2BALA

P38alpha map kinase bound to pyrazoloamine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
337
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDELKILDFGLAATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Prevention of MKK6-Dependent Activation by Binding to p38alpha MAP Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 337
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2005-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2balA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2balA01
3SHEA 4TRLA 2OW3A 4KIQA 1Y8GA 4FSYA 1PMUA 4FTCA 3T9TA 4PPBA 2ONLC 4FEXA 4FEQA 3R22A 4F7NA 3SV0A 3ZCLA 4AN2A 3QWKA 3UBDA 3NEWA 1W8CA 4L42A 2R4BA 3Q04A 3ODYX 4R7HA 4WNMA 4YZBA 3F3UA 4FKWA 1CDKA 4HYSA 4USFA 1OGUA 3KVXA 3LFAA 4OTWA 4RIWB 3I60A 2FSLX 5FD2A 1TQMA 3I79A 5HNBA 2YERA 1IAHA 4L6QA 1RDQE 2X7OA 3P7CA 5KCVA 1IG1A 4AP7A 3NMUF 3KN5A 4IB1A 4BWXA 5CU0A 2X4ZA 4IEBA 3CC6A 5E8UA 4W9XA 2XIRA 1S9JA 4DN5A 4OTHA 4FKSA 4QPAA 1JKTA 4YGAA 2IW9A 3OTVA 4RMZA 4UYNA 3UG1A 5A4EA 3KQ7A 4FSNA 5BVOA 1DAYA 5HX8A 4B4LA 1V0OA 3SVVA 3PVGA 1FQ1B 3CLYA 3POOA 4DFUA 5D1JA 1WMKA 3KRRA 4S32A 3DNDA 3F5UA 3RK9A 3EQFA 2ZVAA 3L8SA 4NEUA 5AR8A 4D1ZA 3M2WA 2EB2A 2F9GA 3KMUA 4ASXA 2WU6A 5EYKA 3JVSA 1G5SA 3KCFA 1XO2B 2PMIA 5IQHA 3S95A 4PX6A 5AAGA 2IW8A 3ALNA 3VRYA 4CFNA 3EYGA 3SX9A 2OJ9A 2XNOA 3P78A 1UVRA 3CGOA 5LXMA 5DWRA 2JLDA 4PMSA 3H3CA 2UW6A 3VUTA 3ROYA 3TV7A 3ZUVA 4XP3A 2OI4X 2XNPA 1AD5A 3MA6A 1BLXA 1GIJA 1VJYA 5I9YA 5HLNA 2CGXA 5I4NA 4H3PA 2X9FA 3O17A 5HO6A 2XK8A 3MY1A 4RVKA 5EM5A 3QTZA 2ZV8A 3C0HA 3ZC5A 4HYIA 2BZHB 3GNIB 4DT9A 3U55A 1ZOGA 3PWYA 4GYIA 3F2RA 5L8KA 1WBPA 2VTTA 3JY9A 2GS6A 3QLFA 4R5YA 2QCSA 4PDYA 3ZO4A 3VS5A 4UN0C 3SDJA 5EHOA 5E1SA 4TW9A 3VF8A 3KA0A 3MH3A 4JVGA 3WF5A 4U81A 3ACJA 3U4UA 2WD1A 2PE1A 4QMQA 1H0VA 3A62A 4DEGA 3RAWA 3FYJX 4QP9A 3BBWA 5IA0A 2J50A 1GOLA 4R5SA 4O1OA 3A61A 3LQ8A 3BYMA 1NVQA 2QONA 4IMYA 2W9ZB 2QI8A 2JBPA 2QURA 3HDMA 3CEKA 3UZPA 3GOKA 3L9LA 3IG7A 2HELA 4Q9SA 5G1XA 3LFQA 3CQUA 3A7FA 2R3LA 4IB3A 1XR1A 2BCJA 2P33A 3F3TA 3LFDA 3DKGA 2GQSA 3KMMA 4JBPA 3KF7A 1V1KA 1ZYDA 2FH9A 3RHXA 2YAKA 3F6XA 5KMLA 1XH6A 3MWUA 3WF7A 4FL3A 3FXWA 4FX3A 3UYSA 3PIXA 5CXHA 5IA1A 4O7NA 2IO6A 3R9OA 3RMFA 2DUVA 3OXTA 2QQ7A 3VO3A 2WTKB 4AOJA 3I1AA 5AADA 4ZMEA 2UVXA 4WRSA 3EFKA 1PXKA 4FZ6A 3SXRA 3ZXTA 2NNWB 4UMPA 1S9IA 3H4JA 3BIZA 4DGOA 4DLJA 4GFMA 4WO5A 2PL0A 3QA0A 4Y8DA 3TT0A 2BTSA 4O0VA 4FEWA 1WBWA 4F0FA 2WIPA 3IO7A 4RBLA 5C1QB 3DY7A 5AUZA 2QOCA 2E9UA 2I0HA 2W17A 3H9RA 2JIIA 3MTLA 3UTOA 2UZTA 3FLNC 5LWMA 4XHKB 4D2RA 3CJGA 5HE1A 4FKVA 3Q53A 4QP4A 4U97A 4J8MA 4LFIA 3OOMA 4I93A 3A60A 4II5A 3RP9A 3CTJA 4YHJA 4FUXA 2LAVA 4FICA 3O71A 4CFWA 3R7IA 3QZIA 2UVZA 4JG7A 4CMUA 4WG5A 3VIDA 5IQIA 4CZUA 3QX4A 4EUTA 5HVKA 3LFSA 2H8HA 4BTFA 3LCTA 4LYNA 4MEDA 4XG2A 5F20A 4CKIA 4RJ3A 1VYWA 1Y6BA 3TEIA 4KUJA 3IW8A 4V05A 1YHVA 1BI7A 5HE2A 1B6CB 5E8SA 3BLRA 1PXPA 1ZAOA 4FF8A 2W5HA 4FV4A 4M3QA 2E9NA 4N6ZA 4PL4A 3OFMA 5FRIA 1XH9A 2BROA 1M7NA 4EK6A 3SAYA 2GNIA 3RNYA 5I9ZA 3VHEA 4XH6A 4F9WA 4HPTE 3I81A 3KY2A 3GP0A 4NH1A 2HY81 3WOWA 3TDWA 2BHEA 1G8AA 3BQCA 4EH9A 2CNUA 4FEVA 5JKGA 2DS1A 4ARKA 4DFZE 3MW1A 3HV5A 2NRYA 2P55A 1FBNA 1JSUA 4NZWB 2QLQA 4LUDA 3AC8A 3FC2A 4IJ9A 4UYAA 4EKKA 1Q97A 4MNEB 4USDA 2P2IA 1URWA 4P5QA 4B8MA 4FL1A 2R3KA 2OK1A 3PXYA 5ANOA 1KUTA 5AAFA 1MUOA 3F9NA 5IQGA 4D2WA 1JBPE 3DTWA 5C9CA 4EC8A 3W2OA 5EQPA 3F5PA 5GZ9A 4XOYA 5LCKA 2V55A 3CGFA 3TNQB 1XBBA 1ZMUA 3BX5A 2A27A 3D5UA 1GIIA 4JOAA 3JVRA 3C5IA 1BUHA 1YKRA 5T6KA 2BDWA 2W1EA 2F7EE 1MRUA 5ANKA 3TUBA 2PU8A 2GPHA 2QHNA 4FK6A 2IVVA 4FNXA 4QO9A 2W06A 3MH0A 4X2NA 3G9LX 4ZXTA 2IVTA 2WTJA 4RJ5A 2XJ0A 5KMJA 4D9UA 2JDOA 4EUUA 4O86A 1CSNA 2IVUA 4KD1A 2VTPA 5E8VA 5EM6A 4Q5HA 2Y0AA 1DM2A 4FR4A 2UZLA 4FIHA 5B2KA 3UZTA 5C27A 1OL6A 4FV3A 4YZNA 3ATSA 1H00A 1O6KA 1Q5KA 1U46A 2VWUA 3F7ZA 5CSXA 4ZY4A 3QKLA 4O83A 4OBQA 4TTHB 4EOSA 3Q96A 3U6IA 4BR3A 3F88A 2VD5A 3GC7A 3QLGA 3FLZA 3VBTA 3EQRA 4ALUA 4G16A 4C2WA 2DWBA 4G9RA 5AP5A 5HVJA 3NUAA 3HA6A 1U4DA 4BIEA 4S33A 5LJJA 1TVOA 3DQXA 4AW1A 1H01A 4NM3A 4C58A 2PUUA 5H8EA 4BB4A 3ENMA 4FV9A 3H10A 3E62A 2X9EA 2ETRA 5BMMA 5I9VA 4A07A 3NZ0A 4LMUA 1GIHA 1P5EA 4AZWA 4MAOA 4O0TA 3ZEPA 5A6OA 3IONA 4ZSLA 3TZ8A 2GU8A 2HY0A 2GTNA 2XBAA 3TV4A 4R77A 4HJOA 2OJJA 3AD5A 3BHUA 3VBWA 3E64A 3OY1A 2R7BA 3PLSA 4GVAA 1XWSA 3GC9A 3AC2A 2QKRA 1FINA 3HDNA 4FTIA 4LOQA 4GK4A 4JG8A 5B2LA 4D2VA 4N6YA 1OL7A 4WNKA 4LG4A 3UNZA 1XH8A 1SMHA 5CQWA 5DR6A 4MD8E 3UE4A 2YACA 5IISA 2XEZA 1R0EA 4YU2A 4IC8A 2VWIA 4FYOA 5JZNA 1WVWA 2NPQA 4IADA 4MH7A 2XZSA 3HL7A 3W8LA 1NVRA 4ASZA 2C5XA 2ONLA 4DG0E 5HIEA 3SLSA 4FK3A 4QT1A 5J1VA 1YVJA 5DT0A 2H6DA 4D1SA 4K11A 2W1IA 1J1CA 4GH2A 3B8RA 3T3UA 4F9BA 2HENA 4ALVA 4IWQA 4GFOA 1ZRZA 4ZK5A 2C47A 2HWPA 2XNGA 3NUUA 4O2PA 3H0YA 3QU0A 3C50A 4F1TA 3I5ZA 4P2KA 4TYEA 2I0EA 2UZOA 3AC1A 3RM7A 3DAKA 4FOCA 5M4FA 3ENHA 2BAJA 3QBNA 5GIOE 3T3VA 3RAHA 5KMKA 2WQBA 3ZH8A 2F49A 5EKOA 2Y6OA 4U45A 3WF9A 4EOQA 3O2MA 1JVPP 4FE2A 3DK3A 4AOTA 1OBDA 3HUCA 1B38A 1OKWA 2PVHA 3II5A 3PJ2A 5CWZA 2FSTX 3FLSA 4KAOA 3VBXA 1AQ1A 5DT4A 3ZBXA 3QKKA 4Z7HA 3CKXA 4FMQA 4ZJVA 1H28A 2HCKA 4O7LA 4YJOA 4E6AA 3ITZA 2XCKA 3SOAA 2J7TA 3FZPA 3EIDA 3RPVA 4IX4A 3QGYA 5CLPA 5LQFA 5ETCA 4NKSA 4O82A 3EB0A 3U6JA 4TYGA 2VO3A 2BRHA 1Q8ZA 2XB7A 3KGAA 3R9HA 3ZLYA 5GJGA 4H58A 3L9MA 4D4VA 3HMMA 4CQGA 2OFVA 4MKCA 5BVFA 5JGDA 3RJCA 3G6GA 1Z9XA 1UU3A 2ITUA 4KB8A 4DFYA 3U4WA 3P7BA 4J98A 4M15A 4IVDA 2B1PA 5CT0A 3HMNA 4AS0A 3HMPA 3Q6WA 4FSRA 2OKRA 4O0XA 3K5UA 4QYEA 3FY2A 3ULIA 4E4LA 2WMWA 3QQFA 5J9LA 2OU7A 5A4LA 3IDCA 1F0QA 4CV8A 4ZTRA 4YTIA 2AC5A 4O96A 2A2AA 2PWLA 4FNWA 2W7XA 4GW8A 4M84A 4AXAA 4F1MA 5BUIA 5J79A 5AUTA 5GHVA 2OWBA 3MIAA 4JRNA 5IQFA 4G9CA 1R3CA 2QODA 4Q5EA 3GCQA 4GUEA 4DGNA 4BBFA 3CY2A 1Y57A 2W5BA 3FMJA 2VTHA 3PSBA 5I5ZA 3EYHA 3OEZA 3VBYA 4X7QA 4MVFA 4FTAA 3W2CA 3ZDUA 4ACMA 5IA3A 4KRCA 3UP2A 1PY5A 2W1DA 4HYUA 3VS2A 4MXZA 4C3RA 5BNJA 4AU8A 4RA4A 4BKJA 4TYHA 3IW4A 4BCGA 3UYTA 2HOGA 4BKYA 3DNEA 4ZTHA 1DI8A 1M7QA 2W96B 4CFMA 3ZUTA 5CEQA 4FL2A 4ZLOA 4EONA 4PNKA 5B2MA 4AFJA 1YQJA 3R7EA 3FBVA 2OIBA 4C3PA 3JYAA 1W0XC 4YLLA 5FTQA 3D14A 3VQHA 4D9TA 4HZSA 4G3DA 3BGZA 4QQ5A 3VAPA 3H0ZA 3D5WA 2LGCA 3OXZA 4IAAA 5IEYA 3KREA 4FTRA 1ZY5A 3L8VA 3LE6A 4AWIA 3IS5A 4DH8A 2RF9A 2Z8CA 5CEIA 4C02A 4CEGA 3PZEA 4L53A 5G6VA 2ZOQA 4YURA 1FVTA 2O63A 3D9VA 3D7ZA 4IH8A 4NTSA 4LL0A 4QNYA 3SRVA 4ASDA 2X0GA 4ASEA 4CRSA 4ACGA 3BWFA 3FV8A 4XP2A 4ZP5A 4OLIA 2C5VA 3Q9ZA 2YZLA 5JH6A 4DFXE 3LQ3A 4PRJA 4BIDA 2XNBA 3LMIA 2YM3A 4AGUA 3QTSA 1Q3WA 3E8CA 5AR3A 5HBHA 3QCYA 4XOZA 4WKQA 2HXLA 5L8LA 1XJDA 4LRJA 3CXWA 3UOJA 4U8ZA 3QD2B 5M06A 2FO0A 4X0MA 1YWVA 3EN7A 4FKRA 4I4FA 5D7VA 2PZPA 2R9SA 3MIYA 3BV2A 4A7CA 5HESA 2VWZA 5EYCA 3UJGA 5A46A 3TUDA 1FPUA 3IW7A 2XVDA 5A9UA 4LQMA 2OICA 3QYWA 1VEBA 3UG2A 5DHJA 3O23A 2Z7LA 3CTHA 2XK6A 3ZU7A 5JFWA 2WMBA 1MQBA 3GBZA 3PDTA 3FZOA 1UWJA 5TOZA 4NT4A 2UZNA 3W10A 4CRLA 3EH9A 3VUMA 5HIBA 2EU9A 3FXZA 2CMWA 4RC4A 1SNXA 4DEIA 3BYUA 4YJUA 4I5MA 1JSTA 5JQ8A 3W2QA 5FEQA 4MHAA 2ZMCA 3A7JA 2WNTA 3BHHA 4IJPA 4C59A 4C36A 4Y95A 5L6OA 3GQIA 2IZUA 3UO5A 3UOKA 2C1BA 2J9MA 3LJ0A 3COMA 2QVSE 3ZEWA 4EZ3A 4R8QA 2I6LA 1YOMA 2VTAA 3EN4A 1IAJA 2G2IA 4W4XA 5E90A 4R7BA 1BI8A 4ITJA 4AX8A 3OY3A 4O1PA 3OWPA 1V0BA 3OWJA 4HVDA 1W7HA 4H05A 4FI1A 3WZKA 3WZUA 3QF9A 3FMLA 4BCFA 5FTGA 4FOBA 3CQWA 4P7EA 2OG8A 4C37A 3OW4A 4ZMFA 2DYLA 4TNBA 4QTCA 3MFTA 5CEMA 1H0WA 5DLSA 4M67A 3NS9A 2CNQA 4FZAB 3Q4CA 2PHKA 3L9NA 3RPYA 1NA7A 4O7WA 2XNEA 3V6SA 4FV0A 3CCNA 5L8JA 4CGAA 3LCKA 2W05A 2XA4A 4N70A 4C57A 4Q9ZA 4OUCA 5CQUA 3QUEA 5FP6A 2YWVA 2RKUA 4LRMA 5TE0A 2WAJA 3W2PA 3AD6A 3E93A 4MWHA 4RWKA 5M08A 2Y8OA 2UZUE 5K0KA 5DN3A 4ACCA 4OR5A 1ZWSA 3OMVA 3M1SA 4A9SA 5CSHA 4C0TA 5A54A 1L8TA 5CAVA 4C2VA 1Q8WA 4WNPA 4X2KA 5DRBA 3V8SA 3P79A 4F7SA 5M57A 3HAVA 4JT3A 5HCXA 1Q62A 2OF2A 3LFCA 3R28A 2XBJA 3ZS5A 5M4IA 4XV2A 3ZO3A 5LVMA 4RJ8A 2PY3A 4E6QA 3OEFX 3E8NA 5LMKC 1WVXA 4QPSA 4GKIA 5J87A 5IQAA 2WQEA 1PKGA 1M14A 3R01A 4WHZA 2QU6A 4U5JA 4HPUE 2OJGA 3ET7A 4BCPA 4H36A 4HZRA 1FVVA 3AMBA 3IDPA 4JQ8A 3LVPA 2QG5A 4B7TA 3RNIA 4I4EA 4CD0A 4AW2A 3BQRA 4EH6A 4BZDA 5D10A 2P3GX 1UA2A 4RFYA 4AN3A 3DA6A 2WTCA 3P9JA 5JRSA 2CHLA 3G0EA 1YOJA 2QNJA 2YHVA 4UV0A 5EOBA 5BQ0A 4KNBA 2HAKA 3LFBA 4PDSA 3UO6A 3OOGA 4ZS4A 4KBCA 4V01A 4UMTA 2X81A 4AA5A 2SRCA 1FGIA 1PXLA 1I44A 3BYVA 4WG3A 2HW7A 3PPJA 5IU2A 4BFMA 4WBBB 5JT2A 4K8AA 2EUFB 3S0OA 4X21A 2CN5A 2YN8A 3MY5A 5LARA 2C0IA 3IW6A 5D11A 2B53A 4EOLA 4RFMA 2BPMA 5CEOA 4GVJA 1OPKA 4YBKA 1W84A 3DXQA 2XMYA 4IX5A 3SXSA 4WD5A 2GNHA 5IG1A 3FKNA 2J0KA 4LV5A 5H2UA 4RT7A 3F66A 5I9UA 5CAOA 4NJ3A 1R78A 1OKZA 3WYYA 3ZO2A 5J9YA 5L4QA 3MYGA 3LKMA 4GL9A 4UB7A 3TTIA 4AT4A 4BDFA 3I6UA 5J7BA 3WI6A 3QD4A 4DFLA 3MPTA 4Z9LA 3AGMA 2YABA 3BGPA 3DBFA 1ZZ2A 4RWIA 2O8YA 3QHRA 2X7FA 4O7YA 3DB8A 2GFCA 4MXYA 1ATPE 1ZARA 5AWMA 5D9HA 3ETAA 3OF0A 4C4EA 4D5KA 3IDBA 1W98A 4FIFA 4GT4A 4L00A 2YCFA 3GCUA 4FZ7A 3BI6A 3NRMA 3OC1A 4H1MA 2C6MA 5E7RA 1SVEA 3G33A 3POZA 4YP8A 5BYYA 3GU8A 3O0GA 2I40A 1LUFA 2RFEA 4BDDA 4MD9E 4TYHB 2ITQA 3DFCB 3EQHA 3EQPA 3FY0A 4ZAUA 2Z60A 5AP3A 3ODZX 3UPZA 4PWNA 3TTJA 1KOBA 3DAEA 3AC5A 4IB5A 3R04A 4FT7A 3C1XA 4IZYA 3LXPA 4RJ4A 5CF5A 3C4XA 2ERZE 3TG1A 2E2BA 4QMMA 4I0TA 3RVGA 3UOHA 2PVKA 1HCLA 4DEDA 5KX8A 1SNUA 4WIHA 5L2WA 3IGGA 3BU6A 3MVJA 4C8BA 1KWPA 3DKFA 3RM6A 4O22A 3BE9A 4C62A 4AAAA 4CCUA 2EXCX 3NYXA 4CMOA 4YJVA 4BDGA 3UO4A 4GFGA 3VBQA 4BDIA 3Q3BA 3SRVB 4I21A 4RFZA 4IX6A 4YZCA 4EHEA 5BYZA 2VWWA 5IZFA 3I7BA 4I5PA 4OBOA 4RJ7A 2J6MA 4FKGA 4BDAA 2WEIA 1QPDA 5FXRA 4OTDA 5AUYA 4EZ5A 5A14A 3SC1A 3I0QA 3ULZA 4LV8A 3WZDA 3QCQA 4JBOA 3R63A 1BKXA 4B9DA 2BRMA 2IWIA 1H07A 2R3GA 5ANDA 3ZYAA 2R3FA 3JY0A 5KZIA 2FB8A 2YIQA 5JRQA 4J7BA 5M53A 4BCMA 2C6OA 3PFQA 1NY3A 5HX6A 1WBVA 3V04A 2G15A 5HORA 2BALA 5FBOA 2GQRA 4A9RA 2B9FA 3RPOA 3DTCA 3DJ7A 1GZNA 4BCIA 3D5XA 4YUQA 3HLLA 3R7VA 4V0GA 3RAKA 3QKMA 5CSVA 5KHWA 3NPCA 4F9YA 4J95A 5AP2A 3CY3A 1KE8A 3D83A 3PRIA 4ZLYA 2XK7A 5JGAA 2VTQA 2Z7QA 3ORMA 1H1PA 4JJRA 4NKAA 1UU8A 4F1OA 3EOCA 4IQ6A 3HZTA 4FZFB 4E6CA 2C5OA 2ZB0A 4FKPA 4JAJA 2J0JA 3LFEA 2XRUA 2WTWA 5EI6A 4BDCA 4NM5A 3WIGA 2EXMA 2ZV2A 4FGRA 3C51A 2WPAA 5DVRA 5GZ8A 1IA9A 4YTCA 3GU7A 3R0TA 4BRXA 3JPVA 4B6LA 1LP4A 5HVYA 2WOUA 1YXVA 3CJFA 1E1VA 1KE7A 4G31A 5E8ZA 5AUVA 5T68A 3NUPA 1YHSA 5FM2A 4ALWA 1TQIA 4DAWA 1OUKA 4D4SA 2ITVA 3FQHA 5IUGA 4UY9A 3ZFYA 4YMJA 3MPMA 1X8BA 3Q52A 4OTIA 3WILA 4C33A 2VZ6A 4GUBA 3ZLSA 3BYOA 5FG8A 2EWAA 4UMUA 3KXHA 5DFPA 1JKLA 3WIKA 1IRKA 1OB3A 3PE2A 3OZ6A 4IHPA 1F5QA 5IA2A 3PRFA 4RX7A 2XRWA 3C0GA 4EOKA 4ZZOA 4DTBA 1WBSA 1E9HA 5CYIA 4FTTA 3WBLA 3NNXA 4BWKA 4JNWA 3VJOA 4OT6A 1SZMA 4H1JA 3QHWA 4KBKA 2B7AA 3IOPA 3QTIA 5AR4A 4F4PA 4IACA 1A9UA 3V5PA 4BDHA 4FG9A 5BX0A 3U8WA 4K77A 3QTXA 3VUHA 5IEXA 4E5AX 1W82A 1ERKA 3F3VA 3FLWA 2PZ5A 2RG5A 2VX1A 2ZM1A 3I0OA 4AGWA 4B99A 4LRKA 1PXMA 5BVKA 3N4VA 1YW2A 5AAEA 3TI1A 3E5AA 2ZAZA 1WCCA 2WTDA 3Q5ZA 4FV7A 5DGZA 1NVSA 2BAQA 1YDSE 4EK3A 5K4JA 5KBQA 2WMQA 3LZBA 3MESA 5DOSA 4X3FC 4L44A 2OFUA 4UZHA 4WUAA 2OH0E 4WOVA 1P4OA 2YDJA 3P4KA 4QTAA 3S4QA 3R7YA 4MX9A 4H3BA 4R1VA 3TNIA 4IWOA 1I09A 3SG9A 4YJRA 2JGZA 3C9WA 1OZ1A 5IUIA 4L8MA 5M4UA 4TWOA 4BDKA 1FMOE 1ZOHA 2XK9A 2V62A 2I1MA 3I7CA 2RSVA 4IM2A 2YDKA 4EH4A 3LFNA 4FVRA 2WMRA 1J7UA 4UXQA 4U43A 4EHGA 3PWDA 2YZAA 3N9XA 5EDPA 5TR6A 4DA5A 4L7SA 3FC1X 1H25A 2C6TA 3DLZA 4AN9A 4MK0A 4N0SA 4UEUA 3VS1A 4CMTA 5E1EA 4M13A 5L2IA 2J0LA 4HNFA 5T3QA 3TKUA 1BL7A 2WXVA 1SVHA 2YITA 4GCJA 4L46A 2OXYA 3TACA 4AUAA 2C5YA 1YHWA 1Q3DA 5E8YA 4IANA 5A4TA 2VO0A 3FMNA 4J8NA 4QYYA 3VS4A 4AGDA 4OGRA 3C0IA 4U7ZA 2R3HA 4JR7A 1OM1A 3IECA 2PVMA 3LQ5A 4NM0A 5FP5A 4EOJA 1PMVA 4AZEA 4D28A 2GNLA 1Q8YA 3IW5A 3RK7A 2W1HA 2PVNA 4JG6A 4IM3A 4QD6A 3V8WA 4BCJA 2PPQA 3PLAE 2XKDA 3DGKA 4TKSA 1ZZLA 3TIYA 3AG9A 3QQGA 5LVNA 3U6HA 5GIPE 3KXXA 5FEDA 4BTMA 4QMWA 4EHVA 2A19B 3MDYA 2CLXA 3P86A 5KBRA 4CTBA 1YI4A 1PMEA 1YI3A 4BICA 2ITOA 3EHAA 3A8XA 4ANMA 4YZ9A 3WYXA 3F5XA 5DIAA 3THBA 3T9IA 5DR9A 4NUSA 2JKQA 3AMAA 4FKIA 4O0UA 4YSJA 2C68A 3UIUA 4BBMA 2A0CX 3OS3A 4UBAA 1ZOEA 4CVAA 4FV8A 2YLEA 1KV2A 2C69A 3DBQA 3U9CA 2ETMA 4I24A 3ORKA 4IAKA 2WMAA 1H08A 3NYOA 4K9YA 5J5SA 4M7IA 5LMKA 4GT5A 2F7XE 4M69A 4BL1A 4GK3A 2VWBA 3ACKA 1MP8A 4RWLA 5AX9A 5CAQA 2PTKA 3BWJA 4J99A 5DI1A 5EQEA 3DXNA 3LLTA 3MFUA 3QZFA 4F99A 4ZOGA 4DBXA 2WMTA 3I6WA 3QCXA 5EHYA 3PPZA 4FTLA 4FTNA 4CKJA 3O51A 3U87A 3ALOA 3UQFA 3O8TA 1OIQA 2ITZA 5FDXA 2WB8A 2XKFA 4FKLA 2R5TA 3KL8A 2X1NA 5HO8A 3NYNA 3Q2MA 2GS7A 2BILB 4L52A 4U0IA 5GNKA 4UMRA 2CJMA 4HGSA 3Q9WA 4AZVA 1BX6A 3OUKA 4WA9A 3MPAA 3RINA 5CEKA 3BYSA 4NL0A 4G2FA 2XCHA 4Y72A 5HI2A 5IDPA 1JQHA 4FT0A 4S30A 5HQ0A 3JR1A 1UWHA 4FTKA 2PMOX 5AMNA 3RCJA 4R6VA 3PY1A 4XG8A 4DLIA 4PP9A 5HO7A 2JC6A 2PZYA 2V5QA 3IKAA 3OXIA 3V3VA 1WFCA 2C30A 4CQEA 4BDBA 1H1RA 4XX9A 4AE6A 4EOPA 3LAUA 2I0VA 5K4IA 5ACKA 3HVCA 2R3OA 1MQ4A 1YOLA 2YM7A 2PUIA 1SYKA 3ORTA 3K3IA 2RGPA 3DK7A 3VNTA 4U3ZA 4IVAA 1JSVA 2FUMA 4FKUA 4UXLA 3QYZA 2WTKC 2G1TA 2GHGA 4JAIA 1QL6A 4BF2A 4V0GB 4U3YA 3W18A 4CLJA 4FNZA 3LCOA 4XUFA 4TYIA 3BHVA 3E8EA 3LM0A 4YNEA 5CSPA 3HMIA 4FVQA 4XLIA 3KXZA 3W32A 5E4HA 5LVOA 4YPDA 2H96A 5J7HA 3PSDA 2ESMA 3R8UA 4CFVA 2YAAA 4EWQA 2WIHA 3DPKA 3KK8A 4J96A 3PVUA 2CN8A 3GCVA 3CS9A 4GU6A 2JKKA 3PSCA 3R1NA 1F3MC 1ZLTA 4QYHA 3IOKA 4DT8A 4FTUA 1ZXEA 5ETIA 5B0XA 3ZSHA 4EH8A 3G15A 2QOIA 3D4QA 4RZWA 3LMHA 2E9OA 1M17A 5HLPA 5LOHA 2XEYA 3NAYA 3IGOA 5GJDA 4JBVA 4FT3A 5HICA 3R1YA 2H34A 5I3RA 4D4RA 4LGDA 3MB7A 2OJFE 3O8UA 4QYFA 3KU2A 4U79A 4M68A 4PL3A 3HUBA 2VTLA 5TT7A 5ETAA 4FVPA 3NUXA 1CM8A 3NWWA 4ONAA 3EFWA 4IC7A 3VUKA 2PK9A 4PTGA 3QRIA 3E7VA 4HGLA 3OCSA 5M55A 2QC6A 4CG9A 5AA9A 4LM5A 3KRXA 3V51A 1G8SA 4M0YA 1BYGA 4UX9A 4PV0A 5EOLA 4ZTLA 2GNFA 1ZYLA 4M12A 4OTQA 5JEBA 1A48A 4F9CA 2X2KA 4TWCA 2WEVA 3ZTXA 1O6YA 2YM4A 3HV6A 4A4XA 2O3PA 1FMKA 4LUEA 4E4NA 3QRTA 4FTMA 4FIJA 1XH4A 4HVHA 5AV0A 3ZBFA 5LCJA 3RALA 2GHMA 4USEA 1CKJA 4QTEA 5LVPA 2JDSA 2YISA 4R3CA 5KMIA 4NWMA 4NCTC 2XYNA 2UW4A 4ID7A 5CT7A 5BUEA 3N4UA 2X6EA 4F9AA 3NW6A 1U5QA 3GT8A 3TKIA 5L3AA 2UV2A 2VNWA 4K2RA 3NX8A 3EQDA 3PUPA 4L3JA 2XIXA 3UQCA 5HIDA 3R83A 5L6PA 4EHZA 3ZDIA 4QYGA 3VQUA 5IH6A 3PJ1A 1JLUE 5FUTA 4F0IA 3PPKA 3ZSIA 1PRYA 4XRJA 5LMAA 3R00A 1TKIA 1NW1A 4FSZA 4XV1A 4BCQA 5KMNA 2E9PA 2WELA 2ZM3A 5CY3A 1OUYA 1ZYCA 4AT5A 1PXOA 5AV2A 4CTCA 2KTYA 3ERKA 3E87A 2OXDA 2P2HA 3QQLA 2W1GA 4PPCA 5D12A 4PPAA 4YTFA 4ANSA 3NW5A 5HHWA 4BGGA 4RGJA 3DBEA 4E7WA 2VX3A 4ZJJA 4MXCA 3QXOA 3HV7A 3VS0A 2UW9A 3RI1A 2CSNA 2FVDA 3HV4A 3ZSGA 2PZIA 2B9IA 4BI1A 4DTAA 4MQ1A 5TKDA 3KRLA 5A6NA 4J52A 1ZMWA 3KVWA 2PVLA 3CE3A 1PXIA 1UNLA 3A2CA 4X6RA 4CFXA 4CSVA 3MVHA 4L9IA 4ANOA 4F0GA 3EWHA 3R73A 3OW3A 5FXSA 4FGBA 2JKOA 3MY0A 4U44A 4DTKA 2GQGA 2ZMDA 1KOAA 1WBOA 4RRVA 4U42A 5CU4A 5EDRA 3RK5A 1J91A 3ID6C 4RX5A 3PG1A 5FBNC 2B54A 3R7GA 1OL2A 2GCDA 4A4LA 1APME 5AR2A 4DH3A 1T46A 4EH3A 2C0TA 4GG7A 1M2RA 3E8DA 1OITA 1OPJA 2VTRA 4YO4A 5CZHA 4BGHA 1B39A 4IXPA 4X3FA 3BHYA 4YC6A 3Q4ZA 4P90A 3PY3A 3MSSA 1Q99A 2RFNA 4RLKA 4G3EA 2FYSA 3KEXA 4MD7E 4PDOA 4KKEA 3OWLA 2YM5A 3OTUA 4EH2A 2YIXA 5L2TA 2C3LA 2YEXA 3A8WA 3F3WA 4IZ5A 3QUPA 2HYYA 3FAAA 4M69B 4RIXA 2QOQA 5AP6A 4RQVA 2BRGA 4XG9A 3RKBA 4CCBA 3MVMA 4ZEGA 1JAMA 1YDTE 2GMXA 4TPTA 4MTAA 4JIKA 4FSTA 1OKYA 2GS2A 4KRDA 1UNHA 5EI2A 4FTJA 5IF1A 1T45A 1V0PA 3P1AA 2QG7A 2JDRA 1OIYA 4XG6A 4W9WA 2X4FA 2XJ2A 2X8IA 3C13A 3GU6A 3Q4UA 4WRGA 3ZXZA 2B52A 2QD9A 2CGUA 3CTQA 3EQCA 4QMPA 5DPVA 5ANJA 3K5VA 4YJNA 4FTOA 3OCBA 3R7OA 4AQCA 4WSYA 5JMSA 4CKRA 4LOPA 3ZHPC 4D1XA 3TIZA 3PJCA 3WF6A 3GB2A 3BE2A 5J8IA 3R9NA 2IN6A 3DOGA 4RX8A 4JI9A 5FGKA 4ANQA 3DKOA 4FSWA 4OBPA 5EM8A 4NK9A 3PXQA 1BL6A 1K9AA 2P4IA 4LI5A 4RC3A 4BDEA 2WMXA 2FGIA 1UV5A 5BUJA 4QOXA 1PXJA 3L8XA 3TN8A 5EQYA 2YCRA 4BIBA 3W33A 1RW8A 2C6KA 5CF8A 1JNKA 1LPUA 2XKEA 4EH7A 1QMZA 3EJ1A 3QZHA 4JQEA 2PE0A 2ZDUA 5HG7A 4YJSA 4K18A 2YIRA 5KO1A 4O7SA 4DC2A 3O96A 2B55A 5CTPA 2YLFA 4O91A 4PQNA 4O27B 4U80A 4A9TA 4V04A 5FQDC 5C26A 1U59A 1R39A 4JIAA 3VF9A 4GJ2A 4R1YA 1LR4A 3K2LA 3MJ1A 5HU9A 3FUPA 5IKWA 4Y73A 5C4KA 3DS6A 2YDIA 4MBIA 4P5ZA 4RIYA 3OT3A 4QPMA 3OHTA 3BCEA 3F2AA 3PVWA 2PYWA 1UU9A 3NUNA 3QTQA 3ZZWA 1P4FA 3KKVA 5JZJA 2FSOX 3MH1A 3SD0A 2OZAA 1YDRE 1WAKA 3B8QA 3OBJA 4RSSA 5M56A 4L01A 1YXUA 4HCUA 2WKMA 3NLBA 4Y46A 3NDMA 3RWPA 5AM7A 4HVGA 2W9FB 5DR2A 5HTBA 3OD6X 2X6DA 1YWRA 4FIEA 3UNKA 4F6SA 4QQCA 1ZYJA 3HKOA 3V5JA 3MN3A 5FDPA 1OL5A 2HZIA 2QKWB 3UVQA 3ZLXA 4QQTA 5LWNA 2J5EA 3D2IA 4AOIA 2YFXA 3AC3A 2WFYA 3RTPA 4R3RA 4EQCA 5EW3A 5CNNA 3R8VA 3FLYA 5ANIA 4IZAA 4ERWA 4DH7A 3EZRA 3F69A 3PY0A 3Q5IA 5KHXA 2AUHA 2YCSA 3AC4A 4XBRA 5AEPA 5J95A 4XYFA 3EFJA 2YIYA 3UC3A 4AACA 3HMOA 1H1QA 2BTRA 2C3KA 3G2FA 5F1ZA 1PF8A 3MFSA 4KKHA 4RWJA 3B2TA 4EJ7A 5CNOA 2BAKA 3GUBA 4L3PA 2Y4IC 4HNIA 5E8TA 5DNRA 2WZJA 3JXWA 3C4EA 2GHLA 5H8BA 3EL7A 4G34A 4YZDA 5AM6A 5LVLA 5IH5A 3SQQA 3SG8A 3OWKA 3FQEA 4ZTMA 3FMHA 1KE9A 5AIRA 2UZDA 2X8EA 1GY3A 2O5KA 1WBTA 5AIKA 2VTMA 4MBJA 4UWYA 4ACDA 5EH0A 1TQPA 1YXXA 4Q2AA 1PJKA 4E4XA 5HCZA 4QP6A 5HBJA 5L2QA 4FSQA 5EKNA 1KV1A 4EOIA 2W1CA 3PA4A 3A7IA 2W4JA 3WF8A 4E5WA 4GSBA 3LOKA 3QQJA 4IAZA 2ITPA 4JDKA 3R8MA 4TXCA 3ORIA 2XH5A 5CU3A 3ANQA 3TDVA 1OL1A 2ZM4A 2F2UA 3EQBA 4MF0A 4YLJA 2ZJWA 3FLQA 5HTCA 4IWPA 2UUEA 5HTIA 4PTEA 3C7QA 3PJ8A 5GINE 2CPKE 4EYMA 4DCEA 4XV3A 5ANEA 2JEDA 4L45A 3QRKA 5EG3A 1CKIA 4EZ7A 4F63A 4D0XA 2O65A 1J3HA 5IQDA 3F82A 4QRCA 3HV3A 5BYLA 3BU5A 4ANLA 4F6UA 2ETKA 1ZY4A 3FHRA 4XG3A 2FA2A 3BEAA 3QD3A 2JITA 3COKA 2QOKA 3W2RA 4K33A 2Y6MA 3G5DA 4PMPA 4HW7A 4F64A 2PE2A 1GAGA 1M2PA 2WMSA 1J1BA 3F5GA 4NJDA 4PDPA 4D4YA 4OTPA 3Q2JA 3HAMA 4BN1A 2BIKB 2RFSA 3BLQA 1WBNA 2H9VA 3LXKA 3GC0A 4NW6A 3VW6A 1J7LA 3IPHA 3ZRMA 1M2QA 3TCPA 4LGGA 5CVGA 3W16A 4AG8A 3KCKA 3R8ZA 3G90X 3CPBA 3F7WA 4CG8A 5JFVA 2YM6A 2ZYBA 4R7IA 4RVTA 3RCDA 1URCA 3EKKA 4XG7A 4BCOA 2XK3A 2F2CB 3PP1A 4BY9E 4ITIA 3TM0A 1HCKA 4E93A 3MH2A 2VWYA 4QP7A 3TWJA 4OTRA 3E92A 4FSMA 1U5RA 2C3IB 4GIIA 3HRCA 3B2WA 5EYMA 2C6LA 2CLQA 2PVYA 3NIEA 3GENA 4QTDA 4RZVA 3DJ6A 2VGPA 3ORLA 4C4FA 2J0IA 1RJBA 2ZDTA 3FKOA 3H30A 3NNUA 4MNFA 2IZRA 4MWIA 4O6EA 4YLKA 3TZMA 4CT2A 4DEEA 5CAPA 1Y91A 3HRFA 2OO8X 1DI9A 1YRPA 3LJ1A 4G17A 4EC9A 5A3XA 2F7ZE 3CD3A 4I6HA 4X3FB 2XIYA 4IVCA 3DLSA 2Q0NA 3NSZA 4G6OA 5CANA 1UU7A 2WOTA 1H8FA 2J0MB 3R30A 4I3ZA 4O7ZA 1EH4A 4NCTA 3COHA 2ITTA 4S31A 5HOAA 4IFCA 2OJIA 3BEGA 3MJ2A 4LL5A 4FG7A 4E8AA 3QAME 5DMZA 4G1WA 3VS6A 4F6WA 3PYYA 3BHTA 2XKCA 4WT6A 4Y85A 4DHFA 4PTCA 4KIKA 1UNGA 3GQLA 3QXPA 3NGAA 4X2GA 4M66A 4YSMA 5CF4A 3COIA 2BKZA 4FSUA 4FYNA 4GEOA 4ZSJA 2EB3A 4FC0A 4G5PA 3VJNA 3VW8A 4D55A 1BMKA 2CCHA 4EK4A 4Z55A 3RZFA 4BBEA 4E3CA 5TO8A 4QP3A 4LMNA 4ORKA 2XM9A 3N51A 2I7QA 3LIJA 1XBAA 1Y8YA 3I5NA 3M42A 4IB0A 4IM0A 5H3QA 2OZOA 2RG6A 3NIZA 3WZEA 1SVGA 2YJSA 3SA0A 4C4GA 1Q41A 2IJMA 5CX9A 3PIYA 4MCVA 4QTBA 5AP4A 4LOOA 4BI0A 3R2YA 4GKHA 4PMMA 5ACBC 3DFAA 3AGLA 4ZSAA 3E3PA 3VWAA 4AZTA 3TXOA 3V5TA 1K2PA 1WVYA 3A7HA 4ZIMA 2ITWA 4PP7A 2CGWA 3E3BX 3JS2A 2OIDA 4ZS0A 4O0RA 2JD5A 3UDBA 2Y7JA 2OXXA 2XP2A 4FV6A 5KKRC 4CNHA 2WHBA 3LM5A 4E73A 2BDFA 3ELJA 3HRBA 4NTTA 3FZRA 4IE9A 2VTNA 2XNNA 2P0CA 3RPSA 4EL9A 5IMXA 1ZYSA 3DU8A 3G6HA 4XLVA 3DZQA 1H27A 4O38A 2XJ1A 4W8DA 5KZ0A 3P0MA 4K6ZA 5EW9A 4NU1A 4U41A 5CALA 4O81A 3DBDA 5CI7A 3EQIA 3S2PA 2WQMA 5L6WL 3V8TA 3FMDA 2XIZA 2J5FA 2W4OA 3C5UA 1K3AA 3KF4A 3O7LD 5EW8A 3PA5A 5CS6A 5E91A 1MRVA 2JFMA 4ERKA 5CVHA 5E8WA 2GTMA 4RIYB 5AP0A 4NYEA 3ZONA 4F7LA 2WGJA 3KULA 3G51A 2Y4PA 3ORXA 2BFXA 4S34A 2ITYA 2R3PA 3AMYA 2OZAB 2R3MA 2IZTA 3E63A 3LCSA 4XG4A 4JXFA 4W4YA 2G2HA 2QO9A 2GFSA 2QOFA 4Y5HA 3CR0A 4EEVA 4Z16A 2B9HA 5BVDA 5CI6A 5M09A 3GFWA 2YWPA 3FWQA 1A06A 4M14A 4B0GA 4EWHA 2PULA 4YHTA 2V7OA 1XKKA 2XK4A 2A1AB 3EN9A 5CZIA 3VHKA 4IDVA 2GSFA 5F94A 4AA0A 3T8OA 4KS7A 5IPJA 4XV9A 4HOKA 5FWKK 3MI9A 1H1WA 3KK9A 3QD0A 4TWNA 2VO7A 5JQ5A 4KIPA 5A4QA 3DAJA 4FEUA 5LMBA 4AA4A 2R0IA 1IA8A 1Z57A 3KFAA 1OI9A 5FLFA 3R8LA 5IEVA 5L2SA 4TL0A 5DRDA 3L1SA 2QO2A 4JX3A 4QMTA 5BMSA 2W4KA 1G3NA 3R1QA 4RVLA 2PSQA 4F08A 4UWCA 1PKDA 3GU4A 4I6FA 4W4WA 4BCKA 5AP7A 2VTIA 5ITAA 1M52A 3D7TA 3R2BA 3UVPA 4D2PA 3AT4A 2Z7RA 4C4JA 4CLIA 2XUUA 4EOMA 1XQZA 4QMLA 2X7GA 3P7AA 4P4CA 4G6NA 3LFFA 4XBUA 5HE3A 2VWXA 1AGWA 1YI6A 4U40A 3HGKA 4Y83A 5AUWA 5AV3A 3R8PA 3TJDA 2UZBA 4YBJA 3OUNB 2GDOA 3TL8A 4W8EA 5K5NA 2PUNA 3VC4A 1XH7A 3QA8A 5HNIX 1NXKA 4PF4A 4BTJA 3UPXA 4GG5A 2ZV7A 3OG7A 1GJOA 4I22A 4WSQA 4YC8A 2I0YA 5C01A 4D2SA 3TNWA 3UP7A 1MRYA 4MXXA 4HVSA 3UIBA 2BFYA 3DK6A 3C4CA 5KNJA 5HG5A 4DFNA 4MXAA 2VWVA 3U9NA 3V5LA 4A4OA 5JN2A 4NIFA 2XS0A 1OIRA 4AZSA 4I94A 3EL8A 4R3PA 3D5VA 3PE1A 3VUIA 3NW7A 4EK5A 4DEHA 4L43A 1H1SA 4QMXA 5KE0A 4JX7A 5D7AA 2VGOA 1KE5A 4XMOA 1Q61A 3Q9YA 4I5HA 5DA3A 3HECA 2UZVA 2UVYA 2W5AA 4GIHA 5AV1A 4BZNA 4DGGA 3R21A 3Q9XA 2FSMX 2R3QA 2UW0A 4FT9A 4IAFA 4FT5A 5GJFA 1DS5A 4O7TA 4A9UA 4IX3A 3GVUA 4HGEA 3ZUUA 1VR2A 3ZC6A 4ENXA 3QALE 3V5QA 4O7VA 3DT1A 4EQUA 4ZTNA 1W83A 5TF9A 2NP8A 4EBWA 2CKOA 1UKHA 4OW8A 4G3FA 4BDJA 4CZTA 3A7GA 3GFEA 3QTRA 4I23A 5K0XA 5EI8A 5M4CA 3EMGA 3PTGA 4BYJA 3QC4A 3Q6UA 4FUYA 4ANBA 5IA4A 4QP2A 3NNVA 3HNGA 3KN6A 5BVNA 2PMNX 3ORNA 1YWNA 5CSWA 5I9XA 1NT2A 2IG7A 4FKJA 5AV4A 2V7AA 4GYGA 3BZ3A 3QRJA 3LLAA 5IQBA 4DFBA 5HG8A 4FIGA 4H39A 2YCQA 2VNYA 3H9OA 3FQSA 3PXZA 2C3JA 3IK3A 4HCTA 3H9FA 2JAMA 5HGIA 2ACXA 3FE3A 3D15A 2GNGA 2OGVA 2JBOA 4M97A 4QMZA 1XBCA 5KMMA 3S00A 3DXPA 1XH5A 2B4SB 3GOPA 2W99B 4FV5A 4IBMA 4AZFA 4U9AA 3AT3A 2ITXA 2R2PA 4I6QA 2VO6A 3HYHA 3RBWA 2E9VA 4CT1A 4KIKB 4EH5A 1QPCA 4YR8A 2JKMA 4ITHA 3GXLA 3DJ5A 2NO3A 3VUGA 4TYJA 3FJQE 2YA9A 5AFVA 2J2IB 3CP9A 2G2FA 3MVLA 4I1ZA 5H9BA 4F65A 4RLLA 3SOCA 3MV5A 2BR1A 3QTUA 2QOBA 4NFMA 3EFLA 4B8LA 4H3QA 3Q60A 4OAVB 3UOLA 3ATTA 4X6QC 3C4ZA 3NR9A 4EJNA 2W0JA 2HK5A 5BPYA 4GK2A 3UQGA 5J5TA 4ENYA 5HEZA 4HVIA 1L3RE 4QMNA 5IUHA 5HNGA 4W4VA 3LMGA 4APPA 4G6LA 3L8PA 4O0YA 3QFVA 1P14A 2V0DA 4WNOA 4TN6A 3UNJA 3PXKA 3W2SA 3R7UA 1FVRA 3LXLA 4AGCA 3LHJA 1FOTA 2OSCA 4BZOA 3BELA 4ZZMA 3QQKA 3ORPA 4ZY6A 4IZ7A 3DV3A 4UWBA 4RG0A 3EN5A 3DB6A 4FA2A 2OLCA 2VTSA 2ZB1A 4KKGA 2WMVA 4NFNA 4XCUA 1OBGA 1UKIA 2CKPA 4YC3A 4EBVA 2C6EA 3I4BA 3QGWA 4O0SA 4BCHA 5JK3A 5C8NA 1OECA 4QMVA 2QOLA 4DG2E 3GCPA 3E7OA 2C6IA 4XNEA 5C8KA 4JBQA 3G0FA 4GV1A 5HU3A 3M11A 2HXQA 2UW8A 4FKOA 2JDVA 3UIXA 2HWOA 3HP2A 3WZJA 5HG9A 3EN6A 4JRVA 4N4SA 3FEGA 3HEGA 4YJTA 3DDPA 3KULB 3ORZA 4PUZA 5C8MA 4BC6A 2QR8A 3K3JA 4BVUA 4L7FA 4G5JA 3ROCA 4EORA 3BGQA 2EVAA 3BRBA 1STCE 4FV1A 4OTFA 4QMUA 5EM7A 4CFFA 2QU5A 3FMKA 2RIOA 2X39A 4YJQA 3AD4A 5HBEA 2PMLX 5IA5A 2B9JA 1PMNA 2R64A 2VN9A 2Y9QA 3CIKA 3FPMA 4C38A 2XYUA 1PYXA 3UMXA 5AA8A 4YNOA 3DQWA 2V22A 5JFXA 3CQEA 4E5BA 3R9RA 4BHZA 2QHMA 3MTFA 4JDHA 3UGCA 5HD7A 4BTKA 4F09A 4O21A 4CV9A 2A4LA 4RPVA 3ANRA 1ND4A 4XP0A 1Y6AA 4AF3A 3QX2A 3AOXA 4I41A 1PXNA 5EHLA 5DE2A 2BMCA 4C7TA 1IEPA 4FTQA 2QR7A 2HIWA 4EQMA 1OIUA 4WUNA 4ZTSA 3F3ZA 4BWPA 3PXFA 4MBLA 3PP0A 4OT5A 3AQVA 5EK7A 5FEEA 4GU9A 4KINA 3R9DA 5IH4A 3A99A 3D7TB 5BVEA 4DEBA 1Q8UA 4TY1A 3ZZEA 3DKCA 2IPXA 3P08A 4UZDA 3SW7A 5H8GA 3HA8A 3F61A 4C4HA 2R0UA 5ANGA 4HCVA 2WU7A 4IDTA 4IVBA 1SM2A 1RQQA 5M44A 2C1AA 3FMMA 4O6LA 3RZBA 4YJPA 3QWJA 2HZ4A 3FI2A 4CXAA 3NYVA 3V6RA 4D58A 4DEAA 1QPEA 3MFRA 3FMEA 4FKQA 4IIRA 4DG3E 3FYKX 3QRUA 5IQEA 3D94A 2CCIA 3QQHA 4GT3A 1DAWA 1CTPE 3QUDA 4Y5QA 4BI2A 4ZLZA 2OBJA 4FBXA 3FI4A 3ZLWA 4HGTA 1R0PA 4X3JA 3EQGA 3OCTA 4NIFB 4PY1A 4EYJA 5DBXA 1JWHA 2VTOA 2BRNA 4QP8A 2WMUA 1H4LA 5DG5A 3VUDA 3TKHA 2OH4A 3K54A 3RPRA 4KABA 2R3NA 3F2NA 4ZZNA 5DYJA 1U54A 2R3JA 1VZOA 5GZAA 3R02A 4DYMA 3MA3A 3NNWA 4QQJA 5AX3A 4MF1A 2PZRA 2X8DA 4F7JA 5E9EA 3KC3A 4GRBA 2BHHA 1P2AA 4XRLA 4OTGA 3FZSA 3O7LB 3OP5A 3R1SA 1XHAA 3AT2A 3PVBA 5CXZA 1GZ8A 5I3OA 3FSFA 1HOWA 2VTJA 5DH3A 4IAYA 4JLCA 4MQ2A 4E26A 2VAGA 4AFEA 5J1WA 3TZ9A 4RVMA 4DGLC 4QP1A 1QCFA 3QL8A 1O6LA 2Z7SA 4JQ7A 4O84A 1IR3A 3KB7A 2Z02A 2C5NA 2CKEA 2VV9A 2VX0A 3NCGA 4E20A 4M0ZA 4ZTQA 4IFGA 5HD4A 5JFSA 3CSVA 2DQ7X 4QMYA 3Q4TA 5A4CA 5AUXA 4FV2A 1GZOA 2QO7A 2C4GA 1OVEA 3EKNA 3FDNA 4JDJA 4C34A 2Y4IB 2EXEA 5HE0A 4LGHA 3FPQA 3TNHA 3QCSA 5KMOA 4AE9A 3U54A 4X2FA 3RGFA 4DINA 2GNJA 3WE4A 2C0OA 2UW3A 2PUPA 4WG4A 3V5WA 3QZGA 3PZHA 5IQCA 5D41A 4I0RA 1R1WA 4RIWA 4XS2A 4L3LA 5DT3A 2UW7A 3P5KA 4G3CA 4U6RA 4JR3A 3TUCA 2HW6A 4FNYA 2BIYA 1OPLA 5E8XA 4EK8A 3OCGA 2F4JA 2WO6A 2BZJA 1O9UA 3FZTA 4YTHA 4HYHA 1OMWA 2REIA 2YM8A 3PA3A 3PJ3A 3ZFXA 5B7VA 4N57A 4OAUC 3AXWA 3EZVA 4ANNA 3CKWA 3R6XA 5AP1A 3VULA 5IDNA 4O7RA 2W1ZA 4I20A 2BRBA 1YXSA 3SW4A 3UZRA 3TV6A 1Q4LA 2QLUA 4CYIA 2IZSA 2R7IA 1IASA 3C4WA 3UC4A 2OF4A 3HP5A 4YPSA 2J4ZA 3D2KA 5FXQA 4E6DA 4UALA 1PW2A 4PL5A 4J71A 4Z3VA 5HLWA 4RA5A 4K1BA 4JL9A 4KIOA 3A4OX 4BCNA 4F70A 1GZKA 3ZOSA 1CKPA 5HZNA 3GEQA 5HCYA 4DF3A 2WTVA 5EYDA 4X2JA 5DEYA 5CU2A 4KWPA 4BGQA 3MGYA 5K9IA 3E88A 4PNIA 2YJRA 3OVVA 3REPA 3KMWA 3QTWA 4A06A 2CNVA 3BKBA 3TJCA 1OKVA 4RIOA 4ZSEA 4DCAA 4C35A 3FI3A 1VYZA 3ZFMA 1RE8A 4I6BA 2X2MA 4IW0A 4YO6A 3DCVA 4ZSGA 3VBVA 3W1FA 5AUUA 2BDJA 3ZM9A 3BU3A 4RX9A 2UZEA 3KRWA 2O0UA 3KXMA 5F9EA 5K5XA 4QNAA 2UZWE 1YXTA 3NUYA 4Z7GA 3NVKI 2OIQA 3ZRLA 2VRXA 4KS8A 3RHKA 4R78A 2O64A 4C61A 4FIIA 2ZV9A 1JKSA 3LXNA 3QC9A 3PIZA 4I5CA 1Z5MA 3UIMA 2ITNA 2J90A 5AR7A 2G01A 5ETFA 3FL5A 4NW5A 4TWPA 3D0EA 2JAVA 4CFUA 3UVRA 2JFLA 2IW6A 4IWDA 4DE4A 3DBCA 4FKTA 5F4NA 3VS7A 3CPCA 4M8TA 5K3YA 4FODA 2B0QA 5DEWA 4RQKA 3PG3A 4S2ZA 3CBLA 1WZYA 2PVRA 3GU5A 3L9PA 3WE8A 4WBOA 2C6DA 4TNDA 3Q32A 5FM3A 3FHIA 4KBAA 4RC2A 4BHNA 4KSQA 4C4IA 2XF0A 3A4PA 4YHFA 4E1ZA 2HZ0A 4QMOA 2XNMA 4QMSA 2HZNA 3KXGA 5E92A 1REKA 3N4TA 3S1HA 4UMQA 3GGFA 3VN9A 4BYIA 4GS6A 1H26A 4J53A 4JDIA 3ZO1A 3GI3A 3FKLA 2Q83A 4ZJIA 5F95A 4YZMA 1QPJA 3PXRA 4O2ZA 4EKLA 1PHKA 3LJ2A 4IAIA 3ZM4A 5CEPA 2VU3A 1Q8TA 3SKCA 1E1XA 4BKZA 2BKKA 2CKQA 5IMEA 4KSPA 3FL4A 4TZRA 3FXXA 4A9YA 4GJ3A 2XM8A 4ACHA 4DH5A 1KE6A 5CU6A 2NRUA 3QQUA 2PVJA 3BPRA 4DH1A 5CAUA 2WTIA 2XIKA 4L67A 4CZYB 3TNPC 1FGKA 3OT8A 3FSKA 4D0WA 3P23A 1H24A 3KRJA 1REJA 3KXNA 4EOOA 3NUSA 5M51A 4XEYA 2BZKB 3SXFA 3JUHA 5KKRB 5KUPA 3TZ7A 2X2LA 3ZMMA 4DGMA 3C4FA 4D2TA 3BBTB 4EI4A 1PYEA 2CDZA 5CENA 3LPBA 2AYPA 5CVFA 2J51A 2QOHA 4ZY5A 3V01A 4I92A 4D5HA 2UW5A 2RL5A 2G9XA 3LW0A 5EDQA 3SGCA 1JKKA 4K0YA 2KULA 4I0SA 3MBLA 3W8QA 2F57A 1JPAA 5I9WA 1KSWA 3WARA 3MB6A 5EFQA 4AW0A 5J9ZA 2PVFA 5M07A 3NCZA 4TT7A 2JDTA 2Z2WA 4KA3A 5C4LA 3VRZA 3O50A 3HX4A 3U51A 4FZDB 4E4MA 4J1RA 2BUJA 2AC3A 4NSTA 2JIUA 2CGVA 4J97A 4G3GA 3VVHA 3OROA 4DITA 5BVWA 4RJ6A 5FTOA 3GCSA 1ZMVA 5ICPA 3RWQA 3G9NA 5AR5A 4APCA 5JSMA 4L68A 2R3RA 2W1FA 3UMWA 2YIWA 3DDQA 2VUWA 1LEWA 1U54B 2ERKA 3O8PA 5CASA 3OBGA 5JGBA 3BLHA 3FZ1A 3RAIA 3VS3A 1J7IA 4AW5A 3FI8A 4C3FA 5HKMA 3CD8A 2BZIB 5AJQA 4FG8A 2R3IA 2WQNA 3LCDA 3NVMB 3UODA 3NAXA 2Q0BA 3W55A 5C03A 2QOOA 4DBNA 1LEZA 2BVAA 3GC8A 4AT3A 3IQ7A 1CMKE 3DZOA 4MYGA 4NM7A 4O0WA 4XJ0A 4GMYA 2JIVA 4MNEA 2IVSA 4JS8A 5I0BA 4MXOA 2WQOA 1JOWB 4CYJA 3MS9A 1GNGA 1Q24A 4PMTA 2O2UA 3S3IA 3R71A 3BV3A 3ZRKA 2RFDA 4RIXB 5CF6A
chains in the Genus database with same CATH superfamily
3SHEA 4TRLA 2OW3A 4KIQA 1Y8GA 4FSYA 1PMUA 4FTCA 3T9TA 4PPBA 2ONLC 4FEXA 4FEQA 2AEGA 3R22A 4F7NA 3SV0A 3ZCLA 4AN2A 3QWKA 3UBDA 3NEWA 1W8CA 4L42A 2R4BA 3Q04A 3ODYX 4R7HA 4WNMA 4YZBA 3F3UA 4FKWA 1CDKA 4HYSA 4USFA 1OGUA 3KVXA 3LFAA 4OTWA 4RIWB 3I60A 2FSLX 5FD2A 1TQMA 2ZFYA 4QEBA 3I79A 5HNBA 2YERA 1IAHA 4L6QA 1RDQE 2X7OA 3P7CA 5KCVA 1IG1A 4AP7A 3NMUF 3KN5A 4IB1A 4BWXA 5CU0A 2X4ZA 4IEBA 3CC6A 5E8UA 4W9XA 2XIRA 1S9JA 4DN5A 4OTHA 4FKSA 4QPAA 1JKTA 4YGAA 2IW9A 3OTVA 4RMZA 4UYNA 3UG1A 5A4EA 3KQ7A 4FSNA 5BVOA 1DAYA 5HX8A 4B4LA 1V0OA 3SVVA 3PVGA 1FQ1B 3CLYA 3POOA 4DFUA 5D1JA 1WMKA 3KRRA 4S32A 3DNDA 3F5UA 3RK9A 3EQFA 2ZVAA 3L8SA 4NEUA 5AR8A 4D1ZA 3M2WA 2EB2A 2F9GA 3KMUA 4ASXA 2WU6A 5EYKA 3JVSA 1G5SA 3KCFA 4AXEA 1XO2B 2PMIA 5IQHA 3S95A 4PX6A 5AAGA 2IW8A 1G8KA 3ALNA 3VRYA 4CFNA 3EYGA 3SX9A 2OJ9A 2XNOA 3P78A 1UVRA 3CGOA 5LXMA 5DWRA 2JLDA 4PMSA 3H3CA 2UW6A 3VUTA 3ROYA 3TV7A 3ZUVA 4XP3A 2OI4X 2XNPA 1AD5A 3MA6A 1BLXA 1GIJA 1VJYA 5I9YA 5HLNA 2CGXA 5I4NA 4H3PA 2X9FA 3O17A 5HO6A 2XK8A 3MY1A 4RVKA 5EM5A 3QTZA 2ZV8A 3C0HA 3ZC5A 4HYIA 2BZHB 3GNIB 4DT9A 3U55A 1ZOGA 3PWYA 4GYIA 3F2RA 5L8KA 1WBPA 2VTTA 3JY9A 2GS6A 3QLFA 4R5YA 2QCSA 4PDYA 3ZO4A 3VS5A 4UN0C 4QDVA 3SDJA 5EHOA 5E1SA 4TW9A 3VF8A 3KA0A 3MH3A 4JVGA 3WF5A 4U81A 3ACJA 3U4UA 2WD1A 2PE1A 4QMQA 1H0VA 3A62A 4DEGA 3RAWA 3FYJX 4QP9A 3BBWA 5IA0A 2J50A 1GOLA 4R5SA 4O1OA 3A61A 3LQ8A 3BYMA 1NVQA 2QONA 4IMYA 2W9ZB 2QI8A 2JBPA 2QURA 3HDMA 3CEKA 3UZPA 3GOKA 3L9LA 3IG7A 2HELA 4Q9SA 5G1XA 3LFQA 3CQUA 3A7FA 2R3LA 4IB3A 1XR1A 2BCJA 2P33A 3F3TA 3LFDA 3DKGA 2GQSA 3KMMA 4JBPA 3KF7A 1V1KA 1ZYDA 2FH9A 3RHXA 2YAKA 3F6XA 5KMLA 1XH6A 3MWUA 3WF7A 4FL3A 3FXWA 4FX3A 3UYSA 3PIXA 5CXHA 5IA1A 4O7NA 2IO6A 3R9OA 3RMFA 2DUVA 3OXTA 2QQ7A 3VO3A 2WTKB 4AOJA 3I1AA 5AADA 4ZMEA 2UVXA 4WRSA 3EFKA 1PXKA 4FZ6A 3SXRA 3ZXTA 2NNWB 4UMPA 1S9IA 3H4JA 3BIZA 4DGOA 4DLJA 4GFMA 3P5JC 4WO5A 2PL0A 3QA0A 4Y8DA 3TT0A 2BTSA 4O0VA 4FEWA 1WBWA 4F0FA 2WIPA 3IO7A 4RBLA 5C1QB 3DY7A 5AUZA 2QOCA 2E9UA 2I0HA 2W17A 3H9RA 2JIIA 3MTLA 3UTOA 2UZTA 3FLNC 5LWMA 4XHKB 4D2RA 3CJGA 5HE1A 4FKVA 3Q53A 4QP4A 4U97A 4J8MA 4LFIA 3OOMA 4I93A 3A60A 4II5A 3RP9A 3CTJA 4YHJA 4FUXA 2LAVA 4FICA 3O71A 4CFWA 3R7IA 3QZIA 2UVZA 4JG7A 4CMUA 4WG5A 3VIDA 5IQIA 4CZUA 3QX4A 4EUTA 5HVKA 3LFSA 2H8HA 4BTFA 3LCTA 4LYNA 4MEDA 4XG2A 5F20A 4CKIA 4RJ3A 1VYWA 1Y6BA 3TEIA 4KUJA 3IW8A 4V05A 1YHVA 1BI7A 5HE2A 1B6CB 5E8SA 3BLRA 1PXPA 1ZAOA 4FF8A 2W5HA 4FV4A 4M3QA 2E9NA 4N6ZA 4PL4A 3OFMA 5FRIA 1XH9A 2BROA 1M7NA 4EK6A 3SAYA 2GNIA 3RNYA 5I9ZA 3VHEA 4XH6A 4F9WA 4HPTE 3I81A 3KY2A 3GP0A 4NH1A 2HY81 3WOWA 3TDWA 2BHEA 1G8AA 3BQCA 4EH9A 2CNUA 4FEVA 5JKGA 2DS1A 4ARKA 4DFZE 3MW1A 3HV5A 2NRYA 2P55A 1FBNA 1JSUA 4NZWB 2QLQA 4LUDA 3AC8A 3FC2A 4IJ9A 4UYAA 3BL7A 4EKKA 1Q97A 4MNEB 4USDA 2P2IA 1URWA 4P5QA 4B8MA 4FL1A 2R3KA 2OK1A 3PXYA 5ANOA 1KUTA 5AAFA 1MUOA 3F9NA 5IQGA 4D2WA 1JBPE 3DTWA 5C9CA 4EC8A 3W2OA 5EQPA 3F5PA 5GZ9A 4XOYA 5LCKA 2V55A 3CGFA 3TNQB 1XBBA 1ZMUA 3BX5A 2A27A 3D5UA 1GIIA 4JOAA 3JVRA 3C5IA 1BUHA 1YKRA 5T6KA 2BDWA 2W1EA 2F7EE 1MRUA 5ANKA 3TUBA 2PU8A 2GPHA 2QHNA 4FK6A 2IVVA 4FNXA 4QO9A 2W06A 3MH0A 4X2NA 3G9LX 4ZXTA 2IVTA 2WTJA 4RJ5A 2XJ0A 5KMJA 4AXDA 4D9UA 2JDOA 4EUUA 4O86A 1CSNA 2IVUA 4KD1A 2VTPA 4O4DA 5E8VA 4Q5HA 2Y0AA 1DM2A 4FR4A 2UZLA 4FIHA 5B2KA 3UZTA 5C27A 1OL6A 4FV3A 4YZNA 3ATSA 1H00A 1O6KA 1Q5KA 1U46A 2VWUA 3F7ZA 5CSXA 4ZY4A 3QKLA 4O83A 4OBQA 4TTHB 4EOSA 3Q96A 3U6IA 4BR3A 3F88A 2VD5A 3GC7A 3QLGA 3FLZA 3VBTA 3EQRA 4ALUA 4G16A 4C2WA 2DWBA 4G9RA 5AP5A 5HVJA 3NUAA 3HA6A 1U4DA 4O4EA 4BIEA 4S33A 5LJJA 1TVOA 3DQXA 4AW1A 1H01A 4NM3A 4C58A 2PUUA 5H8EA 4BB4A 1XMMA 3ENMA 4FV9A 3H10A 3E62A 2X9EA 2ETRA 5BMMA 5I9VA 4A07A 3NZ0A 4LMUA 1GIHA 1P5EA 4AZWA 4MAOA 4O0TA 3ZEPA 5A6OA 3IONA 4ZSLA 3TZ8A 2GU8A 2HY0A 2XALA 2GTNA 2XBAA 3TV4A 4R77A 4HJOA 2OJJA 3AD5A 3BHUA 3VBWA 3E64A 3OY1A 2R7BA 3PLSA 4GVAA 1XWSA 3GC9A 3AC2A 2QKRA 1FINA 3HDNA 4FTIA 4LOQA 4GK4A 4JG8A 5B2LA 4D2VA 4N6YA 1OL7A 4WNKA 4LG4A 3UNZA 1XH8A 1SMHA 5CQWA 5DR6A 4MD8E 3UE4A 2YACA 5IISA 2XEZA 1R0EA 4YU2A 4IC8A 2VWIA 4FYOA 5JZNA 1WVWA 2NPQA 4IADA 4MH7A 2XZSA 3HL7A 3W8LA 1NVRA 4ASZA 2C5XA 2ONLA 4DG0E 5HIEA 3SLSA 4FK3A 4QT1A 5J1VA 1YVJA 5DT0A 2H6DA 4D1SA 4K11A 2W1IA 1J1CA 4GH2A 3B8RA 3T3UA 4F9BA 2HENA 3BL9A 4ALVA 4DDIA 4IWQA 4GFOA 1ZRZA 4ZK5A 2C47A 2HWPA 2XNGA 3NUUA 4O2PA 3H0YA 3QU0A 3C50A 4F1TA 3I5ZA 4P2KA 4TYEA 2I0EA 2UZOA 3AC1A 3RM7A 3DAKA 4FOCA 5M4FA 3ENHA 2BAJA 3QBNA 5GIOE 3T3VA 3RAHA 5KMKA 2WQBA 3ZH8A 2F49A 5EKOA 2Y6OA 4U45A 3WF9A 4EOQA 3O2MA 1JVPP 4FE2A 3DK3A 4AOTA 1OBDA 3HUCA 1B38A 1OKWA 2PVHA 3II5A 3PJ2A 5CWZA 2FSTX 3FLSA 4KAOA 3VBXA 1AQ1A 5DT4A 3ZBXA 3QKKA 4Z7HA 3CKXA 4FMQA 4ZJVA 1H28A 2HCKA 4O7LA 4YJOA 4E6AA 3ITZA 2XCKA 3SOAA 2J7TA 3PFYA 2A98A 3FZPA 3EIDA 3RPVA 4IX4A 3QGYA 5CLPA 5LQFA 5ETCA 4NKSA 4O82A 3EB0A 3U6JA 4TYGA 2VO3A 2BRHA 1Q8ZA 2XB7A 3KGAA 3R9HA 3ZLYA 5GJGA 4H58A 3L9MA 4D4VA 3HMMA 4CQGA 2OFVA 4MKCA 5BVFA 5JGDA 3RJCA 3G6GA 1Z9XA 1UU3A 2ITUA 4KB8A 4DFYA 3U4WA 3P7BA 4J98A 4M15A 4IVDA 2B1PA 5CT0A 3W0PA 3HMNA 4AS0A 3HMPA 3Q6WA 4FSRA 2OKRA 4O0XA 3K5UA 4QYEA 3FY2A 3ULIA 4E4LA 2WMWA 3QQFA 5J9LA 2OU7A 5A4LA 3IDCA 1F0QA 4CV8A 4ZTRA 4YTIA 2AC5A 4O96A 2A2AA 2PWLA 4FNWA 2W7XA 4GW8A 4M84A 4AXAA 4F1MA 5BUIA 5J79A 5AUTA 5GHVA 2OWBA 3MIAA 4JRNA 5IQFA 4G9CA 1R3CA 2QODA 4Q5EA 3GCQA 4GUEA 4DGNA 4BBFA 3CY2A 1Y57A 2W5BA 3FMJA 2VTHA 4DHZA 3PSBA 5I5ZA 3EYHA 3OEZA 3VBYA 4X7QA 4MVFA 5BV3A 4FTAA 3W2CA 3ZDUA 4ACMA 5IA3A 4KRCA 3UP2A 1PY5A 2W1DA 4HYUA 3VS2A 4MXZA 4C3RA 5BNJA 4AU8A 4RA4A 4BKJA 4TYHA 3IW4A 4BCGA 3UYTA 2HOGA 4BKYA 3DNEA 4ZTHA 1DI8A 1M7QA 2W96B 4CFMA 3ZUTA 5CEQA 4FL2A 4ZLOA 1W2DA 4EONA 4PNKA 5B2MA 4AFJA 1YQJA 3R7EA 3FBVA 1OGYA 2OIBA 4C3PA 3JYAA 1W0XC 4YLLA 5FTQA 3D14A 3VQHA 4D9TA 4HZSA 4G3DA 3BGZA 4QQ5A 3VAPA 3H0ZA 3D5WA 2LGCA 3OXZA 4IAAA 5IEYA 3KREA 4FTRA 1ZY5A 3L8VA 3LE6A 4AWIA 3IS5A 4DH8A 2RF9A 2Z8CA 5CEIA 4C02A 4CEGA 3PZEA 4L53A 5G6VA 2ZOQA 4YURA 1FVTA 2O63A 3D9VA 3D7ZA 4IH8A 4NTSA 4LL0A 4QNYA 3SRVA 4ASDA 2X0GA 4ASEA 4CRSA 4ACGA 3BWFA 3FV8A 4XP2A 4ZP5A 4OLIA 2C5VA 3Q9ZA 2XARA 5JH6A 2YZLA 4DFXE 3LQ3A 4PRJA 4BIDA 2XNBA 3LMIA 2YM3A 4AGUA 3QTSA 1Q3WA 3E8CA 5AR3A 5HBHA 3QCYA 4XOZA 4WKQA 2HXLA 5L8LA 1XJDA 4LRJA 3CXWA 3UOJA 4U8ZA 3QD2B 5M06A 2FO0A 4X0MA 1YWVA 3EN7A 3ML1A 4FKRA 4I4FA 5D7VA 2PZPA 2R9SA 3MIYA 3BV2A 4A7CA 5HESA 2VWZA 5EYCA 3UJGA 5A46A 3TUDA 1FPUA 3IW7A 2XVDA 5A9UA 4LQMA 2OICA 3QYWA 1VEBA 3UG2A 3UDZA 5DHJA 3O23A 2Z7LA 3CTHA 2XK6A 3ZU7A 5JFWA 2WMBA 1MQBA 3GBZA 3PDTA 3FZOA 1UWJA 5TOZA 4NT4A 2UZNA 3W10A 4CRLA 3EH9A 3VUMA 5HIBA 2EU9A 3FXZA 2CMWA 4RC4A 1SNXA 4DEIA 3BYUA 4YJUA 4I5MA 1JSTA 5JQ8A 3W2QA 5FEQA 4MHAA 2ZMCA 3A7JA 2WNTA 3BHHA 4IJPA 4C59A 4C36A 4Y95A 5L6OA 3GQIA 2IZUA 3UO5A 3UOKA 2C1BA 2J9MA 3LJ0A 3COMA 2QVSE 3ZEWA 4EZ3A 4R8QA 2I6LA 1YOMA 2VTAA 3EN4A 1IAJA 2G2IA 4W4XA 5E90A 4R7BA 1BI8A 4ITJA 4AX8A 3OY3A 4FRFA 4O1PA 3OWPA 1V0BA 4DDGA 3OWJA 4HVDA 1W7HA 4H05A 4FI1A 3WZKA 3WZUA 3QF9A 3FMLA 4BCFA 5FTGA 4FOBA 3CQWA 4P7EA 2OG8A 4C37A 3OW4A 4ZMFA 2DYLA 4TNBA 4QTCA 3MFTA 5CEMA 1H0WA 5DLSA 4M67A 3NS9A 2CNQA 4FZAB 3Q4CA 2PHKA 3L9NA 3RPYA 1NA7A 4O7WA 2XNEA 3V6SA 4FV0A 3CCNA 5L8JA 4CGAA 3LCKA 2W05A 2XA4A 4N70A 4C57A 4Q9ZA 4OUCA 5CQUA 3QUEA 5FP6A 2YWVA 2RKUA 4LRMA 5TE0A 2WAJA 3W2PA 3AD6A 3E93A 4MWHA 4RWKA 5M08A 2Y8OA 2UZUE 5K0KA 5DN3A 4ACCA 4O4CA 4OR5A 1ZWSA 3OMVA 3M1SA 4A9SA 5CSHA 4C0TA 5A54A 1L8TA 5CAVA 4C2VA 1Q8WA 4WNPA 4X2KA 5DRBA 3V8SA 3P79A 4F7SA 5M57A 3HAVA 4JT3A 5HCXA 1Q62A 2X0PA 2OF2A 3LFCA 3R28A 2XBJA 3ZS5A 5M4IA 4XV2A 3ZO3A 5LVMA 4RJ8A 2PY3A 4E6QA 3OEFX 3E8NA 5LMKC 1WVXA 4QPSA 4GKIA 5J87A 4LDTA 4MUQA 2WQEA 1PKGA 1M14A 3UDSA 3R01A 4WHZA 2QU6A 4U5JA 4HPUE 2OJGA 3ET7A 4BCPA 4H36A 4HZRA 1FVVA 3AMBA 3IDPA 4JQ8A 3LVPA 2QG5A 4B7TA 3RNIA 4I4EA 4CD0A 4AW2A 3BQRA 4EH6A 4BZDA 5D10A 2P3GX 1UA2A 4RFYA 4AN3A 3DA6A 2WTCA 3P9JA 5JRSA 2CHLA 3G0EA 1YOJA 2QNJA 2YHVA 4UV0A 5EOBA 5BQ0A 4KNBA 2HAKA 3LFBA 4PDSA 3UO6A 3OOGA 4ZS4A 4KBCA 4V01A 4UMTA 2X81A 4AA5A 2SRCA 1FGIA 1PXLA 1I44A 3BYVA 4WG3A 2HW7A 3PPJA 5IU2A 4BFMA 4WBBB 5JT2A 4K8AA 2EUFB 3S0OA 4X21A 2CN5A 2YN8A 3MY5A 5LARA 4LV7A 2C0IA 3IW6A 5D11A 2B53A 4EOLA 4RFMA 2BPMA 5CEOA 4GVJA 1OPKA 4YBKA 1W84A 3DXQA 2XMYA 4IX5A 3SXSA 4WD5A 2GNHA 5IG1A 3FKNA 2J0KA 4LV5A 5H2UA 4RT7A 3F66A 5I9UA 5CAOA 4NJ3A 1R78A 1OKZA 3WYYA 3ZO2A 5J9YA 5L4QA 3MYGA 3LKMA 4GL9A 4UB7A 3TTIA 4AT4A 4BDFA 3I6UA 5J7BA 3WI6A 3QD4A 4DFLA 4AXCA 3MPTA 4Z9LA 3AGMA 2YABA 3BGPA 3DBFA 1TZDA 1ZZ2A 2O8YA 4RWIA 3QHRA 2X7FA 4O7YA 3DB8A 2GFCA 4MXYA 1ATPE 1ZARA 5AWMA 5D9HA 3ETAA 3OF0A 4C4EA 4D5KA 3IDBA 1W98A 4FIFA 4GT4A 4L00A 2YCFA 3GCUA 4FZ7A 3BI6A 3NRMA 3OC1A 4H1MA 2C6MA 5E7RA 1SVEA 3G33A 3POZA 4YP8A 5BYYA 3GU8A 3O0GA 2I40A 1LUFA 2RFEA 4BDDA 4MD9E 4TYHB 2ITQA 3DFCB 3EQHA 3EQPA 3FY0A 4ZAUA 2Z60A 5AP3A 3ODZX 3UPZA 4PWNA 3TTJA 1KOBA 3DAEA 3AC5A 4IB5A 3R04A 4FT7A 3C1XA 4IZYA 3LXPA 4RJ4A 5CF5A 3C4XA 2ERZE 3TG1A 2E2BA 4QMMA 4I0TA 3RVGA 3UOHA 2PVKA 1HCLA 4DEDA 5KX8A 1SNUA 4WIHA 5L2WA 3IGGA 3BU6A 3MVJA 4C8BA 1KWPA 3DKFA 3RM6A 4O22A 3BE9A 4C62A 4AAAA 4CCUA 2EXCX 3NYXA 4CMOA 4YJVA 4BDGA 3UO4A 4GFGA 3VBQA 4BDIA 3Q3BA 3SRVB 4I21A 4RFZA 4IX6A 4YZCA 4EHEA 5BYZA 2VWWA 5IZFA 3I7BA 4I5PA 4OBOA 4RJ7A 2J6MA 4FKGA 4BDAA 2WEIA 1QPDA 5FXRA 4OTDA 5AUYA 4EZ5A 5A14A 3SC1A 3I0QA 3ULZA 4LV8A 3WZDA 3QCQA 4JBOA 3R63A 1BKXA 4B9DA 2BRMA 2IWIA 1H07A 2R3GA 5ANDA 3ZYAA 2R3FA 3JY0A 5KZIA 2FB8A 2YIQA 5JRQA 4J7BA 5M53A 4BCMA 2C6OA 3PFQA 1NY3A 5HX6A 1WBVA 3V04A 2G15A 5HORA 2BALA 5FBOA 2GQRA 4A9RA 2B9FA 3RPOA 3DTCA 3DJ7A 1GZNA 4BCIA 3D5XA 4YUQA 3HLLA 3R7VA 4V0GA 3RAKA 3QKMA 5CSVA 5KHWA 3NPCA 4F9YA 4J95A 5AP2A 3CY3A 1KE8A 3D83A 3PRIA 4ZLYA 2XK7A 5JGAA 2VTQA 2Z7QA 3ORMA 1H1PA 4JJRA 4NKAA 1UU8A 4F1OA 3EOCA 4IQ6A 3HZTA 4FZFB 4E6CA 2C5OA 2ZB0A 4FKPA 4JAJA 2J0JA 3LFEA 2XRUA 2WTWA 5EI6A 4BDCA 4NM5A 3WIGA 2EXMA 2ZV2A 4FGRA 3C51A 2WPAA 5DVRA 5GZ8A 1IA9A 4YTCA 3GU7A 3R0TA 4BRXA 3JPVA 4B6LA 1LP4A 5HVYA 2WOUA 1XMLA 1YXVA 3CJFA 1E1VA 1KE7A 4G31A 5E8ZA 5AUVA 5T68A 3NUPA 1YHSA 5FM2A 4ALWA 1TQIA 4DAWA 1OUKA 4D4SA 2ITVA 3FQHA 5IUGA 4UY9A 3ZFYA 4YMJA 3MPMA 1X8BA 3Q52A 4OTIA 3WILA 4C33A 2VZ6A 4GUBA 3ZLSA 3BYOA 5FG8A 2EWAA 4UMUA 3KXHA 5DFPA 1JKLA 3WIKA 1IRKA 1OB3A 3PE2A 3OZ6A 4IHPA 1F5QA 5IA2A 3PRFA 4RX7A 2XRWA 3C0GA 4EOKA 4ZZOA 4DTBA 1WBSA 1E9HA 5CYIA 4FTTA 3WBLA 3NNXA 4BWKA 4JNWA 3VJOA 4OT6A 1SZMA 4H1JA 3QHWA 4KBKA 2B7AA 3IOPA 3QTIA 5AR4A 4F4PA 4IACA 1A9UA 3V5PA 4BDHA 4FG9A 5BX0A 3U8WA 4K77A 3QTXA 3VUHA 5IEXA 4E5AX 1W82A 1ERKA 3F3VA 3FLWA 2PZ5A 2RG5A 2VX1A 2ZM1A 3I0OA 4AGWA 4B99A 4LRKA 1PXMA 5BVKA 3N4VA 1YW2A 5AAEA 3TI1A 3E5AA 2ZAZA 1WCCA 2WTDA 3Q5ZA 4FV7A 5DGZA 1NVSA 2BAQA 3AKLA 1YDSE 4EK3A 5K4JA 5KBQA 2WMQA 3LZBA 3MESA 5DOSA 4X3FC 4L44A 2OFUA 4UZHA 4WUAA 2OH0E 4WOVA 1P4OA 2YDJA 3P4KA 4QTAA 3S4QA 3R7YA 4MX9A 4H3BA 4R1VA 3TNIA 4IWOA 1I09A 3SG9A 4YJRA 2JGZA 3C9WA 1OZ1A 5IUIA 4L8MA 5M4UA 4TWOA 4BDKA 1FMOE 1ZOHA 2XK9A 2V62A 2I1MA 3I7CA 4QDEA 2RSVA 4IM2A 2YDKA 4EH4A 3LFNA 3TMOA 4FVRA 2WMRA 1J7UA 4UXQA 4U43A 4EHGA 3PWDA 2YZAA 3N9XA 5EDPA 5TR6A 4DA5A 4L7SA 3FC1X 1H25A 2C6TA 3DLZA 4AN9A 4MK0A 4N0SA 4UEUA 3VS1A 4CMTA 5E1EA 4M13A 5L2IA 2J0LA 4HNFA 5T3QA 3TKUA 1BL7A 2WXVA 1SVHA 2YITA 4GCJA 4L46A 2OXYA 3TACA 4AUAA 2C5YA 1YHWA 1Q3DA 2X0OA 5E8YA 4IANA 5A4TA 2VO0A 3FMNA 4J8NA 4QYYA 3VS4A 4AGDA 4OGRA 3C0IA 4U7ZA 3AKJA 2R3HA 4JR7A 1OM1A 3IECA 2PVMA 3LQ5A 4NM0A 5FP5A 4EOJA 1PMVA 4AZEA 4D28A 2GNLA 1Q8YA 3IW5A 3RK7A 2W1HA 2PVNA 4JG6A 4IM3A 4QD6A 3V8WA 4BCJA 2PPQA 3PLAE 2XKDA 3DGKA 4TKSA 1ZZLA 3TIYA 3AG9A 3QQGA 5LVNA 3U6HA 5GIPE 3KXXA 5FEDA 4BTMA 4QMWA 4EHVA 2A19B 3MDYA 2CLXA 3P86A 5KBRA 4CTBA 1YI4A 1PMEA 1YI3A 4BICA 2ITOA 3EHAA 3A8XA 4ANMA 4YZ9A 3WYXA 3F5XA 5DIAA 3THBA 3T9IA 5DR9A 4NUSA 2JKQA 3AMAA 4FKIA 4O0UA 4YSJA 2C68A 3UIUA 4BBMA 2A0CX 3OS3A 4UBAA 1ZOEA 4CVAA 4FV8A 2YLEA 1KV2A 2C69A 3DBQA 3U9CA 2ETMA 4I24A 3ORKA 4IAKA 2WMAA 1H08A 3NYOA 4K9YA 5J5SA 4M7IA 5LMKA 4GT5A 2F7XE 4M69A 4BL1A 4GK3A 2VWBA 3ACKA 1MP8A 4RWLA 5AX9A 5CAQA 2PTKA 3BWJA 4J99A 5DI1A 5EQEA 3DXNA 3LLTA 3MFUA 3QZFA 4F99A 4ZOGA 4DBXA 2AQXA 2WMTA 3I6WA 3QCXA 5EHYA 3PPZA 4FTLA 4FTNA 4CKJA 3O51A 3U87A 3ALOA 3UQFA 3O8TA 1OIQA 2ITZA 5FDXA 2WB8A 2XKFA 4FKLA 2R5TA 3KL8A 2X1NA 5HO8A 3NYNA 3Q2MA 2GS7A 2BILB 4L52A 4U0IA 5GNKA 4UMRA 2CJMA 4HGSA 3Q9WA 4AZVA 1BX6A 3OUKA 4WA9A 3MPAA 3UDTA 3RINA 5CEKA 3BYSA 4NL0A 4G2FA 2XCHA 4Y72A 5HI2A 5IDPA 1JQHA 4FT0A 4S30A 5HQ0A 3JR1A 1UWHA 4FTKA 2PMOX 5AMNA 3RCJA 4JMQA 4R6VA 3PY1A 4XG8A 4DLIA 4PP9A 5HO7A 2JC6A 2PZYA 2V5QA 3IKAA 3OXIA 3V3VA 1WFCA 2C30A 4CQEA 4BDBA 1H1RA 4XX9A 4AE6A 4EOPA 3LAUA 2I0VA 5K4IA 5ACKA 3HVCA 2R3OA 1MQ4A 1YOLA 2YM7A 2PUIA 1SYKA 3ORTA 3K3IA 2RGPA 3DK7A 3VNTA 4U3ZA 4IVAA 1JSVA 2FUMA 4FKUA 4UXLA 3QYZA 2WTKC 2G1TA 2GHGA 4JAIA 1QL6A 4BF2A 4V0GB 4U3YA 3W18A 4CLJA 4FNZA 3LCOA 4XUFA 4TYIA 3BHVA 3E8EA 3LM0A 4YNEA 5CSPA 3HMIA 4FVQA 4XLIA 3KXZA 3W32A 5E4HA 5LVOA 4YPDA 2H96A 5J7HA 3PSDA 2ESMA 3R8UA 4CFVA 2YAAA 4EWQA 2WIHA 3DPKA 3KK8A 4J96A 3PVUA 2CN8A 3GCVA 3CS9A 4GU6A 2JKKA 3PSCA 3R1NA 1F3MC 1ZLTA 4QYHA 3IOKA 4DT8A 4FTUA 1ZXEA 5ETIA 5B0XA 3ZSHA 4AQKA 4EH8A 3G15A 2QOIA 3D4QA 4RZWA 3LMHA 2E9OA 1M17A 5HLPA 5LOHA 2XEYA 3NAYA 3IGOA 5GJDA 4JBVA 4FT3A 5HICA 3R1YA 2H34A 5I3RA 4D4RA 4LGDA 3MB7A 2OJFE 3O8UA 4QYFA 3KU2A 4U79A 4M68A 4PL3A 3HUBA 2VTLA 5TT7A 5ETAA 4FVPA 3NUXA 1CM8A 3NWWA 4ONAA 3EFWA 4IC7A 3VUKA 2PK9A 4PTGA 3QRIA 3E7VA 4HGLA 3OCSA 5M55A 2QC6A 4CG9A 5AA9A 4LM5A 3KRXA 3V51A 1G8SA 4M0YA 1BYGA 4UX9A 4PV0A 5EOLA 4ZTLA 2GNFA 1ZYLA 4M12A 4OTQA 5JEBA 1A48A 4F9CA 2X2KA 4TWCA 2WEVA 3ZTXA 1O6YA 2YM4A 3HV6A 4A4XA 2O3PA 1FMKA 4LUEA 4E4NA 3QRTA 4FTMA 4FIJA 1XH4A 4HVHA 5AV0A 3ZBFA 5LCJA 3RALA 2GHMA 4USEA 1CKJA 4QTEA 5LVPA 2JDSA 2YISA 4R3CA</