZA 3B8QA 3H30A 2CNVA 4FR4A 3D14A 3U4WA 1WBVA 3MY5A 1G3NA 2XNNA 4U8ZA 3BV3A 4FSRA 1DAYA 4UEUA 3LE6A 5C03A 3RINA 4CKJA 2B52A 4YZDA 5HCYA 1UKIA 3DY7A 3QGYA 4D2TA 3O8PA 4F08A 1H27A 4I5CA 4PTGA 1OBGA 2QOFA 2A0CX 3SX9A 1WAKA 2BDJA 2W5HA 2O2UA 3FI2A 5CEQA 3MJ1A 1ZRZA 4EUUA 2PE1A 4H58A 1WBOA 2ZOQA 5D7AA 5ETFA 1T46A 2XUUA 4IB1A 3UDBA 2VO3A 3GCSA 3Q4ZA 5AUTA 2PE0A 4EOKA 2B9IA 2FB8A 3QRUA 3P79A 3THBA 3PWDA 2F2CB 3BWJA 3TZ7A 2BKKA 4ACMA 3HUBA 5B2LA 3HMNA 4MYGA 1ZMWA 5BVDA 1UVRA 3QTSA 1YHVA 1R0PA 2YIRA 1G5SA 3CCNA 2JC6A 4PDPA 5HG8A 4NYEA 4FX3A 4QMSA 4EH7A 3GENA 5AUUA 5KMLA 4CMOA 3MWUA 2Y6MA 3DKCA 2I0YA 3F3UA 2OWBA 2P3GX 3W16A 1WZYA 4UN0C 4BTFA 2E2BA 5DFPA 4CLIA 2JFLA 2YACA 4FUYA 4FZDB 4NU1A 1L8TA 4PP7A 4AZFA 3V8WA 3NEWA 4FOCA 3EIDA 2ITVA 5I3OA 4NW6A 3R22A 2O64A 3NX8A 1ZYJA 4FMQA 5HG5A 5KZIA 2YDKA 4FV7A 4F6SA 1XH5A 4DFYA 3QD3A 1NVRA 5CSXA 3FAAA 3V3VA 4RBLA 4MVFA 3NRMA 5L2TA 3BGQA 3SAYA 2UUEA 4DN5A 3Q6WA 4X2KA 3ULZA 3OWPA 5BMMA 3JR1A 3O7LD 1GIIA 2XBJA 1H26A 4M67A 3EQRA 4MXXA 3UIXA 3F5GA 5JZNA 5TO8A 3D5VA 5E8VA 4FIGA 4K8AA 4KSPA 1B38A 3V8SA 3W18A 3R9DA 2VTTA 4W4YA 3S2PA 4RX5A 3QTZA 2FSOX 4FNWA 3BQCA 4ITJA 3L8SA 3ZZWA 3ZC5A 5DT4A 4GK4A 5HORA 5M4IA 5M08A 2ZJWA 4J52A 2AYPA 3ODYX 3JXWA 4RC4A 4EH9A 2XVDA 1CTPE 1WBPA 4TWOA 2JDTA 3IGGA 4AOIA 5JKGA 1BL7A 1E1VA 1PY5A 4IMYA 1JOWB 4M84A 4D9TA 5HQ0A 2OFVA 2ITQA 3QCYA 1M7NA 5E7RA 5HOAA 3VS1A 4AFJA 3HYHA 4TN6A 5EKOA 3WILA 4DAWA 5BUJA 3BYOA 4QPMA 2E9OA 4PMSA 4JVGA 4R5YA 2J0IA 1OPJA 3LXPA 3PXZA 1H24A 4CV9A 4WG4A 4UYNA 4IADA 5DT3A 4G34A 3PXQA 4YC8A 3R7VA 3ZU7A 1S9IA 2C6EA 4CYJA 2XJ0A 3KRLA 3C4CA 3QU0A 5DR2A 4OTDA 4FKSA 4R7BA 4NWMA 3VQHA 5IH5A 2W0JA 4O0TA 5ANJA 2RFEA 3DS6A 4ZJVA 5CS6A 4EK8A 4G1WA 3C4EA 3JPVA 4GG7A 5C01A 5AIRA 4EEVA 3FMKA 3DKFA 3PG1A 4M3QA 2DS1A 2GHMA 3OXTA 4BZDA 5A4CA 3P9JA 1ZOGA 4F7SA 3K3JA 4D2WA 1Q99A 1ERKA 2Y9QA 3ZM9A 3CPCA 1PXNA 3QQUA 5HBJA 2J0JA 4PTEA 5KMKA 2HENA 4OBOA 2WMRA 5HX6A 3FLZA 4AT5A 3L1SA 4MNFA 4X7QA 2R3IA 3DBEA 4DFUA 1PMEA 3BGPA 2C6DA 3IW7A 4UALA 5B2MA 2HWOA 1YRPA 4QYFA 3C5UA 2W1FA 4YJUA 4JRVA 3TNIA 4FSMA 1APME 2B54A 2J51A 3UIBA 4QTBA 2IVSA 1S9JA 4QMXA 1PXMA 3OBGA 5A46A 3FQEA 3MH1A 4DG2E 3LCSA 2RG5A 4OTRA 4FTOA 4RPVA 4E8AA 3KN6A 4FKOA 4GS6A 3EOCA 3QTIA 4FTIA 4RVTA 4W4VA 1JVPP 2RFNA 3PJ8A 3CKXA 3P08A 4CFXA 5M09A 4TW9A 1UU3A 3NYXA 5D1JA 2IZTA 3MY1A 4P90A 3BU3A 4G31A 3E62A 4O7TA 4U45A 2OFUA 3CC6A 4FNZA 3POOA 3PZEA 5KE0A 1WFCA 1KE8A 5J9LA 3PG3A 4RX9A 4C0TA 5DOSA 5LXMA 3FZTA 5C4KA 3HA8A 3I4BA 4I6FA 5ANGA 3Q5IA 4QMOA 4FTTA 1M52A 4RT7A 4PDYA 3QZGA 4FTCA 2CNUA 2PMNX 3NYOA 1G8AA 4QYYA 3TIYA 3M2WA 4DITA 5F1ZA 3UTOA 3UOKA 2GNHA 3MPMA 3NNUA 3MVMA 3PPJA 3WF7A 4DG0E 3SOCA 2CJMA 1UNLA 3EN6A 3IDPA 3Q53A 3T9IA 2G2HA 4D4VA 2J90A 2XYNA 4MKCA 1KE7A 4X21A 1Q8ZA 2GDOA 4UMRA 4H05A 3C51A 4DBXA 2PHKA 1A48A 2VV9A 3F6XA 3MIYA 2XMYA 3W2SA 3WZUA 3GQLA 2V7OA 3BYUA 4F1TA 3EHAA 2C5XA 3K54A 3WF6A 3ZM4A 4FODA 3V5PA 4YTIA 1YWVA 3EFKA 4NZWB 4D4YA 1BKXA 3QC9A 3ORZA 3ZXTA 4CMUA 3VUMA 2RL5A 2BRNA 1OM1A 5FTGA 2Y8OA 3DOGA 4TYGA 3R30A 1ZARA 1Y8GA 3P1AA 4B6LA 2F57A 1IEPA 4NFNA 3TT0A 4BYIA 5EHOA 5CEKA 4QP8A 3LFBA 2WFYA 4I92A 4TKSA 1FMKA 2CNQA 2G15A 5CU0A 3EQBA 3FL4A 3FMHA 4IC7A 4MF0A 3PXFA 3VW6A 4FKQA 3HMOA 4H36A 5DEWA 5CVHA 3VF9A 2SRCA 4RA5A 3DNDA 5JZJA 2UZNA 2YERA 3Q3BA 1PF8A 4F9AA 4YURA 5HVJA 4M66A 4JQ8A 4ZZMA 4CQGA 3ATTA 2GTMA 3FC2A 2X9FA 4X2GA 2Z02A 1OZ1A 3AMYA 4BCPA 4S32A 3Q60A 2WQNA 5CAQA 4HCVA 2QOIA 3QD2B 1H1SA 2NNWB 2UW8A 4MWHA 2FSMX 4DGMA 2OF4A 4XV1A 4YHTA 4EZ3A 2QOCA 3AC2A 3RK7A 1ZZLA 2XIRA 3E5AA 2BDFA 4JBQA 5H8BA 1UU7A 2YJRA 3QQHA 5IMEA 3P78A 5AR5A 5HVYA 1H00A 3DTWA 3LQ5A 4L7SA 3QD0A 3KK8A 3G90X 1XQZA 3QRIA 4JS8A 3QA0A 4KRDA 3A60A 4A4XA 1F5QA 4I22A 4DCEA 3GVUA 3BYMA 3MVJA 1Q3WA 2JDOA 4XOYA 3NIZA 3BCEA 5C8KA 4DA5A 4AZWA 2WTCA 5JT2A 4YTFA 3W2OA 4G3DA 4K77A 4X2JA 4ANBA 1MP8A 4ZXTA 3UQCA 2ITYA 3W10A 2BKZA 4GT4A 2XJ1A 3F3WA 1OL2A 1YI4A 3ITZA 1FGKA 3T3UA 3MV5A 3FQSA 2PVMA 3DFAA 4IX4A 3Q4CA 4S33A 1JKLA 3CD8A 2X6DA 4KS7A 4OTIA 4UY9A 3E3BX 3A7HA 3UIMA 2G2FA 3DA6A 3SDJA 4GKIA 4IB3A 3TTJA 4E3CA 1K9AA 1ZYLA 2F49A 4FTNA 2P33A 4FV0A 3TM0A 4DEHA 5ANKA 2X2MA 4PMTA 5FGKA 1HCLA 5TE0A 3OUNB 3QRTA 4FZFB 4BFMA 5AFVA 2J0KA 4G6NA 4U81A 2JKQA 4YJPA 3R8ZA 4FL2A 3GC8A 2R0IA 2WIPA 1YOLA 5EDPA 2J50A 1NT2A 5IQGA 3A7FA 3WI6A 1WBSA 3W1FA 3E7VA 3HGKA 5DR6A 1B39A 2O0UA 1H8FA 2Y7JA 3IW6A 4Q5EA 4XG9A 3SRVA 3TNHA 1OUYA 5L2WA 4YNOA 2GQRA 3UBDA 2GNJA 2YZAA 3TKUA 3V51A 4FIFA 4S31A 4LYNA 4QMVA 4E5AX 5DI1A 1FVVA 3Q9XA 3ZUTA 1DAWA 4IZYA 5CAPA 2HCKA 3V8TA 3LW0A 3A62A 3PY1A 1ZMUA 2ERKA 3GU5A 4L8MA 4YTHA 4U79A 4G5PA 2PVFA 4WKQA 2P4IA 3OCSA 3NAYA 4EHVA 3MA6A 1PXLA 3MN3A 5LARA 4TWPA 4U97A 4BDEA 2UW0A 3O0GA 5EDQA 1NY3A 2HXQA 2HXLA 2PVJA 4QQCA 1AQ1A 1URCA 2ITXA 2Y0AA 4O2PA 4C8BA 3ZS5A 4ARKA 5DVRA 4R1VA 2NO3A 4FSTA 4ZSEA 3TDVA 2VO0A 1YDRE 5E92A 2H96A 3KXMA 5CT7A 3R1SA 3V01A 2GSFA 2XK3A 3ANQA 4FICA 3GOPA 2C3KA 4YHFA 2C6OA 4BDHA 3CTJA 4NCTC 2YLEA 2AC3A 5BUEA 2VX1A 4O0WA 3S00A 1UNHA 4EC9A 1SMHA 2WQBA 3OY1A 1IASA 4P4CA 4KRCA 1KUTA 3ID6C 5AEPA 4XLIA 3LXLA 1UWJA 3EFLA 3ETAA 5EI2A 5KBRA 3WE4A 3VBVA 3BHYA 2XK9A 3BEGA 3IQ7A 3C4FA 1RDQE 4LV5A 5JK3A 4CVAA 1YOMA 3ZO3A 3QYWA 2QHMA 4FZ6A 4UMUA 1ZYDA 4GIIA 5IA3A 3Q6UA 3FI8A 5IH4A 3T8OA 4Z3VA 4IAYA 2OU7A 2X81A 4G6LA 4LL0A 3NUYA 2OXYA 3G0FA 2Z7LA 3E87A 4FKIA 4WNKA 1YDSE 4LMUA 2E9PA 5A9UA 3O17A 2XKEA 4F6UA 1Q8UA 3SKCA 4L53A 5LMAA 3SW4A 2W7XA 3DFCB 5EQEA 3ORTA 3KRJA 3G9LX 3WARA 3I7BA 5IA5A 4CKRA 4MK0A 5M44A 4TNDA 1IG1A 4GFOA 4FTRA 2IZSA 4EHGA 2VTNA 2XZSA 1A06A 1CMKE 4NW5A 4FL1A 3WYYA 4IC8A 3CS9A 3G6HA 1K2PA 2XK7A 4KBCA 2REIA 3CR0A 3I1AA 4E93A 1U54A 4HZSA 2BAQA 2UW6A 4EWHA 2J9MA 4YC3A 4DEDA 1SVEA 3NDMA 4IZAA 4ONAA 2I40A 4FC0A 2XP2A 2Z2WA 5DRBA 1FGIA 3KB7A 3L8XA 4R77A 3DQXA 4ZJJA 5JSMA 4GK2A 3IOPA 4FBXA 3A4OX 4F63A 1JQHA 3OS3A 4L7FA 2ONLA 3DT1A 3GC7A 5IEXA 2R7BA 4IDVA 4AGWA 3GCPA 4S34A 3P23A 4FL3A 3C4WA 3UO6A 1RQQA 2C6LA 2OJFE 3KRWA 4G5JA 2OW3A 3BHVA 4M15A 1OVEA 3D7ZA 3NUXA 5EI8A 2ZM4A 5IH6A 3LMGA 2GCDA 3UOLA 4YLJA 3WYXA 4CCBA 3OY3A 2H9VA 2R3KA 3MB6A 1MQBA 3EKKA 4XJ0A 4LG4A 2VTHA 3ZDIA 2ZMDA 4IWPA 3SC1A 3VC4A 3QKLA 2FYSA 5EI6A 3LCTA 2R3JA 3QBNA 4XV9A 3SA0A 4RJ7A 5ACKA 2YHVA 3NNVA 4FG7A 5FD2A 4K9YA 2ZDUA 5AUWA 4DT8A 4BKYA 3BHTA 3NGAA 2O8YA 3ENHA 4KS8A 3PE2A 5JGBA 2CLQA 5CENA 4IWQA 3N9XA 3VHKA 4BGQA 1MQ4A 4HGTA 3PJ3A 2B9FA 1UU9A 2CPKE 4J97A 4BHNA 3CBLA 4FGBA 4CFNA 4FEUA 3BWFA 4O84A 2G2IA 2W17A 2B1PA 2OG8A 3AT3A 3EWHA 4RWLA 4BC6A 4AW2A 4RJ3A 3ORPA 4AW0A 4JAJA 4MBLA 4ALVA 2DUVA 4IX6A 4FT7A 5IDPA 5FXQA 4RGJA 5FBNC 5IUGA 5FWKK 4R5SA 3ZLXA 5JGAA 2BTSA 3NWWA 4DFXE 5T6KA 3ZBFA 5DR9A 3ZRKA 5JRSA 3PJ2A 3VS7A 4ZMFA 2QG7A 4HNFA 5B2KA 3NPCA 3IG7A 4YJVA 3TKIA 2HY0A 4UYAA 5LJJA 2X6EA 3OF0A 4PF4A 3EL7A 3C0IA 3GP0A 2WQMA 3FJQE 5BUIA 4KNBA 4RIYA 3ZONA 2UVZA 3SHEA 4U3ZA 3FC1X 2YDIA 3R63A 2JKMA 3FQHA 4FF8A 5E8SA 4O7VA 2WEIA 1Q3DA 2BZHB 3FZSA 3GXLA 2BIYA 4IZ5A 3TNQB 4EC8A 5CEPA 2YITA 2C5NA 3BE2A 4BHZA 3OCGA 5F4NA 4WHZA 5I0BA 3R9RA 4O0VA 4MXYA 3PXKA 4F09A 2VTSA 4JDJA 1XWSA 4LOPA 3KK9A 3GCQA 2WTIA 4DH5A 3ORNA 2A1AB 4DCAA 3VF8A 3FKOA 4O6EA 2I7QA 4TL0A 4UMPA 2GU8A 4JIAA 4EL9A 3UMXA 2IVUA 3RAKA 5F9EA 2HWPA 4O1PA 4O81A 3K3IA 4UWBA 2X8DA 3SG9A 1OL5A 1JBPE 4GU9A 4I0TA 2ZM1A 4ASEA 4J7BA 4EBVA 2PUPA 3OXZA 3KA0A 4RC3A 4AW5A 5BVFA 4IX3A 2P2HA 3QFVA 5DA3A 4EOIA 4ENYA 4HGLA 5HBHA 5AAFA 4LV8A 3IS5A 5EKNA 3V6RA 5LQFA 2A19B 3LCKA 2FGIA 2J5EA 3SD0A 4Z7HA 3DJ7A 4X6QC 3HP2A 2YWPA 2ZM3A 4AZSA 2KULA 3P7CA 4RLKA 4YZBA 5FTQA 4DBNA 2C1BA 5IPJA 3F66A 2UVXA 2RFDA 2VX3A 4LGHA 4J95A 3DBFA 1BL6A 3TV6A 3U87A 5LOHA 2W1HA 5E8YA 1J7UA 2OIQA 5AA9A 4XHKB 3G0EA 4O0UA 5I5ZA 3HDNA 3OWLA 4FV6A 4FEXA 2WOUA 5AAGA 5IF1A 1OIQA 2W9ZB 3FMJA 4JDIA 5DWRA 1O6YA 3RKBA 2RIOA 3C7QA 1P4OA 5IA1A 3GU4A 2YCSA 3KQ7A 4ZOGA 1KV2A 4EJ7A 2EXCX 2BMCA 3CJFA 4P5QA 4GYGA 2YWVA 4RFZA 4I93A 4DEEA 2B7AA 2ZB1A 4WSYA 4AQCA 2XNGA 2EXMA 3R01A 3DAEA 2GHLA 2HAKA 2R3OA 3M1SA 1YQJA 4YU2A 2EUFB 2IW6A 2J0LA 4DEGA 4HYIA 2ZV7A 4EOQA 3DXQA 4RX8A 2PZ5A 5HEZA 4G9RA 3VS5A 4TYJA 4C34A 3Q32A 2UZBA 4XP2A 4ZTHA 4B4LA 2PVNA 2XK8A 3NZ0A 4M0YA 5H8EA 3ALNA 3QUEA 3DJ5A 4Y5HA 3U9CA 3DTCA 3LVPA 1W8CA 4FV8A 4K33A 4BDAA 3HUCA 4QMWA 2QOLA 3C5IA 2XIXA 1MRYA 5HLPA 2JEDA 4NIFA 3E93A 3JS2A 5CU3A 5IU2A 5KMNA 4CYIA 5JGDA 4B0GA 3BHUA 4IH8A 3ROCA 4C2VA 4Y95A 5EDRA 3IDBA 1VEBA 2H34A 3I5NA 1M17A 4NUSA 4QP2A 3R83A 5I9VA 4BGHA 1E1XA 4ID7A 3FMLA 3F61A 4FIJA 3AMBA 3QRKA 4O7ZA 5GINE 2IVVA 2RGPA 2XEYA 4RZWA 5LCJA 2J2IB 4FG8A 1PMVA 2O3PA 4I5MA 5LVPA 2PE2A 3HNGA 1KOBA 2RF9A 4FT3A 4FTJA 3N4VA 4NK9A 3K2LA 5FEEA 3TV4A 2ITTA 4OTQA 3QALE 1V1KA 4ZZOA 4C33A 5BYYA 2YCFA 2JLDA 2Y6OA 3LIJA 4N0SA 4UBAA 4IAIA 4C4FA 4A9TA 4F7LA 1PYXA 2NPQA 4Z7GA 2ERZE 4DGLC 1YWRA 2CLXA 1YXXA 4XG2A 3OG7A 3KMWA 5EQYA 4TT7A 4FOBA 4U42A 5D7VA 3GEQA 3UG2A 5CASA 3UQFA 3DKGA 4JL9A 3RMFA 4E4XA 4A4LA 4MBIA 2YJSA 3O50A 5KX8A 2R2PA 1QPEA 1URWA 4YTCA 2R5TA 2OK1A 2XIYA 2YISA 4I0SA 4DC2A 2OXDA 4RQVA 2E9VA 2C5OA 3QF9A 2QONA 3U6HA 3O8TA 3D0EA 4NSTA 4C4HA 3UPZA 5CQUA 4C36A 3EQFA 2CCIA 2XIZA 4RMZA 5EM6A 2NRUA 1Y57A 5E9EA 2F9GA 3KRRA 1QL6A 4C38A 5LVOA 2X4ZA 2JIVA 3HV6A 4ZSLA 4KABA 4DFZE 5A6OA 4FTLA 4KKHA 4LGDA 3W32A 4AOJA 1WCCA 5L6WL 3ZH8A 3ZRLA 3CSVA 3V6SA 1FMOE 2J0MB 2PTKA 4EONA 2OJGA 3SG8A 3OUKA 2YM8A 2ZV8A 4OT5A 5EOBA 1K3AA 3O23A 3QLFA 3QZHA 5LCKA 3UOJA 3SOAA 1JSVA 3GCVA 5IQBA 2YIQA 3CIKA 2QCSA 2VWXA 2OIBA 2EWAA 2AC5A 3KY2A 3PXYA 4YBJA 3WZDA 4BTKA 3EN7A 3TWJA 2BTRA 4QD6A 1U54B 4YJTA 2UZDA 2VTOA 3E88A 4E6QA 5KKRB 4F9YA 2Z7QA 4Q2AA 4X3FA 3POZA 1Y6AA 1R0EA 3ELJA 3FI3A 3WZEA 4CG9A 3LHJA 2GS6A 2PVLA 1IA8A 3I6WA 3F5UA 4W9XA 2JAVA 4ZZNA 5LVMA 4LRKA 5IUIA 3LMHA 5BQ0A 3U8WA 3PSDA 2V0DA 3ZYAA 4LUDA 5HIEA 3LJ1A 4QMMA 4V04A 3C4ZA 4CMTA 5CSPA 4KA3A 3BU5A 3KF7A 1QPJA 5HE1A 5CALA 3A7GA 5FP6A 3HX4A 2W1GA 1GNGA 3R7GA 2OIDA 2GNIA 3KFAA 3FLYA 4X0MA 5CVGA 2YDJA 3COHA 4FG9A 3IPHA 3RNYA 2YABA 3R04A 5I9XA 2QOKA 4PPBA 1CKJA 3QA8A 2BRGA 3FWQA 1GZ8A 4YLKA 4QMYA 3LLAA 4K11A 4JDHA 3OEFX 1DS5A 3MTFA 5A4LA 1NVSA 1T45A 5FP5A 4BWPA 2F2UA 4ZLZA 1FPUA 2ITUA 4HNIA 3I79A 4BTJA 3KXZA 4BCMA 3O96A 3V5LA 3MESA 3MFRA 4Z55A 4AS0A 3NCZA 1P2AA 3PVWA 2IZUA 4TYHA 4A9UA 3F3ZA 3M42A 4YJRA 3GC9A 4ANLA 5KHWA 1RW8A 5L8KA 4YZ9A 3R8MA 3K5VA 1JSTA 3NCGA 2W4KA 2ITOA 3ROYA 5KO1A 4X2FA 5HE2A 4G3EA 4YO6A 4PPAA 4ITHA 3BHHA 5AR7A 4XLVA 2GTNA 4QTDA 1H08A 3DDPA 2XS0A 3BEAA 3FV8A 4HYSA 2PZPA 4M69A 3RK9A 3ZEPA 1W98A 2VGPA 3VIDA 5HVKA 2GQSA 4PL3A 3KCKA 5AP4A 5DEYA 3TUDA 4FNYA 1CM8A 4XOZA 5F95A 3NMUF 2XNOA 4EZ7A 3O71A 4CRSA 5HESA 4BVUA 4OAVB 3R9HA 2UV2A 2GHGA 3MVLA 5C26A 3QQLA 3D2IA 3LJ0A 4LUEA 5ETIA 3R7UA 5FG8A 4ACHA 4O7YA 1HOWA 3G9NA 2C68A 5DLSA 2R3NA 4I5HA 4L42A 5FXSA 2X7GA 4EOSA 3DQWA 4IW0A 1AD5A 3BPRA 3KMUA 4QMZA 3NVMB 4OAUC 3ZFYA 3C50A 4L3LA 3I6UA 1XH9A 1XBCA 2CGUA 2X2KA 4U9AA 3ZCLA 3EFJA 5CF4A 2B9HA 2BZKB 4BCGA 3EJ1A 2RKUA 2VWVA 4C58A 2X8EA 1OL7A 3P7BA 3H9FA 3UZPA 4S2ZA 4BKJA 4CFUA 4EK6A 3NW6A 4DGGA 4P2KA 4FKVA 4OT6A 3KXHA 5F94A 3UNKA 3A7JA 1H25A 3MPAA 4NTTA 2BRHA 3V5TA 3R8LA 4Y83A 4USFA 2VWWA 4QYEA 3RJCA 1Y6BA 4F9CA 3A61A 4MD7E 5H8GA 3E3PA 1ZOHA 4D5HA 3LFFA 4GH2A 3DBQA 3PIXA 4CQEA 5KMJA 5HTCA 4JXFA 3EZVA 4G9CA 1NW1A 3P7AA 4BY9E 1RJBA 3HMMA 2BRBA 3UC4A 4ZTRA 2WD1A 5C9CA 4OTPA 5EFQA 4AG8A 3HV5A 3RZFA 3CTQA 1PXOA 5AP1A 2XCHA 1PJKA 3G51A 3L9MA 3CJGA 3UO4A 4FT5A 4DH8A 4EOLA 3DAJA 3F82A 3II5A 4UZHA 4C37A 5L2SA 1W84A 3Q9WA 3HV4A 2O5KA 3FMNA 4BR3A 2WTVA 4YGAA 4PQNA 2C6TA 3OVVA 4PV0A 3PY0A 4WT6A 4XBRA 4BBMA 5M06A 3REPA 3I5ZA 4NM3A 4IB0A 5HIBA 2ZAZA 2JKOA 5TKDA 2VTJA 2XKCA 2WKMA 1LR4A 3DV3A 3MH2A 4WUAA 4KKEA 5GJGA 3Q52A 2R3GA 4O0YA 3U6JA 4QQTA 5JFVA 4C3RA 5E1SA 1F0QA 4DINA 5HG9A 2YM6A 2Q0BA 4IQ6A 4FTUA 1OIYA 3TZMA 3DPKA 4KIQA 3MJ2A 4OUCA 4EUTA 3MI9A 5BNJA 3RTPA 5AM6A 1ZYSA 4ZTSA 2X9EA 2ITWA 2VWUA 2J7TA 5ANDA 3PVBA 3BE9A 3DGKA 5HX8A 4H3PA 1W82A 4MQ2A 5IQDA 4HYUA 1XBBA 4O86A 2YN8A 5M4UA 2V7AA 5J7HA 4GU6A 2WZJA 2XRUA 3PTGA 4ZSJA 4ANNA 4EHEA 3MY0A 5AX3A 4EOMA 4QO9A 1VYWA 2UZLA 4V05A 1PYEA 1ZXEA 3HAVA 1BLXA 4EQUA 3BKBA 2HZ4A 2WMVA 1WBNA 2B4SB 3CP9A 5KHXA 5CF5A 4JOAA 4U0IA 1Z5MA 2W1ZA 2UW9A 4BBEA 1OKWA 3DK6A 3Q4TA 3QQGA 4IVCA 5FDXA 4XV2A 2JBPA 4O21A 3N4TA 5H9BA 3RWPA 1JKTA 3FY0A 1P5EA 3AC8A 3OWKA 4IFCA 2W1CA 4BCKA 1WVXA 3TACA 3R6XA 5EYMA 4C3FA 3D94A 3ORIA 2BALA 4UB7A 4EYMA 4HCUA 2QR7A 5J8IA 3LAUA 3DAKA 5I3RA 2UZTA 4I4FA 4E73A 3COIA 1NXKA 3B2WA 4MNEB 3MDYA 2PSQA 5JN2A 5L8JA 4KBKA 4M13A 4ACCA 2B53A 4XCUA 1BI8A 3GGFA 4Y5QA 1IAHA 2Z60A 2PVYA 4XBUA 3ERKA 5HBEA 3RCDA 4XG8A 3FYKX 4B8LA 2V62A 3LFDA 4R7HA 3ZXZA 3JVSA 2YM7A 5IKWA 4F6WA 5KCVA 1XJDA 4EH2A 2PUNA 2OJJA 4AUAA 2WQEA 5DIAA 5EG3A 3IDCA 3A2CA 4F70A 4R8QA 1YXTA 5T68A 5DE2A 2CKOA 1V0PA 3ZRMA 4EQCA 5FEDA 3RGFA 4DLIA 4KINA 2ZB0A 3PWYA 2QOHA 3TEIA 4CTCA 5C27A 5E8WA 4MQ1A 3RPYA 4AW1A 4QMUA 2H6DA 2B55A 2C6MA 4R1YA 3PSBA 2CSNA 4MCVA 4QNYA 4RVLA 5A54A 4C57A 4RWJA 4U41A 2WGJA 3MYGA 3HL7A 5EQPA 3ZSHA 2NP8A 2PYWA 2W05A 5EOLA 2YAKA 4RQKA 1OBDA 4HYHA 3AC1A 5FEQA 3AC4A 4MAOA 5FLFA 4AE9A 4B8MA 5J9ZA 1OPLA 4I4EA 2WOTA 3GQIA 4FYNA 5J5SA 3AOXA 1QCFA 3AD4A 2GMXA 1LPUA 5G6VA 5E8XA 4ACDA 4R7IA 3OHTA 2HY81 3NAXA 4JX3A 4PNKA 2WTKC 4GVJA 3E64A 3R21A 1MRVA 3E63A 3TDWA 4XNEA 5G1XA 3ZSIA 1H1PA 4AN3A 1YKRA 4EK5A 5HKMA 2LAVA 3ZO1A 3EQPA 3GC0A 4E4LA 4U80A 2R64A 3HECA 3QZFA 4ANOA 4A9SA 1Q24A 3PIZA 4DF3A 4L46A 2BAJA 2IZRA 2JDSA 2R3HA 3H10A 4HGSA 5IQCA 2IW8A 3HMPA 3R2YA 3HRBA 2YCRA 5CXHA 5AM7A 1M2PA 5EW8A 3V04A 4F7NA 4BDKA 4O7RA 4YPSA 4J98A 2G9XA 1STCE 3SVVA 4RIYB 3OFMA 4CV8A 1Q41A 5FQDC 3H9RA 3TZ8A 4CSVA 2OZOA 4O0RA 4RSSA 4HVIA 5CI7A 4B99A 2WNTA 2FSTX 3Q9YA 4XH6A 3AD6A 5ETCA 4MXAA 5I9ZA 3LQ3A 5E4HA 2WMQA 5H3QA 4AGDA 5EM8A 4E5BA 2CDZA 1JNKA 4WG3A 3AGMA 4JQ7A 5LVLA 1GY3A 4QP4A 3UP2A 4AWIA 4ZY4A 3ACJA 4FKGA 4KKGA 2Z8CA 4TYEA 3DCVA 4NM7A 2Y4PA 3NUNA 4F4PA 4F0IA 4FVPA 4N4SA 5GNKA 4RG0A 3RNIA 1YW2A 3LCOA 4HVGA 4H39A 4ERKA 1TQIA 2VU3A 3PPKA 2R3FA 3IK3A 2QOQA 1P14A 2KTYA 3VNTA 2WTJA 3GT8A 4QP7A 1Q5KA 3DNEA 4E7WA 3CQEA 3BZ3A 3PSCA 2C0TA 2OH0E 3KVXA 3U9NA 4F99A 4DYMA 4LGGA 5E1EA 4E1ZA 4I41A 2C30A 2XYUA 3LFNA 5FBOA 5D9HA 2OJIA 1OL6A 3EN4A 4PL4A 4XUFA 4MXOA 2QODA 5CU6A 3HLLA 4CZUA 4GYIA 3G2FA 1WVYA 4W8EA 2PZYA 4FEVA 4HZRA 4CZYB 4BIDA 3VO3A 4IM3A 4FSYA 5A3XA 5HZNA 2DWBA 4D5KA 1KSWA 5M53A 5EHYA 2WU7A 4E4NA 4LL5A 4USEA 4JT3A 5GJDA 2C3LA 2GNFA 5AP5A 2UW3A 3ZMMA 4RVMA 1CKPA 4GG5A 1PXKA 3OW3A 3DDQA 2VTRA 4DGOA 4NH1A 3R7OA 1OKVA 2BAKA 2QLUA 3F69A 4FKJA 3BLRA 2F4JA 4OBPA 2VWIA 4YBKA 4O0SA 3RALA 2UW7A 3L9LA 2QU5A 2UZOA 3EYGA 4BIEA 5ICPA 4WO5A 5L2QA 4HVDA 3G15A 4YZMA 4ZMEA 1O6LA 5M4FA 3LMIA 2VZ6A 2C6IA 2VNYA 3NSZA 3LPBA 1PMUA 3NYVA 4Y72A 3R7EA 3VBYA 1SVHA 4EOJA 4IVBA 3NUSA 4M97A 3RBWA 3BV2A 4D2RA 1H28A 4OTHA 2QC6A 5JMSA 3ZO2A 4PDOA 3FHIA 4PTCA 1J7IA 2H8HA 1M2QA 2PVRA 2UZEA 3FY2A 2GPHA 4I24A 4L6QA 3VS2A 1GJOA 3OWJA 2VD5A 4K6ZA 1CDKA 4PY1A 3HV3A 3DK7A 3CXWA 4L67A 3W8LA 4UWCA 1Q61A 2VTIA 5AP6A 1KWPA 2W1IA 4E6CA 5FM3A 4X3FC 5M57A 1R78A 5HD4A 4O7LA 4MBJA 4NIFB 4Y85A 5BVNA 5FUTA 5HE0A 4BBFA 5CLPA 1IR3A 4XYFA 2ITZA 2XK4A 5LVNA 3KKVA 3QQKA 3IONA 4RJ8A 4D0WA 4EH4A 2OSCA 2VAGA 3ULIA 1Q4LA 3V5JA 2YM5A 4J71A 1R39A 3FLSA 3NIEA 4ZIMA 5K4IA 4FGRA 4O7SA 4AX8A 3KRXA 4L9IA 3VS4A 1KE5A 2C4GA 1YXVA 4EBWA 3OW4A 2V55A 4L68A 1PMNA 1XH7A 3ALOA 3TKHA 3EH9A 4B9DA 3OP5A 3EQCA 5BVWA 3FLQA 1LUFA 2YCQA 4GJ3A 5IZFA 2YM3A 4OR5A 2QVSE 2Z7SA 2I0VA 4DEBA 5CTPA 4OBQA 3KXNA 3CD3A 4TY1A 4NM5A 4RJ5A 3V5QA 5L6PA 4G16A 4WRSA 3OCBA 5CNNA 3CPBA 1REKA 1YHWA 3QQJA 4K1BA 4QNAA 2A2AA 2X0GA 3TN8A 1J91A 3UVRA 3UYSA 4RA4A 5KKRC 3KCFA 4TYIA 5L3AA 5HLWA 3COKA 2F7EE 3PP0A 2C5YA 4QP1A 4IBMA 2EB3A 4EH8A 3TUBA 3ORKA 5HG7A 4JX7A 5HI2A 4QOXA 3TZ9A 3I0QA 4O91A 2BILB 3RM7A 5KBQA 3L9PA 2HZ0A 3ZLSA 2VTQA 4L44A 5KMOA 3QAME 4A9RA 3GCUA 2F7ZE 3ZBXA 3VBQA 4FKUA 4BIBA 2R3RA 1W83A 5ETAA 3AC3A 3EKNA 2WMXA 2XBAA 3D4QA 3EQGA 4OW8A 4RIWB 3T9TA 1SYKA 4AGUA 4R6VA 5J5TA 3R8UA 4TZRA 2X2LA 4IM0A 3BIZA 1G8SA 3BYSA 3R8PA 4DE4A 4UMTA 4F0FA 1Z57A 4FV2A 3RHXA 5GZ8A 4KB8A 1XO2B 2C1AA 2X8IA 4LFIA 4ZLYA 4BI2A 4GFMA 3BLHA 4RVKA 1SVGA 3ZC6A 4U3YA 3DK3A 3F7WA 5IG1A 4JBOA 4BZOA 2VGOA 5DGZA 3F88A 5ANOA 4G3FA 3FZPA 2XM9A 5AX9A 3KXXA 1JAMA 4XG4A 3MH0A 4G3GA 5IISA 2P55A 3U4UA 5L2IA 4N57A 4RC2A 4IAFA 5AV3A 3S3IA 3TV7A 2Q83A 4DTKA 5HO8A 3QXPA 4XS2A 4ANSA 4PPCA 4KD1A 3SRVB 3CY2A 1U5QA 4JDKA 4QQ5A 1VR2A 4N6YA 2YIXA 3QD4A 1R3CA 3PRFA 2XF0A 3FZ1A 3QCXA 5AV4A 4AZVA 4I21A 3QX2A 4FIHA 4HJOA 4AFEA 2QNJA 4YLLA 5AADA 5I9YA 5K9IA 3CY3A 4LRMA 4GT5A 4YJQA 5CAVA 4IANA 3PZHA 4DLJA 2GFCA 4ZS4A 3EQIA 4M12A 3LKMA 2C3IB 2ZV9A 3QXOA 4W4WA 5HNBA 3PFQA 3ZUVA 4IFGA 1FINA 2IO6A 4QMNA 3FSFA 3UODA 3FE3A 2BZIB 4XG7A 3AD5A 4JG7A 3NS9A 4QPAA 5HNGA 4QYHA 4ASZA 4I1ZA 2WU6A 4E26A 4APPA 3F7ZA 3FI4A 4FV9A 3OROA 4RRVA 3WIGA 3LFEA 4CFMA 4IXPA 4I6HA 2OF2A 3DBCA 1H0WA 4OLIA 2ETKA 5B7VA 5CX9A 4AACA 2WMBA 3CGFA 4PWNA 2GQGA 4AZEA 2UW4A 4IE9A 1OL1A 4F1OA 4PMPA 2IPXA 4BDDA 4D58A 1JWHA 1XHAA 4WNMA 3MSSA 5J79A 2YFXA 4UXQA 1JSUA 2HOGA 2X7FA 3E92A 4R3CA 2ETMA 2WELA 2OH4A 5AR3A 3UZTA 5JH6A 4ZP5A 2XRWA 2XNPA 5B0XA 2HZNA 1GIHA 2VTAA 3GU6A 3L8VA 1BMKA 2QO7A 3HV7A 2C69A 2PK9A 5M56A 3U55A 2JBOA 5K5NA 5K5XA 4IJPA 3VUDA 5IA0A 3TCPA 1Q8WA 4HCTA 4QT1A 1MUOA 5E90A 4CNHA 4L3JA 3MTLA 3OEZA 5HE3A 1TQMA 4Z9LA 1M2RA 4BDGA 2YLFA 4BRXA 2Y4IB 2HYYA 4MD8E 5EHLA 1FVTA 2CN5A 1R1WA 2OGVA 5E8UA 3VBWA 1Y8YA 3VRYA 3S1HA 5DRDA 3OBJA 2WHBA 1TVOA 5ITAA 3BLQA 4YZCA 3R28A 5GIOE 4ZTLA 5GIPE 2QU6A 3P0MA 3KF4A 3PJCA 1OIRA 2W1DA 1U59A 3R02A 2HELA 4BN1A 5FRIA 4V01A 4EWQA 2FUMA 2XM8A 4KIKB 4XRLA 3WZJA 3MB7A 4BZNA 3MVHA 4NJDA 4CKIA 4CXAA 2HW7A 3IO7A 2VTPA 4ALWA 4Q9SA 5IQAA 4JIKA 1H4LA 4XRJA 2PVKA 4QMLA 3WOWA 3DBDA 3ACKA 5AA8A 3HRCA 3N51A 4U7ZA 1ZLTA 2XA4A 3HEGA 1OIUA 2I1MA 3ET7A 3KGAA 4W4XA 4WBBB 3VW8A 3VRZA 2PY3A 3R9NA 4QMQA 4AOTA 4DEAA 4GMYA 5CAUA 4MX9A 4XMOA 5IQFA 3WF5A 3GNIB 4JI9A 1OPKA 3FYJX 2G01A 3WF9A 4XV3A 4V0GA 4YJNA 4IVDA 1TQPA 3UNZA 3MS9A 5A4EA 3DKOA 1OUKA 2J6MA 4G17A 3HP5A 3F9NA 3BELA 1ZAOA 2RFSA 5AR8A 1KE9A 4WD5A 5BPYA 2DYLA 3TNPC 3IKAA 3QCSA 4PRJA 1PXJA 1IRKA 3QTUA 2OLCA 5JEBA 3E8NA 4W9WA 2R7IA 5EYDA 4F64A 3ZLWA 1Q97A 3I60A 3QUPA 3RVGA 4JRNA 3KULB 1KOAA 2JDVA 5EK7A 1IA9A 4FK6A 3KXGA 2C0IA 3E8EA 3G5DA 4U5JA 3D5UA 5AP0A 3IECA 4I0RA 4AU8A 3HDMA 4D0XA 3ATSA 4FV4A 4IB5A 3VQUA 3NW5A 3FHRA 3VS6A 4AF3A 4KUJA 3AT4A 5EW9A 5HICA 3R0TA 2W06A 5JRQA 4P7EA 5AP2A 3TXOA 5AV0A 1YVJA 3ZTXA 1ZY5A 3NW7A 2HW6A 3Q5ZA 2VO7A 2YA9A 4MF1A 2BDWA 2QO9A 4DH1A 2PULA 3SQQA 2BROA 4R3PA 2WMTA 3U51A 4Y8DA 4L00A 4IM2A 4QTAA 5CQWA 3RAIA 3MFUA 3TG1A 4BWKA 4PP9A 3UPXA 3VN9A 2XNBA 3VJOA 4F9WA 2LGCA 3FXZA 1Q8YA 4QP3A 4FEWA 3S95A 3HVCA 3AGLA 3FPMA 1NA7A 4O2ZA 4X2NA 3SLSA 5C4LA 5A4QA 4C4EA 5IA2A 3A8XA 4QMTA 3RPRA 2WIHA 1YOJA 2QQ7A 4O6LA 5DMZA 4APCA 2XCKA 3PPZA 2YIYA 4FTQA 3DXNA 2BVAA 4C3PA 5E91A 3M11A 4J96A 4MTAA 3KREA 4USDA 2FA2A 3KC3A 4FT9A 4WNPA 1OI9A 5CI6A 3VULA 4X3JA 1Z9XA 3DLZA 3FSKA 4HPUE 3IW8A 3UC3A 1PHKA 2WXVA 2Z7RA 3MW1A 3H3CA 5BVEA 2EVAA 1KV1A 2XNMA 3BX5A 4RZVA 4CRLA 4YHJA 3WBLA 4JLCA 3GI3A 3RPVA 3W2QA 1GAGA 3SW7A 3UVQA 3W33A 1CSNA 4R3RA 3UQGA 1H1WA 1J1BA 1YXUA 2QHNA 3HZTA 4CD0A 4K18A 2W5AA 2WO6A 3FPQA 4IZ7A 4EH6A 3UZRA 2X4FA 5HCZA 3KL8A 5JFWA 2J5FA 3A7IA 3A8WA 4JNWA 4PUZA 3OD6X 2JFMA 2Y4IC 5J1WA 5T3QA 4BTMA 3RAHA 3A99A 3QKMA 4GUBA 4AE6A 4AN9A 4BF2A 3BBTB 2FVDA 3AMAA 3HMIA 4TXCA 2X39A 5K0KA 3DZOA 3QCQA 3TNWA 4O96A 2BR1A 2GFSA 4OGRA 4C2WA 3KVWA 3R1NA 3VBTA 3UVPA 4D1ZA 1XR1A 2QLQA 3HKOA 3OCTA 5TOZA 4O22A 3A4PA 1ZYCA 1PRYA 1JPAA 4QPSA 2CGVA 2WPAA 3HA6A 2I0HA 2ESMA 4DHFA 4I20A 5CEMA 4J99A 4M69B 4Z16A 5I9WA 2QG5A 4TWCA 3OOGA 3UGCA 4A7CA 5J9YA 4C62A 2JDRA 2JD5A 4RWIA 5C8MA 4QTEA 4BI0A 3FL5A 4AA5A 4E6AA 3RHKA 4ORKA 4FKRA 3VVHA 4YUQA 4ZJIA 1OKZA 4FIIA 4Y73A 4G2FA 4QQJA 5KMIA 3D2KA 4DFNA 3VHEA 4WNOA 5FDPA 5D41A 2XK6A 2NRYA 2EB2A 3LFAA 2A27A 4XG6A 3R00A 4MD9E 4AT4A 2E9NA 4BKZA 4TTHB 3VS3A 5K4JA 4LQMA 3U54A 1I44A 1PXPA 3QUDA 4IAAA 3PYYA 1OECA 5CYIA 3OT8A 3QQFA 4UXLA 3WE8A 2GNGA 4GKHA 4ZTQA 2W9FB 4IWDA 3R8VA
chains in the Genus database with same CATH superfamily
4JG6A 4LI5A 5LWMA 3O8UA 5TT7A 5BX0A 4HVSA 2CGWA 5IEYA 4WUNA 1ZWSA 3KN5A 4D28A 2P2IA 4GK3A 3PIYA 4GT3A 4BCQA 3QX4A 4MXZA 4LOQA 3RP9A 2VWYA 3QTRA 1XH8A 5AV1A 4RFYA 4Q5HA 5LMBA 2CKEA 5CU2A 4GV1A 3BYVA 4AAAA 4H3QA 5A6NA 1NVQA 4EK4A 1A9UA 2IJMA 1YI6A 2QKWB 3PLAE 5HLNA 5JQ8A 1ZY4A 4NCTA 4WA9A 1XH4A 4QMPA 4W8DA 4A06A 2UZUE 2IVTA 4BYJA 3NUPA 4O82A 1GIJA 4O0XA 4ASXA 2QR8A 5LMKC 4BCFA 5HD7A 1X8BA 4NT4A 4EKLA 5EM7A 1FOTA 2HK5A 4DTAA 3NNXA 3Q96A 3W2CA 3LXNA 3W2RA 5EM5A 5HCXA 2XB7A 5H2UA 3RI1A 4D2PA 4N70A 2WTWA 1YDTE 1TKIA 3F2AA 4QYGA 4X3FB 3OMVA 5DT0A 4DFBA 2YAAA 4RIXA 4F0GA 3GFEA 4GSBA 4IDTA 4N6ZA 4QRCA 5HU9A 2VN9A 3EFWA 1LP4A 3FZOA 3NUUA 4BB4A 4XG3A 4CT1A 5AAEA 5ANIA 4TRLA 4AXDA 3QHWA 3R9OA 4JR3A 2IWIA 4MHAA 4C4IA 2OZAA 3MFTA 3BRBA 4D55A 3DU8A 4L43A 4MH7A 4YMJA 1RE8A 5CVFA 4PMMA 5AJQA 4NJ3A 4RJ4A 3SXRA 3COMA 3FMDA 4A9YA 3O7LB 1XKKA 1VYZA 2O63A 3JYAA 1V0OA 1O6KA 5CZHA 4H1JA 4A4OA 1DM2A 2WB8A 5CEOA 5J87A 2ZV2A 1GOLA 4RIXB 3ZFXA 2YM4A 2VWZA 3FUPA 1BI7A 3TJDA 3D5WA 4IHPA 4AA0A 4YO4A 4NKAA 1PKGA 4DH3A 3DXPA 3P5KA 4XP3A 3TL8A 3SGCA 4BGGA 2FH9A 1GZNA 3QTWA 3E8DA 1XH6A 2F7XE 3EQHA 2XH5A 4IACA 5HU3A 5IQEA 2ITNA 2I6LA 1PKDA 4JBVA 4EYJA 2XIKA 4U43A 2PZIA 5KUPA 5C1QB 2BCJA 4GVAA 2QURA 2FO0A 3BBWA 3UE4A 4J8NA 2ONLC 3W2PA 1H07A 1J1CA 2W1EA 5AP3A 3OOMA 3UDZA 3MGYA 2VUWA 2C3JA 2OKRA 3IW5A 2PWLA 1XBAA 5L4QA 3ZOSA 4FTKA 3BQRA 2XANA 3HAMA 3L9NA 2W96B 2PVHA 1JKKA 3BGZA 4J53A 3GUBA 3ODZX 4FVQA 4D1SA 4E5WA 5CF8A 1ST0A 4CG8A 3MBLA 2WTKB 1YI3A 4ZTNA 4K2RA 3FZRA 4XP0A 4C59A 4EZ5A 4O38A 3LCDA 4KAOA 2PUIA 2R9SA 4JJRA 5TR6A 3TI1A 3D5XA 3ZSGA 4ANQA 4ZEGA 4F65A 1SNXA 4AGCA 4EKKA 4KBAA 3WIKA 4NEUA 4L52A 3BI6A 4QP9A 2R3LA 3OTUA 5CWZA 4ZAUA 3W55A 2WTDA 3BL9A 3LQ8A 4FKTA 3QL8A 4ENXA 3UIUA 4AP7A 2GS2A 5HNIX 3Q2MA 3EN9A 4WIHA 4BDJA 1E9HA 1OGUA 2EXEA 2IW9A 4AXAA 4F78A 4P5ZA 4JG8A 4O4DA 5HO6A 1ZMVA 2YIWA 3EMGA 4TPTA 3RM6A 4PDSA 5FM2A 3UYTA 4EK3A 2QI8A 3C9WA 4QP6A 4F9BA 4RX7A 4FV5A 3RAWA 5M4CA 4ANMA 4EOPA 3PXRA 3LLTA 3R71A 1IAJA 4E20A 4BDCA 3DZQA 4L01A 5AR2A 3S4QA 4ERWA 2Q0NA 1OB3A 4KIOA 3F2NA 4FIEA 2PL0A 1J7LA 2BRMA 4BDIA 3D15A 4LRJA 3F3TA 3UG1A 2CKQA 2WAJA 1BUHA 4IEBA 4GCJA 5DPVA 4BDBA 5AUVA 4BCHA 4ZLOA 3ZHPC 5M07A 3RZBA 1O9UA 2CGXA 3AT2A 2WQOA 3JY0A 3Q04A 4I23A 1WBTA 3DJ6A 2R4BA 1YXSA 4M8TA 5AIKA 4RFMA 3AXWA 2OBJA 4FSZA 1Q62A 3H9OA 1J3HA 3SXFA 4YJSA 3ORXA 4ZY5A 3W8QA 4J1RA 3PVUA 2QD9A 3Q9ZA 4CZTA 5HGIA 3PUPA 2ZYBA 2B0QA 4G6OA 3VUGA 5HTBA 3ZUUA 3QGWA 3QRJA 5AUZA 4GEOA 5KMMA 3D7TB 3W0MA 4JQEA 2UW5A 4FKLA 4BCJA 3OZ6A 1H01A 3RWQA 3GU7A 2C0OA 4RLLA 4S30A 5DG5A 4ANLA 5ACBC 2C5VA 3FXXA 4PNIA 2VNWA 5J1VA 3R2BA 1SNUA 3UP7A 2W5BA 4EQMA 2OXXA 4IJ9A 2W99B 4H3BA 4EI4A 2DQ7X 5BYLA 1BYGA 4EH3A 1PW2A 2O65A 4O1OA 4GJ2A 3I0OA 4DG3E 5HHWA 4HVHA 3GU8A 3R7YA 4CEGA 4RIOA 2VRXA 5C8NA 5DYJA 3I7CA 4IIRA 4D1XA 3RPOA 4GL9A 2B9JA 1LEWA 4JBPA 4QTCA 2XKFA 4ZS0A 1TZDA 3OC1A 4U44A 3ZO4A 5CU4A 2JITA 4M0ZA 2R3QA 2VTMA 3N4UA 4FNXA 3E7OA 3GBZA 4FSNA 1I09A 2RG6A 3LXKA 4FZ7A 2WEVA 4HOKA 2A4LA 2R3PA 3EYHA 4ITIA 5EW3A 3RK5A 4F1MA 2VX0A 5EYCA 1QPCA 2E9UA 4FI1A 4UV0A 4DT9A 3BU6A 3MPTA 4FJVA 4TWNA 3LJ2A 4D4SA 3LFQA 4EHZA 3G33A 5CXZA 4FEQA 3VUTA 5CZIA 5IUHA 1VJYA 4U40A 2ZDTA 1JKSA 4BWXA 5GJFA 3QKKA 3C13A 3NYNA 2QOOA 4CGAA 3ENMA 3QZIA 2X1NA 1U5RA 5F20A 4UWYA 4YSMA 3OTVA 4M14A 4NKSA 1GZOA 3EB0A 1H1RA 3FKLA 4HPTE 4YP8A 5D10A 5I9UA 4FSQA 4IAKA 4KIPA 3FMMA 4LOOA 2I0EA 4PX6A 3C1XA 2OZAB 5AP7A 1H1QA 4RWKA 5E8TA 4DH7A 3PA4A 5EYKA 4ZSGA 3IOKA 1F3MC 3EN5A 3VS0A 1Q8TA 4CFFA 4MNEA 4X6RA 5CSVA 3PDTA 2RSVA 4AN2A 3VUIA 4BCNA 2C6KA 4V0GB 1CKIA 4FA2A 4AQKA 1SZMA 3NNWA 3PRIA 4CFWA 3VBXA 4FZAB 3VUKA 5A14A 1GZKA 2OI4X 1Y91A 1P4FA 2QKRA 2VWBA 3R1QA 4I6QA 4NM0A 3FMEA 3QTXA 4OTWA 2XNEA 4FTAA 3GOKA 5CANA 5IQHA 2IN6A 4RIWA 4DTBA 1OITA 3UDSA 2GS7A 4WG5A 3TYKA 3L8PA 4GRBA 4YJOA 1QMZA 5K3YA 1FVRA 3EL8A 3D9VA 1UKHA 1PXIA 3ZEWA 1W0XC 3F2RA 1WVWA 3CGOA 3DB6A 3QLGA 4FV1A 5K0XA 2BFYA 4UX9A 3R73A 4C61A 3R1YA 4FE2A 5DH3A 4YSJA 1OKYA 4UMQA 3P86A 2VTLA 3FKNA 4U6RA 4II5A 5CSWA 5DBXA 4BCOA 1ND4A 3PP1A 1BX6A 4GFGA 5D12A 5I4NA 3ZLYA 5CF6A 1QPDA 1FBNA 1JLUE 1ZZ2A 5IA4A 3MA3A 3MIAA 3RPSA 3D7TA 3LM5A 4O27B 3VWAA 3GB2A 5M51A 3DB8A 4NL0A 4IWOA 4PL5A 5HIDA 1YHSA 5FTOA 1UWHA 3PA3A 5JQ5A 3LZBA 3S0OA 3O51A 1SM2A 4XEYA 4D2SA 2JGZA 5JFSA 3RCJA 1AGWA 3NLBA 2JIUA 2PUUA 4BDFA 5LMKA 3VJNA 5AUYA 4C35A 3P4KA 1KE6A 1LEZA 5HO7A 5BMSA 4ALUA 5CEIA 1DI8A 4HW7A 4YZNA 4G3CA 4MEDA 4C7TA 4I3ZA 2WMWA 3PE1A 5BVOA 3UNJA 3CTHA 4E4MA 3QWJA 1TFFA 2XEZA 3PJ1A 2BIKB 4FV3A 2P0CA 2IF8A 4MWIA 3IW4A 3Q2JA 2HIWA 1REJA 3ANRA 2YZLA 4LM5A 4A07A 1H0VA 4KWPA 1B6CB 3F5XA 4FSUA 4YC6A 5AV2A 2WMUA 4I5PA 2CMWA 4WSQA 4J8MA 3UOHA 1UA2A 4O7NA 4F7JA 2WMAA 4ZK5A 3SXSA 3H0YA 3PVGA 5DHJA 3VAPA 3KU2A 2CCHA 3CQUA 5GZAA 3KMMA 3R7IA 2C47A 5ANEA 4AZTA 5CT0A 4K0YA 3QC4A 3JVRA 2XJ2A 5J7BA 5GZ9A 5AR4A 3CKWA 1VZOA 3ORMA 2BUJA 3KULA 4BI1A 4Q9ZA 3VUHA 3FDNA 4IX5A 4AXCA 4Y46A 2PPQA 1FQ1B 5EH0A 5IQIA 5L8LA 4I6BA 4FK3A 3D83A 4WBOA 3WZKA 2IG7A 3OT3A 3QTQA 4O83A 2ZVAA 2PU8A 2PZRA 4XX9A 4EJNA 3C0HA 3F3VA 4FUXA 3MFSA 4ZTMA 5LWNA 4BL1A 4ACGA 4CFVA 2JAMA 4IAZA 4LMNA 3UJGA 4GW8A 2V5QA 4C4JA 4FKPA 3PY3A 4D4RA 4FKWA 5TF9A 4KSQA 5M55A 3KEXA 4TYHB 4OTFA 5IMXA 2JKKA 4QDEA 3UDTA 3HRFA 4O7WA 2BZJA 3FLWA 3IGOA 4EORA 3LFCA 4FYOA 1M14A 2CN8A 2HZIA 2JIIA 4JR7A 3V5WA 4AT3A 2XAMA 4M68A 3PA5A 3GFWA 3C0GA 5A4TA 2W4JA 1V0BA 4KIKA 5GHVA 2OO8X 2ETRA 4OTGA 1U46A 3ZFMA 3WF8A 3CQWA 3AQVA 4FVRA 1UV5A 2UZVA 4M7IA 1W7HA 2AUHA 2XKDA 4ZSAA 3O2MA 5AWMA 4CTBA 5KNJA 3U6IA 2PMIA 4DGNA 5J95A 5DN3A 3UMWA 3ZDUA 2R0UA 3I81A 3JY9A 4NTSA 3NR9A 4FSWA 3AC5A 2OJ9A 5DNRA 4NFMA 4AA4A 3NVKI 1M7QA 2V22A 2BFXA 4RJ6A 4BCIA 3FLNC 2CKPA 3LM0A 1OMWA 3EQDA 4YNEA 3QYZA 4D9UA 4CLJA 3FEGA 3OXIA 1DI9A 3CLYA 5IEVA 2EU9A 1WBWA 4I94A 4EOOA 3F5PA 3DLSA 3SV0A 4WOVA 5BYZA 4DEIA 1MRUA 4MXCA 2YEXA 2R3MA 2W4OA 4TNBA 3TUCA 5HTIA 3ORLA 4CCUA 2WMSA 2VO6A 4YR8A 2ACXA 3H4JA 2QOBA 4EH5A 3CEKA 4FT0A 5E8ZA 5FXRA 3TIZA 3FBVA 4YPDA 4FTMA 3QHRA 2BHHA 2ITPA 5AMNA 3TTIA 4ASDA 5D11A 5CSHA 3ZZEA 1U4DA 2G1TA 3CE3A 1UU8A 3K5UA 4GIHA 4L3PA 3C4XA 2UVYA 1HCKA 4R78A 3MH3A 2PMLX 4GUEA 5AUXA 2X7OA 3TJCA 3G6GA 1WMKA 2BPMA 1UNGA 3B8RA 3PLSA 4DFLA 2NYAA 2OICA 3QWKA 4C4GA 1ZOEA 4BICA 3LOKA 2GNLA 3UO5A 2FSLX 2ZMCA 3E8CA 4JMQA 4C02A 5L6OA 4L45A 2QO2A 1YWNA 4D2VA 3B2TA 4E6DA 3H0ZA 5CNOA 2UZWE 4H1MA 3JUHA 5IDNA 1L3RE 5KZ0A 5CY3A 4B7TA 4IVAA 3AG9A 4WRGA 4CT2A 2CHLA 4HGEA 5JFXA 1EH4A 2PMOX 3LFSA 5BVKA 1ATPE 3FXWA 2BHEA 3Q4UA 4ZY6A 4JAIA 4UZDA 3T3VA 3NUAA 5CAOA 3EZRA 2J4ZA 3B8QA 3H30A 2CNVA 4FR4A 3D14A 3U4WA 1WBVA 3MY5A 1G3NA 2XNNA 4U8ZA 3BV3A 4FSRA 1DAYA 4UEUA 3LE6A 5C03A 3RINA 4CKJA 2B52A 4YZDA 5HCYA 1UKIA 3DY7A 3QGYA 4D2TA 3O8PA 4F08A 1H27A 4I5CA 4PTGA 1OBGA 2QOFA 2A0CX 3SX9A 1WAKA 2BDJA 2W5HA 2O2UA 3FI2A 5CEQA 3MJ1A 1ZRZA 4EUUA 2PE1A 4H58A 1WBOA 2ZOQA 5D7AA 5ETFA 1T46A 2XUUA 4IB1A 3UDBA 2VO3A 3GCSA 3Q4ZA 5AUTA 2PE0A 4EOKA 2B9IA 2FB8A 3QRUA 3P79A 3THBA 3PWDA 2F2CB 3BWJA 3TZ7A 2BKKA 4ACMA 3HUBA 5B2LA 3HMNA 4MYGA 1ZMWA 5BVDA 1UVRA 3QTSA 1YHVA 1R0PA 2YIRA 1G5SA 3CCNA 2JC6A 4PDPA 5HG8A 4NYEA 4FX3A 4QMSA 4EH7A 3GENA 5AUUA 5KMLA 4CMOA 3MWUA 2Y6MA 3DKCA 2I0YA 3F3UA 2OWBA 2P3GX 3W16A 1WZYA 4UN0C 4BTFA 2E2BA 5DFPA 4CLIA 2JFLA 2YACA 4FUYA 4FZDB 4NU1A 1L8TA 4PP7A 4AZFA 3V8WA 3NEWA 4FOCA 3EIDA 2ITVA 5I3OA 4NW6A 3R22A 2O64A 3NX8A 1ZYJA 4FMQA 5HG5A 5KZIA 2YDKA 4FV7A 4F6SA 1XH5A 4DFYA 3QD3A 1NVRA 5CSXA 3FAAA 3V3VA 4RBLA 4MVFA 3NRMA 5L2TA 3BGQA 3SAYA 2UUEA 4DN5A 3Q6WA 4X2KA 3ULZA 3OWPA 5BMMA 3JR1A 3O7LD 1GIIA 2XBJA 1H26A 4M67A 3EQRA 4MXXA 3UIXA 3F5GA 5JZNA 3W0OA 5TO8A 3D5VA 5E8VA 4FIGA 4K8AA 4KSPA 1B38A 3V8SA 3W18A 3R9DA 2VTTA 4W4YA 3S2PA 4RX5A 3QTZA 2FSOX 4FNWA 3BQCA 4ITJA 3L8SA 3ZZWA 3ZC5A 5DT4A 4GK4A 5HORA 5M4IA 5M08A 2ZJWA 4J52A 2AYPA 3ODYX 3JXWA 4RC4A 4EH9A 2XVDA 1CTPE 1WBPA 4TWOA 2JDTA 3IGGA 4AOIA 5JKGA 1BL7A 1E1VA 1PY5A 4IMYA 1JOWB 4M84A 4D9TA 5HQ0A 2OFVA 2ITQA 3QCYA 1M7NA 5E7RA 5HOAA 3VS1A 4AFJA 3HYHA 4TN6A 5EKOA 3WILA 4DAWA 5BUJA 3BYOA 4QPMA 2E9OA 4PMSA 4JVGA 4R5YA 2J0IA 1OPJA 3LXPA 3PXZA 1H24A 4CV9A 4WG4A 4UYNA 4IADA 5DT3A 4G34A 2A98A 3PXQA 4YC8A 3R7VA 3ZU7A 1S9IA 2C6EA 4CYJA 2XJ0A 3KRLA 3C4CA 3QU0A 5DR2A 4OTDA 4FKSA 4R7BA 4NWMA 3VQHA 5IH5A 2W0JA 4O0TA 5ANJA 2RFEA 3DS6A 4ZJVA 5CS6A 4EK8A 4G1WA 3C4EA 3JPVA 4GG7A 5C01A 5AIRA 4EEVA 3FMKA 3DKFA 3PG1A 4AXFA 4M3QA 2DS1A 2GHMA 3OXTA 3W0RA 4BZDA 5A4CA 3P9JA 1ZOGA 4F7SA 3K3JA 4D2WA 1Q99A 1ERKA 2Y9QA 3ZM9A 3CPCA 1PXNA 3QQUA 5HBJA 2J0JA 4PTEA 5KMKA 2HENA 4OBOA 2WMRA 5HX6A 3FLZA 4AT5A 1W2FA 3L1SA 4MNFA 4X7QA 2R3IA 3DBEA 4DFUA 1PMEA 3BGPA 2C6DA 3IW7A 4UALA 5B2MA 2HWOA 1YRPA 4QYFA 3C5UA 2W1FA 4YJUA 4JRVA 3TNIA 4FSMA 1APME 2B54A 2J51A 4O4FA 3UIBA 4QTBA 2IVSA 1S9JA 4QMXA 1PXMA 3OBGA 5A46A 3FQEA 3MH1A 4DG2E 3LCSA 2RG5A 4OTRA 4FTOA 4RPVA 4E8AA 3KN6A 4FKOA 4GS6A 3EOCA 3QTIA 4FTIA 4RVTA 4W4VA 1JVPP 2RFNA 3PJ8A 3CKXA 3P08A 4CFXA 5M09A 4TW9A 1UU3A 3NYXA 5D1JA 2IZTA 3MY1A 4P90A 3BU3A 4G31A 3E62A 4O7TA 4U45A 2OFUA 3CC6A 4FNZA 3POOA 3PZEA 5KE0A 1WFCA 1KE8A 5J9LA 3PG3A 4RX9A 4C0TA 5DOSA 5LXMA 3FZTA 5C4KA 3HA8A 3I4BA 4I6FA 5ANGA 3Q5IA 4QMOA 4FTTA 1M52A 4RT7A 4PDYA 3QZGA 4FTCA 2CNUA 2PMNX 3NYOA 1G8AA 4QYYA 3TIYA 3M2WA 4DITA 5F1ZA 3UTOA 3UOKA 2GNHA 3MPMA 3NNUA 3MVMA 3PPJA 3WF7A 4DG0E 3SOCA 2CJMA 1UNLA 3EN6A 3IDPA 3Q53A 3T9IA 2G2HA 4D4VA 2J90A 2XYNA 4MKCA 1KE7A 4X21A 1Q8ZA 2GDOA 4UMRA 4H05A 3C51A 4DBXA 2PHKA 1A48A 2VV9A 3F6XA 3MIYA 2XMYA 3W2SA 3WZUA 3GQLA 2V7OA 3BYUA 4F1TA 3EHAA 2C5XA 3K54A 3WF6A 3ZM4A 4FODA 3V5PA 4YTIA 1YWVA 3EFKA 4NZWB 4D4YA 1BKXA 3QC9A 3ORZA 3ZXTA 4CMUA 3VUMA 2RL5A 2BRNA 1OM1A 5FTGA 2Y8OA 3DOGA 4TYGA 3R30A 1ZARA 1Y8GA 3P1AA 4B6LA 2F57A 1IEPA 4NFNA 3TT0A 4BYIA 5EHOA 5CEKA 4QP8A 3LFBA 2WFYA 4I92A 4TKSA 1FMKA 2CNQA 2G15A 5CU0A 3EQBA 3FL4A 3FMHA 4IC7A 4MF0A 3PXFA 3VW6A 4FKQA 3HMOA 4H36A 5DEWA 5CVHA 3VF9A 2SRCA 4RA5A 3DNDA 5JZJA 2UZNA 2YERA 3Q3BA 1PF8A 4F9AA 4YURA 5HVJA 4M66A 4JQ8A 4ZZMA 4CQGA 3ATTA 2GTMA 3FC2A 2X9FA 4X2GA 2Z02A 1OZ1A 3AMYA 4BCPA 4S32A 3Q60A 2WQNA 5CAQA 5BV3A 4HCVA 2QOIA 3QD2B 1H1SA 2NNWB 2UW8A 4MWHA 2FSMX 2X0PA 2OF4A 4DGMA 4XV1A 4YHTA 4EZ3A 2QOCA 3AC2A 3RK7A 1ZZLA 2XIRA 3E5AA 2BDFA 4JBQA 5H8BA 1UU7A 2YJRA 3QQHA 5IMEA 3P78A 5AR5A 5HVYA 1H00A 3DTWA 3LQ5A 4L7SA 3QD0A 3KK8A 3G90X 1XQZA 3QRIA 4JS8A 3QA0A 4KRDA 3A60A 4A4XA 1F5QA 4I22A 4DCEA 3GVUA 3BYMA 3MVJA 1Q3WA 2JDOA 4XOYA 2XAOA 3NIZA 3BCEA 5C8KA 4DA5A 4AZWA 2WTCA 5JT2A 4YTFA 3W2OA 4G3DA 4K77A 4X2JA 4ANBA 1MP8A 4ZXTA 3UQCA 2ITYA 3W10A 2BKZA 4GT4A 2XJ1A 3F3WA 1OL2A 1YI4A 3ITZA 1FGKA 3T3UA 3MV5A 3FQSA 2PVMA 3DFAA 4IX4A 3Q4CA 4S33A 1JKLA 3CD8A 2X6DA 4KS7A 4OTIA 4UY9A 3E3BX 3A7HA 3UIMA 2G2FA 3DA6A 3SDJA 4GKIA 4IB3A 3TTJA 4BJJB 4E3CA 1K9AA 1ZYLA 2F49A 4FTNA 2P33A 4FV0A 3TM0A 4DEHA 5ANKA 2X2MA 4PMTA 5FGKA 1HCLA 5TE0A 3OUNB 3QRTA 4FZFB 4BFMA 5AFVA 2J0KA 4G6NA 4U81A 2JKQA 4YJPA 3R8ZA 4FL2A 3GC8A 2R0IA 2WIPA 1YOLA 5EDPA 2J50A 1NT2A 5IQGA 3A7FA 3WI6A 1WBSA 3W1FA 3E7VA 3HGKA 5DR6A 1B39A 2O0UA 1H8FA 2Y7JA 3IW6A 4Q5EA 4XG9A 3SRVA 3TNHA 1OUYA 5L2WA 4YNOA 2GQRA 3UBDA 2GNJA 2YZAA 3TKUA 3V51A 4FIFA 4S31A 4LYNA 4QMVA 4E5AX 5DI1A 1FVVA 3Q9XA 3ZUTA 1DAWA 4IZYA 5CAPA 2HCKA 3V8TA 3LW0A 3A62A 3PY1A 1ZMUA 2ERKA 3GU5A 4L8MA 4YTHA 4U79A 4G5PA 2PVFA 4WKQA 2P4IA 3AKKA 3OCSA 3NAYA 4EHVA 3MA6A 1PXLA 3MN3A 5LARA 4TWPA 4U97A 4BDEA 2UW0A 3O0GA 5EDQA 1NY3A 2HXQA 2HXLA 2PVJA 4QQCA 1AQ1A 1URCA 2ITXA 2Y0AA 4O2PA 4C8BA 3ZS5A 3NFFB 4ARKA 5DVRA 4R1VA 2NO3A 4FSTA 4ZSEA 3TDVA 2VO0A 3TMOA 1YDRE 5E92A 2H96A 3KXMA 5CT7A 3R1SA 3V01A 2GSFA 2XK3A 3ANQA 4FICA 3GOPA 2C3KA 4YHFA 2C6OA 4BDHA 3CTJA 4NCTC 2YLEA 2AC3A 5BUEA 2VX1A 4O0WA 3S00A 1UNHA 4EC9A 1SMHA 2WQBA 3OY1A 1IASA 4P4CA 4KRCA 1KUTA 4MUQA 3ID6C 5AEPA 4XLIA 3LXLA 1UWJA 3EFLA 3ETAA 5EI2A 5KBRA 3WE4A 3VBVA 3BHYA 2XK9A 3BEGA 3IQ7A 3C4FA 1RDQE 4LV5A 5JK3A 4CVAA 1YOMA 3ZO3A 3QYWA 2QHMA 4FZ6A 4UMUA 1ZYDA 4GIIA 5IA3A 3Q6UA 3FI8A 5IH4A 3T8OA 4Z3VA 4IAYA 2OU7A 2X81A 4G6LA 4LL0A 3NUYA 2OXYA 3G0FA 2Z7LA 3E87A 4FKIA 4WNKA 1YDSE 4LMUA 2E9PA 5A9UA 3O17A 2XKEA 4F6UA 1Q8UA 3SKCA 4L53A 5LMAA 3SW4A 2W7XA 3DFCB 4LDTA 5EQEA 3ORTA 3KRJA 3G9LX 3WARA 3I7BA 5IA5A 4CKRA 4MK0A 5M44A 4TNDA 1IG1A 4GFOA 4FTRA 2IZSA 4EHGA 2VTNA 2XZSA 1A06A 1CMKE 4NW5A 4FL1A 3WYYA 4IC8A 3CS9A 3G6HA 1K2PA 2XK7A 4KBCA 1W2DA 2REIA 3CR0A 3I1AA 4E93A 3W0SA 1U54A 4HZSA 2BAQA 2UW6A 4EWHA 2J9MA 4YC3A 4DEDA 1SVEA 3NDMA 3BL7A 4IZAA 4ONAA 2I40A 4FC0A 2XP2A 2Z2WA 5DRBA 1FGIA 3KB7A 3L8XA 4R77A 3DQXA 4ZJJA 5JSMA 4GK2A 1XMMA 3IOPA 4FBXA 3A4OX 4F63A 1JQHA 3OS3A 4L7FA 2ONLA 3DT1A 3GC7A 5IEXA 2R7BA 4IDVA 4AGWA 3GCPA 4S34A 3P23A 4FL3A 3C4WA 3UO6A 1RQQA 2C6LA 2OJFE 3KRWA 4G5JA 2OW3A 3BHVA 4M15A 1OVEA 3D7ZA 3NUXA 5EI8A 2ZM4A 5IH6A 3LMGA 2GCDA 3UOLA 4YLJA 3WYXA 4CCBA 3ML1A 3OY3A 2H9VA 2R3KA 3MB6A 1MQBA 3EKKA 4XJ0A 4LG4A 2VTHA 3ZDIA 2ZMDA 4IWPA 3SC1A 3VC4A 3QKLA 3NFGB 2FYSA 5EI6A 3LCTA 2R3JA 3QBNA 4XV9A 3SA0A 4RJ7A 5ACKA 2YHVA 3NNVA 4FG7A 5FD2A 4K9YA 2ZDUA 5AUWA 4DT8A 4BKYA 3BHTA 3NGAA 2O8YA 3ENHA 4KS8A 3PE2A 5JGBA 2CLQA 5CENA 4IWQA 3N9XA 3VHKA 4BGQA 1MQ4A 4HGTA 3PJ3A 2B9FA 1UU9A 2CPKE 4J97A 4BHNA 3CBLA 4FGBA 4CFNA 4FEUA 3BWFA 4O84A 2G2IA 2W17A 2B1PA 2OG8A 3AT3A 3EWHA 4RWLA 4BC6A 4AW2A 1G8JA 4RJ3A 3ORPA 4AW0A 4JAJA 4MBLA 4ALVA 2DUVA 4IX6A 4FT7A 5IDPA 5FXQA 3PFYA 4RGJA 5FBNC 5IUGA 5FWKK 4R5SA 3ZLXA 5JGAA 2BTSA 3NWWA 4DFXE 5T6KA 3ZBFA 5DR9A 3ZRKA 5JRSA 3PJ2A 3VS7A 4ZMFA 2QG7A 4HNFA 5B2KA 3NPCA 3IG7A 4YJVA 3TKIA 2HY0A 4UYAA 5LJJA 2X6EA 3OF0A 4PF4A 3EL7A 3C0IA 3GP0A 2WQMA 3FJQE 5BUIA 4KNBA 4RIYA 3ZONA 3KIOC 2UVZA 3SHEA 4U3ZA 3FC1X 2YDIA 3R63A 2JKMA 3FQHA 4FF8A 5E8SA 4O7VA 2WEIA 1Q3DA 2BZHB 3FZSA 3GXLA 2BIYA 4IZ5A 3TNQB 4EC8A 5CEPA 2YITA 2C5NA 3BE2A 4BHZA 3OCGA 5F4NA 4WHZA 5I0BA 3R9RA 4O0VA 4MXYA