4C4FA

Structure-based design of orally bioavailable pyrrolopyridine inhibitors of the mitotic kinase mps1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
280
structure length
254
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQQVGVNYMPPEAIKDISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Based Design of Orally Bioavailable 1H-Pyrrolo[3, 2-C]Pyridine Inhibitors of the Mitotic Kinase Monopolar Spindle 1 (Mps1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
total genus 88
structure length 254
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2013-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c4fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c4fA01
5CEOA 1L3RE 4WG5A 3F2NA 2X7OA 3E8DA 3PWYA 4FR4A 2Q0NA 2HXLA 4YJPA 2IO6A 5ETFA 1VYWA 5ANKA 2R3GA 1F5QA 2BVAA 2WMWA 5EHLA 2IW9A 3VJOA 2GFCA 4F7NA 3PRFA 3DB8A 4FZFB 3ET7A 4FV0A 4M15A 4WT6A 3QYZA 3D7TA 2OSCA 3IONA 4NUSA 5HOAA 4HVHA 2BUJA 3HMMA 1WMKA 3ZBFA 3OTUA 4X6QC 4K6ZA 5DR9A 5FDPA 2CLXA 3R01A 5ITAA 5CNNA 3O2MA 2W1EA 2XH5A 4PDPA 4JT3A 2OI4X 3PY3A 3SXRA 2OO8X 4YHFA 2PMOX 4P5ZA 3GU4A 3E92A 3HX4A 5KMKA 2AYPA 4B9DA 2VZ6A 4FTJA 4R7IA 2BFXA 2NPQA 3WF7A 5LVLA 3ZS5A 4EBWA 3IQ7A 5EK7A 5AAEA 1BX6A 4C36A 4AGUA 3MJ1A 4FSWA 3C4ZA 4ASEA 5F9EA 4KUJA 2C4GA 3UYSA 3GNIB 3IOKA 2XS0A 3LMHA 3AQVA 3PXKA 4TYEA 3QUPA 3R73A 4IB0A 3T9IA 4L42A 5JH6A 4EZ3A 4C33A 3VRYA 3VS2A 1STCE 4C4JA 2XNOA 4R1YA 3MGYA 3ZOSA 5AUUA 4DH5A 4BYJA 4MXYA 1PXPA 5KMIA 4FKPA 4TKSA 4DEGA 4ZK5A 2QOLA 3PA4A 3NCGA 4XV2A 2PYWA 3P7CA 2G2HA 3CTQA 5GHVA 4N6ZA 1CMKE 4XV9A 2WMAA 2YLFA 4O7RA 3FSFA 2B9IA 3FLSA 3KGAA 5AFVA 1UKIA 5JFSA 3H9FA 2X1NA 2ZOQA 2WHBA 3CEKA 5E8WA 4TYJA 5IA5A 4HYHA 2GNGA 5CAOA 4DTBA 4BF2A 5T6KA 3QYWA 3LXKA 4YZBA 3AT3A 4DFLA 5L2SA 1Q8TA 2ZV2A 2WB8A 3RK9A 3ZZEA 2HENA 2DUVA 4R5SA 4BRXA 1JVPP 4R78A 1LR4A 2BKZA 1P4OA 2ETRA 3EQFA 4EK5A 3OXZA 3NW6A 4MD7E 4OUCA 3CGFA 4RFMA 4FEQA 1YDTE 3BU5A 4N4SA 5DH3A 1OL5A 5CEIA 1MQ4A 5CXZA 1PRYA 2RIOA 5CNOA 3R7IA 4CVAA 4EYMA 2RL5A 1YWVA 4GK2A 4IAYA 4IJ9A 5IISA 2QR8A 5HTIA 4IWQA 5TOZA 4D5HA 2ZYBA 3RPYA 4O7TA 5ANDA 3CBLA 4JR7A 3UBDA 5B2MA 5DA3A 5HICA 5KBRA 2BRNA 4JX7A 4G5PA 3RCDA 5EYDA 1Q8WA 4QP6A 3FI3A 5EOBA 4MX9A 2FA2A 1XBCA 2GNLA 4O83A 2FH9A 3NEWA 4ERKA 1HOWA 4JDKA 4U41A 4M69B 4BGQA 2OXYA 3I6UA 1YI3A 2IVTA 3ALNA 3QCYA 5B2KA 2R5TA 3T9TA 3G51A 4O1OA 4QNYA 4EHGA 4X2JA 1Q4LA 4YZCA 4DBNA 3R1NA 4O7SA 2YCSA 4DFBA 5GIOE 4E4MA 4G6OA 2W96B 3OFMA 4QO9A 5HQ0A 3PSBA 3R8ZA 3QLFA 2UZWE 3R30A 1P4FA 2OZAA 5DI1A 1VEBA 2UZOA 1HCLA 4B0GA 3WZDA 5IG1A 3LW0A 4PTGA 4LYNA 3KK8A 3Q3BA 4FV8A 4XRLA 3N4VA 4ANBA 4Z7GA 5JEBA 3EQIA 1OB3A 4Q9SA 4FK3A 2PE0A 3KKVA 3NNVA 2BTRA 3NUXA 4J71A 5CX9A 5C8NA 1XR1A 2PVKA 2W9ZB 1Q24A 4W4YA 5BVFA 5C4LA 3ELJA 4GH2A 2WZJA 5D7VA 3LFEA 3KB7A 4JX3A 3HA8A 4GFOA 4JS8A 4CMTA 1VYZA 4OTFA 2PZYA 4MVFA 4O7YA 1ERKA 4KIOA 4X2FA 4ZTQA 3VBQA 4WNPA 3DV3A 3EQHA 4L46A 5M4IA 4GKIA 2BAJA 4MXCA 3ZCLA 4ALVA 4BTJA 5AA8A 4FE2A 4EZ5A 3ZC5A 3O96A 3EN6A 3QRIA 3W2CA 4CKJA 1JNKA 1YHWA 3BGPA 3HRFA 3OY3A 3QC9A 2IVSA 3MJ2A 1YRPA 3Q9ZA 4BWXA 2OIDA 4U81A 2XF0A 3E63A 1W83A 2PVFA 3E8EA 4FKRA 1UWJA 5IPJA 4DYMA 5DT4A 3II5A 3ORZA 4FNWA 4GT4A 1YQJA 2Y0AA 3OUNB 3PPJA 3MA3A 3MY1A 3QU0A 3RWQA 4BTFA 5BUEA 5IUGA 5JFVA 2AC5A 3OMVA 4UXQA 4ZLYA 5I9ZA 1UNHA 5E8YA 5HBHA 4NEUA 3RHKA 3VO3A 5I9YA 1UV5A 4GEOA 1Y57A 2GNJA 4I1ZA 2QQ7A 4XG9A 3QZHA 2W5BA 3POZA 3I0QA 3U8WA 4EJ7A 5A14A 2PZIA 3OBGA 4BL1A 1JPAA 3F69A 3PLSA 4FF8A 1F3MC 3EQDA 4IM2A 4BKJA 3FC1X 4YJNA 2J0MB 4HOKA 4YLKA 3VC4A 4XV1A 4IAFA 5M08A 2JDTA 3UG2A 2W1HA 4AN2A 4Y85A 3ANRA 4JBQA 3CKWA 1YXSA 3QWKA 2JGZA 4FV9A 1QPCA 1QCFA 3ORNA 3Q96A 4YUQA 3QALE 1OL1A 2YWVA 5CEKA 4X2GA 5EM8A 3COMA 2JIIA 1CKJA 3OTVA 4FV4A 3GB2A 4IH8A 4L3PA 4LRKA 4GVAA 5AUVA 4F9AA 5IU2A 3P7BA 3JVRA 1W0XC 4PPAA 4E4XA 2QVSE 3W8LA 3F5GA 5BX0A 5AV1A 3RJCA 3FKNA 4DGOA 2WTKC 3IG7A 4IADA 5HIDA 4CT2A 2QLQA 2UZVA 1U46A 3P4KA 4EWQA 1M52A 3QGYA 4LOOA 5AIKA 1KE6A 4BZOA 4NZWB 1ZY5A 2OW3A 1V1KA 3BEGA 3R71A 4ZTHA 5AP2A 3NW7A 4S33A 5IMXA 4LUDA 1MP8A 4YP8A 5EM5A 3KMUA 3PVBA 3LMGA 4XJ0A 1URCA 3MH0A 4JG6A 3OW4A 3BIZA 4X7QA 2VGOA 4UV0A 1PYXA 5CT7A 4NFMA 1H07A 4TW9A 3R0TA 1H0VA 2UUEA 3D94A 1DM2A 4NIFA 2O0UA 4AP7A 5E8ZA 3VBXA 1W84A 1PMEA 3KXHA 3ZRLA 2C3IB 4L3LA 4FT5A 1Q41A 2GQGA 4I6QA 3W1FA 5EM7A 3QCXA 4Z9LA 1ZYSA 4FTRA 4ITHA 3WZKA 4MF0A 4DITA 3PIZA 2OJIA 4QMZA 4DINA 2J4ZA 5J7BA 2VU3A 4G3FA 1R0EA 2E9PA 3BWJA 3F5PA 4DEAA 2QR7A 5CU0A 2CNQA 3LZBA 2JAVA 3PXQA 5C8KA 4QTCA 1SVHA 4AZWA 2R3KA 1SNUA 4Z7HA 5E8VA 4ACMA 1B38A 2F49A 5EFQA 5IQDA 1VJYA 2B54A 5BMSA 4J52A 3UOKA 1V0PA 5CASA 4FEXA 4KIQA 3OHTA 5ETIA 3DT1A 3ZSHA 4FZ6A 3F3TA 5AJQA 4E5AX 2R3LA 3R28A 3F2RA 5M07A 3P9JA 4CV8A 3PVGA 3H4JA 5J87A 4EK3A 4AZVA 2PVMA 5CF8A 3FYJX 4FV7A 4O0TA 5J9LA 3VBTA 2XK3A 3CQUA 3NNUA 1H1PA 4RSSA 1ZYCA 3RAKA 2I7QA 3CS9A 3IW7A 3PA5A 3G90X 3K54A 3PJ1A 1Q3WA 1R78A 3ZEWA 5CENA 3LFQA 3MSSA 3RNIA 4HVGA 2BR1A 2XVDA 2W5HA 3W18A 4JIAA 3QQFA 4L45A 4GMYA 2BHEA 4EH6A 4OTWA 3OWJA 3ZUUA 3ZFXA 3RP9A 2B4SB 2VO0A 3O7LD 4L7SA 4QQ5A 2UZDA 5T68A 4KBAA 3ZYAA 2E9OA 2O8YA 4U97A 1ZYLA 4GVJA 3FQHA 4XP0A 1P5EA 3HUBA 4MQ2A 3V01A 3U4WA 5IMEA 2CKOA 4RC4A 4OTDA 4RVKA 2BDJA 5I3RA 4U79A 3SRVA 3OT8A 5FEQA 4IB1A 5CXHA 3V51A 2OJGA 5DGZA 5LOHA 4FYNA 2OJ9A 2OZAB 5IA2A 2YA9A 5F4NA 3D15A 3QD2B 5L2TA 2QU6A 2GPHA 2W0JA 5CS6A 1NW1A 4AWIA 3LHJA 4ZIMA 4YTIA 2QOKA 2P0CA 1ZOGA 3REPA 1GZKA 3W32A 4AOTA 2XYUA 4CKRA 3V5LA 2H9VA 3DNEA 4Q2AA 3D5WA 4S31A 1ND4A 3ETAA 1NY3A 2JD5A 3EKNA 3ODYX 4NW5A 4JJRA 5AR7A 4O7WA 3UDBA 5CU2A 3SHEA 4GT5A 4L67A 1H8FA 4XUFA 4J99A 2RFNA 4OTIA 2YIYA 3F5UA 5I5ZA 1J1CA 4I5MA 4YNEA 3ROCA 3OCGA 3UZPA 5FP6A 5C26A 5D10A 3SKCA 5E9EA 3ZFYA 4I5CA 3AC3A 5AP0A 4RJ5A 4DHFA 3CJFA 4FSRA 4CTCA 3FI8A 3MESA 4TWPA 5LXMA 4LGDA 3ZO2A 4HNIA 2C5XA 4A4OA 2EUFB 1APME 4U5JA 5DOSA 1XH7A 4IAAA 4XX9A 4G9RA 5GJFA 4XG4A 3OVVA 3G0EA 4I0RA 1S9IA 4TWOA 5CZIA 3ZRMA 4HCVA 4E3CA 1OL6A 4G5JA 2IPXA 5LVPA 5EHOA 4O22A 3ERKA 2A27A 3PXFA 3CD3A 4J95A 4C7TA 4C0TA 4TYHB 1MRYA 3VQHA 4EC9A 4IFCA 4MCVA 4CFFA 4MQ1A 4YJRA 1KOBA 3MFRA 3NW5A 2GMXA 5D12A 5DMZA 4XOYA 4QP1A 3U87A 3AGLA 5KKRB 3EFJA 1FMKA 3EQPA 4R1VA 4Y72A 3EQCA 4BCJA 4DEEA 5CAVA 5J79A 2WTKB 3BYVA 1ZXEA 2VTJA 3AXWA 5L3AA 3MH3A 3E88A 3L8PA 4XBUA 4MK0A 3PSDA 4B7TA 1P2AA 3KL8A 4FKVA 4TWNA 4Q5HA 4XH6A 4PMPA 3CTHA 3KN6A 1SVEA 4X6RA 2YN8A 4QMOA 3N9XA 2JBOA 3LFSA 2C3JA 4FV2A 4GJ3A 4RA5A 5ICPA 3Q9YA 4GYIA 5LJJA 1OUKA 4IZ5A 3MFUA 4F0IA 2IZRA 3VBWA 4YJOA 5CAQA 4ANQA 3OP5A 2CGUA 3FHRA 3UQFA 4QYGA 5HO7A 4FNYA 4S34A 1PMNA 4JQ7A 3WILA 4RWLA 2H8HA 3AC2A 4L52A 3BCEA 2DS1A 2IZSA 4RQKA 4DFUA 3MV5A 5E92A 2WU6A 1M14A 2ZM1A 2ZB0A 3HP2A 4FL1A 4WRSA 4DFXE 3S95A 4JDHA 4F9CA 3PG1A 4IVDA 3KCFA 4AGWA 4XLIA 4W4WA 3ODZX 3CC6A 3P0MA 3Q6WA 4FV1A 3EQRA 4D2RA 3ZM4A 2J0JA 1MQBA 2E2BA 1IAJA 1A9UA 3DAKA 2LGCA 1BI7A 2VGPA 1BLXA 4FGBA 2ITTA 2QKWB 4FSTA 5AP1A 2EU9A 5FM2A 4R5YA 2V22A 2WMBA 3PUPA 3A99A 5HG8A 2C6IA 4HYIA 4FTQA 4MBIA 5I3OA 4DG3E 5JQ5A 5KBQA 5IQGA 3EB0A 2Y8OA 2F2CB 2HAKA 3EN5A 2IZTA 2O65A 2ITVA 2PE2A 2QG5A 2V55A 4FL2A 3QX2A 4JAIA 5ANIA 3BYMA 4C3PA 3CXWA 2R7BA 4RBLA 4XRJA 3ZRKA 2VWWA 3QKLA 2VTQA 2Z60A 5CVHA 3ZO4A 3L8XA 3FLQA 3R21A 4S30A 5K0XA 2B0QA 5IH4A 3GUBA 2YACA 4XP2A 5CSVA 4FMQA 3BBWA 4FG9A 1U5QA 5IQEA 3CTJA 3EQBA 4U6RA 1XH4A 2ZM4A 2RFEA 4F09A 1BKXA 2XNGA 2CDZA 3KU2A 4GK4A 3EQGA 3MVMA 3SVVA 1OPJA 4R8QA 4C4FA 4QMQA 4RWKA 4O0YA 1NVQA 4ZSGA 3D83A 3HV7A 4F9BA 1REJA 4TTHB 4UEUA 4B6LA 1J7IA 4I21A 5CSPA 4IX4A 1TQIA 3MA6A 2PUNA 3QTRA 2C1BA 3DZQA 4U9AA 4UZHA 3QBNA 4IWDA 2UZLA 3QGWA 4QMYA 5HLPA 3V5QA 4FTAA 4F9WA 1WFCA 3HV6A 4AF3A 2IW6A 4UYNA 2JKQA 3MVJA 3SV0A 3DXPA 3F7WA 2FVDA 1IASA 4EBVA 4RIXB 5L8LA 2NO3A 3NRMA 5CANA 3HGKA 3ULIA 2CN5A 1H27A 4C4IA 4BDJA 1TQMA 4BICA 1W8CA 4RJ8A 5IDPA 2CCIA 2R2PA 4UZDA 4J53A 1FVRA 5ACBC 3VRZA 3ZSIA 2HZ4A 4TRLA 4CLIA 1BMKA 3NPCA 3VUHA 3DZOA 4H36A 3KCKA 4EYJA 5BVWA 5DR2A 2NRUA 4Y73A 5FXQA 1LUFA 3ZZWA 2UVXA 4NCTA 2WEVA 4E7WA 2C0TA 4YJUA 3MDYA 1OKWA 4ZSLA 2BMCA 1YHVA 2PZRA 4GFMA 3HMOA 5AV2A 1G5SA 5FXSA 5A4EA 3WZUA 4JAJA 3VHKA 1LPUA 5GZAA 3Q2JA 2G9XA 4WUNA 3WIGA 4OTPA 2ZV8A 1XQZA 1WVYA 5JMSA 5IQBA 4FA2A 3ORPA 5EKOA 1ZOHA 2GDOA 4O6LA 2RFDA 4EL9A 5AUXA 2YZLA 3TKUA 4K33A 1IEPA 2PTKA 2R3QA 5BUIA 2WQEA 3KK9A 4YLLA 4QTAA 4D4VA 2XCKA 3QWJA 2F7ZE 5A4LA 3P86A 4DLJA 2ERZE 5LWMA 4G2FA 4ZEGA 3BYUA 4OR5A 3A8XA 3MYGA 5J8IA 3UPXA 1ZMUA 5AADA 3D2KA 1Z5MA 4CYIA 1YOLA 3H9RA 3PVUA 1UNGA 3GQLA 1BUHA 3TT0A 2FB8A 3IW8A 4FV5A 5HI2A 1ZAOA 4U43A 5FEEA 4M67A 3SXFA 2G01A 2VTRA 2Z2WA 4GRBA 4LMNA 5AWMA 3HV3A 1KV2A 3GXLA 2DQ7X 4EUTA 4FKGA 1OMWA 4R6VA 3IK3A 3FXWA 5CZHA 4LOQA 2PVNA 2GHGA 5HD7A 4N57A 1NVSA 2W5AA 4IWOA 4KBKA 2CNVA 5I4NA 2XK8A 4FVPA 4ACHA 2YM6A 3OCBA 4LV8A 4FYOA 5GINE 3Q5ZA 2A1AB 1CDKA 2ONLA 2W05A 2XIZA 3MB7A 3FWQA 3D2IA 3OOMA 3QD0A 4DC2A 4B8LA 3HAVA 1OI9A 4CFXA 4UMQA 4CQGA 3WZEA 3EWHA 2EB2A 3KQ7A 1PMVA 5A6NA 4NH1A 4BDEA 3FV8A 2HZ0A 3KFAA 3LLAA 1URWA 4MH7A 5JN2A 1PXJA 3SXSA 3EFLA 3S0OA 4CV9A 3IW6A 4KS7A 3ZC6A 1G3NA 3BGQA 4HPUE 2VTHA 4G34A 5GIPE 2W17A 4YURA 3M1SA 4P5QA 3TNPC 4MD9E 4YSMA 2VWXA 4DEIA 2WIPA 3D9VA 2P4IA 2C6MA 4PP7A 1HCKA 4FG7A 4FKWA 4FX3A 4KD1A 3LVPA 4YJVA 3T3UA 3R7OA 4PUZA 2FSMX 3QCSA 4FKTA 4NFNA 2RSVA 3OS3A 4X3FA 3BPRA 3VUKA 2C6EA 4AXAA 2PVHA 4JLCA 2PUUA 3VS0A 3W2QA 5FGKA 3HMNA 4Q9ZA 4ZMEA 2X9FA 1Q62A 3IW5A 2X8EA 2OG8A 4DN5A 5HBJA 4R77A 3EFWA 4A9UA 2O64A 3LM5A 4ACCA 2OBJA 1PXNA 4X3FC 1RJBA 3FZRA 1PKDA 4E5BA 5HX6A 1XWSA 2R3HA 2R3NA 1GZNA 1XH9A 3DU8A 4R3CA 2QCSA 3NUUA 3QQLA 4K11A 5A4QA 3GT8A 3LFNA 3R9RA 4QMUA 2I0HA 4GYGA 3MN3A 2YJSA 2XEZA 3FUPA 3ORLA 4CFWA 4DE4A 4G9CA 4U0IA 4G1WA 2C0OA 3CQWA 4F9YA 5A54A 4QQJA 4EJNA 2HY0A 1WBVA 5AR2A 5FD2A 4U40A 3R8LA 2YJRA 3F3VA 3OXIA 4H3BA 3UOHA 3VUDA 4IX5A 4F1OA 1XO2B 3FMDA 4CCUA 4UN0C 3NYNA 3NIEA 2WQBA 4O27B 3K5UA 2R3OA 2WAJA 4F6WA 5IQCA 1CKIA 4FV3A 4C38A 3R1YA 2BRBA 3AC8A 4F7SA 2CMWA 2XNEA 3COIA 3QTIA 4OLIA 5HTCA 4F0GA 5L6PA 4NM5A 3EN4A 4XNEA 4HVDA 3BYOA 4FIGA 5ETCA 5H8EA 1A48A 4L7FA 1WBWA 4JNWA 4BGHA 4KINA 3RZBA 3FHIA 5D1JA 4UWBA 4PY1A 5GNKA 3SDJA 2C5OA 4LUEA 3ZLXA 4I20A 4HCUA 4A9SA 3QD3A 3NZ0A 4FKSA 5F95A 1CTPE 3TEIA 3V8TA 4IACA 4FZAB 4GIIA 2W99B 4IB3A 2JKKA 4HW7A 4XLVA 3AD5A 3V5WA 4BDIA 3UE4A 2Z7SA 1M2RA 3UIXA 3PA3A 5KMMA 2QO9A 3R04A 4RIWA 3G5DA 3JXWA 5HVKA 5E8SA 3DAJA 4CZYB 2QU5A 3COHA 4EH8A 1G8AA 2B7AA 5G6VA 2Y4IC 4RFZA 3U6HA 2CLQA 2ITPA 2XIKA 2VTLA 4JQ8A 3V3VA 3V8WA 4AE9A 4QPAA 2UW6A 2WTWA 1GZ8A 1Q5KA 1Y6BA 4H3PA 3R1QA 2BILB 2HELA 4I94A 4WNKA 3I81A 3LFDA 1LEZA 3MIAA 5AM7A 3FYKX 4CNHA 4ORKA 1ZOEA 3E5AA 5HIBA 3F3ZA 3CD8A 2XK7A 5E8XA 3CPBA 4KSPA 5K3YA 4FVRA 4EOIA 3FEGA 4FTNA 4YC8A 4IVAA 3UYTA 3WIKA 5KMOA 5HVJA 3P5KA 1H28A 3TDWA 1OPLA 1H08A 3DCVA 2YM5A 4JBOA 2V7OA 3R9HA 5M09A 4QD6A 1YDRE 2WMTA 4GG5A 3W2PA 2DWBA 4BHNA 4NYEA 3RPOA 4PNIA 3PZHA 4F1MA 4BR3A 4RIXA 5HORA 1H01A 4A4XA 2QLUA 3G9NA 4QPSA 3WF8A 3OWKA 4NM7A 4AGDA 1JKTA 4CG9A 3BV2A 1BI8A 2C0IA 4FBXA 4OW8A 2A0CX 5J7HA 5G1XA 3LCTA 4MNEA 5HKMA 4BIEA 3O17A 3R9OA 5AUYA 1IA9A 4UWCA 2BROA 3MH2A 1U54B 3DDQA 3DFAA 3QZIA 1PMUA 1U59A 1QL6A 2HZNA 2JIUA 3KRRA 5FWKK 3OG7A 4NTTA 2F7EE 3BE9A 4UB7A 5E8UA 2UZEA 3H10A 2GTNA 4AGCA 4YTCA 3UNZA 4QYFA 3DGKA 4QMPA 4DEHA 2HXQA 3W8QA 4EH9A 4ANOA 2AUHA 5ANOA 4F1TA 4BWPA 4K0YA 5D7AA 3RINA 1E1VA 2OJFE 4QMSA 4JRVA 4BDAA 2WTJA 3AT2A 4GUBA 4QQCA 3MY0A 3HKOA 2YM4A 3KF7A 4U8ZA 5L2WA 4LGHA 1FQ1B 2A2AA 4W4VA 1OPKA 2YM3A 3W2RA 1OM1A 4CQEA 3E3PA 3Q9WA 4GS6A 4MXOA 4G3GA 3RZFA 3LCSA 1WBNA 3WE8A 1SZMA 4M69A 3FMHA 2BZJA 2XB7A 1B6CB 3KY2A 3PE2A 4EOKA 2VN9A 3B2WA 3ZLWA 4AA5A 2QC6A 3MTFA 3QQHA 4WUAA 4USEA 1U5RA 1IRKA 3MB6A 1UU8A 3TZMA 4QP3A 2VTTA 2PHKA 3BLQA 3E3BX 2PU8A 3LOKA 2R3FA 3ORXA 4XG2A 4MWHA 2GS6A 3FKOA 3QFVA 4IB5A 4IJPA 1PXLA 4C2WA 3QTXA 3KRJA 1DAWA 3L1SA 3TTJA 1CKPA 5HD4A 3FL4A 4O0XA 3UPZA 4HNFA 3I4BA 5HE2A 4GU9A 5DVRA 4BFMA 3KA0A 3OXTA 4AZSA 3PZEA 4N0SA 5KE0A 4I41A 3SA0A 2WTVA 5IF1A 3QTSA 5HU9A 4TWCA 1YI4A 4AA4A 4JI9A 4WA9A 4MXXA 3F6XA 1OBGA 2PVYA 3C51A 4L53A 3HRCA 3DNDA 4PMMA 4HGTA 3TI1A 3DDPA 1ZY4A 3KULB 1MRVA 5IUHA 1QMZA 5AP3A 4ANSA 3LFBA 1YHSA 4JQEA 4CEGA 3PPKA 3GVUA 4WSQA 5FP5A 5AX3A 3W2OA 2HW7A 5J5SA 3F9NA 3LM0A 3W2SA 2B9HA 3CPCA 4O91A 5EW9A 3OROA 4FTTA 1FVVA 4XMOA 1XJDA 3LIJA 5LVNA 4FTOA 3D0EA 3OBJA 3QRTA 1WZYA 4PF4A 4EZ7A 2BFYA 3DAEA 3ZXTA 1OGUA 3FMLA 4CZUA 4RIWB 4FSMA 3ZHPC 3VF9A 4AOJA 3RVGA 1U54A 2ZMCA 3M2WA 3NUSA 4QPMA 4H1JA 2BIKB 3EL8A 3NVKI 2VO3A 4CFMA 4C34A 5K0KA 4BCNA 3RHXA 3U51A 3VVHA 3DLSA 2LAVA 3NUAA 4AAAA 2WEIA 4LGGA 2Y6MA 2PY3A 1JSUA 2PSQA 4II5A 4BWKA 5F94A 1RQQA 1TQPA 4BCPA 5DT0A 2OH4A 5ACKA 4CTBA 1X8BA 4EEVA 3A7JA 2GTMA 4ASXA 4BTMA 3FMMA 4Y95A 5BVKA 4I4FA 4EKKA 4O82A 4Y5QA 5I9UA 3F7ZA 3O7LB 2QO2A 1WBTA 4JG7A 3R8PA 2EWAA 2XMYA 1ZLTA 2YFXA 1BL7A 4JBVA 4P7EA 2GCDA 5C01A 4R3RA 2EXCX 3GU7A 3OEZA 5T3QA 2J5EA 1LP4A 2XNBA 2BZHB 3GCQA 1AQ1A 2XEYA 2JEDA 3Q4ZA 3ORMA 3CY3A 2E9NA 3G33A 1SMHA 3K3IA 3U6JA 3PLAE 4HYSA 4P90A 4BBEA 4BB4A 4EH3A 4LL0A 5CVFA 5H2UA 4AT5A 4RX5A 3IGGA 4HCTA 1IG1A 4ANLA 3JYAA 4IVCA 4ACDA 2R3PA 5CU3A 3LAUA 4EK6A 2YIRA 2AC3A 3BU3A 3LLTA 4JIKA 3O51A 5ETAA 3V5JA 3S1HA 3DJ6A 3FLWA 3THBA 4FIFA 4RJ3A 3D14A 1PW2A 3FQSA 2YDKA 2F7XE 5HLNA 3F2AA 5JGAA 5HG7A 2Q0BA 3NCZA 3UJGA 2FSLX 3Q5IA 3TNQB 5CTPA 3HP5A 3JS2A 4AOIA 2XP2A 2OXDA 1PJKA 3A8WA 3QTWA 5DEYA 4D2TA 1GY3A 1SVGA 4Q5EA 2R3MA 3GC8A 4CGAA 2O5KA 3LJ0A 4AN9A 3LXLA 4U42A 1KE7A 4IMYA 4FSQA 4OT6A 5K4JA 3P7AA 4AW0A 5A46A 4I6BA 5A6OA 4CXAA 5DWRA 3JPVA 5IEXA 1Q61A 3RI1A 5CI7A 2JKMA 1UU3A 3T8OA 4RVLA 4JDIA 1VR2A 3MVHA 4PX6A 4TYHA 3TV4A 3SRVB 5FLFA 2ZAZA 1OBDA 3IKAA 2UW3A 3QX4A 4ZTNA 5EDQA 5KKRC 4D4YA 1B39A 3GC7A 2ZMDA 3DFCB 3KVXA 3LJ2A 4J7BA 4EOPA 4Z16A 4TYIA 4DFNA 3SX9A 2JLDA 3C4FA 3PVWA 1UU7A 3TACA 4BYIA 3FMEA 3WARA 3WF9A 3QF9A 3DK6A 5AUWA 3F3UA 4GK3A 3UTOA 4DGGA 4QMTA 2UVYA 2WIHA 4GV1A 4BI2A 2XNPA 3TNHA 4CT1A 2E9UA 2WMQA 4PMSA 3BHYA 3KRLA 3O8TA 1JLUE 2UW5A 4FZDB 3GCPA 4IHPA 4YBJA 5AR4A 4DH1A 5K9IA 3JY0A 3TIZA 5FM3A 3UIUA 4C3FA 4D1SA 4QMMA 2G1TA 5E1EA 5JKGA 3VUTA 4AT4A 3UIBA 5HESA 3EYHA 4E4NA 1M2PA 3LFCA 2Y7JA 3K2LA 4XHKB 3TKIA 4MBJA 4QP7A 4BCIA 4DEBA 5FXRA 1Y6AA 1K9AA 4O38A 3RTPA 2FYSA 2PMIA 3CJGA 3MWUA 5DPVA 3PP1A 3KXNA 3OY1A 5AR3A 5H3QA 1FOTA 3C50A 3O8PA 3Q52A 1QPDA 4QMVA 3PRIA 4RC3A 3VS4A 1IA8A 3DKGA 5BNJA 4E6AA 2XNMA 4XS2A 4AFEA 1JKKA 1YOJA 1V0BA 4WBBB 5JK3A 1KE9A 3OWPA 5HTBA 4IBMA 3FY2A 2CSNA 2RF9A 5AP4A 5HU3A 2GNFA 3R63A 3UODA 4H05A 3BU6A 2YLEA 3WYYA 2VD5A 4LL5A 3A61A 4LFIA 2XM8A 4LRJA 2FSOX 4AACA 3DBFA 3QTUA 4I0TA 3PXYA 1OKZA 3QQKA 3QZGA 4MXAA 4FKJA 4QP2A 2BHHA 5EYKA 2Q83A 2CGXA 3C4EA 2OFUA 2PVRA 3WOWA 4EHEA 1V0OA 2F9GA 4TL0A 4Z3VA 1UWHA 3QCQA 5HG9A 3UO4A 2WO6A 3Q04A 1T46A 4IDVA 4LOPA 4R3PA 2YITA 3A7HA 4W9WA 3WI6A 5AR5A 5F1ZA 5HG5A 2A19B 3PSCA 3QZFA 4PL5A 5DHJA 3FI2A 4ACGA 5BPYA 2V7AA 4WRGA 4A9TA 1OL7A 4IE9A 1YXVA 3BYSA 3DTCA 4PP9A 1PYEA 2XM9A 4MBLA 4YPDA 2IJMA 3DJ7A 2V0DA 4UMUA 2SRCA 2QONA 3CLYA 3FMKA 3M11A 4PPCA 4TNBA 3TIYA 2XKDA 4XCUA 4I5PA 3U9NA 3A60A 3F66A 3EOCA 4TNDA 3W16A 3VW6A 2WNTA 3V5TA 2GNHA 2YAAA 2NRYA 4EH5A 3KVWA 4K2RA 3KEXA 5A9UA 2FSTX 2PL0A 3QTQA 4FTKA 2BRHA 2VWZA 2WOTA 2V5QA 4FIHA 1O6KA 2DYLA 5FBOA 1ZYDA 3R7GA 3UG1A 4EQMA 4FSUA 4E6QA 4BC6A 3LKMA 3S00A 3L9MA 4FG8A 4I24A 5C8MA 5BUJA 3UP7A 3IO7A 3QQUA 4KAOA 5FTOA 4ALWA 2WTIA 3DBEA 4QTBA 3DKCA 4NW6A 4X21A 4YHTA 2XA4A 2QKRA 3UP2A 4RWIA 3ORTA 4GU6A 3WZJA 3MFTA 4DBXA 5J95A 2ITNA 4LM5A 5CU6A 3HMPA 3PE1A 4BIDA 4EOMA 4E1ZA 1YVJA 5L2IA 3AC5A 4K9YA 2CNUA 4KIKB 2OJJA 2CCHA 5KMJA 3R7VA 4EQUA 3BBTB 4RRVA 3ZMMA 2PWLA 4WNOA 4NM0A 4FIIA 4B8MA 1JOWB 3R02A 4YZ9A 2X8DA 5E7RA 4EOLA 1UVRA 1XBBA 5AAFA 3QHRA 3FPMA 4TPTA 1PXOA 3H0ZA 2BKKA 4RA4A 4PDSA 4RGJA 2YEXA 4A06A 2QO7A 3QRKA 2GHLA 4ITJA 4WD5A 4DAWA 4F4PA 2ITZA 2WTDA 5AR8A 4FTMA 4PL4A 3R7UA 1A06A 1ZRZA 3IOPA 4O0SA 3LXNA 1OECA 4I6HA 4JVGA 1DI8A 4RLLA 3DOGA 1PY5A 5CVGA 3ANQA 4ZY5A 2HCKA 4O0WA 3TZ7A 3NNXA 4ZSEA 4U3YA 5M51A 4RFYA 3FPQA 4V04A 3AOXA 4HYUA 4C3RA 4ZZNA 2R0UA 4O7ZA 3QRJA 3P78A 3BHTA 4MWIA 4MXZA 4PRJA 4ENXA 5EKNA 5CSWA 2GQRA 4EK4A 1GIJA 3TL8A 3KMWA 3HDMA 4FZ7A 1JSTA 2VTOA 3DKFA 2QI8A 3KXGA 2BCJA 3PIXA 3G6GA 3UO6A 1M17A 2C5NA 4BCMA 4KKGA 3D5VA 4EI4A 1M7QA 5CSXA 2XJ1A 2V62A 4A7CA 2WQOA 1O6LA 3FXXA 4R7BA 5CWZA 2C3LA 5L6OA 1KUTA 4S2ZA 5HBEA 3CE3A 2HYYA 5LMAA 3G15A 2C6KA 5BMMA 2XIXA 4YZNA 3UZTA 5FUTA 3DQWA 3ZM9A 3NDMA 4ASZA 4GG7A 2VTNA 4X3FB 1GAGA 3VBYA 5JQ8A 1ATPE 3BHUA 4AA0A 3ENMA 4IC8A 4GCJA 3KRXA 2UW4A 3M42A 2WOUA 4IEBA 2P3GX 4ZTMA 1YW2A 4J96A 2XBJA 4QNAA 4D9UA 3MPTA 4DGLC 3FMJA 2C6DA 1H1WA 1ZMVA 5J5TA 2ZJWA 3W10A 3GOPA 4BKZA 2C5VA 3F61A 3PWDA 4FVQA 3I5ZA 3MTLA 4M97A 1Y8GA 3QXOA 2OH0E 5CT0A 5ANGA 3BWFA 3TTIA 4EUUA 4BCOA 3H3CA 1YDSE 3C4XA 3H30A 5H8BA 3C4CA 4H58A 3TKHA 3TV7A 4YTFA 2WQNA 2OLCA 4FGRA 2WMVA 4O0UA 4E93A 1RW8A 5IA1A 4TXCA 5M44A 2PVLA 5B0XA 4L43A 3DLZA 3R7EA 1J3HA 5GZ9A 3WYXA 3ZXZA 2BDFA 4F70A 4Z55A 4F99A 3UIMA 5EYCA 5CYIA 1UNLA 3TG1A 3EZRA 2PUPA 3NAXA 3VS7A 2WMSA 3MW1A 4QOXA 3SG8A 5HNBA 3I6WA 4M66A 5I0BA 3R1SA 3HDNA 3UMWA 3C13A 4QTEA 1ZMWA 4MHAA 2H6DA 2VNYA 3GI3A 3UC3A 3WE4A 4QP9A 4D28A 2BIYA 2WFYA 4PV0A 4I5HA 3O50A 3G9LX 3BHVA 3BHHA 4F08A 1GZOA 2ITOA 2QOBA 2VWIA 4FOCA 5BVEA 5AIRA 4DLIA 5DN3A 4RVTA 4ZZOA 4E73A 2ZB1A 2W9FB 3VJNA 3SW4A 2G15A 5E8TA 2B9JA 3KXMA 4EWHA 5IEYA 3LQ8A 1JKSA 2E9VA 2PMLX 3RGFA 5HEZA 3NSZA 2CKQA 3FDNA 1XKKA 4ZY6A 4O81A 2IVVA 3FC2A 4M12A 4APPA 4EH7A 5AP6A 4IM3A 4E20A 1CM8A 2O2UA 2OZOA 2UW9A 2YZAA 4OBPA 3ZSGA 4BHZA 3QC4A 4OBOA 2QHMA 4PNKA 4FODA 1YI6A 1OVEA 3SGCA 3QHWA 1Q8UA 4FTIA 5EW8A 4ZY4A 3EJ1A 5KUPA 3R6XA 4FEUA 4BTKA 4WBOA 2EXEA 2C6OA 2XKCA 1Q8YA 2R3IA 4UXLA 5DG5A 4BDFA 3HZTA 3R7YA 3KN5A 5TT7A 3QKKA 5HVYA 3TWJA 5H9BA 5LMKC 2OFVA 3QRUA 4EHVA 5E90A 4WIHA 4QTDA 3GU8A 3PFQA 3TNWA 1CSNA 5C1QB 5HE1A 3LCOA 4FI1A 3DB6A 2UZNA 5EI2A 3ENHA 4JRNA 1ZARA 1AGWA 4BN1A 3IPHA 2VO7A 2YAKA 2XRUA 3B8QA 4M13A 3ZTXA 4TN6A 3UGCA 4DG0E 3S4QA 3RMFA 1TKIA 2X6DA 2WQMA 4E6DA 2RGPA 3SAYA 3ACKA 4RZVA 5DFPA 1Y8YA 4YZMA 4L68A 4X2KA 4TY1A 2R3RA 2XK6A 3PJ3A 2GHMA 1RE8A 2P33A 3TXOA 2YM7A 4FEWA 3G6HA 3NWWA 4MNFA 3TZ9A 4KRDA 3NGAA 5AUTA 5AMNA 4Y83A 4AX8A 1E9HA 1H1SA 3QXPA 3O71A 4M84A 4NKSA 4NU1A 3OZ6A 5JT2A 5KHWA 3UC4A 2VV9A 5IA0A 4FUYA 4DTKA 3NMUF 4K1BA 2VTIA 1PF8A 3RPVA 4IAKA 1J7LA 3S2PA 2UVZA 1GIHA 2ACXA 4QQTA 1QPEA 5CY3A 4O1PA 2PULA 5EQYA 4CZTA 3FL5A 2RFSA 4NSTA 5M4CA 3JY9A 1J1BA 3R8UA 2RG6A 2YIXA 3OF0A 2W1IA 3UZRA 5M56A 5J1VA 4ZXTA 4RPVA 1JKLA 2BTSA 1K2PA 2GS2A 2W7XA 4IX6A 4AG8A 2YWPA 3G0FA 1FPUA 1W98A 2R7IA 2WELA 2R9SA 2VTPA 4IZYA 4IW0A 3V8SA 3VNTA 4P4CA 2OK1A 3OD6X 3AD6A 5AM6A 5EI6A 3UVRA 2ITQA 3QA8A 1UU9A 5D9HA 3LCDA 4Y5HA 1H00A 2I0YA 1JSVA 2GU8A 3FLZA 4ZJJA 2X4ZA 4B99A 1KE8A 4DTAA 2ZDTA 5C9CA 4HVSA 4S32A 5AAGA 5CALA 4I22A 3ULZA 4ZLZA 4CCBA 5CQUA 3PIYA 1BYGA 3GC0A 4YU2A 3OCTA 4DA5A 5KZ0A 4KBCA 3FZOA 3VUMA 4QMWA 3O0GA 4U45A 4F65A 5IUIA 4RT7A 3E8CA 2YIWA 5DBXA 1H24A 2JBPA 4G3CA 4XOZA 4RIYA 5IQHA 2R64A 3FI4A 3ZUTA 5KMLA 5DYJA 2NP8A 4NWMA 3EHAA 3ZUVA 4U7ZA 3KRWA 5B2LA 4G31A 4I0SA 3R83A 4UY9A 2C3KA 5L8JA 3IECA 3VS3A 4WG4A 2XIYA 2O63A 3HVCA 4ANNA 4G3EA 4EC8A 4ZS4A 4RZWA 1Q99A 3MIYA 4HPTE 3NUNA 3BLRA 4NT4A 2ITYA 3R8VA 4J1RA 2ZM3A 1VZOA 2VNWA 3PY0A 4HGEA 5M06A 2YCQA 3RM7A 3DBDA 1KV1A 4KS8A 4MEDA 4W9XA 3IDCA 4XBRA 3IDPA 4F6SA 5L4QA 3I1AA 2X6EA 1G8SA 1IAHA 3G2FA 2X8IA 2RG5A 3SLSA 4W8EA 2ITXA 3PY1A 4FICA 4D9TA 4N70A 4USFA 3GCVA 2X0GA 3SOCA 5ANEA 3ZFMA 5KHXA 2B9FA 2WTCA 4M3QA 2UZBA 4ALUA 2B1PA 3DJ5A 3Q6UA 5A4TA 5C4KA 4HJOA 4LG4A 4HVIA 4DCAA 3CGOA 4IDTA 4D0WA 1QPJA 4FTCA 5J1WA 3UOLA 3F5XA 2F57A 4YPSA 4LQMA 4HGSA 3E7VA 4L00A 2HIWA 3U9CA 2J90A 2QOHA 3W33A 1MUOA 4GFGA 2H96A 5CI6A 4BDDA 3TUCA 2JDSA 3C7QA 2EXMA 3FLNC 4FSZA 4TZRA 4AZFA 4AQCA 4CFUA 2OKRA 2JDRA 2YM8A 3CR0A 3RM6A 5AP5A 4RX8A 3AGMA 3RAIA 3Q60A 4KKHA 3BLHA 2IWIA 1W7HA 1OUYA 4RG0A 2J2IB 2OU7A 4C4HA 4L6QA 2B53A 5FG8A 4ZTLA 3MI9A 5FTQA 4EOJA 5HNIX 3V04A 2JFMA 5AV3A 3PXZA 4ASDA 4C37A 4AE6A 1AD5A 2C47A 4G16A 5CLPA 3WF6A 4ZP5A 2ZVAA 1PXMA 4M8TA 5CU4A 3UNJA 2QG7A 3BE2A 3GFEA 4OTQA 2XKFA 2Y4PA 3NVMB 3TJDA 3IW4A 3ITZA 3SC1A 5AV4A 2BRMA 4D1ZA 3UQCA 2PK9A 4PMTA 2IG7A 5HHWA 3ZO3A 3GU6A 3C5UA 3FJQE 4CMOA 3GGFA 3GCUA 3HV4A 4B4LA 4D2WA 5K5XA 4BCQA 2VWUA 4F7JA 3HLLA 1JWHA 3H9OA 3L9PA 3MBLA 3PJCA 2OWBA 3A4PA 4F64A 5FEDA 3E93A 3R2BA 4RIOA 3KMMA 1Q3DA 3FMNA 1I09A 2QODA 1PHKA 3TUBA 1P14A 3B8RA 4U44A 5IZFA 3TM0A 2BDWA 1FINA 2VX0A 4V05A 4AN3A 3DKOA 5EG3A 4D2SA 4DT8A 4BBMA 2XNNA 4ENYA 4AW5A 2BPMA 3MY5A 4YBKA 2OF4A 4QMXA 3BELA 4AUAA 2GFSA 1PKGA 2YISA 3EL7A 1UA2A 3EMGA 4BDHA 4EH2A 1YWNA 3ZU7A 4LRMA 1YXXA 2J7TA 3CQEA 3D7ZA 3HA6A 3QD4A 2G2FA 2XYNA 2BALA 4NK9A 4ZSJA 3VQUA 3DS6A 4AZEA 4C59A 3GBZA 4JR3A 5BVOA 4C4EA 2GSFA 5HNGA 5DEWA 3U4UA 2G2IA 4XG7A 5BVNA 4KKEA 2X2LA 3C4WA 3FAAA 5AUZA 4BBFA 3V6SA 1O9UA 5HCXA 3DY7A 3I0OA 2CN8A 4ZAUA 4NJDA 3HMIA 4FNXA 4HZSA 5DE2A 4O7LA 1RDQE 2C6LA 2ETMA 2WMRA 3R8MA 2GQSA 5E4HA 3KULA 4Y8DA 3UMXA 2YABA 3L8SA 1J7UA 2HY81 4MYGA 2PUIA 3Q2MA 3POOA 2C1AA 4M0ZA 4YO6A 4A4LA 1R1WA 3FSKA 4IXPA 4CKIA 4CLJA 3QTZA 5TF9A 4CRLA 4UWYA 4V01A 1SYKA 4HZRA 4BDBA 3R9NA 4IQ6A 5AX9A 4OBQA 4DFZE 3HRBA 5CF4A 4EOOA 2QOQA 4KA3A 1FGIA 4E5WA 4USDA 4AZTA 1H25A 1NXKA 3DXNA 4JBPA 2R4BA 2ITUA 3EN7A 2X2MA 3HYHA 4GUEA 5JZNA 2QNJA 2J51A 3VF8A 2X7FA 1LEWA 4LMUA 4F63A 3HL7A 1DS5A 4OTGA 3UOJA 4IAZA 5IKWA 4RC2A 5IDNA 1NVRA 4GL9A 2ESMA 1OIYA 3KREA 3PYYA 3ATTA 4FSYA 4PDYA 4UMTA 3DA6A 3FY0A 3GP0A 2UW8A 4X3JA 2KULA 2YHVA 4FL3A 4PDOA 2J50A 5BYZA 3LQ3A 2EB3A 3CKXA 1GJOA 4YGAA 4RMZA 4JL9A 5IQAA 3B2TA 4M14A 2C5YA 3V6RA 4DH7A 4J8NA 3ZH8A 2C6TA 2YDJA 2W4OA 2BZIB 3Q4UA 2HZIA 2VWYA 1XHAA 3Q4CA 4L01A 4A07A 4ANMA 4YR8A 5DRBA 4UALA 4D4RA 2VX3A 4NJ3A 3T3VA 2NNWB 4K18A 4V0GA 3N4TA 4NCTC 2WGJA 1WAKA 3HV5A 1ZZLA 3AG9A 4QT1A 3HUCA 5DR6A 5CQWA 4ZJIA 2X4FA 3FZTA 4GSBA 1ZYJA 4OTRA 3R9DA 2J0LA 3QUDA 3P23A 4Y46A 5EDPA 3ROYA 3BI6A 4AFJA 3ACJA 2VTMA 3JUHA 3D5UA 5KCVA 4DF3A 3NIZA 4UX9A 3AT4A 3E7OA 5BVDA 4PPBA 3C0GA 3F3WA 1SNXA 4JG8A 3RPSA 4E6CA 4AW1A 3BRBA 3RAWA 4FV6A 3A7GA 3NR9A 4RJ6A 2OF2A 2I40A 4KB8A 1WBPA 1M2QA 3UVPA 4JDJA 2JC6A 3IDBA 4PWNA 5B7VA 1DAYA 2QOCA 2OIQA 2W06A 4RJ4A 4WG3A 4ZSAA 3W55A 2IZUA 4FIEA 4FSNA 4G3DA 4MF1A 4J97A 4O6EA 5FRIA 3VBVA 4AU8A 3NUYA 3C9WA 1FMOE 3MPAA 4J8MA 1REKA 4BDCA 5JFXA 2FO0A 4DEDA 4YSJA 4D1XA 3A2CA 4RX9A 3A62A 5CAPA 1FGKA 4GW8A 1JAMA 4IX3A 2C30A 4OAVB 3ZEPA 4YO4A 5F20A 2CJMA 3QAME 5GJGA 3VWAA 4YLJA 2W1ZA 1H1QA 1R0PA 1Y91A 3E87A 3ORIA 4XG8A 3UVQA 3VW8A 4C62A 1TVOA 4D0XA 2ETKA 5A3XA 4ERWA 1WBSA 2VO6A 1ZZ2A 1GOLA 4FTUA 5TO8A 3VUGA 2C68A 2ONLC 3GU5A 3SD0A 4ZJVA 1Z57A 3COKA 3BKBA 5LVMA 3CY2A 4KIKA 3OWLA 2OIBA 1I44A 4L3JA 2XJ0A 2X81A 3ZO1A 1H0WA 2YIQA 3MVLA 2UW0A 3LPBA 4O7VA 4FT9A 3SOAA 3C0HA 2Z7RA 4ID7A 5EW3A 3L9LA 5CEPA 2ITWA 1UKHA 4FUXA 5IA4A 3E64A 2REIA 4ZZMA 3KC3A 1H4LA 3MS9A 5TE0A 1DI9A 3O23A 2B55A 3A7FA 4IANA 3UQGA 4CD0A 3ID6C 3LJ1A 5HE0A 4FKUA 3HEGA 3TZ8A 3ZBXA 3D7TB 3Q4TA 2B52A 4WSYA 2IVUA 4K8AA 4BVUA 3NYVA 2P2HA 4TYGA 4FT7A 4FKOA 4MNEB 4FKQA 5JZJA 1OIUA 3NUPA 3OEFX 2PZPA 4EOSA 1KE5A 4QYYA 3AD4A 1YOMA 2VWBA 3DTWA 4YMJA 5BQ0A 1Q97A 4FK6A 3OCSA 4JXFA 4KIPA 1O6YA 4WO5A 4YC3A 3EZVA 3IS5A 4C8BA 3P1AA 4WHZA 3GOKA 4J98A 2XRWA 2R3JA 2H34A 2O3PA 3D5XA 4G17A 4U3ZA 1OZ1A 4CMUA 4GIHA 3I7BA 1NT2A 2YDIA 5DIAA 4E26A 1GIIA 2QOFA 4BCFA 5AA9A 3F88A 2Z7LA 3RKBA 5H8GA 1EH4A 3OW3A 4BI0A 3MH1A 3PJ8A 2A4LA 2WXVA 3QUEA 4I23A 5FDXA 5KZIA 3RNYA 4MTAA 4QYEA 4CRSA 2PZ5A 2W1GA 5L2QA 3NYXA 4UYAA 2W1DA 5C27A 4I93A 5TR6A 4EK8A 4MD8E 4BCHA 2QOOA 2HOGA 2CGVA 3A7IA 3TV6A 4V0GB 5HGIA 4YHJA 1BL6A 1YKRA 2XBAA 2YCRA 2Z8CA 2QURA 4QP8A 2WU7A 5LCJA 1S9JA 5K5NA 1L8TA 4ZOGA 1K3AA 2UZTA 1FVTA 5KO1A 2EVAA 4EKLA 5LMBA 2QOIA 3UO5A 5KMNA 2X2KA 3EFKA 2VRXA 4YZDA 4G6LA 4C2VA 1IR3A 1PXKA 4OGRA 4EONA 4CFVA 3FKLA 4FTLA 5EDRA 4DCEA 3EIDA 3DQXA 4KABA 1KWPA 2XIRA 1XH5A 2C69A 2OICA 4MAOA 3CSVA 4D2VA 3QL8A 2JAMA 2ZDUA 3GCSA 4FKIA 3RPRA 3R22A 4BGGA 4C4GA 1W82A 2Z7QA 3I60A 5HO6A 3S3IA 2P2IA 5AV0A 4BDKA 3U55A 3NS9A 1MRUA 5LQFA 1SM2A 3TN8A 2J9MA 4D2PA 3ORKA 4IC7A 1JBPE 4LV5A 4X0MA 5HZNA 2RKUA 3NLBA 4O2ZA 4BY9E 4WKQA 3LE6A 4BCKA 2I0EA 4F0FA 3ALOA 2VUWA 2J0IA 4O21A 1JQHA 5J9ZA 4EHZA 3VAPA 5IH6A 4O0VA 2KTYA 2PE1A 4C02A 3MPMA 5JGDA 3AMYA 3PG3A 4GJ2A 3K5VA 2J6MA 2I1MA 1ZWSA 5JSMA 5HIEA 4ZTRA 4M7IA 4NL0A 4CSVA 3BX5A 4FEVA 3L8VA 4IAIA 2WKMA 2F2UA 4D58A 5E1SA 1U4DA 3RALA 1KOAA 3KXXA 3ZLSA 5JGBA 4I6FA 3I5NA 4NTSA 4XG3A 3L9NA 4YJSA 5IH5A 4XYFA 5JRQA 3LFFA 2IW8A 4UMPA 3LMIA 2PPQA 4H39A 5AP7A 5DT3A 3DPKA 5E91A 4BZNA 3TCPA 1WBOA 3OT3A 4AS0A 4UMRA 5I9VA 3U54A 3JVSA 3E62A 4FIJA 5CSHA 5IQIA 4YNOA 4FOBA 5IQFA 3RAHA 3A4OX 3FZPA 3MFSA 4QP4A 3P79A 2X39A 4YTHA 4IWPA 4O86A 2WPAA 3FBVA 3Q9XA 4PTEA 2QHNA 4XV3A 4RWJA 2XK9A 4EORA 4WNMA 2CHLA 3HAMA 3RK7A 4I4EA 2F4JA 3IGOA 4K77A 3DBCA 3O8UA 3PJ2A 5IEVA 4O7NA 2XZSA 3ZLYA 1OKYA 2WMXA 4DG2E 5M4FA 5DLSA 4MKCA 3NNWA 4IVBA 4A9YA 2JDOA 4YJQA 4NM3A 4OTHA 1FBNA 2CGWA 4XG6A 2GS7A 5KX8A 1H1RA 4PQNA 4QMLA 1KSWA 4IM0A 2HWPA 5LMKA 5JFWA 4TT7A 3FE3A 3ZDUA 2JIVA 3DK3A 1GNGA 1R39A 4FT0A 3RWPA 4DGMA 2QD9A 2FUMA 4KWPA 5HCYA 1OIRA 1F0QA 3CCNA 5M53A 5M57A 5IA3A 3UNKA 2WD1A 2WMUA 4KSQA 5FBNC 3BQCA 3TJCA 5DRDA 4APCA 5EYMA 2JKOA 3C5IA 2W4JA 2GNIA 3QQJA 1Z9XA 1OL2A 4ZTSA 4PL3A 5HO8A 4A9RA 3RCJA 4BIBA 5HLWA 2JFLA 3ATSA 4N6YA 3WF5A 2VAGA 2ZV9A 5J9YA 1WVXA 3I7CA 3TUDA 3BEAA 4O0RA 5LCKA 5M4UA 4CFNA 3QQGA 5L8KA 4D5KA 4GKHA 1XH8A 5AEPA 1OIQA 4C35A 4H3QA 4RQVA 2ZV7A 5EH0A 2ERKA 5BYLA 2BRGA 4IZ7A 3NYOA 4DH3A 3VULA 3RK5A 4GT3A 4PTCA 3LXPA 4RJ7A 3TNIA 3N4UA 4D55A 3HNGA 2Y9QA 5GZ8A 2HWOA 2OGVA 5EM6A 5TKDA 3KF4A 5LWNA 5EQPA 2VX1A 3QKMA 5CF5A 4BKYA 3Q53A 3DXQA 3VS5A 3EKKA 3CIKA 3WBLA 4M68A 3GC9A 3PXRA 2Z02A 3EH9A 3BZ3A 3PTGA 3R00A 4EQCA 3BV3A 4L9IA 3OUKA 5EOLA 4G6NA 5JRSA 3FZSA 3GENA 2X7GA 3NX8A 3DBQA 4KRCA 5FQDC 2Y4IB 3H0YA 4O84A 4O2PA 3U6IA 3ZONA 1E1XA 1OKVA 3FZ1A 4FNZA 1YXTA 4DFYA 2I0VA 4IZAA 5CEQA 2X9EA 3EN9A 3K3JA 4YC6A 4ZLOA 2YCFA 5D11A 4KNBA 5EHYA 2I6LA 4DGNA 4RVMA 4QMNA 1T45A 4CG8A 4C57A 1R3CA 4FKLA 3CP9A 2YERA 2XKEA 3V5PA 4RLKA 4LI5A 2BAKA 3PPZA 2JDVA 2P55A 2CKPA 3VUIA 5CEMA 3DK7A 5D41A 3FQEA 4F7LA 3EYGA 5LARA 2HK5A 4C61A 3AMBA 2J0KA 2JITA 4EH4A 4XP3A 3VN9A 2PVJA 4AT3A 3E8NA 2FGIA 3GEQA 2CPKE 3LCKA 4XEYA 4BCGA 3SQQA 3GFWA 3C1XA 5CF6A 2IN6A 2OXXA 5DNRA 2HW6A 3TDVA 3D4QA 3OC1A 4YJTA 4NKAA 1YWRA 3VS6A 5K4IA 3VIDA 3Q32A 3LQ5A 3BGZA 4L44A 4BI1A 3I79A 1WCCA 3VS1A 5A4CA 3FXZA 1WVWA 3KXZA 4HGLA 4QYHA 5BYYA 3ZDIA 2PMNX 4OT5A 4P2KA 4OAUC 2XK4A 4U80A 4CYJA 5L6WL 4AW2A 4O96A 4RIYB 3AC4A 1OITA 2XUUA 1XBAA 5EI8A 1NA7A 4X2NA 4I92A 5C03A 3BQRA 3QLGA 2UW7A 3PDTA 5I9WA 2XCHA 4L8MA 4R7HA 3AC1A 4IFGA 3SW7A 4ZS0A 3C0IA 1PXIA 5EQEA 4E4LA 4C58A 2CKEA 4RX7A 5GJDA 3OOGA 4FT3A 4FC0A 5M55A 3P08A 4BZDA 4EOQA 4F6UA 3VHEA 3HECA 5HX8A 3SG9A 2VTSA 4W4XA 5HCZA 2BZKB 3N51A 4E8AA 2BAQA 1J91A 4D4SA 3GQIA 5CAUA 5I9XA 4NIFB 3FLYA 4M0YA 2W1CA 2R0IA 2XJ2A 5KNJA 1M7NA 1Q8ZA 2UV2A 4WOVA 4ARKA 4JOAA 3NAYA 3QA0A 3R2YA 5ANJA 4DH8A 5HE3A 4UBAA 3JR1A 2UZUE 4DT9A 4BDGA 2W1FA 2J5FA 2VTAA 2Y6OA 3AMAA 4IIRA 3F82A 1H26A 2VWVA 4ONAA 1XH6A 4H1MA 2W4KA 4I3ZA 4ZMFA 5FTGA 3LFAA 5LVOA 1YXUA 3PP0A 3RBWA 4ITIA 4W8DA 4QRCA
chains in the Genus database with same CATH superfamily
5CEOA 1L3RE 4WG5A 3F2NA 2X7OA 3E8DA 3PWYA 4FR4A 2Q0NA 2HXLA 4YJPA 2IO6A 5ETFA 1VYWA 5ANKA 2R3GA 1F5QA 2BVAA 2WMWA 5EHLA 2IW9A 3VJOA 2GFCA 4F7NA 3PRFA 3DB8A 4FZFB 3ET7A 4FV0A 4M15A 4WT6A 3QYZA 3D7TA 2OSCA 3IONA 4NUSA 5HOAA 4HVHA 2BUJA 3HMMA 1WMKA 3ZBFA 3OTUA 4X6QC 4K6ZA 5DR9A 5FDPA 2CLXA 3R01A 5ITAA 5CNNA 3O2MA 2W1EA 2XH5A 4PDPA 4JT3A 2OI4X 3PY3A 3SXRA 2OO8X 4YHFA 2PMOX 4P5ZA 3GU4A 3E92A 3HX4A 5KMKA 2AYPA 4B9DA 2VZ6A 4FTJA 4R7IA 2BFXA 2NPQA 3WF7A 5LVLA 3ZS5A 4EBWA 3IQ7A 5EK7A 5AAEA 1BX6A 4C36A 4AGUA 3MJ1A 4FSWA 3C4ZA 4ASEA 5F9EA 4KUJA 2C4GA 3UYSA 3GNIB 3IOKA 2XS0A 3LMHA 3AQVA 3PXKA 4TYEA 3QUPA 3R73A 4IB0A 3T9IA 4L42A 5JH6A 4EZ3A 4C33A 3VRYA 3VS2A 1STCE 4C4JA 2XNOA 4R1YA 3MGYA 3ZOSA 5AUUA 4DH5A 4BYJA 4MXYA 1PXPA 5KMIA 2X0OA 4FKPA 4TKSA 4DEGA 4ZK5A 2QOLA 3PA4A 3NCGA 4XV2A 2PYWA 3P7CA 2G2HA 3CTQA 5GHVA 4N6ZA 1CMKE 4XV9A 2WMAA 2YLFA 4O7RA 3FSFA 2B9IA 3FLSA 3KGAA 5AFVA 1UKIA 5JFSA 3H9FA 2X1NA 2ZOQA 2WHBA 3CEKA 5E8WA 4TYJA 5IA5A 4HYHA 2GNGA 5CAOA 4DTBA 4BF2A 5T6KA 3QYWA 3LXKA 4YZBA 3AT3A 4DFLA 5L2SA 1Q8TA 2ZV2A 2WB8A 3RK9A 3ZZEA 2HENA 2DUVA 4R5SA 4BRXA 1JVPP 4R78A 1LR4A 2BKZA 1P4OA 2ETRA 3EQFA 4EK5A 3OXZA 3NW6A 4MD7E 4OUCA 3CGFA 4RFMA 4FEQA 1YDTE 3BU5A 4N4SA 5DH3A 1OL5A 5CEIA 1MQ4A 5CXZA 1PRYA 2RIOA 5CNOA 3R7IA 4CVAA 4EYMA 2RL5A 1YWVA 4GK2A 4IAYA 4IJ9A 5IISA 2QR8A 5HTIA 4IWQA 5TOZA 4D5HA 2ZYBA 3RPYA 4O7TA 5ANDA 3CBLA 4JR7A 3UBDA 5B2MA 5DA3A 5HICA 5KBRA 2BRNA 4JX7A 4G5PA 3RCDA 5EYDA 1Q8WA 4QP6A 3FI3A 5EOBA 4MX9A 2FA2A 1XBCA 2GNLA 4O83A 2FH9A 3NEWA 4ERKA 1HOWA 4JDKA 4U41A 4M69B 4BGQA 2OXYA 3I6UA 1YI3A 2IVTA 3ALNA 3QCYA 5B2KA 2R5TA 3T9TA 3G51A 4O1OA 4QNYA 4EHGA 4X2JA 1Q4LA 4YZCA 4DBNA 3R1NA 4O7SA 2YCSA 4DFBA 5GIOE 4E4MA 4G6OA 2W96B 3OFMA 4QO9A 5HQ0A 3PSBA 3R8ZA 3QLFA 2UZWE 3R30A 1P4FA 2OZAA 5DI1A 1VEBA 2UZOA 1HCLA 4B0GA 3WZDA 5IG1A 3LW0A 4PTGA 4LYNA 3KK8A 3Q3BA 4FV8A 4XRLA 3N4VA 4ANBA 4Z7GA 5JEBA 3EQIA 1OB3A 4Q9SA 4FK3A 2PE0A 3KKVA 3NNVA 2BTRA 3NUXA 4J71A 5CX9A 5C8NA 1XR1A 2PVKA 2W9ZB 1Q24A 4W4YA 5BVFA 5C4LA 3W0SA 3ELJA 4GH2A 2WZJA 5D7VA 3BLAA 3LFEA 3KB7A 4JX3A 3HA8A 4GFOA 4JS8A 4CMTA 1VYZA 4OTFA 2PZYA 4MVFA 4O7YA 1ERKA 4KIOA 4X2FA 4ZTQA 3VBQA 4WNPA 3DV3A 3EQHA 4L46A 5M4IA 3BL7A 4GKIA 2BAJA 4MXCA 3ZCLA 4ALVA 4BTJA 5AA8A 4FE2A 4EZ5A 3ZC5A 3O96A 3EN6A 3QRIA 3W2CA 4CKJA 1JNKA 1YHWA 3BGPA 3HRFA 3OY3A 3QC9A 2IVSA 3MJ2A 1YRPA 3Q9ZA 4BWXA 2OIDA 4U81A 2XF0A 3E63A 1W83A 2PVFA 3E8EA 4FKRA 1UWJA 5IPJA 4DYMA 5DT4A 3II5A 3ORZA 4FNWA 4GT4A 1YQJA 2Y0AA 3OUNB 3PPJA 3MA3A 3MY1A 3QU0A 3RWQA 4BTFA 5BUEA 5IUGA 5JFVA 2AC5A 3OMVA 4UXQA 4ZLYA 5I9ZA 1UNHA 5E8YA 5HBHA 4NEUA 3RHKA 3VO3A 5I9YA 1UV5A 4GEOA 1Y57A 2GNJA 4I1ZA 2QQ7A 4XG9A 3QZHA 2W5BA 3POZA 3I0QA 3U8WA 4EJ7A 5A14A 2PZIA 3OBGA 4BL1A 1JPAA 3F69A 3PLSA 4FF8A 1F3MC 3EQDA 4IM2A 4BKJA 3FC1X 4YJNA 2J0MB 4HOKA 4YLKA 3VC4A 4XV1A 4IAFA 5M08A 2JDTA 3UG2A 2W1HA 4AN2A 4Y85A 3ANRA 4JBQA 3CKWA 1YXSA 3QWKA 2JGZA 4FV9A 1QPCA 1QCFA 3ORNA 3Q96A 4YUQA 3QALE 1OL1A 2YWVA 5CEKA 4X2GA 5EM8A 3COMA 2JIIA 1CKJA 3OTVA 4FV4A 3GB2A 4IH8A 4L3PA 4LRKA 4GVAA 5AUVA 4F9AA 5IU2A 3P7BA 3JVRA 1W0XC 4PPAA 4O4FA 4E4XA 2QVSE 3W8LA 3F5GA 5BX0A 5AV1A 3RJCA 3FKNA 4DGOA 2WTKC 3IG7A 4IADA 5HIDA 4CT2A 2QLQA 2UZVA 1U46A 3P4KA 4EWQA 1M52A 3QGYA 4LOOA 5AIKA 1KE6A 4BZOA 4NZWB 1ZY5A 2OW3A 1V1KA 3BEGA 3R71A 4ZTHA 5AP2A 3NW7A 4S33A 5IMXA 4LUDA 1MP8A 4YP8A 5EM5A 3KMUA 3PVBA 3LMGA 4XJ0A 1URCA 3MH0A 4JG6A 3OW4A 3BIZA 4X7QA 2VGOA 4UV0A 1PYXA 5CT7A 4NFMA 4O4EA 1H07A 4TW9A 3R0TA 1H0VA 1G8KA 2UUEA 3D94A 1DM2A 4NIFA 2O0UA 4AP7A 5E8ZA 3VBXA 1W84A 1PMEA 3KXHA 4O4CA 3ZRLA 2C3IB 4L3LA 4FT5A 1Q41A 2GQGA 4I6QA 3W1FA 5EM7A 3QCXA 4Z9LA 1ZYSA 4FTRA 4ITHA 3WZKA 4MF0A 4DITA 3PIZA 2OJIA 4QMZA 4DINA 2J4ZA 5J7BA 2VU3A 4G3FA 1R0EA 2E9PA 3BWJA 3F5PA 4DEAA 2QR7A 5CU0A 2CNQA 3LZBA 2JAVA 3PXQA 5C8KA 4QTCA 1SVHA 4AZWA 2R3KA 1SNUA 4Z7HA 5E8VA 4ACMA 1B38A 2F49A 5EFQA 5IQDA 1VJYA 2B54A 5BMSA 4J52A 3UOKA 1V0PA 5CASA 4FEXA 4KIQA 3OHTA 5ETIA 3DT1A 3ZSHA 4FZ6A 3F3TA 5AJQA 4E5AX 2R3LA 3R28A 3F2RA 5M07A 3P9JA 4CV8A 3PVGA 3H4JA 5J87A 4EK3A 4AZVA 2PVMA 5CF8A 3FYJX 4FV7A 4O0TA 5J9LA 3VBTA 2XK3A 3CQUA 3NNUA 1H1PA 4RSSA 1ZYCA 3RAKA 2I7QA 3CS9A 3IW7A 3PA5A 3G90X 3K54A 3PJ1A 1Q3WA 1R78A 3ZEWA 5CENA 3LFQA 3MSSA 3RNIA 4HVGA 2BR1A 2XVDA 2W5HA 3W18A 4JIAA 3QQFA 4L45A 4GMYA 2BHEA 4EH6A 4OTWA 3OWJA 3ZUUA 3ZFXA 3RP9A 2B4SB 2VO0A 3O7LD 4L7SA 4QQ5A 2UZDA 5T68A 4KBAA 3ZYAA 2E9OA 2O8YA 4U97A 1ZYLA 4GVJA 3FQHA 4XP0A 1P5EA 3HUBA 4MQ2A 3V01A 3U4WA 5IMEA 2CKOA 4RC4A 4OTDA 4RVKA 2BDJA 5I3RA 4U79A 3SRVA 3OT8A 5FEQA 4IB1A 5CXHA 3V51A 2OJGA 5DGZA 5LOHA 4FYNA 2OJ9A 2OZAB 5IA2A 2YA9A 5F4NA 3D15A 3QD2B 5L2TA 2QU6A 2GPHA 2W0JA 5CS6A 1NW1A 4AWIA 3LHJA 4ZIMA 4YTIA 2QOKA 2P0CA 4DHZA 1ZOGA 3REPA 1GZKA 3W32A 4AOTA 2XYUA 4CKRA 3V5LA 2H9VA 3DNEA 4Q2AA 3D5WA 4S31A 1ND4A 3ETAA 1NY3A 2JD5A 3EKNA 3ODYX 4NW5A 4JJRA 5AR7A 4O7WA 3UDBA 5CU2A 3SHEA 4GT5A 4L67A 1H8FA 4XUFA 4J99A 2RFNA 4OTIA 2YIYA 3UDSA 3F5UA 5I5ZA 1J1CA 4I5MA 4YNEA 3ROCA 3OCGA 3UZPA 5FP6A 5C26A 1W2FA 5D10A 3SKCA 5E9EA 3ZFYA 4I5CA 3AC3A 5AP0A 4RJ5A 4DHFA 3CJFA 4FSRA 4CTCA 3FI8A 3MESA 4TWPA 5LXMA 4LGDA 3ZO2A 4HNIA 4JMQA 2C5XA 4A4OA 2EUFB 1APME 4U5JA 5DOSA 1XH7A 4IAAA 4XX9A 4G9RA 5GJFA 4XG4A 3OVVA 3G0EA 4I0RA 1S9IA 4TWOA 5CZIA 3ZRMA 4HCVA 4E3CA 1OL6A 4G5JA 2IPXA 5LVPA 5EHOA 4O22A 3ERKA 2A27A 3PXFA 3CD3A 4J95A 4C7TA 4C0TA 4TYHB 1MRYA 3VQHA 4EC9A 4IFCA 4MCVA 4CFFA 4MQ1A 4YJRA 1KOBA 3MFRA 3NW5A 2GMXA 5D12A 5DMZA 4XOYA 4QP1A 3U87A 3AGLA 5KKRB 3EFJA 1FMKA 3EQPA 4R1VA 4Y72A 3EQCA 4BCJA 4DEEA 5CAVA 5J79A 4AAYA 2WTKB 3BYVA 1ZXEA 2VTJA 2NYAA 3AXWA 5L3AA 3MH3A 3E88A 3L8PA 4XBUA 4MK0A 3PSDA 4B7TA 1P2AA 3KL8A 4FKVA 3AKLA 4TWNA 4Q5HA 4XH6A 4PMPA 3CTHA 3KN6A 1SVEA 4X6RA 2YN8A 4QMOA 3N9XA 2JBOA 3LFSA 2C3JA 1TZDA 4FV2A 4GJ3A 4RA5A 5ICPA 3Q9YA 4GYIA 5LJJA 1OUKA 4IZ5A 3MFUA 4F0IA 2IZRA 3VBWA 4YJOA 5CAQA 4ANQA 3OP5A 2CGUA 3FHRA 3UQFA 4QYGA 5HO7A 4FNYA 4S34A 1PMNA 4I6LA 4JQ7A 3WILA 4RWLA 2H8HA 3AC2A 4L52A 3BCEA 2DS1A 2IZSA 4RQKA 4DFUA 3MV5A 5E92A 2WU6A 1M14A 2ZM1A 2ZB0A 3HP2A 4FL1A 4WRSA 4DFXE 3S95A 4JDHA 4F9CA 3PG1A 4IVDA 3KCFA 4AGWA 4XLIA 3TMOA 4W4WA 3ODZX 3CC6A 3P0MA 3Q6WA 4FV1A 3EQRA 4D2RA 3ZM4A 2J0JA 1MQBA 2E2BA 1IAJA 1A9UA 3DAKA 2LGCA 1BI7A 2VGPA 1BLXA 4FGBA 2ITTA 2QKWB 4FSTA 5AP1A 2EU9A 5FM2A 4R5YA 2V22A 2WMBA 3PUPA 3A99A 5HG8A 2C6IA 4HYIA 3BL9A 4FTQA 4MBIA 5I3OA 4DG3E 5JQ5A 5KBQA 5IQGA 4BJJA 3EB0A 2Y8OA 2F2CB 2HAKA 3EN5A 2IZTA 2O65A 2ITVA 2PE2A 2QG5A 2V55A 4FL2A 3QX2A 4JAIA 5ANIA 3BYMA 4C3PA 3CXWA 2R7BA 4RBLA 4XRJA 3ZRKA 2VWWA 3QKLA 2VTQA 2Z60A 1ST4A 5CVHA 3ZO4A 3L8XA 3FLQA 3R21A 4S30A 5K0XA 2B0QA 5IH4A 3GUBA 3NFFB 2YACA 4XP2A 5CSVA 4FMQA 3BBWA 4FG9A 1U5QA 5IQEA 3CTJA 3EQBA 4U6RA 1XH4A 2ZM4A 2RFEA 4F09A 1BKXA 2XNGA 2CDZA 3KU2A 4GK4A 3EQGA 3MVMA 3SVVA 1OPJA 4R8QA 4C4FA 4QMQA 4RWKA 4O0YA 1NVQA 4ZSGA 3D83A 3HV7A 4F9BA 1REJA 4TTHB 4UEUA 4B6LA 1J7IA 4I21A 5CSPA 4IX4A 1TQIA 3MA6A 2PUNA 3QTRA 2C1BA 3DZQA 4U9AA 4UZHA 3QBNA 4IWDA 2UZLA 3QGWA 4QMYA 5HLPA 3V5QA 4FTAA 4F9WA 1WFCA 3HV6A 4AF3A 2IW6A 4UYNA 2JKQA 3MVJA 3SV0A 3DXPA 3F7WA 2FVDA 1IASA 4EBVA 4RIXB 5L8LA 2NO3A 3NRMA 5CANA 3HGKA 3ULIA 2CN5A 1H27A 4C4IA 4BDJA 1TQMA 4BICA 1W8CA 4RJ8A 5IDPA 2CCIA 2R2PA 4UZDA 4J53A 1FVRA 5ACBC 3VRZA 3ZSIA 2HZ4A 4TRLA 4CLIA 1BMKA 3NPCA 3VUHA 3DZOA 4H36A 3KCKA 4EYJA 5BVWA 5DR2A 2NRUA 4Y73A 5FXQA 1LUFA 3ZZWA 2UVXA 4NCTA 2WEVA 4E7WA 2C0TA 4YJUA 3MDYA 1OKWA 4ZSLA 2BMCA 1YHVA 2PZRA 4GFMA 3HMOA 5AV2A 1G5SA 5FXSA 5A4EA 3WZUA 4JAJA 3VHKA 1LPUA 5GZAA 3Q2JA 2G9XA 4WUNA 3WIGA 4OTPA 2ZV8A 1XQZA 1WVYA 5JMSA 5IQBA 4FA2A 3ORPA 5EKOA 1ZOHA 2GDOA 4O6LA 2RFDA 4EL9A 5AUXA 2YZLA 3TKUA 4K33A 1IEPA 2PTKA 2R3QA 5BUIA 2WQEA 3KK9A 4YLLA 4QTAA 4D4VA 2XCKA 3QWJA 2F7ZE 5A4LA 3P86A 4DLJA 2ERZE 5LWMA 4G2FA 4ZEGA 3BYUA 4OR5A 3A8XA 3MYGA 5J8IA 3UPXA 1ZMUA 5AADA 3D2KA 1Z5MA 4CYIA 1YOLA 3H9RA 3PVUA 1UNGA 5BV3A 3GQLA 1BUHA 3TT0A 2FB8A 3IW8A 4FV5A 5HI2A 1ZAOA 4U43A 5FEEA 4M67A 3SXFA 2G01A 2VTRA 2Z2WA 4GRBA 4LMNA 5AWMA 3HV3A 1KV2A 3GXLA 2DQ7X 4EUTA 3TYKA 4FKGA 1OMWA 4R6VA 3IK3A 3FXWA 5CZHA 4LOQA 2PVNA 2GHGA 5HD7A 4N57A 1NVSA 2W5AA 4IWOA 4KBKA 2CNVA 5I4NA 2XK8A 4FVPA 4ACHA 2YM6A 3OCBA 4LV8A 4FYOA 4O84A 5GINE 3Q5ZA 2A1AB 1CDKA 2ONLA 2W05A 2XIZA 3MB7A 3FWQA 3D2IA 3OOMA 3QD0A 4DC2A 4B8LA 3HAVA 1OI9A 4CFXA 4UMQA 4CQGA 3WZEA 3EWHA 2EB2A 3KQ7A 1PMVA 5A6NA 4NH1A 4BDEA 3FV8A 2HZ0A 3KFAA 3LLAA 1URWA 4MH7A 5JN2A 1PXJA 3SXSA 3EFLA 3S0OA 4CV9A 3IW6A 4KS7A 3ZC6A 1G3NA 3BGQA 4HPUE 2VTHA 4G34A 5GIPE 2W17A 4YURA 3M1SA 4P5QA 3TNPC 4MD9E 4YSMA 2VWXA 4DEIA 2WIPA 3D9VA 2P4IA 2C6MA 4PP7A 1HCKA 4FG7A 4FKWA 4FX3A 4KD1A 3LVPA 4YJVA 3T3UA 3R7OA 4PUZA 2FSMX 3QCSA 4FKTA 4NFNA 2RSVA 3OS3A 4X3FA 3BPRA 3VUKA 2C6EA 4AXAA 2PVHA 4JLCA 2PUUA 3VS0A 3W2QA 4O4BB 3HMNA 5FGKA 4Q9ZA 2X9FA 4ZMEA 1Q62A 3IW5A 2X8EA 2OG8A 4DN5A 5HBJA 4R77A 3EFWA 4A9UA 2O64A 3LM5A 4ACCA 2OBJA 1PXNA 4X3FC 1RJBA 3FZRA 1PKDA 4E5BA 5HX6A 1XWSA 2R3HA 2R3NA 1GZNA 1XH9A 3DU8A 4R3CA 2QCSA 3NUUA 3QQLA 4K11A 5A4QA 3GT8A 3LFNA 3R9RA 4QMUA 2I0HA 4GYGA 3MN3A 2YJSA 2XEZA 3FUPA 3ORLA 4CFWA 4DE4A 4G9CA 4U0IA 4G1WA 2C0OA 3CQWA 4F9YA 5A54A 4QQJA 4EJNA 2HY0A 1WBVA 5AR2A 5FD2A 4U40A 3R8LA 2YJRA 3F3VA 3OXIA 4H3BA 3UOHA 3VUDA 4IX5A 4F1OA 1XO2B 3FMDA 4CCUA 4UN0C 3NYNA 3NIEA 2WQBA 4FRFA 4O27B 3K5UA 2R3OA 2WAJA 4F6WA 5IQCA 1CKIA 4FV3A 4C38A 3R1YA 2BRBA 3AC8A 4F7SA 2CMWA 2XNEA 3COIA 3QTIA 4OLIA 5HTCA 4F0GA 5L6PA 4NM5A 3EN4A 4XNEA 4HVDA 3BYOA 4FIGA 5ETCA 5H8EA 1A48A 4L7FA 1WBWA 4JNWA 4BGHA 4KINA 3RZBA 3FHIA 5D1JA 4UWBA 4PY1A 5GNKA 3SDJA 2C5OA 4LUEA 3ZLXA 4I20A 4HCUA 4A9SA 3QD3A 3NZ0A 4FKSA 5F95A 1CTPE 3TEIA 3V8TA 4IACA 4FZAB 4GIIA 2W99B 3AKKA 4IB3A 2JKKA 4HW7A 4XLVA 3AD5A 3V5WA 4BDIA 3UE4A 2Z7SA 1M2RA 3UIXA 3PA3A 5KMMA 2QO9A 3R04A 4RIWA 3G5DA 3JXWA 5HVKA 5E8SA 3DAJA 4CZYB 2QU5A 3COHA 4EH8A 1G8AA 2B7AA 5G6VA 2Y4IC 4RFZA 1XMMA 3U6HA 2CLQA 2ITPA 2XIKA 2VTLA 4JQ8A 3V3VA 3V8WA 4AE9A 4QPAA 2UW6A 2WTWA 1GZ8A 1Q5KA 1Y6BA 4H3PA 3R1QA 4QDEA 2BILB 2HELA 4I94A 4WNKA 3I81A 3LFDA 1LEZA 3MIAA 5AM7A 3FYKX 4CNHA 4ORKA 1ZOEA 3E5AA 5HIBA 3F3ZA 3CD8A 2XK7A 5E8XA 3CPBA 4KSPA 5K3YA 4FVRA 4EOIA 3FEGA 4FTNA 4YC8A 4IVAA 3UYTA 3WIKA 5KMOA 5HVJA 3P5KA 1H28A 3TDWA 1OPLA 1H08A 3DCVA 2YM5A 4JBOA 2V7OA 3R9HA 3W0QA 4BJJB 5M09A 4QD6A 1YDRE 2WMTA 4GG5A 3W2PA 2DWBA 4BHNA 4NYEA 3RPOA 4PNIA 3PZHA 4F1MA 4BR3A 4RIXA 5HORA 1H01A 4A4XA 2QLUA 3G9NA 4QPSA 3WF8A 3OWKA 4NM7A 4AGDA 1JKTA 4CG9A 3BV2A 1BI8A 2C0IA 4FBXA 4OW8A 2A0CX 5J7HA 5G1XA 3LCTA 4MNEA 5HKMA 4BIEA 3O17A 3R9OA 5AUYA 1IA9A 4UWCA 2BROA 3MH2A 1U54B 3DDQA 3DFAA 3QZIA 1PMUA 1U59A 1QL6A 2HZNA 2JIUA 3KRRA 5FWKK 3OG7A 4NTTA 2F7EE 3BE9A 4UB7A 5E8UA 2UZEA 3H10A 2GTNA 4AGCA 4YTCA 3UNZA 4QYFA 3DGKA 4QMPA 4DEHA 4O4DA 2HXQA 3W8QA 4EH9A 4ANOA 2AUHA 5ANOA 4F1TA 4BWPA 4K0YA 5D7AA 3RINA 1E1VA 2OJFE 4QMSA 4JRVA 4BDAA 2WTJA 3AT2A 4GUBA 4QQCA 3MY0A 3HKOA 2YM4A 3KF7A 4U8ZA 5L2WA 3UDZA 4LGHA 1FQ1B 2A2AA 4W4VA 1OPKA 2YM3A 3W2RA 1OM1A 4CQEA 3E3PA 3Q9WA 4GS6A 4MXOA 4G3GA 3RZFA 1XMLA 3LCSA 1WBNA 3WE8A 1SZMA 4M69A 3FMHA 2BZJA 2XB7A 1B6CB 3KY2A 3PE2A 4EOKA 2VN9A 3B2WA 3ZLWA 2XALA 4AA5A 2QC6A 3MTFA 3QQHA 4WUAA 4USEA 1U5RA 1IRKA 3MB6A 1UU8A 3TZMA 4QP3A 2VTTA 2PHKA 3BLQA 3E3BX 2PU8A 3LOKA 2R3FA 3ORXA 4XG2A 4MWHA 2GS6A 3FKOA 3QFVA 4IB5A 2IEWA 1PXLA 4IJPA 4C2WA 3QTXA 3KRJA 1DAWA 3L1SA 3TTJA 1CKPA 5HD4A 3FL4A 4O0XA 3UPZA 4HNFA 3I4BA 5HE2A 4GU9A 5DVRA 4BFMA 3KA0A 3OXTA 4AZSA 3PZEA 4N0SA 5KE0A 4I41A 3SA0A 2WTVA 5IF1A 3QTSA 5HU9A 4TWCA 1YI4A 4AA4A 4JI9A 4WA9A 4MXXA 3F6XA 1OBGA 2PVYA 3C51A 4L53A 3HRCA 3DNDA 4PMMA 4HGTA 3TI1A 3DDPA 1ZY4A 3KULB 1MRVA 5IUHA 1QMZA 5AP3A 4ANSA 3LFBA 1YHSA 4JQEA 4CEGA 3PPKA 3GVUA 4WSQA 5FP5A 5AX3A 3W2OA 2HW7A 5J5SA 3F9NA 3LM0A 3W2SA 2B9HA 3CPCA 4O91A 2AQXA 5EW9A 3OROA 2A98A 1FVVA 4FTTA 4XMOA 1XJDA 3LIJA 5LVNA 4FTOA 3D0EA 3OBJA 3QRTA 1WZYA 4PF4A 4EZ7A 2BFYA 3DAEA 3ZXTA 1OGUA 3FMLA 4CZUA 4RIWB 4FSMA 3ZHPC 3VF9A 4AOJA 3RVGA 1U54A 2ZMCA 3M2WA 3NUSA 4QPMA 4H1JA 2BIKB 3EL8A 3NVKI 2VO3A 4CFMA 4C34A 5K0KA 4BCNA 3RHXA 3U51A 3VVHA 3DLSA 2LAVA 3NUAA 4AAAA 2WEIA 4LGGA 2Y6MA 2PY3A 1JSUA 2PSQA 4II5A 4BWKA 5F94A 1RQQA 1TQPA 4BCPA 5DT0A 2OH4A 5ACKA 4CTBA 1X8BA 4EEVA 3A7JA 2GTMA 4ASXA 4BTMA 3FMMA 4Y95A 5BVKA 4I4FA 4EKKA 4O82A 4Y5QA 5I9UA 3F7ZA 3O7LB 2QO2A 1WBTA 4JG7A 3R8PA 2EWAA 2XMYA 1ZLTA 2YFXA 1BL7A 4JBVA 4P7EA 2GCDA 5C01A 4R3RA 3W0MA 2EXCX 3GU7A 3OEZA 5T3QA 2J5EA 1LP4A 2XNBA 2BZHB 3GCQA 1AQ1A 2XEYA 2JEDA 3Q4ZA 3ORMA 3CY3A 2E9NA 3G33A 1SMHA 3K3IA 3U6JA 3PLAE 4HYSA 4P90A 4BBEA 4BB4A 4EH3A 4LL0A 5CVFA 5H2UA 4AT5A 4RX5A 3IGGA 4HCTA 1IG1A 4ANLA 3JYAA 4IVCA 4ACDA 2R3PA 5CU3A 3LAUA 4EK6A 2YIRA 2AC3A 3BU3A 3LLTA 4JIKA 3O51A 5ETAA 3V5JA 3S1HA 3DJ6A 3FLWA 3THBA 4FIFA 4RJ3A 3D14A 1PW2A 3FQSA 2YDKA 2F7XE 5HLNA 3F2AA 5JGAA 5HG7A 2Q0BA 3NCZA 3UJGA 2FSLX 3Q5IA 3TNQB 5CTPA 3HP5A 3JS2A 4AOIA 2XP2A 2OXDA 1PJKA 3A8WA 3QTWA 5DEYA 4D2TA 1GY3A 1SVGA 4Q5EA 2R3MA 2X0PA 3GC8A 2O5KA 4CGAA 3LJ0A 4AN9A 3LXLA 4U42A 1KE7A 4IMYA 4FSQA 4OT6A 5K4JA 3P7AA 4AW0A 5A46A 4I6BA 5A6OA 4CXAA 5DWRA 3JPVA 5IEXA 1Q61A 3RI1A 5CI7A 2JKMA 1UU3A 3T8OA 4RVLA 4JDIA 1VR2A 3MVHA 4PX6A 4TYHA 3TV4A 3SRVB 5FLFA 2ZFYA 2ZAZA 1OBDA 3IKAA 2UW3A 3QX4A 4ZTNA 5EDQA 5KKRC 4D4YA 1B39A 3GC7A 2ZMDA 3DFCB 3KVXA 3LJ2A 4J7BA 4EOPA 4Z16A 4TYIA 4DFNA 3SX9A 2JLDA 3C4FA 3PVWA 1UU7A 3TACA 4BYIA 3FMEA 3WARA 3WF9A 3QF9A 3DK6A 5AUWA 3F3UA 4GK3A 3UTOA 4DGGA 4QMTA 2UVYA 2WIHA 4GV1A 4BI2A 2XNPA 3TNHA 4CT1A 2E9UA 2WMQA 4PMSA 3BHYA 3KRLA 3O8TA 1JLUE 2UW5A 4FZDB 3GCPA 4IHPA 4YBJA 5AR4A 4DH1A 5K9IA 3JY0A 3TIZA 5FM3A 3UIUA 4C3FA 4D1SA 4QMMA 2G1TA 5E1EA 5JKGA 3VUTA 4AT4A 3UIBA 5HESA 3EYHA 4E4NA 1M2PA 3LFCA 2Y7JA 3K2LA 4XHKB 3TKIA 4MBJA 4QP7A 4BCIA 4DEBA 5FXRA 1Y6AA 1K9AA 4O38A 3RTPA 2FYSA 2PMIA 3CJGA 3MWUA 5DPVA 3PP1A 3KXNA 3OY1A 5AR3A 5H3QA 1FOTA 3C50A 3O8PA 3Q52A 1QPDA 4QMVA 3PRIA