4C4FA

Structure-based design of orally bioavailable pyrrolopyridine inhibitors of the mitotic kinase mps1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
280
structure length
254
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQQVGVNYMPPEAIKDISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Structure-Based Design of Orally Bioavailable 1H-Pyrrolo[3, 2-C]Pyridine Inhibitors of the Mitotic Kinase Monopolar Spindle 1 (Mps1).
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 254
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2013-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c4fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c4fA01
3TM0A 2XRUA 4IXPA 2OK1A 4D58A 2KTYA 2F49A 1MRUA 4L46A 2ONLA 1Y6BA 4KKHA 4HW7A 2RL5A 4ONAA 5E8YA 4Z3VA 4DCAA 1PMUA 4I4EA 3W55A 1IAJA 4JJRA 3A61A 1G5SA 4TWOA 4CQEA 4MAOA 5ANJA 4BKZA 1SM2A 3F7ZA 5EQYA 5HVKA 5BUJA 3FWQA 4FX3A 4N57A 4QP7A 4BCIA 2CJMA 2DQ7X 4UALA 1W83A 2ZV9A 3PWYA 4EHEA 3AD4A 2VX3A 2X39A 4FZ7A 4CT2A 2WTCA 3WARA 2CGXA 3QTUA 3OW3A 4FZDB 3F5XA 5DEYA 4EQCA 4ZTMA 2VWUA 4FTAA 3LAUA 1OGUA 3OTVA 2WMAA 2OBJA 2H9VA 4D0WA 2HIWA 2XNBA 1E1VA 4D1XA 4H39A 4V0GB 4DG2E 4R7BA 3GGFA 3R8UA 4MHAA 4L3PA 4TNDA 2QD9A 4DFXE 2G2HA 5L8LA 3TXOA 3FPMA 4FF8A 2VGOA 3R1NA 4ZJJA 2I1MA 4YLJA 2X8DA 2CHLA 2XIZA 3P23A 3I6WA 1P14A 5CVFA 4TWNA 2B1PA 4U97A 2WB8A 5CY3A 3UODA 4I24A 2PULA 5HBHA 5LOHA 2R3NA 4PTCA 1H0VA 2PMOX 4B8LA 4CVAA 2AUHA 3GBZA 4KAOA 4BTKA 3IK3A 2ONLC 4FSQA 3OW4A 4FSRA 3MA3A 3MY1A 4W4VA 5JGBA 4JDIA 4A07A 4E6AA 2IO6A 1REJA 3UG2A 3UIBA 4WA9A 3R1SA 3ATTA 4GEOA 5HVJA 2WMBA 3AOXA 1ZWSA 4FV4A 4N6YA 5CQUA 1Q8YA 2OZOA 1YI3A 4TZRA 5T3QA 1PXJA 2OJIA 2PVMA 2WMTA 5CEPA 3QWJA 3EQIA 5IEVA 3QHWA 1YXSA 4M14A 3ZZWA 5DOSA 4O82A 4O0RA 4KS7A 4F1OA 5I9VA 4G9RA 5B0XA 4WIHA 2B4SB 2Z7RA 3CQWA 2Y4IC 3ETAA 4E6CA 3DZQA 3ELJA 3R9NA 4L7SA 2XNOA 2BRNA 2PHKA 3FC1X 3GENA 3VN9A 4E26A 4CD0A 4AU8A 3COHA 4KKGA 4RJ6A 3O50A 4DH1A 4EK6A 4F9CA 4FE2A 4NJDA 5L2TA 1UVRA 4EOPA 4DEBA 5EYKA 4C8BA 4RLKA 5D11A 3HMOA 1J3HA 2XRWA 5DBXA 3R9OA 1YWVA 3GCVA 2R3RA 3O7LB 2OIBA 3UIMA 4C3RA 3HUCA 2VTJA 3OEFX 4IM0A 4X7QA 5H2UA 3AD5A 4PMTA 4R78A 1FINA 2PZIA 2ZV2A 4QQJA 4USEA 4ZSLA 3SXSA 4TL0A 5IEYA 3ORLA 4OBQA 3MH1A 3LFNA 5I9UA 3KREA 4LI5A 3TNWA 1WBTA 1OL7A 3Q6UA 3QLFA 3P4KA 4BCNA 4CMTA 2C3JA 1WCCA 2VX1A 5FEEA 1SVEA 4FOBA 4BGHA 3W10A 3R1QA 4WUNA 3S95A 1G8SA 1J7UA 2QR7A 1ZMUA 5LVMA 3FQSA 3QALE 4TW9A 3TNIA 3QAME 4FODA 3HA6A 2GHMA 3I7BA 5I3OA 2X2MA 5DR2A 4DGLC 4GG5A 3VUKA 3TZ7A 4AT5A 4BKYA 3LJ1A 4C2WA 4IX6A 4QMZA 2J5EA 3NW7A 4FT7A 2RG6A 1FVRA 5TT7A 3HUBA 4WRGA 4YC3A 4OT6A 4DTKA 4ZSGA 3DDQA 2YCFA 2YDJA 2VTIA 3SXRA 3P7BA 3OOMA 4OTGA 3AC1A 3FQHA 5HZNA 4ZOGA 3EZVA 4FT5A 3GC8A 1M7NA 3F82A 4O83A 5M57A 5DLSA 3V6RA 2UZEA 4NKSA 5CSVA 3MFTA 4KRDA 1BMKA 4YTIA 4E73A 5E8UA 4DBXA 2O8YA 3EMGA 5HCYA 3QF9A 3SOAA 3TIZA 4O0YA 3LVPA 3F2RA 2QHMA 5IQGA 5AR4A 3UVQA 1IRKA 1YXUA 4UWYA 5AIRA 3GEQA 2C3KA 4AW2A 4E8AA 3KRXA 3CE3A 4IWOA 4QP4A 2CN8A 2QU6A 5IQCA 3ALNA 4QTCA 4M97A 4TPTA 3EKNA 3PJ8A 1O6LA 5A4CA 3I6UA 5AR3A 3ORNA 3FXZA 4XHKB 4E4MA 4NWMA 2IW9A 4OTIA 2J50A 3LFFA 3LFEA 2DWBA 3MIAA 4IX5A 2HENA 1WBVA 2Y8OA 3V3VA 4R1YA 2WOUA 3LFCA 2E9VA 4X6QC 4WNPA 5DFPA 5HO6A 5HTIA 4NIFB 3H9RA 3VUIA 2UZOA 1F5QA 4K8AA 4OTDA 2VRXA 3HGKA 1QPCA 4IAKA 5CSPA 3BYVA 4AZFA 3EQGA 3R8ZA 3VRZA 2VTLA 4BCFA 3LM0A 4QMSA 2IZUA 3LXKA 1OL1A 4TYIA 5DR9A 3LXPA 1Z57A 1XH8A 3DPKA 2ITYA 5EI8A 3TIYA 4TKSA 4FKWA 2F2UA 2QI8A 2JKMA 4KIKB 3FMNA 4G34A 5D7VA 5J9LA 2Y6MA 2JDRA 2IW6A 3PZEA 4QMTA 3RZFA 5HIBA 3NUXA 4WKQA 4IC7A 4RFZA 4QP6A 1W8CA 3AT3A 2ZV8A 1RJBA 4DG0E 5BVOA 2YDKA 3WF6A 4XV3A 4A9UA 4BZNA 1BI7A 3G90X 2QG5A 5JFSA 1UV5A 3F5GA 4D55A 3PJCA 4EOLA 2QLUA 4PWNA 3UPXA 4XUFA 4R5SA 3ANRA 2BIYA 3R00A 3EZRA 3FZTA 3PVWA 2LAVA 2XH5A 3Q9ZA 5EHYA 3UBDA 3ZC6A 4EWQA 4FICA 4XG9A 5EYCA 4EH2A 4HVGA 1S9JA 3HNGA 3QD2B 3RK5A 3E7VA 1KE5A 3SD0A 3BBWA 3U87A 2CGWA 5HO8A 3FLWA 4L8MA 5JRSA 3V8TA 2YIXA 3N4TA 4U3ZA 3GCPA 5AIKA 2WTVA 1JKTA 3TI1A 1AD5A 4ZSJA 2QO9A 3UG1A 2RFDA 3OD6X 2W1HA 4DEHA 4RLLA 2ZDUA 3DQXA 3QTXA 3NUSA 4J99A 3EN6A 2PWLA 4JXFA 5LVLA 4RA4A 2VTOA 3MVHA 5AP6A 3VS0A 4IB5A 3FC2A 3FMDA 3QC9A 2UZTA 2VTSA 3OT3A 4I5MA 4J1RA 4QP3A 4IW0A 3A7IA 4J95A 4FTQA 5ANEA 3ZEWA 3BU6A 3OP5A 3AMBA 2QOFA 4RWLA 3NYXA 2X0GA 4KNBA 2JKOA 3QKKA 4GCJA 3FV8A 4KRCA 3TKUA 4IAAA 3HZTA 1Q8TA 3OCTA 1H1SA 3BWFA 4IJPA 4F0FA 3LLTA 4HYIA 2YM6A 5FP5A 3AGMA 3EQBA 5JGDA 5JN2A 3FLZA 3H9OA 3HP2A 1JAMA 3KGAA 2R3FA 4I23A 3KF4A 4ERWA 2J9MA 1SZMA 4EOQA 2R3IA 1ZMWA 3UIUA 1NVQA 1GIHA 4J97A 4RX5A 2ERZE 4HVHA 2W4OA 4DLIA 4GKHA 1O6YA 3O96A 4AOTA 3SC1A 5TKDA 3OMVA 4WT6A 3ZRKA 5BVKA 5ANGA 1B38A 2EB3A 2IVUA 3PXFA 2CGUA 2CNUA 4PV0A 5T6KA 1XBBA 4AA4A 4RVTA 3L8PA 3LPBA 3DBCA 1MQBA 4P5ZA 5HICA 5ETIA 2BCJA 1CSNA 4NKAA 3ZZEA 5ACKA 3U4WA 1KWPA 3KXMA 2BHHA 5KZIA 4E6DA 2H34A 3QRIA 4S34A 4O86A 2R5TA 4ALVA 5ICPA 4L45A 4EORA 1SNUA 2R3JA 1V0PA 2VAGA 4FSWA 5AX9A 3EN4A 3RMFA 3ITZA 3RPYA 5KCVA 2R7IA 2W1EA 5IDPA 1R1WA 3A7JA 4FNWA 3LIJA 2XYNA 4FV6A 5CZHA 4JIAA 2I0HA 3SRVB 3R9HA 4APCA 2J5FA 3S0OA 4F6SA 4E4LA 3Q04A 3QKMA 4FTRA 3HL7A 1ZOHA 5EKOA 2C0IA 5CYIA 4ARKA 5BNJA 4CZUA 5CXZA 1JQHA 4HGEA 3WIGA 5GJDA 2QOLA 2YWVA 3GU8A 3K2LA 4I6BA 4PNIA 4AOJA 4C36A 5JRQA 3BHTA 1XHAA 2DUVA 3NNVA 1GZKA 3ZFYA 3P79A 5LXMA 4J8MA 4QPSA 4QMPA 1T45A 4TT7A 1UU8A 3PP0A 5D7AA 4M0ZA 3IGGA 3AT4A 4YNOA 2B54A 2WFYA 3CKXA 3VJOA 3BU5A 1XH4A 5CU0A 2DYLA 4XJ0A 1LR4A 2YACA 4RIXA 4YZ9A 3GT8A 2GNFA 2GU8A 4YC6A 4CFFA 3FZOA 4F9AA 4U43A 4G6OA 3QXOA 3MH3A 1YHSA 4C33A 2UZWE 3P86A 2UVZA 3UVPA 4RJ7A 5CAQA 2R0UA 3Q4CA 5DA3A 3T3UA 5L2WA 4BI0A 2PVKA 3G33A 5HIEA 1U5RA 3COKA 1Q8ZA 1TKIA 4DLJA 3NAYA 1WMKA 4LM5A 4C2VA 5I9ZA 3KFAA 5HD7A 5AX3A 3BE2A 2R3GA 2BAKA 3D0EA 1QPJA 3BV2A 3O17A 2R3MA 4FTLA 4XBUA 3UIXA 2XIXA 4II5A 1PYXA 4QMWA 4C35A 1W82A 4Q5EA 4MBIA 2B55A 2P3GX 2ZM1A 3CR0A 5EQEA 4HZRA 2HCKA 4CV9A 2IZRA 2ZM3A 4G3FA 4O7TA 4RFMA 5HG7A 1ZAOA 2IVTA 3MPTA 5AR2A 4ZTSA 5EW3A 2JFLA 4LMUA 5IISA 4LGDA 2WQMA 4HCTA 4TYJA 2OW3A 3WILA 4BDJA 4BFMA 2RF9A 1ERKA 4O6EA 4YJRA 3HYHA 3G0EA 1HCKA 2XIKA 3FYKX 2C6KA 4R8QA 3KMUA 4XOYA 5J5SA 3VVHA 3ZO4A 1OVEA 3GCSA 3FLQA 4CMUA 4F08A 2GHLA 4GUEA 2GDOA 2HYYA 4WNMA 3S2PA 3R22A 5A46A 3HAVA 1FGKA 4RQKA 3HV4A 4K2RA 4PTGA 3UOJA 3R7GA 4FSZA 3CEKA 4J71A 4OTQA 4AACA 5E7RA 3VS1A 4P2KA 4C3FA 3RM7A 3IGOA 1R39A 4PL5A 3OEZA 1IA9A 1FVTA 4ZJVA 5CSWA 4LYNA 2NRUA 4D4VA 4HGLA 5L6PA 3LQ3A 2BAJA 3A8WA 3W2QA 3FKLA 3HAMA 4ZTRA 4PQNA 3NX8A 3ZONA 5FTQA 3SG9A 1YDTE 3DKFA 1U54B 3VBYA 3PJ3A 3Q2MA 2FGIA 3EJ1A 5AFVA 3RJCA 3V8SA 4P4CA 4M68A 1PXOA 3LLAA 4ACCA 3R8PA 1XJDA 3W2RA 2OLCA 4YPDA 4ZMFA 4QMOA 4U6RA 2XBAA 4FKRA 4CLIA 2XNPA 2ITTA 4K33A 4M13A 1Q97A 2PE1A 4GYGA 3N9XA 4QRCA 4O0WA 2W9FB 4ASXA 5L8KA 4WNOA 4NU1A 3VHKA 4BCHA 1QMZA 1UKHA 1UU3A 2C6LA 3KRJA 3NZ0A 3EIDA 4W9XA 4CG9A 3ORMA 1PXLA 3GVUA 3FQEA 4YJUA 3VS3A 5BVDA 2HXLA 3CD3A 4CFWA 3EKKA 3HX4A 4HGSA 4O2ZA 3PPJA 1YVJA 4BBEA 5C26A 2CLXA 4F7LA 4PP9A 5AUXA 5KMKA 2Q0BA 3PVUA 3SW7A 2ITVA 3KULB 1MUOA 4IAZA 5FUTA 3OY1A 4GJ3A 4NM0A 4BCJA 5JZNA 2WTWA 1DI9A 3A99A 2ITQA 2CKPA 2XIYA 5CEOA 4ASEA 4QMNA 5IMXA 3L8SA 4QT1A 5HNBA 4CTCA 4U45A 5CI7A 3PLAE 3VF8A 3D5VA 3Q6WA 3S1HA 2JDSA 3PJ2A 2W06A 3RHXA 3SLSA 2YA9A 4U40A 4EOIA 4MWIA 4TXCA 2C6DA 2CLQA 5AJQA 3V5JA 4AE6A 1A9UA 1KE9A 4IX3A 3SX9A 4EBWA 4X0MA 4BZOA 4K11A 4Y8DA 4AW5A 2FYSA 4FKIA 3IDBA 1YWNA 4V05A 3GOPA 4WSQA 4GFOA 3VUTA 2JLDA 4BI1A 3D4QA 4IH8A 4OTWA 1H0WA 5KMIA 4RVKA 3EQRA 4S31A 3A4OX 5EM7A 3OXIA 3VBVA 5EW8A 4ZIMA 1ZZ2A 2PZRA 4IJ9A 2XK4A 1URWA 1WBPA 1BYGA 2C5OA 5HVYA 3ZDUA 3QTZA 4PTEA 2R64A 3U6IA 1Q24A 2I7QA 5JH6A 2OI4X 1NY3A 2C5YA 2YISA 2WIHA 4DCEA 2ESMA 4GRBA 3OVVA 3TV4A 1XQZA 4M69A 3RGFA 4GV1A 4L9IA 2GQGA 3A7HA 2C3IB 4K9YA 4Q9SA 2XNNA 5GIPE 5DG5A 5CAVA 4FTUA 2A4LA 3M42A 3PRFA 3BLHA 3NRMA 3BYUA 2YCQA 3QKLA 4JG8A 4AGUA 1Q3WA 3M11A 4U80A 1I09A 5LJJA 3LFQA 2F2CB 4NTTA 4AN2A 2YCRA 3BGQA 4QMUA 4J96A 3U51A 3T9IA 2GS6A 5IH5A 5M51A 2R4BA 3ZSGA 2UW5A 5KMNA 3R71A 3GI3A 4DFNA 3OFMA 3PUPA 2VO6A 5D41A 3FL4A 1KE7A 2BRGA 4IACA 3VUGA 3FMLA 5C01A 4YZCA 3PRIA 3UYSA 1H07A 1XH7A 2F7ZE 2CPKE 4RJ5A 4DGNA 2JKKA 3DAJA 3KQ7A 3SKCA 4DHFA 3R83A 3EQDA 1VEBA 1PRYA 2IG7A 3MB7A 4IBMA 2Y6OA 4ACMA 3I60A 3LJ2A 2R2PA 5L2QA 3EQPA 3OXZA 3IW8A 3RHKA 3IOKA 3MSSA 2AC3A 4MBJA 2QOBA 2G9XA 3RBWA 4Z7GA 5CVGA 4PF4A 5J8IA 2XK3A 4D9UA 4L67A 4JX7A 5JT2A 1M2QA 3SOCA 3D7TA 4RA5A 4RGJA 1G8AA 1FBNA 4M66A 2PVLA 2UW6A 4JNWA 4YZNA 4BWXA 1P2AA 2J0LA 4FK3A 1PXIA 3NNWA 2XIRA 3HRFA 1UNLA 3U9CA 3KRRA 4YU2A 2W4KA 2JBPA 3EOCA 4XS2A 4B9DA 2X7GA 2R3QA 2PUUA 2J0KA 3QTIA 4XP3A 1OUYA 3Q3BA 4DINA 4F63A 3NIEA 5LQFA 4XRLA 3F3TA 5GJGA 2J90A 4UYNA 4IWDA 3EL8A 3FE3A 4IAFA 2ZB1A 3UJGA 3RPVA 4E93A 4ACDA 2IVVA 1XH6A 2Q0NA 2GNJA 4MH7A 3RKBA 5KMJA 4FT9A 3BYSA 2C6MA 2ETRA 4ZLYA 3TG1A 2VTQA 3BZ3A 5J9ZA 2O2UA 4JBPA 3RP9A 3IDCA 3A4PA 2Y7JA 4I4FA 4UX9A 3NNXA 5L8JA 4GK2A 4YJVA 5I9YA 2WU6A 1UU7A 4RIWA 3R7IA 3R28A 5JFWA 3BELA 3BYOA 3JVSA 3ZUUA 2QR8A 3LCKA 3PG3A 3TN8A 4ANLA 4D2RA 5D9HA 4I5CA 3DBDA 3IG7A 3RWQA 3T9TA 2AC5A 1JOWB 1H8FA 2FB8A 2X9FA 3OCGA 4UV0A 4YJOA 3WBLA 5KO1A 4ZMEA 3SXFA 4AGCA 1RE8A 4ZLZA 3EFLA 4TYGA 4EH9A 4X2KA 4IVBA 3A7GA 2R7BA 2OXYA 3VAPA 2XEYA 1PF8A 5J1WA 4D5HA 2W0JA 2WPAA 3HEGA 1ZYLA 2ITXA 3F66A 4QMVA 4EC8A 1U59A 1V1KA 3PFQA 4PL3A 3FBVA 4EK4A 5JSMA 3I79A 4XRJA 4B7TA 3HMNA 1UA2A 2BZJA 3P9JA 5AP2A 1GZ8A 4MXCA 2R0IA 4WG5A 1RW8A 3FXWA 5C1QB 3LXNA 1FOTA 3VS2A 4EOMA 5FRIA 3Q9WA 4JVGA 3I81A 4CRLA 4DITA 4ANOA 1LP4A 1Y8YA 4RJ4A 2BFXA 2G15A 5IA4A 3Q4ZA 4QYEA 3R7EA 1Z5MA 5E90A 1GZOA 3BGPA 5HE1A 2WAJA 4G3CA 3BGZA 4RT7A 5I9XA 4AW1A 3V5LA 3FEGA 3BEAA 4NTSA 4FV1A 3V5WA 2VO3A 3ZUTA 4O0VA 3LE6A 3ZTXA 3DKCA 4DGGA 1BKXA 3PZHA 2A2AA 5FQDC 3MVJA 4NFNA 1SNXA 3F9NA 4EQMA 1ATPE 3CQUA 3GQIA 3UP7A 1JKSA 4ZTLA 5E1SA 2QODA 4F09A 4L52A 5I5ZA 1JKLA 4I0RA 1PMVA 4G6NA 4A9YA 2WTIA 4B6LA 3IW5A 4FIIA 4QP1A 4ACHA 5KMMA 4MK0A 5FDXA 3AC4A 4DFUA 4A4XA 1XBAA 5HCXA 2R3PA 4CQGA 5I4NA 2PE2A 2J0MB 3IW7A 4WRSA 4NJ3A 4TRLA 5DT4A 2JGZA 4NYEA 4F7SA 4L68A 4RIXB 4W4WA 3CTQA 4DA5A 4JRVA 3MTLA 4YJNA 5IH6A 2X81A 3UMWA 4ZY6A 1CKIA 4YC8A 3H10A 2WU7A 4MXYA 3PVGA 2H6DA 5AV1A 4GFMA 4ANNA 3VC4A 4AS0A 2PUNA 3FZRA 4HYHA 5IUGA 3OUKA 2YZLA 3C4CA 5FXRA 2B9FA 3NMUF 4F65A 2QOIA 2OJ9A 4D1ZA 3DJ6A 3C0GA 4X3FB 5A54A 4EH7A 1Q61A 1ZMVA 4O81A 2QCSA 2FO0A 5DHJA 4ZXTA 4BDKA 5JK3A 3MIYA 4YO6A 2P0CA 3G15A 1NT2A 3SQQA 2ACXA 2JC6A 4HPTE 3R7YA 4IEBA 3MDYA 5FDPA 2BAQA 2JKQA 4Y5QA 2UZDA 4PDOA 4EHVA 2EUFB 2ZAZA 5TF9A 3Q96A 4D4YA 4EJ7A 2VO0A 3FHRA 4CMOA 1OECA 2W5BA 4NM3A 3MJ2A 3NCZA 4NT4A 4UMTA 4UMUA 3L1SA 4XNEA 5K4JA 3SGCA 3V5TA 4AA0A 2XBJA 3IO7A 4FKQA 2VWYA 1YKRA 3KCFA 4GUBA 1KV2A 3MWUA 4EKLA 2X2LA 5IKWA 2P55A 4MD7E 4JIKA 4PUZA 3KXNA 2XA4A 3QLGA 3QTSA 4V01A 1WBSA 1LPUA 4IFGA 4R77A 4U8ZA 3RK7A 3UNZA 4EONA 5BUIA 4ITIA 1HCLA 4DC2A 3KMWA 5M4UA 4IZYA 1GJOA 5J95A 4BDGA 2W1GA 4O7YA 1PJKA 2C5VA 5E4HA 3LZBA 2I40A 1Y6AA 1ZLTA 3F3WA 2JIUA 2WNTA 3R8VA 4F70A 3OWLA 3KRLA 1UKIA 2V5QA 3VF9A 5FM3A 1WBNA 1J7LA 2EVAA 2WOTA 2V7OA 4QYFA 1CTPE 1Q4LA 4MNEB 4CTBA 4AP7A 4DFLA 1HOWA 4I20A 3G2FA 5L2SA 3EH9A 4R3PA 5FGKA 2QURA 3WF9A 4AZWA 4KS8A 4C02A 2B0QA 3R9RA 3Q9XA 1ZYJA 4RMZA 5EK7A 4E5BA 5J5TA 2G2FA 3RWPA 3VS4A 2F7XE 1KUTA 5EI6A 1XKKA 3E7OA 3LOKA 2XNEA 3EL7A 4O6LA 4QMLA 4AZEA 2VO7A 3R6XA 3OCBA 5CLPA 1M2PA 3E8DA 2DS1A 3D5XA 5CENA 1G3NA 3PSCA 4TN6A 4YJQA 2XJ1A 4M7IA 2UVXA 4ZZMA 4TTHB 4PDPA 2HK5A 5KUPA 3NVMB 4NL0A 5B2MA 3QCSA 3DBFA 3SW4A 4I22A 4CG8A 3HRCA 2CCIA 4GU9A 3VIDA 4ID7A 4MXXA 3RAIA 5ANKA 1CM8A 4FR4A 4CYIA 4GMYA 3LQ8A 1UWHA 2BFYA 3O8TA 5EYMA 3ATSA 5ANIA 5TOZA 3TV6A 2BILB 2FSLX 1SVGA 5AAFA 3LCDA 2XB7A 2HW6A 1Z9XA 2G1TA 5CANA 2PZPA 4ERKA 5LWMA 5CS6A 4LRJA 2JDTA 4CFUA 3GU5A 4G31A 2KULA 2ITZA 5EYDA 5TE0A 3REPA 3F5UA 5AM6A 2QOHA 4H1JA 3AGLA 3QUPA 1H1QA 4UEUA 5IA5A 1Q8WA 4U9AA 4BWKA 5HG8A 4X2FA 5CU2A 3R7UA 5EQPA 4BY9E 4NSTA 5E9EA 3O8PA 4ZAUA 4QMMA 4RX7A 5FTOA 3ULIA 4DFZE 1XH5A 1YHWA 3S00A 4IVDA 5HG9A 4AUAA 3OROA 3TUCA 2W9ZB 4FKGA 2Z7LA 4FT3A 2VTRA 5BUEA 3ZOSA 4UMRA 4RJ8A 5A6OA 2X2KA 3IONA 4WSYA 4FVPA 4IZ7A 5GZ8A 4GJ2A 5FD2A 2XK9A 1H1WA 3D94A 1T46A 2QKWB 2YM3A 5ETAA 5ITAA 4ZLOA 2WTKC 4ALUA 4CLJA 4WD5A 1IG1A 4PNKA 5EI2A 3PY1A 4KABA 2UZNA 2Z7SA 5HESA 2W1CA 3CKWA 5KBRA 4H58A 4UXQA 2W17A 2ZMDA 4D2PA 2QOCA 5K0XA 2E9OA 4I6FA 2VUWA 2X4ZA 3QCXA 4LMNA 3A60A 5F20A 3MY0A 5CXHA 4ZY4A 4C3PA 2C1AA 4FEUA 2B53A 5BMMA 1OPJA 5AAEA 2OF4A 4D1SA 4KIPA 4EQUA 2NPQA 4R7IA 1NW1A 3U54A 5A4EA 1UU9A 1YDSE 3H0ZA 2F57A 1BI8A 2NNWB 3F6XA 3W18A 3ACKA 3QCQA 5LARA 4J8NA 3KF7A 2QVSE 3FL5A 3FZ1A 3LM5A 1OL2A 5HTBA 3FZPA 3CC6A 2BRHA 4XLVA 3OUNB 4R7HA 4CFVA 4DTAA 3KCKA 5C27A 3BEGA 3BBTB 4FKSA 3QGYA 4AE9A 4EYJA 5A4LA 1GIIA 2OZAB 3DOGA 4LUEA 2VWXA 3GC9A 1OUKA 4RC2A 1JKKA 3TDVA 2OH4A 4U41A 4YZMA 5K3YA 2F4JA 3HMIA 3UMXA 4FEWA 4CKIA 4FVRA 5DWRA 3LCTA 3NDMA 5M06A 4EZ5A 5HE3A 5DH3A 1H00A 2QO2A 5EW9A 2QOQA 3PA3A 4RWJA 5GHVA 4FA2A 1YI6A 4UWBA 2WO6A 4PMPA 4QTBA 4FEXA 1DM2A 1S9IA 1UNGA 1Y91A 1TQPA 2IWIA 2GS7A 2JAVA 3DJ7A 3NW5A 3L9PA 1L3RE 4PL4A 2P33A 5IQFA 4RWKA 4USDA 5IZFA 3DXQA 5LMBA 3G9LX 3GCUA 3TZ9A 3DQWA 4EOOA 3NWWA 4AF3A 2BZKB 3ODYX 3RTPA 3KN6A 2YIYA 1GNGA 3DK6A 5IA0A 3B2WA 4C38A 5CF4A 4U7ZA 3P78A 3HV7A 1YOMA 2PVRA 1YXVA 2FSTX 3F7WA 5EKNA 2WD1A 4ZTQA 2W7XA 4BYJA 2CKQA 4CKRA 1YWRA 3MVLA 5KMLA 3OBJA 2BUJA 4FTNA 4YJTA 2I0YA 4BDBA 4BDIA 4TYHB 5CVHA 2VGPA 3UOLA 3TDWA 4BGGA 3SVVA 4JX3A 3UO4A 1PKGA 2YCSA 4OAVB 5KZ0A 3QQLA 3QD4A 4OLIA 5IA2A 3DJ5A 3MH0A 4P5QA 4PY1A 4RIWB 3UQGA 4RJ3A 3UZPA 5B2LA 5HBJA 4DEIA 5L2IA 4YTCA 4K1BA 5IPJA 2C6TA 1OPLA 2BHEA 3P0MA 4B8MA 1VYWA 2YAKA 2UVYA 1E9HA 4ASDA 2QQ7A 1W84A 3R7OA 4IWQA 1J1BA 4PP7A 3UDBA 2QNJA 2QG7A 4K77A 2V22A 5FXQA 3HP5A 4XCUA 4J98A 3O8UA 4JRNA 5KHWA 3V8WA 4DE4A 4TY1A 2CNVA 3MVMA 5E8VA 2C6IA 4J53A 4NUSA 5ANOA 4RPVA 2CSNA 3OWJA 1JWHA 2RGPA 2O0UA 4DGOA 3W2PA 3L9MA 5TR6A 4V04A 4H1MA 4WOVA 2E9UA 4DAWA 2PK9A 3PXYA 3FMKA 4HCVA 4PRJA 5CNNA 5HIDA 5AUVA 1AGWA 5FBNC 2OO8X 5M07A 3C0IA 2XK8A 2WQNA 4DEGA 2JIIA 4L7FA 5CAUA 4YNEA 5F1ZA 2CMWA 3IW6A 2GTNA 4IZAA 4C57A 3BPRA 4PX6A 3C1XA 4MQ1A 3QYZA 3CD8A 4JG7A 2AYPA 3KXHA 2YEXA 4FYNA 4XEYA 3ZSHA 3QHRA 4GVAA 4EK5A 3ORTA 4LOPA 4O0XA 4USFA 5CT0A 4F6UA 5HI2A 4KINA 3K5VA 3OXTA 5IQBA 1DI8A 3K3IA 4F9BA 2Y4IB 1UNHA 3QXPA 3V04A 3PP1A 3BKBA 2PYWA 4QO9A 3FKNA 4FUYA 4MXZA 4QTDA 5I3RA 5FM2A 4JLCA 4D0XA 4A9RA 3LW0A 3FPQA 4LV8A 3TWJA 3VBWA 4NM5A 5AR7A 3TL8A 3VRYA 2NRYA 3HA8A 4MQ2A 4RG0A 3AT2A 5C8MA 4D28A 4JOAA 1SMHA 3ZC5A 5IU2A 4Y72A 4BHNA 1M52A 3FLNC 3MGYA 4O0SA 5I9WA 4RIYA 1XO2B 4S30A 4BB4A 4DH3A 3R63A 3CJFA 4LOOA 4UN0C 2C6EA 1PXNA 3O2MA 3QC4A 3OY3A 5LCJA 3CY3A 4L00A 4XH6A 3E8EA 4K6ZA 4XP2A 2OICA 3CP9A 3NUUA 4IIRA 1E1XA 4WNKA 4UZHA 4Y95A 3OS3A 1PKDA 3LFBA 5JKGA 4W8DA 1XR1A 3FDNA 4FTOA 2YIQA 5HLWA 2Z8CA 2RFEA 4OW8A 2FSOX 2X7OA 3R9DA 1J1CA 1PXKA 3KXZA 3QTRA 4DFBA 3BHYA 1CDKA 4OTRA 2P4IA 1PXMA 5AEPA 3FI2A 3NIZA 3TZMA 4XG4A 1JPAA 2ETKA 1TQMA 4FUXA 2YLFA 3ORIA 3TUDA 4FBXA 4YMJA 4FTJA 4MD8E 5E8ZA 3VS6A 1JBPE 3ZH8A 3KVWA 4GYIA 3WYXA 4DFYA 4QP8A 2VNWA 3D5WA 3EB0A 1F3MC 3W32A 5HQ0A 2GTMA 4AW0A 3W2OA 1WFCA 2WXVA 1H1RA 1LEWA 3EQHA 3OTUA 4QP2A 3RCDA 3WE4A 2CN5A 2R9SA 3HMPA 4C37A 3LKMA 4G5JA 3MB6A 4CEGA 4DH7A 2R3HA 4A7CA 4BYIA 3WZJA 2X1NA 3FLYA 2XUUA 3HLLA 1W7HA 3ZEPA 2GNGA 5IDNA 2XCKA 4FL3A 4G16A 4W9WA 5E8WA 1MP8A 4A4LA 2I0VA 3ULZA 5J9YA 5D10A 2C69A 3G6HA 2WMXA 3KK8A 4FSTA 3QGWA 2ZDTA 3ZUVA 2PMIA 3PSBA 4AGWA 2VX0A 2GNLA 3DXPA 4FOCA 1V0BA 3PXRA 3QD0A 4KWPA 3GP0A 3MFSA 4PPBA 4L3LA 3IOPA 2XKEA 3E3PA 3H30A 3ORZA 5AP7A 4I92A 4QMQA 4ITJA 1PY5A 5J7HA 4GH2A 4JI9A 4C4GA 3KU2A 1P5EA 2R3OA 3N4VA 2BZIB 4D5KA 4O0UA 4YZBA 3VW8A 3FY0A 3VW6A 4EK8A 1P4OA 4Y73A 2HELA 3T3VA 3EHAA 4FG9A 4BTFA 4TWCA 4DH5A 4ANQA 4DH8A 4ENXA 4QMYA 4KIQA 3P5KA 2VZ6A 3GQLA 2YFXA 3MV5A 1OM1A 4YGAA 4BHZA 1OBGA 2B7AA 2C0TA 3H0YA 3ZCLA 3GB2A 3FSKA 4YBKA 4GVJA 2EB2A 1R0PA 1YQJA 1YW2A 4QNAA 2VN9A 1M14A 3DB6A 4FL1A 4GL9A 5GIOE 2HZ4A 2QOKA 2VNYA 4BBFA 2WTDA 1IAHA 3VBTA 4YLLA 2PZ5A 3MY5A 4NIFA 4XOZA 3E63A 2WIPA 2C3LA 3PJ1A 4XBRA 4AGDA 4DEEA 3U55A 4MXAA 2W1ZA 3KXGA 3FI3A 4EBVA 4WG4A 5DVRA 3NS9A 4EOKA 4DT9A 1R3CA 2EWAA 2W1IA 3QX2A 2HOGA 2JD5A 3AC2A 4KSPA 2ITNA 4ZTHA 4O27B 3F3ZA 4XG8A 4FV5A 4EHGA 1VJYA 1NXKA 2A19B 3D2IA 3DK3A 3DK7A 4OTFA 4AN9A 2X8EA 1NA7A 1ZOEA 4QPAA 5AP4A 3CTJA 4BC6A 4KIKA 5DMZA 3G51A 4AG8A 1W98A 4X2JA 4F9WA 2C68A 1OKYA 4L6QA 5AA9A 4U3YA 3OZ6A 4JBOA 5H8EA 4YP8A 3BHUA 4CCBA 5FBOA 3TEIA 3COIA 4W4YA 4E6QA 4R3CA 3P1AA 3Q32A 2W99B 4FZ6A 3WZKA 2GCDA 2UW9A 2YM4A 1B39A 3EYGA 1REKA 4D2SA 4IB1A 5M44A 3ENMA 4YHFA 5CF5A 4EH4A 3RNYA 3UO5A 4RWIA 5HE0A 3IQ7A 5AP3A 4FEVA 4R1VA 3OOGA 5JGAA 4HPUE 5HO7A 5BQ0A 3MBLA 4MEDA 5KBQA 4OAUC 4IADA 3U6HA 2YM8A 1SYKA 2UW8A 5DEWA 3A2CA 4IQ6A 1O9UA 1H27A 4BICA 3W33A 5JZJA 3Q9YA 3M2WA 4FKVA 4O7LA 2VTNA 3ODZX 2X7FA 4JBQA 5K0KA 3PA5A 4F7JA 3FY2A 4E20A 4MVFA 1PHKA 2C1BA 4OBPA 1STCE 4RC4A 3TKIA 1Y8GA 2W1DA 4NW5A 5IUHA 3TKHA 5HBEA 3R2YA 3WF8A 3QTQA 3R1YA 2PVJA 1FMOE 3ZS5A 3Q5IA 2J7TA 1FMKA 4FTKA 3ANQA 3NYVA 1VYZA 3BU3A 3Q53A 2PU8A 3II5A 2YERA 3EN7A 4EKKA 5AUUA 2BZHB 4NEUA 4E1ZA 3MPMA 4WUAA 4FIEA 3UZTA 4M0YA 3QZGA 5IQIA 2RIOA 4W8EA 4N6ZA 2C30A 3GUBA 2UV2A 2YABA 4MTAA 5L3AA 3NEWA 4YURA 3JR1A 2OGVA 3WIKA 2B52A 5B2KA 1YHVA 5BVFA 4ITHA 4I41A 3CSVA 4LQMA 3HECA 1ZY5A 3GU4A 5HEZA 3V51A 4CFNA 5DRBA 2IZTA 4FC0A 5FXSA 4H3QA 3BYMA 4BDHA 2WHBA 4BCOA 1JSUA 3QZFA 3HV6A 1ZXEA 2QONA 3OF0A 2HXQA 2VTMA 3NPCA 3DAEA 4BL1A 3PPZA 4UY9A 4XYFA 3RI1A 2XM9A 4D2VA 2J51A 3R21A 3IPHA 5EM8A 5AV3A 3DTWA 3NLBA 4IHPA 4F1TA 5M56A 3QYWA 2V0DA 5JEBA 4JT3A 2F9GA 1LUFA 2WKMA 3LXLA 3R8MA 4G6LA 3SG8A 4U42A 4F0IA 3ENHA 5A4QA 2ZVAA 2WEIA 3UYTA 2CDZA 2GSFA 2B9JA 5LMKA 2BKZA 1YXXA 4MBLA 3PPKA 2HAKA 1BLXA 3EQCA 3VQHA 3WOWA 4QPMA 4QQ5A 3FMHA 3CQEA 4LV5A 3CGFA 1H24A 5HNGA 1BL7A 4C4IA 4UB7A 5CASA 5IEXA 4A9SA 4HVDA 2IN6A 3CS9A 3NUAA 3BCEA 3MFRA 1PYEA 4FK6A 4XV1A 4FG7A 4FTMA 4BKJA 3B8QA 4FVQA 1FGIA 2OXXA 1Q3DA 2H8HA 4R3RA 1ZY4A 2VTHA 3BLRA 3L8VA 3EFKA 1J91A 4HNIA 3SRVA 4ANMA 4MYGA 3PIZA 4FEQA 1WBOA 3QQFA 4HVIA 5J1VA 5AUTA 1IEPA 2QOOA 3TTIA 2ETMA 1H25A 2OU7A 2IPXA 4ZSAA 3NYOA 3RZBA 4CYJA 4DN5A 1WBWA 3CPCA 4QD6A 1W0XC 3AC8A 3GU7A 4CCUA 3QRKA 4E7WA 5AUYA 1OITA 4HGTA 3FAAA 3EQFA 4AAAA 3ZBFA 4NM7A 4EL9A 3E62A 3HRBA 3QCYA 4NW6A 4GW8A 5D1JA 3WF5A 5CNOA 4DGMA 3L9LA 2VWZA 3MI9A 2BALA 1ZYSA 3R73A 2WMQA 5DNRA 4IVAA 3UZRA 5LMKC 3BRBA 5BYYA 2A27A 1Q62A 1X8BA 1WZYA 4O0TA 4IVCA 4F0GA 3IECA 2W5AA 3FZSA 4RFYA 3IS5A 3OWPA 3TV7A 4YSJA 2VWBA 4JQ7A 5DGZA 4UZDA 3TNQB 3ZLYA 3E8CA 4BDFA 5HNIX 2PUIA 3NSZA 1H01A 2J4ZA 3ZM9A 2RFSA 2OFUA 1OL6A 3KVXA 3ZO1A 2IZSA 2OIQA 3DNEA 4IAIA 2VWWA 5IH4A 3PXKA 4BI2A 2XKDA 2RFNA 3LFDA 3K5UA 1PMNA 2GFCA 4BIDA 1OIYA 3GCQA 4Q2AA 2W4JA 1Q5KA 5AR8A 3ZO2A 4H3PA 4XMOA 5D12A 2GQSA 3DZOA 3QQHA 1JSVA 2ITWA 4PPAA 5M55A 5CQWA 4BCPA 4EWHA 5LVNA 2HY0A 2X6DA 4KA3A 3NW6A 4IMYA 3BLQA 3DS6A 4RRVA 5E8SA 2PL0A 3HV5A 3G6GA 5ETFA 3DAKA 1ND4A 3ZDIA 4O7WA 3VUHA 2XF0A 3UC3A 5C8NA 4UBAA 4E3CA 4IC8A 4FV2A 3EN9A 4BDDA 4C4FA 4EJNA 3I0OA 4CSVA 4HVSA 2WZJA 5LWNA 5C4KA 3H3CA 3UVRA 3GNIB 4BDEA 1KOBA 2BKKA 3VBXA 1XBCA 4M3QA 3FMEA 3Q60A 2H96A 4CKJA 4I5HA 4G17A 4OT5A 1ZYDA 3PY0A 3WZDA 2VTAA 3POOA 3QFVA 4U44A 4IX4A 4ZZNA 4JQEA 3ZLSA 3PE2A 3RINA 2J0IA 4FT0A 3NCGA 3DKOA 4BTJA 3ORPA 3ZRMA 3K54A 3GU6A 4DEAA 2EXCX 3BHHA 2FVDA 3DCVA 3GC0A 4HOKA 4EUUA 2V7AA 4C62A 2UZVA 1GY3A 1URCA 2UW4A 5CT7A 4Q5HA 2PMLX 3R04A 3ZSIA 4F6WA 5J79A 4ZTNA 3UPZA 3UQFA 4JS8A 5BYLA 4X21A 4G3DA 2OF2A 2PSQA 4RIYB 5FEDA 4WG3A 4Z55A 3LQ5A 3DU8A 4UXLA 4G3GA 3JS2A 4CRSA 2VTTA 1U54A 3O71A 1YRPA 4L44A 4MKCA 4PPCA 5IA3A 4XG2A 3DFAA 1GIJA 1Q41A 2BDWA 2Z2WA 4JBVA 5CEQA 4HCUA 3AC3A 4EZ3A 4O7ZA 3HVCA 4FYOA 5LVPA 4KKEA 4TYEA 5KKRC 3ROYA 4RSSA 2XK6A 1KOAA 4G3EA 3VWAA 4AN3A 2I6LA 2IVSA 4BCGA 3JUHA 4Z16A 1Q99A 3E87A 3A7FA 5G6VA 3QA0A 3VQUA 4F1MA 1V0OA 3DKGA 4QYHA 4RVLA 2RSVA 1CMKE 3EFWA 3VJNA 2ZB0A 1VZOA 4G1WA 5CF8A 4DF3A 2E9PA 3F61A 3FSFA 2X6EA 2QHNA 4GK4A 5GJFA 5E1EA 2WGJA 4J7BA 2FSMX 3O23A 1OI9A 4L3JA 4RC3A 5AUWA 4BDAA 3MN3A 4UMPA 4EH6A 3F2AA 4RQVA 3E5AA 3JXWA 4BVUA 4MWHA 3KULA 3LFSA 3QD3A 2JFMA 3FMJA 1P4FA 3FKOA 4YO4A 3WE8A 3PXZA 2LGCA 4FV0A 5L6WL 4P7EA 3QWKA 3E8NA 3W1FA 4C4JA 1R0EA 1FQ1B 1OL5A 4ZS0A 2HW7A 4TNBA 1WVXA 2ITOA 4FKOA 4BCMA 2C5XA 3HV3A 3E92A 2YAAA 2W5HA 1DAWA 2PZYA 4F7NA 4C61A 3QQJA 4FTCA 4BRXA 3I0QA 3FMMA 3KB7A 1XH9A 1CKPA 3F3VA 5HORA 3RPRA 1CKJA 3I5NA 1WAKA 4GS6A 3SAYA 3O7LD 5L6OA 4BIEA 4IB0A 4A06A 4K0YA 5CSXA 4CZTA 5CI6A 4C4EA 3HMMA 5ACBC 3EWHA 5LMAA 1ZARA 2Y9QA 1DS5A 5C9CA 2GMXA 1APME 4ASZA 4IZ5A 1QPDA 2BDFA 3NYNA 3IDPA 2BTSA 4OUCA 1NVSA 2PVFA 5LCKA 1WVYA 3ORKA 4OTPA 3MPAA 4UYAA 5CSHA 5ANDA 3GC7A 4C34A 3G9NA 4JAIA 4KBCA 4FSYA 4FGBA 3CCNA 1FPUA 4B4LA 2VTPA 2O5KA 5EDRA 1Y57A 3DXNA 3GFWA 4BWPA 4Q9ZA 4ZS4A 2IJMA 2QC6A 3O51A 3WI6A 5CWZA 1OKVA 4I93A 4O1OA 3I4BA 4YLKA 4X2NA 3M1SA 4NH1A 3TJDA 3G0FA 2JITA 3ZRLA 2ITUA 4N0SA 4NCTA 4BCKA 3VHEA 4B99A 1BX6A 2Z60A 3W8QA 3KK9A 3DB8A 4FNYA 2HWPA 3BQCA 3R8LA 4H05A 3V01A 5KHXA 2YM5A 3C51A 2YM7A 3I1AA 4HYSA 4M69B 5TO8A 3TNPC 1XWSA 4EC9A 1ZRZA 3D2KA 4M12A 3C5IA 4LUDA 1PXPA 3NVKI 2WQBA 5AMNA 5K5NA 1TVOA 5IG1A 3CTHA 5F9EA 3CY2A 3QX4A 1M2RA 3NNUA 5FP6A 4H3BA 4IM3A 3R2BA 1PW2A 4KB8A 5EH0A 5IUIA 5JQ5A 3MW1A 3LMGA 5EG3A 2YJSA 2JIVA 3D83A 1L8TA 2YLEA 3D15A 4FGRA 3UNJA 4J52A 3F5PA 4L42A 5AADA 3RPSA 3E93A 2WQOA 5FWKK 5AR5A 3QL8A 5BMSA 2CNQA 3QZIA 5HLNA 4XV2A 2Y0AA 3RCJA 2PUPA 5BVEA 3UO6A 4FV9A 3DLSA 3P7AA 3QBNA 5CU3A 2BPMA 5IMEA 4O2PA 4C4HA 4IDTA 3DDPA 3TCPA 4BIBA 4L01A 5CALA 4O7SA 5KX8A 4NCTC 3F2NA 4GK3A 4FSNA 5A6NA 3DGKA 3WZUA 4HYUA 2BIKB 2VU3A 3KEXA 3PVBA 4GG7A 2XKFA 4R6VA 4XG3A 3K3JA 4DYMA 1OKWA 4I6HA 5G1XA 4E5AX 4YR8A 5A14A 5AV4A 3F69A 4XG7A 3BHVA 3VULA 4W4XA 5AM7A 5A9UA 3F88A 4O7NA 2UUEA 4ANBA 3D7TB 3LCSA 4L43A 3PLSA 2ERKA 3GXLA 5H9BA 3SDJA 1WVWA 2JEDA 2GPHA 4E5WA 4EOSA 2BMCA 4QTAA 4IFCA 1R78A 1GZNA 4O96A 3BE9A 3FYJX 4M8TA 3SA0A 4I0TA 3ORXA 5IA1A 2HWOA 1TQIA 2CGVA 5CEIA 3PSDA 5HCZA 4D9TA 4RIOA 2PY3A 2Y4PA 2BVAA 1OPKA 4KIOA 3ZMMA 4LL5A 3RAWA 3IKAA 4FIJA 2F7EE 3ZXTA 4PMSA 4IAYA 1OKZA 4Y83A 4DTBA 3NUYA 2C6OA 4FKTA 1U4DA 4CZYB 4L53A 5E8XA 3MTFA 4C0TA 4OTHA 4HZSA 1SVHA 5LVOA 4Z9LA 3CIKA 3FI4A 1Q8UA 2VWVA 3JPVA 3DA6A 4XP0A 2O63A 2W96B 2PVHA 1YDRE 4ACGA 4I3ZA 4ALWA 4S33A 3QRJA 4YJPA 3ZXZA 2YIWA 4PMMA 3E64A 4DBNA 3S3IA 5FTGA 5M4CA 1LEZA 3QQGA 4DG3E 3PYYA 3LFAA 3I7CA 3Q5ZA 1MRYA 2XJ2A 4AZTA 4BTMA 4CT1A 3ZBXA 4Z7HA 5A4TA 2X9EA 4ORKA 5HOAA 4F9YA 1KV1A 4JDJA 5EM6A 1JNKA 5DI1A 5KNJA 4FTIA 5HU9A 2XVDA 3RNIA 1YI4A 4RBLA 1OB3A 4C7TA 5M53A 3BQRA 4AT3A 2GQRA 3PE1A 2XMYA 3N51A 4AA5A 5K5XA 2XEZA 3QUDA 4ZY5A 5C4LA 1ZZLA 4XV9A 5M4FA 3DFCB 1AQ1A 3QRTA 4IWPA 4QP9A 2YWPA 5IQEA 5H8GA 3QUEA 2WMRA 4BZDA 3UQCA 2GFSA 3AMAA 2OJFE 4I1ZA 3PY3A 3C5UA 4V0GA 3D7ZA 4G2FA 3LJ0A 4BBMA 4DT8A 2XK7A 1FVVA 2CCHA 2W1FA 3CXWA 2VWIA 3D9VA 3ZM4A 4FNXA 4PDYA 4AFEA 4EUTA 3KKVA 4NZWB 4EEVA 3C4WA 4WBOA 4XLIA 4BCQA 4KUJA 2SRCA 4QNYA 4EK3A 1B6CB 2CKOA 2BTRA 1F0QA 3EYHA 3GFEA 2FH9A 4I21A 3QTWA 4FIHA 4ZK5A 3V5PA 3RALA 4WO5A 2GNIA 3HDNA 3QZHA 3VNTA 4CFMA 3TACA 2ZMCA 5M4IA 2FUMA 3S4QA 1BUHA 4CGAA 1KE8A 3CJGA 4FKUA 3AXWA 2C0OA 4GT3A 5DE2A 4BGQA 5JMSA 4P90A 3LCOA 2BDJA 5EOBA 4M84A 2PVNA 2C47A 4LL0A 3UOHA 3UP2A 3C9WA 1MQ4A 4ENYA 4I5PA 4JQ8A 5HTCA 5CX9A 1O6KA 2V55A 5HE2A 5HD4A 3UNKA 4U5JA 3FI8A 3AG9A 1OBDA 4UWCA 4H36A 4MCVA 5HKMA 4RZVA 4EOJA 5K9IA 5AWMA 4X3FA 3BX5A 2PTKA 4A9TA 4LGHA 3QU0A 1YOJA 5E92A 5BX0A 5DRDA 3GOKA 2Q83A 4QQTA 4ZZOA 2O65A 4R5YA 1KE6A 2IW8A 4AZVA 3FXXA 3RAHA 4FSUA 3KA0A 4ZP5A 4MF1A 4CFXA 2OIDA 2G01A 4IDVA 4MXOA 4WBBB 1YOLA 2YIRA 4JDHA 2UZLA 4LFIA 4O22A 2X8IA 3KN5A 3PIXA 2WQEA 4UMQA 5HGIA 4D4SA 3U6JA 4I6QA 4IM2A 3HDMA 2R3KA 2GHGA 3LMHA 5KKRB 1YXTA 3NR9A 3MESA 2WMSA 5DT0A 3DV3A 3P08A 4TWPA 5HX8A 3Q4TA 5EDQA 2V62A 4KD1A 3EFJA 3CGOA 3PWDA 2WMWA 3ERKA 3ZLWA 1K2PA 2QKRA 5BVNA 1H4LA 4JDKA 4DEDA 4FV3A 4EHZA 3LMIA 3KMMA 3FLSA 2HZ0A 2JDOA 2VD5A 4Y5HA 3PA4A 5GZAA 3KRWA 4JG6A 5EM5A 2XKCA 3SHEA 4AOIA 4F99A 4D4RA 1OMWA 4GT4A 3ZFXA 1OZ1A 2OKRA 2VV9A 2G2IA 2E2BA 4X3FC 3QA8A 2O64A 4FSMA 4QYYA 2BROA 5HHWA 3U8WA 4EH8A 4MNEA 5CF6A 3ZYAA 2YJRA 4U0IA 3ID6C 3BIZA 4KBKA 3UTOA 3VS5A 2WMVA 4A4OA 4LG4A 1KSWA 2OG8A 2OXDA 3P7CA 4YJSA 3IW4A 1IASA 5EHOA 4G5PA 3JYAA 3TZ8A 3ROCA 4GIHA 3ZHPC 5FLFA 3JY9A 3Q4UA 1RDQE 2ZV7A 4FV7A 4YHTA 5AP0A 3ACJA 3ZU7A 4LGGA 4ZSEA 2RG5A 4FL2A 2HY81 4FKJA 5HLPA 1OIRA 4KBAA 4U81A 3T8OA 4AWIA 3AMYA 3R0TA 4YPSA 3EN5A 4X2GA 2YDIA 4MF0A 3ET7A 2E9NA 5KMOA 3C13A 5DR6A 4EH5A 4C59A 2J2IB 4FI1A 2BR1A 5L4QA 4GIIA 3DNDA 5EFQA 1GOLA 4GSBA 4IB3A 3C4XA 4Y85A 3CBLA 3KC3A 4YHJA 2HZIA 2C5NA 4U79A 2PMNX 5M08A 3MJ1A 4I94A 4LOQA 4MX9A 4O21A 4OBOA 2CKEA 3N4UA 3AQVA 3OT8A 4E4XA 3L9NA 3BWJA 2WTJA 2HZNA 1H28A 4QTEA 4EI4A 4PDSA 5DPVA 4X3JA 4MD9E 1JLUE 4OGRA 3U9NA 4FKLA 5HX6A 1K3AA 2EXEA 4FIGA 3SV0A 5IQHA 2UW3A 3D14A 2YITA 3R7VA 3A62A 3H4JA 3W16A 4M15A 2YN8A 5AAGA 5JQ8A 2OJGA 5AA8A 3VUDA 1ZOGA 5CTPA 3UE4A 5EHLA 4ANSA 3C4ZA 5EOLA 5C03A 2WTKB 4ZJIA 4QOXA 5GZ9A 2PE0A 1U5QA 2BRBA 2EXMA 4E4NA 5EDPA 2BRMA 1H1PA 2UW0A 3CPBA 5IF1A 4JL9A 2P2IA 4YSMA 3RAKA 1H26A 3I5ZA 2EU9A 5HG5A 3A8XA 3FUPA 2NP8A 2X4FA 4AQCA 3QRUA 1QL6A 1PMEA 3RK9A 4N4SA 3NAXA 3OG7A 2JAMA 1UWJA 2J6MA 3V6SA 3H9FA 2JBOA 2WELA 5HU3A 4C58A 4O91A 1OIQA 4K18A 3C7QA 4QMXA 3QQKA 4IE9A 5BVWA 3VS7A 5BPYA 2B9IA 1IR3A 4GFGA 3ZLXA 3RM6A 2Z02A 5DT3A 4O7VA 2OWBA 3VO3A 3VUMA 3QQUA 4EH3A 4S2ZA 3Q2JA 2PVYA 4NFMA 4D2TA 2XYUA 4JAJA 4M67A 1OIUA 3W8LA 1M17A 2A1AB 3FJQE 3O0GA 3R30A 3NUPA 1A06A 4YTFA 2I0EA 3D5UA 2RKUA 4YZDA 2UW7A 2YHVA 5AP5A 3WF7A 5CEMA 3NUNA 2C4GA 3B2TA 3PIYA 4FZAB 4G9CA 2XNMA 1BL6A 3C50A 2R3LA 3ZFMA 2GNHA 3DBEA 3OHTA 5CAOA 5I0BA 5FEQA 5GNKA 3JVRA 5ETCA 1GAGA 2A0CX 2XS0A 3RVGA 5DYJA 3PG1A 3PDTA 2OZAA 3NGAA 2JDVA 2PPQA 3DTCA 3JY0A 1DAYA 4CXAA 5CU6A 3DBQA 5F95A 3THBA 4YBJA 2WEVA 5AV0A 1M7QA 4AFJA 4OR5A 2ZM4A 4APPA 4GU6A 5AUZA 4BR3A 2QO7A 3ALOA 4AZSA 4FMQA 5AP1A 3UC4A 2P2HA 5A3XA 5F94A 3CLYA 4GT5A 4HNFA 3OBGA 3MFUA 3MH2A 4N70A 1QPEA 2XCHA 3C4EA 3COMA 3MYGA 4QYGA 4RX9A 5AV2A 4EZ7A 3V5QA 4LRMA 5J87A 2J0JA 4AT4A 3TJCA 2UZBA 1VR2A 3R02A 3MS9A 5CZIA 5J7BA 4Y46A 1A48A 5FG8A 2QU5A 2ITPA 2WMUA 2GS2A 5KE0A 3UGCA 3W2CA 2XM8A 3E88A 2XNGA 3WZEA 4FKPA 4O84A 4F4PA 4XG6A 5F4NA 5IQAA 3G5DA 2OH0E 4O38A 4S32A 3TT0A 4IANA 1H08A 3HKOA 3ZO3A 2ZOQA 4XX9A 3PTGA 3OC1A 2OFVA 2ZYBA 4KSQA 4MNFA 1RQQA 2OSCA 5IQDA 4GKIA 2Z7QA 3TTJA 5E91A 4ZEGA 4I0SA 4CV8A 3R01A 4FV8A 4LRKA 1JSTA 5CAPA 5JFXA 4FIFA 3WYYA 4YTHA 1JVPP 2W05A 4CNHA 4F64A 2REIA 4JR3A 4EYMA 3AD6A 5GINE 3OCSA 4AX8A 1K9AA 4TYHA 3VBQA 4RZWA 3KXXA 3LHJA 5C8KA 3DY7A 3OWKA 4O7RA 2NO3A 2XP2A 3PXQA 3TUBA 5DIAA 2ZJWA 4BN1A 2B9HA 5BYZA 4RX8A 5M09A 5B7VA 3C4FA 3POZA 4WHZA 2O3PA 4FNZA 3FHIA 1NVRA 2OJJA 4QQCA 4O1PA 3KY2A 4HJOA 4NK9A 4FG8A 4RVMA 4YUQA 3W2SA 5E8TA 5H8BA 3BI6A 3UOKA 3KL8A 3BV3A 5H3QA 4FZFB 4JR7A 5JFVA 2XZSA 5T68A 1IA8A 3DT1A 1ZYCA 3TNHA 4D2WA 4BF2A 1MRVA 1U46A 3MA6A 2YZAA 4AXAA 2FA2A 1J7IA 1QCFA 1I44A 2UZUE 3E3BX 3F3UA 5CEKA 1EH4A 3L8XA 3U4UA 5K4IA 2QLQA 3C0HA 3AC5A 4X6RA 5CU4A 3DLZA 5DN3A 3B8RA 3Q52A 3RPOA 4B0GA 2XJ0A 4BDCA 4FTTA
chains in the Genus database with same CATH superfamily
3TM0A 2XRUA 4IXPA 2OK1A 4D58A 2KTYA 2F49A 1MRUA 4L46A 2ONLA 1Y6BA 4KKHA 4HW7A 2RL5A 4ONAA 5E8YA 4Z3VA 4DCAA 1PMUA 4I4EA 3W55A 1IAJA 4JJRA 3A61A 1G5SA 4TWOA 4CQEA 4MAOA 5ANJA 4BKZA 1SM2A 3F7ZA 5EQYA 5HVKA 5BUJA 3FWQA 4FX3A 4N57A 4QP7A 4BCIA 2CJMA 2DQ7X 4UALA 1W83A 2ZV9A 3PWYA 4EHEA 3AD4A 2VX3A 2X39A 4FZ7A 4CT2A 2WTCA 3WARA 2CGXA 3QTUA 3OW3A 4FZDB 1W2FA 3F5XA 5DEYA 4EQCA 4ZTMA 3AKKA 2VWUA 4FTAA 3LAUA 1OGUA 3OTVA 2WMAA 2OBJA 2H9VA 4D0WA 2HIWA 2XNBA 1E1VA 4D1XA 4H39A 4V0GB 4DG2E 4R7BA 3GGFA 3R8UA 4MHAA 4L3PA 4TNDA 2QD9A 4DFXE 2G2HA 5L8LA 3TXOA 3FPMA 4FF8A 2VGOA 3R1NA 4ZJJA 2I1MA 4YLJA 2X8DA 2CHLA 2XIZA 4DHJA 3P23A 3I6WA 1P14A 5CVFA 4TWNA 2B1PA 4U97A 2WB8A 5CY3A 3UODA 4I24A 2PULA 5HBHA 5LOHA 2R3NA 4PTCA 1H0VA 2PMOX 4B8LA 4CVAA 2AUHA 3GBZA 4KAOA 4BTKA 3IK3A 2ONLC 4FSQA 3OW4A 4FSRA 3MA3A 3MY1A 4W4VA 5JGBA 4JDIA 4A07A 4E6AA 2IO6A 1REJA 3UG2A 3UIBA 4WA9A 3R1SA 3ATTA 4GEOA 5HVJA 2WMBA 3AOXA 1ZWSA 4FV4A 4N6YA 5CQUA 1Q8YA 2OZOA 1YI3A 4TZRA 5T3QA 1PXJA 2OJIA 2PVMA 2WMTA 5CEPA 3QWJA 3EQIA 5IEVA 3QHWA 1YXSA 4M14A 3ZZWA 5DOSA 3BLAA 4O0RA 4O82A 4KS7A 4F1OA 2X0OA 5I9VA 4G9RA 5B0XA 4WIHA 2B4SB 2Z7RA 3CQWA 2Y4IC 3ETAA 4E6CA 3DZQA 3ELJA 3R9NA 4L7SA 2XNOA 2BRNA 2PHKA 3FC1X 3GENA 3VN9A 4E26A 4CD0A 4AU8A 3COHA 4KKGA 4RJ6A 3O50A 4DH1A 4EK6A 4F9CA 4FE2A 4NJDA 5L2TA 1UVRA 4EOPA 4DEBA 5EYKA 4C8BA 4RLKA 5D11A 3HMOA 1J3HA 2XRWA 5DBXA 3R9OA 1YWVA 3GCVA 2R3RA 3O7LB 2OIBA 3UIMA 4C3RA 3HUCA 2VTJA 3OEFX 4IM0A 4X7QA 5H2UA 3AD5A 4PMTA 4R78A 1FINA 2PZIA 2ZV2A 4QQJA 4USEA 4ZSLA 3SXSA 4TL0A 5IEYA 3ORLA 4OBQA 3MH1A 3LFNA 5I9UA 3KREA 4LI5A 3TNWA 1WBTA 1OL7A 3Q6UA 3QLFA 3P4KA 4BCNA 4CMTA 2C3JA 1WCCA 2VX1A 5FEEA 1SVEA 4FOBA 4BGHA 3W10A 3R1QA 4WUNA 3S95A 1G8SA 1J7UA 2QR7A 1ZMUA 5LVMA 3FQSA 3QALE 4TW9A 3TNIA 3QAME 4FODA 3HA6A 2GHMA 3I7BA 5I3OA 2X2MA 5DR2A 4DGLC 4GG5A 3VUKA 3TZ7A 4AT5A 4BKYA 3LJ1A 4C2WA 4IX6A 4QMZA 2J5EA 3NW7A 4FT7A 2RG6A 1FVRA 5TT7A 3HUBA 4WRGA 4YC3A 4OT6A 4DTKA 4ZSGA 3DDQA 2YCFA 2YDJA 2VTIA 3SXRA 3P7BA 3OOMA 4OTGA 3AC1A 3FQHA 5HZNA 4ZOGA 3EZVA 4FT5A 3GC8A 1M7NA 3F82A 4O83A 5M57A 5DLSA 3V6RA 2UZEA 4NKSA 5CSVA 3MFTA 4KRDA 1BMKA 4YTIA 4E73A 5E8UA 4DBXA 2O8YA 3EMGA 5HCYA 3QF9A 3SOAA 3TIZA 4O0YA 3LVPA 2XALA 3F2RA 2QHMA 5IQGA 5AR4A 3UVQA 1IRKA 1YXUA 4UWYA 5AIRA 3GEQA 2C3KA 4AW2A 4E8AA 3KRXA 3CE3A 4IWOA 4QP4A 2CN8A 2QU6A 5IQCA 3ALNA 4QTCA 4M97A 4TPTA 3EKNA 3PJ8A 1O6LA 5A4CA 3I6UA 5AR3A 3ORNA 3FXZA 4XHKB 4E4MA 4NWMA 2IW9A 4OTIA 2J50A 3LFFA 3LFEA 2DWBA 3MIAA 4IX5A 2HENA 1WBVA 2Y8OA 3V3VA 4R1YA 2WOUA 3LFCA 2E9VA 4X6QC 4WNPA 5DFPA 5HO6A 5HTIA 4NIFB 3H9RA 3VUIA 2UZOA 1F5QA 4K8AA 4OTDA 2VRXA 3HGKA 1QPCA 4IAKA 5CSPA 3BYVA 4AZFA 3EQGA 3R8ZA 3VRZA 2VTLA 4BCFA 3LM0A 4QMSA 2IZUA 3LXKA 1OL1A 4TYIA 5DR9A 3LXPA 1Z57A 1XH8A 3DPKA 2ITYA 5EI8A 3TIYA 4TKSA 4FKWA 2F2UA 2QI8A 2JKMA 4KIKB 3FMNA 4G34A 5D7VA 5J9LA 2Y6MA 2JDRA 2IW6A 3PZEA 4QMTA 3RZFA 5HIBA 3NUXA 4WKQA 4IC7A 4RFZA 4QP6A 1W8CA 3AT3A 2ZV8A 1RJBA 4DG0E 5BVOA 2YDKA 3WF6A 4XV3A 4A9UA 4BZNA 1BI7A 3G90X 2QG5A 5JFSA 1UV5A 3F5GA 4D55A 3PJCA 4EOLA 2QLUA 4PWNA 3UPXA 4XUFA 4R5SA 3ANRA 2BIYA 3R00A 3EZRA 3FZTA 3PVWA 2LAVA 2XH5A 3Q9ZA 5EHYA 3UBDA 3ZC6A 4EWQA 4FICA 4XG9A 5EYCA 4EH2A 4HVGA 1S9JA 3HNGA 3QD2B 3RK5A 3E7VA 1KE5A 3SD0A 3BBWA 1TZDA 3U87A 2CGWA 5HO8A 3FLWA 4L8MA 5JRSA 3V8TA 2YIXA 3N4TA 4U3ZA 3GCPA 5AIKA 2WTVA 1JKTA 3TI1A 1AD5A 4ZSJA 2QO9A 3UG1A 2RFDA 3OD6X 2W1HA 4DEHA 4RLLA 2ZDUA 3DQXA 3QTXA 3NUSA 4J99A 3EN6A 2PWLA 4JXFA 5LVLA 4RA4A 2VTOA 3MVHA 5AP6A 3VS0A 4IB5A 3FC2A 3FMDA 3QC9A 2UZTA 2VTSA 3OT3A 4I5MA 4J1RA 4QP3A 4IW0A 3A7IA 4J95A 4FTQA 5ANEA 3ZEWA 3BU6A 3OP5A 3AMBA 2QOFA 4RWLA 3NYXA 2X0GA 4KNBA 2JKOA 3QKKA 4GCJA 3FV8A 4KRCA 3TKUA 4IAAA 3HZTA 1Q8TA 3OCTA 1H1SA 3BWFA 4IJPA 4F0FA 3LLTA 4HYIA 2YM6A 5FP5A 3AGMA 3EQBA 5JGDA 5JN2A 3FLZA 3H9OA 3HP2A 1JAMA 3KGAA 2R3FA 4I23A 3KF4A 4ERWA 2J9MA 1SZMA 4EOQA 2R3IA 1ZMWA 3UIUA 1NVQA 1GIHA 4J97A 4RX5A 2ERZE 4HVHA 2W4OA 4DLIA 4GKHA 1O6YA 3O96A 4AOTA 3SC1A 5TKDA 3OMVA 4WT6A 3ZRKA 5BVKA 5ANGA 1B38A 2EB3A 2IVUA 3PXFA 2CGUA 2CNUA 4PV0A 5T6KA 1XBBA 4AA4A 4RVTA 3TMOA 3L8PA 3LPBA 3PFYA 3DBCA 1MQBA 4P5ZA 5HICA 5ETIA 2BCJA 1CSNA 4NKAA 3ZZEA 5ACKA 3U4WA 1KWPA 3KXMA 2BHHA 2IEWA 5KZIA 4E6DA 2H34A 3QRIA 4S34A 4O86A 2R5TA 4ALVA 5ICPA 4L45A 4EORA 1SNUA 2R3JA 1V0PA 2VAGA 4FSWA 5AX9A 3EN4A 3RMFA 3ITZA 3RPYA 5KCVA 4QEBA 2R7IA 2W1EA 5IDPA 1R1WA 3A7JA 4FNWA 3LIJA 2XYNA 4FV6A 5CZHA 4JIAA 2I0HA 3SRVB 3R9HA 4APCA 2J5FA 3S0OA 4F6SA 4E4LA 3Q04A 3QKMA 4FTRA 3HL7A 1ZOHA 5EKOA 2C0IA 5CYIA 4ARKA 5BNJA 4CZUA 5CXZA 1JQHA 4HGEA 3WIGA 5GJDA 2QOLA 2YWVA 3GU8A 3K2LA 4I6BA 4PNIA 4AOJA 4C36A 5JRQA 3BHTA 1XHAA 2DUVA 3NNVA 1GZKA 3ZFYA 3P79A 5LXMA 4J8MA 4QPSA 4QMPA 1T45A 4TT7A 1UU8A 3PP0A 5D7AA 4M0ZA 3IGGA 3AT4A 4YNOA 2B54A 2WFYA 3CKXA 3VJOA 3BU5A 1XH4A 5CU0A 2DYLA 4XJ0A 1LR4A 2YACA 4RIXA 4YZ9A 3GT8A 2GNFA 2GU8A 4YC6A 4CFFA 3FZOA 4F9AA 4U43A 4G6OA 3QXOA 3MH3A 1YHSA 4C33A 2UZWE 3P86A 2UVZA 3UVPA 4RJ7A 5CAQA 2R0UA 3Q4CA 5DA3A 3T3UA 5L2WA 4BI0A 2PVKA 3G33A 5HIEA 1U5RA 3COKA 1Q8ZA 1TKIA 4DLJA 3NAYA 1WMKA 4LM5A 4C2VA 5I9ZA 3KFAA 5HD7A 5AX3A 3BE2A 2R3GA 2BAKA 3D0EA 1QPJA 3BV2A 3O17A 2R3MA 4FTLA 4XBUA 3UIXA 2XIXA 4II5A 1PYXA 4QMWA 4C35A 1W82A 4Q5EA 4MBIA 2B55A 2P3GX 2ZM1A 3CR0A 5EQEA 4HZRA 2HCKA 4CV9A 2IZRA 2ZM3A 4G3FA 4O7TA 4RFMA 5HG7A 1ZAOA 2IVTA 3MPTA 5AR2A 4ZTSA 5EW3A 2JFLA 4LMUA 5IISA 4LGDA 2WQMA 4HCTA 4TYJA 2OW3A 3WILA 4BDJA 4BFMA 2RF9A 1ERKA 4O6EA 4YJRA 3HYHA 3G0EA 1HCKA 2XIKA 3FYKX 2C6KA 4R8QA 3KMUA 4XOYA 5J5SA 3VVHA 3ZO4A 1OVEA 3GCSA 3FLQA 4CMUA 4F08A 2GHLA 4GUEA 2GDOA 2HYYA 4WNMA 3S2PA 3R22A 5A46A 3HAVA 1FGKA 4RQKA 3HV4A 4K2RA 4PTGA 3UOJA 3R7GA 4FSZA 3CEKA 4J71A 4OTQA 4AACA 5E7RA 3VS1A 4P2KA 4C3FA 2XARA 3RM7A 3IGOA 1R39A 4PL5A 3OEZA 1IA9A 1FVTA 4ZJVA 5CSWA 4LYNA 2NRUA 4D4VA 4HGLA 5L6PA 3LQ3A 2BAJA 3A8WA 3W2QA 3FKLA 3HAMA 4ZTRA 4PQNA 3NX8A 3ZONA 5FTQA 3SG9A 1YDTE 3DKFA 1U54B 3VBYA 3PJ3A 3Q2MA 2FGIA 3EJ1A 5AFVA 3RJCA 3V8SA 4P4CA 4M68A 1PXOA 3LLAA 4ACCA 3R8PA 1XJDA 3W2RA 2OLCA 4YPDA 4ZMFA 4QMOA 4U6RA 2XBAA 4FKRA 4CLIA 2XNPA 2ITTA 4K33A 4DHZA 4M13A 1Q97A 2PE1A 4GYGA 3N9XA 4QRCA 4O0WA 2W9FB 4ASXA 5L8KA 3PUFC 4WNOA 4NU1A 3VHKA 4BCHA 1QMZA 1UKHA 1UU3A 2C6LA 3KRJA 3NZ0A 3EIDA 4W9XA 4CG9A 3ORMA 1PXLA 3GVUA 3FQEA 4YJUA 3VS3A 5BVDA 2HXLA 3CD3A 4CFWA 3EKKA 3W0OA 3HX4A 4HGSA 4O2ZA 3PPJA 1YVJA 4BBEA 5C26A 2CLXA 4F7LA 4PP9A 5AUXA 5KMKA 2Q0BA 3PVUA 3SW7A 2ITVA 3KULB 1MUOA 4IAZA 5FUTA 3OY1A 4GJ3A 4NM0A 4BCJA 5JZNA 2WTWA 1DI9A 3A99A 2ITQA 2CKPA 2XIYA 5CEOA 4ASEA 4QMNA 5IMXA 3L8SA 4QT1A 5HNBA 4CTCA 4U45A 5CI7A 3PLAE 3VF8A 3D5VA 3Q6WA 3S1HA 2JDSA 3PJ2A 2W06A 3RHXA 3SLSA 2YA9A 4U40A 4EOIA 4MWIA 4TXCA 2C6DA 2CLQA 5AJQA 3V5JA 4AE6A 1A9UA 1KE9A 4IX3A 3SX9A 4EBWA 4X0MA 4BZOA 4K11A 4Y8DA 4AW5A 2FYSA 4FKIA 3IDBA 1YWNA 4V05A 3GOPA 4WSQA 4GFOA 3VUTA 2JLDA 4BI1A 3D4QA 4IH8A 4OTWA 2IF8A 1H0WA 5KMIA 4RVKA 3EQRA 4S31A 3A4OX 5EM7A 3OXIA 3VBVA 5EW8A 4ZIMA 1ZZ2A 2PZRA 4IJ9A 2XK4A 1URWA 1WBPA 1BYGA 4O4BB 2C5OA 1TFFA 5HVYA 3ZDUA 3QTZA 4PTEA 2R64A 3U6IA 1Q24A 2I7QA 5JH6A 2OI4X 1NY3A 2C5YA 2YISA 2WIHA 4DCEA 2ESMA 4GRBA 3OVVA 3TV4A 1XQZA 4M69A 3RGFA 4GV1A 4L9IA 2GQGA 3A7HA 2C3IB 4K9YA 4Q9SA 2XNNA 5GIPE 5DG5A 5CAVA 4FTUA 2A4LA 3M42A 3PRFA 3BLHA 3NRMA 3BYUA 2YCQA 3QKLA 4JG8A 4AGUA 1Q3WA 3M11A 4U80A 1I09A 5LJJA 3LFQA 2F2CB 4NTTA 4AN2A 2YCRA 3BGQA 4QMUA 4J96A 3U51A 3T9IA 2GS6A 5IH5A 5M51A 2R4BA 3ZSGA 2UW5A 5KMNA 3R71A 3GI3A 4DFNA 3OFMA 3PUPA 2VO6A 5D41A 3FL4A 1KE7A 2BRGA 4IACA 3VUGA 3FMLA 5C01A 4YZCA 3PRIA 3UYSA 1H07A 1XH7A 2F7ZE 2CPKE 4RJ5A 4DGNA 2JKKA 3DAJA 3KQ7A 3SKCA 4DHFA 3R83A 3EQDA 1VEBA 1PRYA 2IG7A 3MB7A 4IBMA 2Y6OA 4ACMA 3I60A 3LJ2A 2R2PA 5L2QA 3EQPA 3OXZA 3IW8A 3RHKA 3IOKA 3MSSA 2AC3A 4MBJA 2QOBA 2G9XA 3RBWA 4Z7GA 5CVGA 4PF4A 5J8IA 2XK3A 4D9UA 4L67A 4JX7A 5JT2A 1M2QA 3SOCA 3D7TA 4RA5A 4RGJA 1G8AA 1FBNA 4M66A 2PVLA 2UW6A 4JNWA 4YZNA 4BWXA 1P2AA 2J0LA 4FK3A 1PXIA 3NNWA 2XIRA 3HRFA 1UNLA 3U9CA 3KRRA 4YU2A 2W4KA 2JBPA 3EOCA 4XS2A 4B9DA 2X7GA 2R3QA 2PUUA 2J0KA 3QTIA 4XP3A 1OUYA 3Q3BA 4DINA 4F63A 3NIEA 5LQFA 4XRLA 3F3TA 5GJGA 2J90A 4UYNA 4IWDA 3EL8A 3FE3A 4IAFA 2ZB1A 3UJGA 3RPVA 4E93A 4ACDA 2IVVA 1XH6A 2Q0NA 2GNJA 4MH7A 3RKBA 5KMJA 4FT9A 3BYSA 2C6MA 2ETRA 4ZLYA 3TG1A 2VTQA 3BZ3A 5J9ZA 2O2UA 4JBPA 3RP9A 3IDCA 3A4PA 2Y7JA 4I4FA 4UX9A 3NNXA 5L8JA 4GK2A 4YJVA 5I9YA 2WU6A 1UU7A 4RIWA 3R7IA 3R28A 5JFWA 3BELA 3BYOA 3JVSA 3ZUUA 2QR8A 3LCKA 3PG3A 3TN8A 4ANLA 4D2RA 5D9HA 4I5CA 3DBDA 3IG7A 3RWQA 3T9TA 2AC5A 1JOWB 1H8FA 2FB8A 2X9FA 3OCGA 4UV0A 4YJOA 3WBLA 5KO1A 4ZMEA 3SXFA 4AGCA 1RE8A 4ZLZA 3EFLA 4TYGA 4EH9A 4X2KA 4IVBA 3A7GA 2R7BA 2OXYA 3VAPA 2XEYA 1PF8A 5J1WA 4D5HA 2W0JA 2WPAA 3HEGA 1ZYLA 2ITXA 3F66A 4QMVA 4EC8A 1U59A 1V1KA 3PFQA 4PL3A 3FBVA 4EK4A 5JSMA 3I79A 4XRJA 4B7TA 3HMNA 1UA2A 2BZJA 3P9JA 5AP2A 1GZ8A 4MXCA 2R0IA 4WG5A 1RW8A 3FXWA 5C1QB 3LXNA 1FOTA 3VS2A 4EOMA 5FRIA 3Q9WA 4JVGA 3I81A 4CRLA 4DITA 4ANOA 1LP4A 1Y8YA 4RJ4A 2BFXA 2G15A 5IA4A 3Q4ZA 4QYEA 3R7EA 1Z5MA 5E90A 3W0PA 1GZOA 3BGPA 5HE1A 2WAJA 4G3CA 3BGZA 4RT7A 5I9XA 4AW1A 3V5LA 3FEGA 3BEAA 4NTSA 4FV1A 3V5WA 2VO3A 3ZUTA 4O0VA 3LE6A 3ZTXA 3DKCA 4DGGA 1BKXA 3PZHA 2A2AA 5FQDC 3MVJA 4NFNA 1SNXA 3F9NA 4EQMA 1ATPE 3CQUA 3GQIA 3UP7A 1JKSA 4ZTLA 5E1SA 2QODA 4F09A 4L52A 5I5ZA 1JKLA 4I0RA 1PMVA 4G6NA 4A9YA 2WTIA 4B6LA 3IW5A 4FIIA 4QP1A 4ACHA 5KMMA 4MK0A 5FDXA 3AC4A 4DFUA 4A4XA 1XBAA 5HCXA 2R3PA 4CQGA 5I4NA 2PE2A 3UDSA 2J0MB 3IW7A 4WRSA 4NJ3A 4TRLA 5DT4A 2JGZA 4NYEA 4F7SA 4L68A 4RIXB 4W4WA 3CTQA 4DA5A 4JRVA 3MTLA 4YJNA 5IH6A 2X81A 3UMWA 4ZY6A 1CKIA 4YC8A 3H10A 2WU7A 4MXYA 3PVGA 2H6DA 5AV1A 4GFMA 4ANNA 3VC4A 4AS0A 2PUNA 3FZRA 4HYHA 5IUGA 3OUKA 2YZLA 3C4CA 5FXRA 2B9FA 3NMUF 4F65A 2QOIA 2OJ9A 4D1ZA 3DJ6A 3C0GA 4X3FB 5A54A 4EH7A 1Q61A 1ZMVA 4O81A 2QCSA 2FO0A 5DHJA 4ZXTA 4BDKA 5JK3A 3MIYA 4YO6A 2P0CA 3G15A 1NT2A 3SQQA 2ACXA 2JC6A 4HPTE 3R7YA 4IEBA 3MDYA 4O4DA 5FDPA 2BAQA 2JKQA 4Y5QA 2UZDA 4PDOA 4EHVA 2EUFB 2ZAZA 5TF9A 3Q96A 4D4YA 4EJ7A 2VO0A 3FHRA 4CMOA 1OECA 2W5BA 4NM3A 3MJ2A 3NCZA 4NT4A 4UMTA 4UMUA 3L1SA 4XNEA 5K4JA 3SGCA 3V5TA 4AA0A 2XBJA 3IO7A 4FKQA 2VWYA 2XANA 1YKRA 3KCFA 4GUBA 1KV2A 3MWUA 4EKLA 2X2LA 5IKWA 2P55A 4MD7E 4JIKA 4PUZA 3KXNA 2XA4A 3QLGA 3QTSA 4V01A 1WBSA 1LPUA 4IFGA 4R77A 4U8ZA 3RK7A 3UNZA 4EONA 5BUIA 4ITIA 1HCLA 4DC2A 3KMWA 5M4UA 4IZYA 1GJOA 5J95A 4BDGA 2W1GA 4O7YA 1PJKA 2C5VA 5E4HA 2A98A 3LZBA 2I40A 1Y6AA 1ZLTA 3F3WA 2JIUA 2WNTA 3R8VA 4F70A 3OWLA 3KRLA 1UKIA 2V5QA 3VF9A 5FM3A 1WBNA 1J7LA 2EVAA 2WOTA 2V7OA 4QYFA 1CTPE 1Q4LA 4MNEB 4CTBA 4AP7A 4DFLA 1HOWA 4I20A 3G2FA 5L2SA 3EH9A 4R3PA 5FGKA 2QURA 3WF9A 4AZWA 4KS8A 4C02A 2B0QA 3R9RA 3Q9XA 1ZYJA 4RMZA 5EK7A 4E5BA 5J5TA 2G2FA 3RWPA 3VS4A 2F7XE 1KUTA 5EI6A 1XKKA 3E7OA 3LOKA 2XNEA 3EL7A 4O6LA 4QMLA 4AZEA 2VO7A 3R6XA 3OCBA 5CLPA 1M2PA 3E8DA 2DS1A 3D5XA 5CENA 1G3NA 3PSCA 4TN6A 4YJQA 2XJ1A 4M7IA 2UVXA 4ZZMA 4TTHB 4PDPA 2HK5A 5KUPA 3NVMB 4NL0A 5B2MA 3QCSA 3DBFA 3SW4A 4I22A 4CG8A 3HRCA 2CCIA 4GU9A 3VIDA 4ID7A 4MXXA 3RAIA 5ANKA 1CM8A 4FR4A 4CYIA 4GMYA 3LQ8A 1UWHA 2BFYA 3O8TA 5EYMA 3ATSA 5ANIA 5TOZA 3TV6A 2BILB 2FSLX 1SVGA 5AAFA 3LCDA 2XB7A 2HW6A 1Z9XA 2G1TA 5CANA 2PZPA 4ERKA 5LWMA 5CS6A 4LRJA 2JDTA 4CFUA 3GU5A 4G31A 2KULA 2ITZA 5EYDA 5TE0A 3REPA 3F5UA 5AM6A 2QOHA 4H1JA 3AGLA 3W0SA 3QUPA 1H1QA 4UEUA 5IA5A 4QDEA 1Q8WA 4U9AA 4BWKA 5HG8A 4X2FA 5CU2A 3R7UA 5EQPA 4BY9E 4NSTA 5E9EA 3O8PA 4ZAUA 4QMMA 4RX7A 5FTOA 3ULIA 4DFZE 1XH5A 1YHWA 3S00A 4IVDA 5HG9A 4AUAA 3OROA 3TUCA 2W9ZB 4FKGA 2Z7LA 4FT3A 2VTRA 2XAOA 5BUEA 3ZOSA 4UMRA 4RJ8A 5A6OA 2X2KA 3IONA 4WSYA 4FVPA 4IZ7A 5GZ8A 4GJ2A 2ZFYA 5FD2A 4BJJA 2XK9A 1H1WA 3D94A 1T46A 2QKWB 2YM3A 5ETAA 5ITAA 4ZLOA 2WTKC 4ALUA 4CLJA 4WD5A 1IG1A 4PNKA 5EI2A 3PY1A 4KABA 2UZNA 2Z7SA 5HESA 2W1CA 3CKWA 5KBRA 4H58A 4UXQA 2W17A 2ZMDA 4D2PA 2QOCA 5K0XA 2E9OA 4I6FA 2VUWA 2X4ZA 3QCXA 4LMNA 3A60A 5F20A 3MY0A 5CXHA 4ZY4A 4C3PA 2C1AA 4FEUA 2B53A 5BMMA 1OPJA 5AAEA 2OF4A 4D1SA 4KIPA 4EQUA 2NPQA 4R7IA 1NW1A 3U54A 5A4EA 1UU9A 1YDSE 3H0ZA 2F57A 1BI8A 2NNWB 3F6XA 3W18A 3ACKA 3QCQA 5LARA 4J8NA 3KF7A 2QVSE 3FL5A 3FZ1A 3LM5A 1XMMA 1OL2A 5HTBA 3FZPA 3W0NA 3CC6A 2BRHA 4XLVA 3OUNB 4R7HA 4CFVA 4DTAA 3KCKA 5C27A 3BEGA 3BBTB 4FKSA 3QGYA 4AE9A 4EYJA 5A4LA 1GIIA 2OZAB 3DOGA 4LUEA 4JMQA 2VWXA 3GC9A 1OUKA 4RC2A 1JKKA 3TDVA 2OH4A 4U41A 4YZMA 5K3YA 2F4JA 3HMIA 3UMXA 4FEWA 4DHIB 4CKIA 4FVRA 5DWRA 3LCTA 3NDMA 5M06A 4EZ5A 5HE3A 5DH3A 1H00A 2QO2A 5EW9A 2QOQA 3PA3A 4RWJA 5GHVA 4FA2A 1YI6A 4UWBA 2WO6A 4PMPA 4QTBA 4FEXA 1DM2A 1S9IA 1UNGA 1Y91A 1TQPA 2IWIA 2GS7A 2JAVA 3DJ7A 3NW5A 3L9PA 1L3RE 4PL4A 2P33A 5IQFA 4RWKA 4USDA 5IZFA 3DXQA 5LMBA 3G9LX 3GCUA 3TZ9A 3DQWA 4EOOA 3NWWA 4AF3A 2BZKB 3ODYX 3RTPA 3KN6A 2YIYA 1GNGA 4AQKA 3DK6A 5IA0A 3B2WA 4C38A 5CF4A 4U7ZA 3P78A 3HV7A 1YOMA 2PVRA 1YXVA 2FSTX 3F7WA 5EKNA 2WD1A 4ZTQA 2W7XA 4BYJA 2CKQA 4CKRA 1YWRA 3MVLA 5KMLA 3OBJA 2BUJA 4FTNA 4YJTA 2I0YA 4BDBA 4BDIA 1OGYA 4TYHB 5CVHA 2VGPA 3UOLA 3TDWA 4BGGA 3SVVA 4JX3A 3UO4A 1PKGA 2YCSA 4OAVB 5KZ0A 3QQLA 3UDZA 3QD4A 4OLIA 5IA2A 3DJ5A 3MH0A 4P5QA 4PY1A 4RIWB 3UQGA 4RJ3A 3UZPA 5B2LA 5HBJA 4DEIA 5L2IA 4YTCA 4K1BA 5IPJA 2C6TA 1OPLA 2BHEA 3P0MA 4B8MA 1VYWA 2YAKA 2UVYA 1E9HA 4ASDA 2QQ7A 1W84A 3R7OA 4IWQA 1J1BA 4PP7A 4O4CA 2QNJA 3UDBA 4K77A 2V22A 2QG7A 5FXQA 3HP5A 4XCUA 4J98A 3O8UA 4JRNA 5KHWA 3V8WA 4DE4A 4TY1A 2CNVA 3MVMA 5E8VA 2C6IA 4J53A 4NUSA 5ANOA 4RPVA 2CSNA 3OWJA 1JWHA 2RGPA 2O0UA 4DGOA 3W2PA 3L9MA 5TR6A 4V04A 4H1MA 4WOVA 2E9UA 4DAWA 2PK9A 3PXYA 3FMKA 4MUQA 4HCVA 4PRJA 5CNNA 5HIDA 5AUVA 1AGWA 5FBNC 2OO8X 5M07A 3C0IA 2XK8A 2WQNA 4DEGA 2JIIA 4L7FA 5CAUA 4YNEA 5F1ZA 2CMWA 3IW6A 2GTNA 4IZAA 4C57A 3BPRA 4PX6A 3C1XA 4MQ1A 3QYZA 3CD8A 4JG7A 2AYPA 3KXHA 2YEXA 4FYNA 4XEYA 3ZSHA 3QHRA 4GVAA 4EK5A 3ORTA 4LOPA 4O0XA 4USFA 5CT0A 4F6UA 5HI2A 4KINA 3K5VA 3OXTA 5IQBA 1DI8A 3K3IA 4F9BA 2Y4IB