4BDAA

Fragment-based screening identifies a new area for inhibitor binding to checkpoint kinase 2 (chk2)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
304
structure length
284
Chain Sequence
MSVYPKALRDEYIMSKTLGSEVKLAFERKTCKKVAIKIISKNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Fragment-Based Screening Maps Inhibitor Interactions in the ATP-Binding Site of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 284
sequence length 304
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bdaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bdaA01
3EKNA 1M2QA 4XJ0A 3CJGA 2HIWA 5H8EA 1R1WA 5E8TA 4XG7A 2VX3A 3LVPA 4ORKA 3QWJA 5TO8A 2R3KA 3OFMA 3DCVA 4XLIA 3OXZA 4C4FA 4X3JA 2J0MB 2PVRA 3GCVA 3IDBA 1EH4A 3DQXA 1OITA 2QD9A 4FE2A 4K0YA 3G15A 3IW7A 5HBJA 3DBDA 3DFAA 2BRBA 5DFPA 5JH6A 4QMSA 3GCUA 3IK3A 3Q52A 5DRDA 5CQWA 3SHEA 4BDCA 1ERKA 2F7ZE 3Q2MA 4Y46A 4YJQA 4C36A 2GQRA 4P4CA 5J7HA 3E8DA 3BPRA 2XBAA 5C27A 3AGLA 3KQ7A 4XV1A 1YXTA 3TV7A 1XBBA 2Z7SA 3GFWA 1W8CA 4FKLA 2OGVA 4EBVA 4M14A 3CKWA 5A4QA 4CZTA 5HNIX 2UW4A 2WTWA 3ZRKA 4C3PA 2NPQA 4KWPA 3VIDA 3PVWA 3ET7A 3R7GA 4FV7A 4EJ7A 4DLIA 2QR7A 1ZLTA 3OOGA 5ETAA 4BCIA 4FG7A 3U6JA 4JAIA 2BILB 4N57A 2XKDA 4ZZNA 4M68A 2FSLX 3MSSA 5E4HA 2ZJWA 3RVGA 3O71A 3GOPA 4ZTHA 1V0BA 2OZOA 4FTUA 3TIYA 4Y85A 5CZHA 5B0XA 5TT7A 3IECA 5CVFA 3SG8A 3CCNA 5AP4A 3EQRA 4C2WA 5JFWA 2X7FA 4ZTQA 2HW7A 2C1AA 3F82A 1KUTA 2XJ2A 4YZ9A 4OTFA 3PIYA 5DG5A 5HCYA 5IISA 4DH5A 4GH2A 4IAKA 2R3QA 3ANRA 1R0EA 3R63A 4OGRA 3TZ7A 3OWJA 1H1PA 1PHKA 4K6ZA 4ZY4A 3G2FA 3PJ3A 5DOSA 2QNJA 3U9CA 5K4IA 2YACA 3BHVA 2EUFB 4RBLA 2VTQA 3RWQA 1GZOA 3I0OA 4B7TA 3OWLA 4M13A 2ZV2A 4I5PA 4DINA 3R28A 1VYZA 1G3NA 3GQLA 5CT0A 4ANMA 3JY0A 1A9UA 4O2PA 5CSPA 5KNJA 3V8SA 4C0TA 4ZS0A 3Q9ZA 4KBCA 1UU7A 1UU8A 2UZEA 4GYIA 4BDGA 4JBVA 3PXQA 5L8KA 4AW1A 1M14A 5IEXA 4BCNA 1ZY4A 3POOA 5CEOA 4IQ6A 4U40A 2PVMA 2YZAA 2V7AA 5AUYA 2UW5A 3D5XA 1WVXA 3BU5A 3O8UA 3WILA 2WNTA 4NZWB 4YLLA 2GHMA 2PU8A 3IW8A 3OCSA 4FKWA 4R8QA 4EC9A 1FMKA 4L52A 2XNOA 4XG3A 4E6DA 2O3PA 4FUXA 3W33A 3F6XA 3ORXA 3KC3A 4BDDA 2F57A 5EK7A 5GIOE 5M4CA 2HELA 2UZVA 4WNKA 5CU3A 4X6QC 3FPMA 2CGXA 2R3IA 2RG5A 1OIRA 2HZ0A 2VNWA 2VTOA 3E92A 3PZHA 4FV4A 3M11A 3PA5A 5I9VA 2E9PA 2B0QA 2UUEA 1KV2A 1KE9A 2BFXA 4CKJA 4OTQA 5GIPE 2W1IA 3F5UA 4XH6A 3MY1A 5I9UA 4E20A 2ZYBA 3OVVA 3DJ5A 4IFGA 4L45A 2YWVA 4Y5QA 3OS3A 3DBQA 4RGJA 2X0GA 3MH0A 3OW3A 4BCPA 1OIYA 3BU3A 4RWKA 2W99B 1WFCA 4N4SA 2BDJA 3TI1A 4AGDA 4BDBA 4U44A 2J0JA 3L9NA 4FNXA 1SM2A 3KF7A 4PPCA 4PTCA 1CDKA 4U6RA 5HGIA 2LGCA 2O5KA 5JRSA 2O8YA 3H10A 4NK9A 3V5WA 1XH5A 4FYOA 4GK3A 4CG8A 3ODYX 4G34A 3MY5A 4RRVA 2JKKA 3RNYA 3HVCA 4DGOA 5I9XA 4BCOA 4I4EA 4K8AA 4GUBA 4LRMA 3TTIA 5M56A 3F2AA 2OH0E 3HUCA 3F3ZA 3OD6X 1Q5KA 3I1AA 4TNDA 5FXQA 2BR1A 4RVMA 1DS5A 4FSTA 3R1NA 3UIXA 2C3IB 1BKXA 2W1HA 4IC8A 4JX7A 4IXPA 5J87A 4CD0A 4RJ6A 4EOOA 4KD1A 4KIPA 5AWMA 4J95A 3L9LA 4MXZA 2HENA 2IZRA 4W4XA 3E3BX 4PRJA 5EI8A 5AUVA 5CQUA 5HBEA 5TOZA 4GKHA 2X9FA 2IZSA 4L46A 1JPAA 3RAKA 4O83A 3DGKA 3D14A 4QTDA 1OBGA 3LCOA 4DT9A 4RT7A 1YHWA 5LXMA 1PXLA 3QZHA 2ZDTA 4M3QA 3QKMA 5DWRA 3A99A 3D4QA 3PY3A 4DH1A 5K5NA 3ZHPC 4FT9A 3QYZA 4AGUA 1G8SA 3KXZA 3V5QA 5FBOA 5EKOA 3SD0A 4GT5A 3MPAA 4LQMA 5AR8A 4ZTMA 3RPOA 4NIFB 5M44A 3HRCA 2QO9A 4AZVA 3R6XA 3U4UA 4IX6A 4FTLA 4MD8E 4R3RA 4U8ZA 4D1SA 4GV1A 5AADA 4NTTA 2QCSA 4IAIA 5AMNA 2YIWA 4LRKA 4G5PA 4EHGA 1YOLA 3ROYA 4EL9A 3F66A 1NY3A 4WD5A 4FEUA 4JG8A 3VVHA 2IO6A 2AYPA 3H9RA 2JBOA 3PLSA 3FLNC 5DEYA 4JQ8A 3NUSA 4I0SA 5E8VA 2YISA 5FDPA 2IVUA 2EXMA 4QMQA 2C6DA 1WBNA 2YLFA 5IMXA 1V0PA 4WG4A 3SXRA 3ZM9A 2PUNA 4YHTA 3KCKA 1DI8A 5CAOA 2VTPA 4FZFB 2HWPA 2J6MA 3VUIA 3MIYA 3R7EA 3QQGA 3V3VA 4GUEA 2Z8CA 4MYGA 3DOGA 3U8WA 5BVNA 2NRUA 3NVMB 4U80A 2YIYA 3SRVA 3LJ2A 4USEA 1OIQA 4G9RA 4JG6A 4WSYA 3PUPA 2W17A 3MYGA 3GU6A 5EHYA 3EFWA 3DKOA 4FBXA 4U42A 1VR2A 1PXMA 2XMYA 3FLQA 3R22A 4FKVA 3QUEA 4FT0A 4N6YA 4S30A 4BN1A 4CFUA 2PVHA 4Y73A 4CEGA 3FYJX 3RALA 1OL7A 4AQCA 5LWMA 1MRYA 2OSCA 4C38A 5LVOA 3NUUA 5E91A 4JBQA 4B0GA 3TNQB 3U51A 1YW2A 3GOKA 4QMZA 2VO3A 4S2ZA 5L2TA 2H6DA 3LMHA 1JBPE 5J95A 2Z7QA 4QQCA 4E4MA 4BI1A 4OAUC 3MVJA 4FR4A 5IZFA 4FG9A 5AX3A 2YERA 5K0XA 3TKHA 2WB8A 5J5SA 4G2FA 4E1ZA 2CKQA 4ANQA 4ZY6A 5ANJA 4ACMA 4HZSA 4HNFA 4BKZA 2P2HA 5GJFA 2WMTA 3MWUA 4LOQA 2ACXA 1CKJA 4NFNA 3LFDA 3DU8A 3KMUA 4OTHA 3S2PA 5HU9A 2WMAA 4D1ZA 2YM4A 1GZ8A 4IM2A 2HAKA 5A3XA 1U5RA 4DLJA 5HU3A 2A1AB 2PYWA 1KSWA 3BGQA 4YNOA 2YAAA 3DXNA 3K3IA 5L8JA 2FA2A 1H01A 3FMKA 3GENA 3MFUA 2XCHA 4JIAA 5AM6A 4G3EA 3HMOA 4KIOA 3RAWA 4YTIA 4X2JA 1YQJA 2R9SA 1JVPP 3CTHA 3HDNA 4IMYA 3EQFA 3V5TA 2P4IA 4X2GA 4IB5A 2WTCA 4WOVA 3VRYA 4XLVA 4R7BA 4D9UA 2WEIA 4I41A 2WELA 3QZFA 4QNAA 4NW5A 2J51A 3RZBA 5EG3A 4GSBA 4QP1A 4MKCA 5IUHA 3KVXA 3F9NA 2R5TA 3Q6WA 2HY81 3P7AA 4IM3A 3TNHA 3QC9A 4P7EA 3UNZA 2ITPA 4BGQA 2WMSA 3G0FA 4PV0A 4AGWA 1HCKA 3F5XA 1V0OA 3MFTA 3EN9A 4JQEA 5KX8A 3SOAA 3UBDA 4I94A 3UIUA 4ZOGA 5IKWA 4IAYA 4WT6A 4BBEA 4Q2AA 4PX6A 2DQ7X 3SKCA 2PWLA 4FKSA 1OKZA 4Z7HA 3MW1A 4DEDA 4F9BA 3NUXA 3PXZA 5AAGA 4HCVA 3FUPA 3U6IA 1JLUE 4H3QA 4L3PA 1KE7A 4QTBA 2XKCA 4GFOA 3QX4A 3EQGA 4DEAA 4BI0A 4DEGA 1Z5MA 3RCDA 3LQ3A 2F7EE 4ZZOA 5FM2A 3GP0A 1QMZA 4K33A 3R8PA 2OBJA 3ITZA 3CE3A 3BI6A 4HGSA 3ZLYA 4AWIA 4LRJA 4C3RA 4DTBA 3VS1A 2E9OA 2QOFA 1ZWSA 3EN5A 4Y72A 4BGHA 4XMOA 4YZMA 3LCDA 4H39A 3VBWA 3WZDA 5CEKA 3U54A 5CXHA 4ALUA 4TYHA 4DBXA 4O0UA 4O6LA 3NR9A 4U7ZA 2WTDA 2ITZA 3PPZA 5DT0A 5CXZA 2E2BA 3MH1A 3AMAA 3QCXA 5EFQA 4F7JA 5DR9A 1XR1A 4GK4A 5DT3A 1PXKA 3KN5A 4NUSA 3NNWA 4WG5A 5E8ZA 3OUKA 3FE3A 4O21A 4EH9A 2QONA 3VJNA 3DLZA 3NCZA 3OMVA 3UVPA 3QXOA 3PVBA 3H3CA 2G2IA 3COIA 1OUYA 4GT3A 3ZFMA 4R5YA 1XH4A 3UNKA 3EIDA 3W10A 3BGZA 2WMQA 3P86A 4FG8A 4MH7A 3TV6A 3Q2JA 1TQIA 1ZMWA 3Q9WA 3VS2A 5HTBA 5T68A 3WF8A 4BTJA 3GUBA 3A60A 4RC3A 1NVSA 4UEUA 4O84A 3DKFA 5DE2A 1Q24A 3RI1A 4QMTA 4RZWA 1BL6A 3W55A 4LI5A 4QP3A 3BHHA 1OVEA 1XBCA 2C30A 3PA3A 3IPHA 1QPCA 4FSYA 2C6IA 4RA4A 3SAYA 5E1EA 3LW0A 3OWPA 4IWPA 4F7LA 4DEIA 3HRFA 3O8PA 3R7VA 2GU8A 3LFAA 5FGKA 4F1OA 3KFAA 4M0ZA 2CHLA 1PW2A 5AEPA 2HCKA 1TQMA 4U41A 4BCFA 5BUIA 2W1DA 4CQGA 1LEZA 3C4WA 4XUFA 3LOKA 3KMMA 5L4QA 3QTZA 4Z3VA 3IW4A 2GNLA 2RFDA 3P7BA 3PFQA 4O0SA 3TUCA 1YWVA 4M67A 4C8BA 2OFVA 3ENMA 3A4OX 3UDBA 2YAKA 3RMFA 3R30A 5FLFA 3Q3BA 1S9IA 2W5AA 4IVCA 5C9CA 4YTCA 3LCTA 4PP7A 5AR7A 5LCJA 4A9RA 3LJ1A 1V1KA 5M08A 1X8BA 3V8TA 1CKPA 2OU7A 5HG7A 5HG8A 5CU4A 3RHKA 4V01A 2QOHA 2VUWA 4DGGA 5CAPA 5M51A 5AR4A 3DA6A 4H05A 3GXLA 5CVHA 1KWPA 1QPDA 2W0JA 3BV3A 3ORLA 4C3FA 4YUQA 3AG9A 3C1XA 4GU6A 2P55A 3QTSA 4ENYA 5HIBA 4Z16A 5AV1A 1WVWA 4IX5A 4TYEA 3DJ7A 1SMHA 4FOCA 3VS3A 3V8WA 5EKNA 4QMVA 1REKA 3KRXA 3LCKA 4YC6A 3UVQA 4P2KA 4YU2A 3LQ5A 4J1RA 2Y4IC 4QMWA 3F61A 4X3FA 5HVJA 4AU8A 5KBRA 1J7UA 3BYOA 5EW9A 3WARA 4R7IA 2VO7A 1UWHA 3A8WA 3M42A 2R3MA 4KNBA 4UYNA 5AX9A 4YR8A 4E4XA 2G1TA 2XJ1A 4L42A 4I21A 4ACGA 4AGCA 4C4GA 3OROA 3DXPA 1YRPA 4CYIA 4BZOA 4C58A 4HGTA 3K3JA 4GFMA 4QP4A 4RFYA 4D5HA 1OBDA 4X2NA 3O23A 3HECA 3QTXA 4HVDA 4HYIA 5C26A 4R5SA 2W1EA 2WMVA 4I24A 4QMOA 1GAGA 4O7LA 2IVVA 2WQBA 1CM8A 5JFXA 4XP2A 5AIKA 3MH3A 2F2UA 5GJGA 3DKCA 4BZNA 3U6HA 3UP2A 4BKJA 1BUHA 3ZUTA 5IPJA 3F5GA 3MB7A 1E1XA 4KKEA 3HP5A 3VULA 3PP1A 1A06A 4ZTSA 2R7IA 3NUPA 4GK2A 3W18A 4DFZE 2WTKB 4F9CA 4IAZA 5I0BA 4IFCA 3HP2A 5FD2A 4CT1A 2R3NA 5F9EA 2CKEA 3MTFA 4DITA 1PMEA 3RZFA 2WMXA 3C0HA 3S4QA 4AX8A 2C1BA 3R1SA 4G5JA 2ZV9A 4BY9E 3OBJA 4V05A 3MY0A 2X4ZA 2VX0A 2C6KA 4DGNA 4YO6A 3NCGA 3MIAA 4ZJIA 4JDHA 3VW6A 3WIGA 3KEXA 5BUEA 2FSTX 4CVAA 2H9VA 4YJUA 2QLUA 5A4LA 2NO3A 3POZA 3GGFA 3RKBA 4C62A 4CKRA 5M53A 4HNIA 4NCTA 4F08A 5AFVA 5LJJA 1RJBA 2ITTA 2XNEA 2BMCA 4L9IA 2IW8A 2Z7RA 4DGMA 2XCKA 1OL6A 3GI3A 5BYZA 1R78A 1PXIA 2PE2A 4MD7E 4CTBA 4FVPA 4RPVA 3OC1A 3SXSA 4EWHA 2YEXA 5EM6A 4F9WA 3DV3A 4DTKA 3VS7A 2SRCA 3HMIA 4DFUA 3MJ1A 4DT8A 5D9HA 5HG9A 1W98A 4YJSA 3TEIA 2QQ7A 3DAJA 2H8HA 4GJ3A 2XS0A 4CCBA 2I7QA 3HRBA 1H0WA 3BLHA 4W4WA 3RWPA 4YZBA 4EQMA 2JIUA 3QQFA 2JAMA 2E9NA 3SW4A 4IANA 3UYTA 2O0UA 1YXXA 2ITWA 3R73A 4DCEA 4EHVA 3ALNA 4YURA 4G6NA 4F09A 5L2WA 5HCXA 5JFSA 4C4JA 3TN8A 4FEVA 3GT8A 4EH2A 4MNEA 3EYHA 3WZKA 4ALWA 4EOKA 4CFMA 4TW9A 4UB7A 1JKLA 3KRLA 4APCA 2OF2A 3QD2B 4NEUA 5HLPA 5AV2A 3OEZA 4BDFA 5GZ8A 1GJOA 3FZSA 4B8MA 4CRSA 3ZEPA 4BYIA 3HZTA 2VV9A 3BHUA 4IVBA 2NP8A 2WMBA 3E3PA 1YDTE 4E4NA 3PXRA 5AUWA 3HAMA 1Q8TA 4O1PA 1Y8YA 4E6AA 1WBWA 2JDOA 3QRTA 5CWZA 3EL8A 3COHA 3KRWA 2OZAB 5D11A 4I4FA 4BL1A 5AP2A 4ITIA 3NNXA 3MGYA 3VBVA 3WE8A 2OJ9A 2ZMDA 2W4JA 2XIKA 3Q53A 2CLXA 4GW8A 5LARA 4BTKA 1ZOHA 4FV6A 3AC4A 3UNJA 3L8XA 4MBLA 2JKMA 1W84A 4LL5A 5CF5A 5BX0A 3NLBA 3KU2A 4NSTA 3ACJA 4FKOA 4E6QA 3OT8A 3EQIA 3OWKA 3ORIA 4F64A 4HVSA 4HZRA 4KIKB 5K5XA 4G1WA 4F0IA 3FKLA 4BF2A 4IDVA 5HX8A 4RC2A 2R0IA 3ERKA 2R3PA 4F9YA 2UZOA 2YCSA 2Z7LA 2GTMA 3BLRA 4IX3A 4J97A 3EJ1A 3FC2A 4O38A 5AIRA 4PMPA 1NA7A 1HOWA 3R9OA 3R01A 4OTWA 4FT7A 4MD9E 4NW6A 2BAKA 4JNWA 4FOBA 3T9IA 4O82A 1M2RA 3FSKA 4I5MA 2PVNA 4L43A 2B4SB 4ZSEA 5CAQA 1REJA 5HESA 3CKXA 3LFQA 4KRCA 5D41A 2CGWA 2WKMA 2R3JA 1H00A 3FJQE 5ANKA 4J8NA 3VJOA 3MVHA 5CEPA 4U45A 4UMPA 2B9JA 4HPUE 5FTQA 3A7HA 3RPYA 1FVVA 1UNLA 5TKDA 1IEPA 1FMOE 3TL8A 4YJNA 5JSMA 1PMNA 3W2QA 3D83A 2G01A 5E7RA 5EM5A 4D2WA 2CSNA 2WGJA 4ACCA 5K0KA 1ZZLA 3KKVA 1DAYA 4FTIA 3LJ0A 4IB3A 4M84A 4WBBB 2WQOA 2YDJA 3SQQA 4D2PA 1PY5A 3SOCA 2VO6A 3PG1A 4KSPA 4RJ3A 2V5QA 4E8AA 3U87A 1W82A 4L6QA 5EM8A 3LCSA 5FEQA 1XO2B 4UMRA 4R3CA 4AZEA 3W2SA 2PE0A 4FICA 5JEBA 4Z9LA 2XBJA 4XOZA 2CLQA 2BZIB 2XF0A 5HNGA 3LFFA 4G3FA 4JIKA 3H0ZA 3ZUUA 4O7RA 4IZYA 1U54B 5ANOA 3O50A 3V04A 2BPMA 4X2FA 2QVSE 3VUTA 3EN7A 3LM5A 3HMNA 4QMXA 1ZMUA 4TWCA 3S00A 2BRNA 3KVWA 3FKOA 3FLZA 3Q4TA 4D1XA 2C6LA 3BV2A 2QHNA 2GNJA 3MDYA 4R1YA 3TZ9A 4CG9A 3JYAA 2PL0A 2XK8A 1L3RE 3DZQA 4HGEA 4X3FC 5K9IA 3I5ZA 4FODA 2C68A 4S33A 5HE2A 3OCBA 5HTCA 3BRBA 3GNIB 4ZTLA 5K4JA 2RFEA 2OXXA 3UE4A 1B6CB 4IHPA 1XQZA 1M2PA 3Q96A 4FNYA 4ALVA 4ZAUA 4AP7A 5BNJA 5ANDA 5AUZA 3CTJA 3WF7A 1H26A 4XP0A 4KRDA 2UW7A 4U79A 5F94A 4KIQA 3WF5A 4NL0A 2Y7JA 3EKKA 2CKPA 4IEBA 4XP3A 3C5UA 4QMNA 3FC1X 4X0MA 3GCPA 3D94A 5AV4A 5CENA 4ASXA 3TV4A 4BIBA 5CLPA 5E92A 2UZUE 4ZSGA 2C5YA 5JGBA 2C3JA 3FL4A 4YP8A 5H9BA 3E7VA 3VWAA 3I0QA 4EOJA 5HORA 3ZLSA 4IDTA 4OTGA 3ID6C 3AQVA 5HE3A 4FEXA 4FYNA 1MQ4A 4GCJA 3QYWA 4CXAA 4PTGA 4LMNA 2BHHA 3NVKI 4L00A 1FINA 5BVKA 3RCJA 2HYYA 3PP0A 2A27A 4D4VA 2ITYA 3C5IA 5AP1A 4XG4A 1SVEA 3IW5A 3CPBA 4ZMEA 2IVTA 3DNEA 3QC4A 5AUXA 3Q32A 2XK9A 3DS6A 3GFEA 3CD3A 2QR8A 4L67A 1YOJA 2JDSA 4FSRA 4LUDA 4E73A 2FGIA 3EOCA 1F3MC 5J1VA 4OTRA 5LQFA 2P33A 3MJ2A 4N6ZA 3UJGA 4FT3A 3V5PA 4HVHA 3GBZA 2RFNA 3ZU7A 4RVLA 3AT3A 4FMQA 4TL0A 4NCTC 2V22A 4HPTE 1GZNA 3DTCA 4L3LA 4EUUA 1K9AA 4PDPA 5D7VA 4ASZA 2XNNA 2RFSA 5DR2A 4F0GA 5FRIA 1ZRZA 2HWOA 3G0EA 4QP9A 4L01A 3B2WA 4EYJA 2BRGA 1NVRA 5EM7A 4AUAA 1OUKA 4O1OA 3ZSIA 2EXCX 4LFIA 4E4LA 4H1JA 3QKKA 4F7NA 3A7GA 3E8NA 4UXLA 3JS2A 5HTIA 5I3RA 2BTRA 3OF0A 5KMNA 3LFEA 4CYJA 2XRUA 4UWBA 5HLNA 4FKJA 4DH8A 4BDKA 2RL5A 4NT4A 3G6GA 5I5ZA 1JOWB 5HE1A 2VGPA 3CLYA 5LMAA 4HOKA 4E5BA 4FEWA 4ZY5A 1O6YA 2QU6A 3NIEA 3ZBXA 2XB7A 2QO7A 1WBPA 5CASA 1J91A 3AC2A 4F1MA 3MB6A 4IE9A 4FF8A 4EOIA 2O63A 5AR3A 5HIEA 5AV0A 3TZMA 5CF8A 2HXLA 5C4KA 5LWNA 4E6CA 3VS0A 5M4UA 3LIJA 2GHLA 2CDZA 2UZTA 1YOMA 2PSQA 3UZRA 3OHTA 2C6OA 2DS1A 3DQWA 1R39A 1XBAA 2QC6A 3HL7A 3ORPA 4JDKA 4ASEA 3FI2A 3UYSA 3LLTA 1M52A 2FH9A 1GZKA 2BDWA 2IJMA 2YIXA 4DH3A 5KKRB 4NM5A 2WTVA 1Q8UA 3MPMA 4K77A 5HO7A 4ENXA 5KE0A 4NFMA 3GB2A 5CF4A 4GL9A 2JIIA 3U4WA 4QYFA 4EOMA 4MK0A 3WF6A 3BKBA 3MN3A 4BI2A 2IVSA 5CTPA 3E93A 2OJJA 1P4OA 4PY1A 4UYAA 3QD0A 3CTQA 3V6SA 4CTCA 3R8LA 3FY0A 4TTHB 3VBTA 3I5NA 1RE8A 5BVFA 3VUGA 4ANOA 2VWUA 3BBTB 3PJCA 5EYDA 3QZIA 3IGOA 3THBA 3N9XA 3LXLA 3V01A 3ZSHA 2B9IA 2UZDA 3FL5A 5EYMA 2R0UA 2KULA 3KK8A 3ROCA 4EC8A 3ZDUA 4Q9ZA 2VTAA 2QOOA 1F5QA 4IVDA 3VF8A 4BDJA 2WO6A 3LXKA 4H58A 4AOTA 3K5UA 5IEVA 4EH6A 4OUCA 1JKSA 3W8QA 1Q8YA 4ZS4A 4RIYA 1FOTA 2YFXA 3R00A 4IWOA 4RSSA 5L2SA 3FI8A 2FYSA 4R3PA 4M69A 3LM0A 5G6VA 2BRMA 2PZYA 3UGCA 2EVAA 4KS8A 1H0VA 3ANQA 4BZDA 1PXJA 5E8XA 4CZYB 3QU0A 4NM7A 4PMSA 3FI4A 3BCEA 1W0XC 4JG7A 4PWNA 5KZIA 3RGFA 2ITXA 3EWHA 1BI7A 4YZCA 4EKKA 5AUTA 3ZFXA 3PYYA 3GU8A 2I6LA 2UW3A 4FKGA 4XG9A 3H0YA 4OTIA 3ORTA 5IDPA 2B9HA 2OJGA 4GG5A 3FZTA 3KCFA 4JR3A 4ANBA 1OKWA 3QWKA 4EH4A 4DEHA 4FL2A 2OJIA 2W9FB 3U9NA 3KREA 5EQEA 5DPVA 4EONA 4UZHA 2PZ5A 4BCKA 2EXEA 4CCUA 3C7QA 2WTJA 3AOXA 3OUNB 2EB3A 3D2KA 3R7OA 3HV4A 5EOBA 1Y6BA 4ASDA 2ZMCA 2Q83A 4BDAA 5FXRA 3IGGA 5J9ZA 5BVOA 2VTSA 4I6HA 2YN8A 4UZDA 4RC4A 2PVFA 4ERWA 2PZPA 4U81A 3UTOA 4IWDA 4C59A 3EQPA 3A62A 3OCGA 5EYKA 2X81A 4A4XA 4RIXA 2OXYA 5IQEA 4OBPA 3K2LA 4TYJA 1FBNA 4W8DA 4FL3A 4GS6A 4FZ7A 5CI7A 4BDEA 1Q99A 5CT7A 3ZO1A 4EJNA 3LQ8A 1OL1A 3D5VA 4FK6A 4BDIA 3EQCA 5DNRA 1O6KA 3DTWA 5KMKA 3I7CA 3SLSA 4DFNA 5JK3A 4GMYA 4CFNA 1E1VA 5IQCA 3D7TA 2C47A 4F6SA 2YABA 5BUJA 2HXQA 3ALOA 2X8EA 4DFLA 2GNGA 5BPYA 2BZJA 3OY3A 1J1CA 4FSNA 1WVYA 2QODA 5CU6A 5KCVA 4IZAA 4II5A 1ZYLA 2NRYA 3VBQA 5L6PA 2B52A 3DJ6A 3AT2A 1WMKA 3BYUA 4NM0A 2CGUA 5AP5A 1GIHA 2E9VA 2GS6A 5B2LA 2PPQA 4E5WA 2YCRA 3BHTA 4L7SA 1SNUA 4N0SA 4V0GA 3GU7A 5HLWA 3P4KA 4JOAA 5HI2A 4EK8A 3KXMA 4G6OA 3EFJA 2QOQA 3OCTA 2BFYA 4FT5A 2XKFA 3NYXA 4JVGA 1ZXEA 4DH7A 2ETRA 1Y57A 3IDPA 4FIIA 4IH8A 3I4BA 2CCIA 3PWDA 3RPRA 3VUHA 3QXPA 4QP2A 4BBMA 4A9UA 4RIWA 3OTUA 3C0GA 3CGFA 4YPSA 3AD5A 3SRVB 3R7YA 1R3CA 2YJRA 2XKEA 3ZS5A 5ACBC 5HKMA 2BAQA 4C02A 5DBXA 2VWVA 4L68A 5M07A 3LFCA 1Z57A 4BDHA 3MA3A 1GY3A 2JEDA 4GEOA 3PLAE 5GNKA 4GJ2A 3UMWA 3T3UA 2RKUA 4GVAA 1DAWA 3V6RA 3AT4A 3IW6A 5AP0A 4I20A 3TTJA 3F7ZA 2HOGA 1M7QA 4I6QA 4S32A 1KOAA 3SVVA 1GNGA 3T8OA 3A2CA 4ZJJA 4CZUA 1I44A 2DYLA 4ZMFA 3HV5A 4A9TA 4BRXA 3R2BA 1L8TA 1LR4A 5AP3A 5EH0A 1AGWA 5D10A 4EEVA 2XRWA 5FQDC 3CBLA 2WMUA 4XV2A 5HOAA 4O0WA 1UA2A 4O7ZA 2UZLA 3EYGA 3QQUA 3PY1A 4I93A 5BVEA 4C34A 4A4LA 4QYHA 4DBNA 3I6WA 1BI8A 2IG7A 2B9FA 3QZGA 4PUZA 3O0GA 4JLCA 3ATSA 4BR3A 3GCQA 3L8SA 5CNOA 5M4FA 3HMMA 3BWJA 5L6OA 3D7ZA 3OBGA 4PQNA 3NIZA 5CEMA 2CNUA 3NMUF 4QYEA 5I9ZA 3NPCA 5CU2A 3BQCA 4A06A 4FSWA 1WAKA 2WMRA 3KXGA 1CSNA 3H4JA 4B6LA 3QRJA 5HD7A 2F9GA 1U4DA 5G1XA 4QYYA 4WNPA 3MBLA 4AZWA 4JS8A 2EB2A 1J1BA 3EN6A 2QURA 2PTKA 4RX9A 3VUMA 4BBFA 1IAHA 1JSUA 4JBOA 3ZBFA 3C4EA 3F5PA 3V51A 5HO6A 1O6LA 2YM3A 2KTYA 4JJRA 2VWZA 4AA0A 4D55A 3PTGA 1G5SA 4TT7A 3VS4A 3R21A 2X7GA 3ZEWA 4FC0A 2XIRA 5KMJA 2WU6A 4DG0E 4F9AA 5H2UA 4J53A 5AA8A 3RM6A 2W1CA 3ETAA 5KMLA 2C0IA 3TT0A 1VJYA 4DG3E 5ETFA 2QLQA 3AMBA 1F0QA 4RFMA 4TY1A 3BX5A 4G3DA 4IJ9A 4JRNA 3TKIA 3FQEA 4A9YA 4D4YA 4DFXE 3BYMA 4EORA 4UX9A 3KXHA 3G6HA 4MWIA 4ZEGA 4EBWA 5KMMA 3WE4A 4CSVA 4CV8A 1KE6A 3OG7A 4RLKA 2XIZA 3PJ8A 3WYXA 4F65A 3Q4UA 5DLSA 2HK5A 2QO2A 4I6BA 1OECA 5EDRA 3CC6A 5HO8A 3UO6A 4IB0A 4YBKA 4D9TA 3L1SA 3KRJA 2C6TA 5T3QA 4B99A 3HV6A 3HAVA 4QP8A 4NYEA 3MFSA 2C0OA 3NNUA 5AP6A 2JFMA 4JRVA 4L7FA 1PXPA 1LP4A 2ITQA 3KN6A 2WAJA 3FMJA 2YCQA 5IA2A 2GHGA 3EH9A 3KF4A 4I0RA 3BBWA 2VTTA 3FI3A 3FY2A 4NKSA 3R7IA 3ATTA 5KHWA 3P79A 3ZONA 5BQ0A 5ICPA 3ZRMA 4KSQA 4TYHB 3PWYA 4R7HA 3DKGA 1YXVA 3G9NA 4E93A 5A6OA 2VTHA 1OL2A 3C4FA 4IC7A 3V5LA 4WG3A 3ZZEA 2GS2A 3R1YA 3SGCA 2OKRA 1GOLA 4BTFA 3B8QA 4QTAA 2JGZA 2Q0BA 1Y8GA 4EH5A 4BIEA 3ZO4A 4PPAA 3NRMA 2WHBA 1H1QA 2W96B 1YXSA 4RG0A 3BYVA 3E87A 4O0VA 5EI6A 3FZOA 2A0CX 2CN5A 2F7XE 4QYGA 1UU9A 1XWSA 2BRHA 5HNBA 3F88A 4PDOA 3CR0A 2HZIA 1MP8A 5CAVA 3AC1A 1KV1A 3D0EA 3CD8A 4LOPA 2XIXA 2ETMA 4YGAA 3VHEA 1PJKA 4KAOA 2BUJA 5E8SA 4EK4A 2UV2A 4AXAA 4O7VA 4RWLA 1WBOA 3C0IA 3A7JA 2VTNA 2C5VA 2VTMA 5M06A 3ZTXA 3E8CA 4EOSA 1S9JA 5C8NA 3QD3A 2GCDA 4XV3A 3UOKA 2WIPA 1ZAOA 3UQFA 4FIEA 5E90A 4TYIA 5LVPA 2W1GA 4J98A 2R3OA 4F7SA 3FZRA 3CGOA 4FSUA 3EQHA 4OT5A 4YSJA 4R77A 3SA0A 4MEDA 3KULA 3G33A 4CT2A 3GU5A 4YJTA 4V04A 5AM7A 4UY9A 2QG5A 4ZSJA 3AD4A 3TIZA 5IA3A 4O7SA 3KL8A 1JKKA 4I3ZA 4QT1A 3HEGA 1Q3DA 4G16A 4CFVA 2UZWE 4TPTA 1YDSE 3EB0A 3UOHA 2PVJA 3DDPA 2UW6A 2UZBA 3I81A 5DH3A 4D0XA 1OL5A 1BL7A 3R02A 3UC3A 5AR5A 2X2KA 3Q04A 3NWWA 4M8TA 4XG8A 2FB8A 3BLQA 2R3LA 2X8IA 3QQLA 4YJOA 3SW7A 5F20A 2GDOA 2B54A 3R8ZA 4I0TA 4I1ZA 4QD6A 3HUBA 3LZBA 2BCJA 1HCLA 2CMWA 5DN3A 3ZRLA 4IAFA 4M97A 4RJ8A 3E63A 2C6EA 4L8MA 5D12A 3NZ0A 4MBIA 2I0VA 1Q4LA 3D9VA 2OF4A 4K9YA 4NU1A 4C57A 1J7LA 4RFZA 4W9XA 4MF0A 2EU9A 2DWBA 2PMNX 5HVYA 3GEQA 4GKIA 2CNVA 4FTJA 3FHRA 4FKPA 3KXXA 3MTLA 3FHIA 2LAVA 4LMUA 3P0MA 4L44A 4Y5HA 2UZNA 1IA8A 4FUYA 4AA5A 3UOJA 3TJDA 3IONA 4X21A 3HGKA 5JRQA 3C9WA 4EH3A 3JY9A 2ONLC 3NW6A 5E1SA 2YWPA 1RW8A 4FV5A 3ZLWA 3EFLA 1SVHA 3PPJA 3G9LX 4AOJA 3DK3A 4D2SA 3RTPA 5IMEA 3HKOA 2WQMA 3DAKA 4RQVA 3ZXTA 3DB8A 3LXNA 1YXUA 4YTHA 4FA2A 3OEFX 1NT2A 1Y6AA 3OOMA 4EK3A 3UODA 4MX9A 3LPBA 3CPCA 3TDVA 5CSVA 3PVUA 2HZ4A 4OW8A 2GNHA 2FUMA 4OT6A 2O65A 4XRJA 4JT3A 1ZYSA 2WOUA 4RJ7A 3BE9A 5JGDA 3TG1A 3BELA 2IN6A 4WBOA 4QMUA 2VWYA 4U3ZA 5F95A 4C61A 3NYOA 3B8RA 3A4PA 3COKA 5IQIA 3VN9A 4IZ7A 3CSVA 5IQBA 4BGGA 2CPKE 4LGGA 4FV8A 5AAFA 3QLGA 1H28A 4ONAA 4B8LA 4LM5A 3QX2A 4FSZA 3E5AA 4G3CA 4FZAB 4EK6A 3F2RA 4FZDB 3T9TA 3LMIA 3WZJA 3NYVA 3I7BA 4Z55A 5L2QA 2A4LA 3JR1A 5A4EA 3BHYA 3ZFYA 1TVOA 5C01A 1GIJA 2JLDA 2ZM1A 2H96A 3MS9A 4ITHA 1UNHA 4PNKA 1JSTA 3W2OA 1XH8A 2ZB1A 4O27B 2RIOA 4YLKA 4FGRA 3TKUA 3RAIA 4E3CA 2RF9A 4X2KA 4FTOA 1JQHA 4H1MA 4J99A 4PDSA 4YPDA 1DM2A 1UV5A 2JBPA 2VO0A 3RM7A 3MESA 2BIKB 1DI9A 4K11A 2PVYA 2WXVA 5CSHA 1P4FA 1WZYA 1OPJA 4QO9A 2QHMA 3TACA 4R6VA 3AC8A 4YNEA 1J3HA 3P5KA 4CGAA 3L9MA 4BB4A 3FZPA 4Q9SA 4AA4A 4O7WA 4RWIA 1U59A 3O2MA 3EZVA 3Q5ZA 3NW5A 5GHVA 2YITA 3P9JA 4MWHA 4CLJA 1U5QA 3UVRA 3D2IA 3QF9A 4U43A 1H27A 1W83A 4E7WA 4EHEA 3PZEA 4FKRA 5LCKA 2CNQA 1PXOA 3QA0A 2XNBA 1U54A 3R0TA 5EDPA 2OFUA 3REPA 5HX6A 1TQPA 2OXDA 2GFSA 1U46A 1UKHA 3OT3A 4FX3A 5B2KA 3ZO3A 3F3WA 2W06A 3PG3A 4U9AA 1LEWA 1OKVA 5L6WL 3LLAA 3DPKA 2VX1A 4MNEB 1SZMA 1OKYA 1Q97A 4NWMA 4W9WA 4A9SA 3MVMA 2Y9QA 2DUVA 3E88A 2F49A 2J5EA 3BIZA 5I3OA 3VS5A 4EOQA 3FV8A 4D58A 3ZH8A 1PYXA 3RP9A 2X1NA 2BVAA 4O6EA 4YJRA 2VWWA 3IO7A 3PRFA 4ZTNA 4ZZMA 3LMGA 2R3RA 4RLLA 4BIDA 3ORMA 4I92A 2JDTA 3ZUVA 3FMHA 2WMWA 2ZV8A 3H9FA 4GIIA 5M55A 2X6EA 3NEWA 5CSWA 1NW1A 3VO3A 4W8EA 3W1FA 3FXXA 4XRLA 2B7AA 2QOKA 2QOIA 2UVYA 2R64A 4FEQA 4FTCA 4RX5A 2YIQA 3D15A 3VBXA 5C1QB 5JMSA 2YJSA 4U3YA 5KBQA 1GIIA 3A8XA 2JAVA 3QTRA 2C4GA 3E8EA 4QTCA 3ULIA 4ANLA 5BYLA 2JFLA 2C3LA 1YHSA 2WU7A 4R1VA 1ZYJA 3QALE 3O51A 1ND4A 3QQHA 1JWHA 3FSFA 4FK3A 4H3PA 5IQDA 2ESMA 2X7OA 3BE2A 3PE1A 3P1AA 4YHJA 2XP2A 4HGLA 5AA9A 5I4NA 3UQGA 3QQJA 5JN2A 4OBQA 4HYUA 1I09A 3Q9XA 2XH5A 4YZNA 4KABA 2CKOA 2WTKC 1PKGA 2W5BA 4F1TA 1H4LA 5FTOA 1QL6A 4X7QA 2BDFA 4FTTA 4YJPA 4K2RA 4O2ZA 3QFVA 2XNGA 5HIDA 1FPUA 1PKDA 3B2TA 4IBMA 5DA3A 2X4FA 4PL4A 2PK9A 2XEZA 4PL3A 3FWQA 4BWPA 4FI1A 4WUAA 3ACKA 4LG4A 2V7OA 3NSZA 2ZAZA 5FP5A 3E7OA 2O2UA 5FEDA 4NKAA 5IA4A 4ZP5A 2FO0A 3KB7A 2J0KA 3RJCA 3F69A 5C8KA 4G6LA 1ZZ2A 5CY3A 4E5AX 3CXWA 4IX4A 4BCGA 4UBAA 3QCQA 4XBUA 3EMGA 4FZ6A 4TWOA 4BWKA 3BYSA 3O7LB 1UVRA 5GZAA 4QPAA 2OLCA 2YLEA 3W8LA 4ID7A 4MBJA 2R3HA 2CN8A 4KA3A 2BHEA 4XNEA 5HE0A 3FBVA 1OPLA 3DB6A 2XJ0A 4OLIA 3PA4A 4D2VA 5A9UA 5EW3A 4ARKA 4WHZA 1FQ1B 4FKUA 4QPMA 2BKKA 4S34A 2AC5A 4ZSAA 3GC7A 2RGPA 5JFVA 5IQHA 4RWJA 4ANNA 5IEYA 5KMIA 4H3BA 5EDQA 3QRUA 2I0HA 4M12A 1PMUA 4EI4A 3PJ2A 4DC2A 4O81A 5EOLA 4EK5A 1P2AA 5M57A 3SXFA 4P5QA 3QTWA 5DYJA 4AW5A 4P90A 3PXKA 4U0IA 4MQ1A 3QCYA 2JKOA 3Q4ZA 4IWQA 2XIYA 4QP7A 1AQ1A 5A46A 1XKKA 2YA9A 3JUHA 3ORZA 4XS2A 2PY3A 3JPVA 3ZC5A 3UZTA 4PMTA 2PUPA 5AAEA 3HV7A 4I23A 2VAGA 4FL1A 3PXYA 4RQKA 4EUTA 2GNIA 1Q61A 4WSQA 4AN9A 5AUUA 2FVDA 3U55A 3UG2A 4EZ7A 4CRLA 1MRVA 4QMLA 2C5OA 3LFBA 4L3JA 4C7TA 4EZ5A 1A48A 1ZOEA 4GVJA 5ITAA 4O91A 5B7VA 2QG7A 4DTAA 4FKIA 3QTIA 4AN2A 3KRRA 4FVRA 1NVQA 1KOBA 3QRKA 4FSQA 3DXQA 3GU4A 4U5JA 1OGUA 3F3UA 3OTVA 4IJPA 3OP5A 4KINA 4P5ZA 3MFRA 4QQ5A 4YLJA 4W4VA 4AAAA 3M1SA 3DY7A 2YIRA 3UPZA 4DA5A 3EQDA 5IA0A 4CNHA 4AACA 2GTNA 2XK4A 1UU3A 2GQSA 4Y95A 1FGIA 2VTLA 3ODZX 4IB1A 4ZLOA 1URWA 4O96A 4TRLA 4CMTA 1ZOGA 3O7LD 2W4KA 4WKQA 4JDJA 5EHOA 4NIFA 3ZMMA 4BFMA 4EOLA 1WBSA 5A4TA 2C69A 5CANA 2ZOQA 3SV0A 4EWQA 3QUPA 5LOHA 4YO4A 5FXSA 3FLYA 5J9YA 1Q62A 1Q8WA 3TUBA 3V5JA 5D7AA 4MXCA 3TCPA 1YVJA 4ITJA 4AFJA 4DG2E 2ERZE 3EQBA 3QBNA 4QQJA 3RK7A 4IAAA 3PVGA 2FSMX 3QLFA 4YHFA 3ZO2A 4HVIA 4PMMA 3RHXA 5IQGA 4MTAA 3JVRA 4CKIA 4DGLC 3HNGA 3FKNA 5FDXA 3A61A 4LGHA 4C35A 2XYUA 2OICA 3DBEA 3FMEA 3KK9A 3KY2A 5A14A 4CV9A 5DR6A 3I60A 2ITVA 2YDKA 1H24A 3HX4A 3UIMA 4QPSA 3ORKA 2C5NA 3CIKA 2QKWB 1H08A 2XA4A 3BWFA 5J1WA 2JC6A 1XHAA 5IUGA 3KXNA 2GFCA 5LMKA 3I79A 2ITUA 2ERKA 2G2HA 4RMZA 2BALA 4AFEA 3R2YA 5HICA 3R8MA 4XG2A 4QQTA 5ANGA 3BQRA 4EHZA 5CF6A 5IG1A 4XOYA 4PNIA 4WRGA 4UMQA 3BZ3A 3SX9A 2PUIA 3UG1A 5FP6A 3RBWA 2W9ZB 4I6FA 5HG5A 2GQGA 2JD5A 3D5UA 2VNYA 3CJFA 4H36A 3M2WA 4WIHA 3FXZA 5EHLA 4ZIMA 3R9NA 3ZOSA 1ZYDA 1OZ1A 4QMPA 4CMUA 1PXNA 4OTDA 4JBPA 4AE6A 4TZRA 4O0XA 5E9EA 3QKLA 3W2RA 3A7IA 4KKHA 4QNYA 5HEZA 4WNMA 4BCQA 5IU2A 3R9RA 3PJ1A 4FKQA 3UIBA 1YI6A 5KUPA 3R83A 4YC3A 4AN3A 1NXKA 4A7CA 3R04A 3TNIA 5LMBA 1IAJA 1Z9XA 2H34A 4FV2A 3QTUA 3LAUA 4TXCA 4YSMA 3PSDA 5IDNA 2J90A 4RJ5A 2ZV7A 2YM7A 5J8IA 4KBAA 3IG7A 5FTGA 4G31A 2WQNA 3PDTA 3GC8A 3CY2A 4K1BA 5J79A 2AC3A 2IW6A 4HCUA 4C4EA 3QD4A 4IACA 2W4OA 3BU6A 2QI8A 2OIBA 4WNOA 5FBNC 1H1WA 1H8FA 4MCVA 4WUNA 5IA5A 4O7TA 2GPHA 5IQAA 4EH7A 4YJVA 2OO8X 2R4BA 5CEQA 3ORNA 4C37A 2BZKB 5F1ZA 2GNFA 3FPQA 4Z7GA 5JGAA 5KO1A 4EH8A 4O7NA 5IH4A 4LYNA 4LGDA 4A4OA 4QMMA 3LFNA 5DVRA 5CSXA 2G9XA 4J71A 2XNMA 3CP9A 3IOKA 1IRKA 2W05A 4FNWA 4HVGA 1PYEA 2F4JA 3GC0A 3Q5IA 4FVQA 3UO4A 4CFWA 5ETIA 2Y8OA 1KE5A 4O0RA 1YDRE 3MH2A 4XX9A 5CALA 1JSVA 2XNPA 3C4CA 3CQEA 4BKYA 5DIAA 1UWJA 5EQYA 3PE2A 2X39A 1STCE 1WBTA 3QGWA 4RIYB 1YI3A 3R9DA 3FEGA 2VRXA 5H8GA 3MV5A 4B4LA 4M69B 3OZ6A 4QTEA 4D4SA 1Q8ZA 5HCZA 3PPKA 4XBRA 3VQUA 3COMA 4DAWA 2VWBA 3NUAA 1T46A 3IKAA 2VTJA 2J0LA 2QKRA 4Q5HA 4E26A 3BEGA 1IASA 3CQWA 2WQEA 4LL0A 2I40A 1PRYA 4FGBA 4NJDA 4I5HA 1SYKA 2HW6A 2Y6OA 3QCSA 4FV1A 2Y4IB 4HCTA 4XYFA 1UNGA 2B53A 3QA8A 2XM9A 2V0DA 5HHWA 4FKTA 3H9OA 4LUEA 4OTPA 1P14A 3ZXZA 4DFYA 2PE1A 2W1ZA 5FWKK 4ZJVA 3IQ7A 3OW4A 1BYGA 5IH5A 3N4VA 4XV9A 2ONLA 5KMOA 4WA9A 2GSFA 1YHVA 3NGAA 4EZ3A 4XG6A 4QRCA 3AC3A 4RA5A 2C5XA 2HY0A 5BMSA 3N51A 2BKZA 2IWIA 4O22A 1IG1A 3IS5A 5DHJA 3Q4CA 3LE6A 4FIJA 2QOLA 3FYKX 4RIXB 5FUTA 3L8PA 2JDRA 4UV0A 3W2CA 3E62A 2JDVA 3E64A 2ETKA 3MVLA 2YCFA 4F4PA 4TNBA 5JQ5A 3PSBA 4FNZA 3G51A 2X2LA 4LV8A 4HJOA 3TUDA 1OM1A 2P0CA 4D28A 2OG8A 3II5A 4HYHA 3D7TB 3RNIA 4O0YA 4JI9A 3OY1A 4JXFA 4UN0C 1XH7A 1RQQA 3KGAA 4QMYA 5KKRC 4AZSA 3W32A 2UW8A 2I0EA 4UWYA 4GRBA 4C33A 2ZB0A 2I1MA 3UC4A 1TKIA 2XK6A 2IZUA 4FV3A 1M7NA 4A07A 2BZHB 2WPAA 3CY3A 1ZARA 3GCSA 4USFA 5AJQA 5HQ0A 1ZYCA 4AG8A 2QOCA 5D1JA 3FMLA 2ITOA 4FTRA 1APME 2VGOA 5ACKA 3L9PA 4AF3A 2OJFE 2R3GA 2XK7A 1Y91A 2CJMA 3P7CA 4V0GB 3WIKA 4CMOA 4JAJA 5JQ8A 3CS9A 2E9UA 2J5FA 4IM0A 2X8DA 3ZSGA 4R78A 3AXWA 1OPKA 2W5HA 3BGPA 1QCFA 4UXQA 4DYMA 3SG9A 2Q0NA 2R3FA 4BICA 2WZJA 3HA8A 3OXTA 3R1QA 4RIWB 4AW0A 4B9DA 3R8VA 4BCHA 5EYCA 2BAJA 2VN9A 4MXAA 5DEWA 3FMNA 3NW7A 4IZ5A 3FMDA 4PP9A 4IIRA 4F0FA 3DT1A 5LVMA 3F3TA 2VWXA 3VAPA 2BIYA 2VU3A 3MA6A 2OIDA 5ANIA 3WOWA 2OH4A 4D5KA 3R7UA 2Y6MA 3W2PA 2CGVA 3MI9A 4ANSA 4YC8A 1ATPE 2YHVA 4TYGA 3WI6A 4FIGA 2ZVAA 3HDMA 4AT3A 2P2IA 3HA6A 4MXOA 5TR6A 2VD5A 4BCMA 1CMKE 5EW8A 4RVTA 2X2MA 4BVUA 2OI4X 4MF1A 3ENHA 5CZIA 3UZPA 3CEKA 5CI6A 1MQBA 4UWCA 5HBHA 1QPEA 4TWPA 4TWNA 3FQSA 4F99A 5TE0A 2Z2WA 2BTSA 2UVXA 5AR2A 4DE4A 1OB3A 2PULA 3QHRA 4JQ7A 5LMKC 3VQHA 3TM0A 3HMPA 3DBCA 4CQEA 5J7BA 4S31A 5ETCA 1SNXA 3UP7A 3NX8A 3F2NA 3P08A 2QOBA 1O9UA 2PUUA 4I5CA 4MQ2A 4D0WA 5JT2A 2BROA 2GMXA 3ZM4A 1BLXA 3VUDA 4YZDA 2OK1A 3Q9YA 3S3IA 4AW2A 4ZK5A 5CEIA 1LPUA 5CNNA 5H3QA 2YDIA 4Q5EA 3NAYA 4OBOA 3UOLA 5DI1A 1JKTA 4HW7A 5AV3A 2PMOX 3DFCB 2ITNA 3FMMA 4OAVB 2J50A 3AGMA 3VW8A 4AT5A 3DZOA 2NNWB 3LKMA 5A4CA 2HZNA 1B38A 3QGYA 3FLWA 4F6UA 4PF4A 3JXWA 4FTKA 5BYYA 5HZNA 5I9YA 1OIUA 3FDNA 2X6DA 3TWJA 3QUDA 3O8TA 4DEEA 2ZM4A 1M17A 4J8MA 1G8AA 4NTSA 4BHZA 2YM8A 5F4NA 1CKIA 2V62A 4DEBA 3EHAA 2Z02A 3NUNA 5E8YA 2C3KA 2PZIA 2EWAA 3DBFA 2XVDA 2VTRA 1ZMVA 2R7BA 4FTAA 4XEYA 1OMWA 2PMIA 2Y0AA 3AD6A 1AD5A 1UKIA 2J7TA 2XZSA 5BMMA 3EN4A 5J5TA 4IVAA 5IQFA 5CX9A 2W7XA 3I6UA 3ZZWA 3C51A 4RJ4A 4ACDA 3SC1A 2Z60A 1VYWA 4BTMA 3ZCLA 5JZNA 1P5EA 1ZY5A 4M66A 3ZLXA 2ZDUA 5B2MA 4G17A 4O7YA 3R8UA 2J0IA 2XM8A 3BEAA 2VTIA 1H1SA 5L2IA 5L3AA 1K2PA 3NNVA 3VS6A 4BYJA 5FM3A 5C03A 2WTIA 4IADA 5HD4A 5KHXA 2F2CB 3UMXA 4C4HA 4G9CA 3O17A 1H1RA 2G2FA 2G15A 2JITA 4FSMA 2JIVA 3SDJA 4BHNA 4EKLA 4D2RA 1PMVA 4J52A 4ZLYA 2RSVA 2A2AA 3CQUA 1URCA 2REIA 3FXWA 2Y4PA 1FVRA 1YI4A 4O86A 3NUYA 2V55A 3GQIA 3UPXA 1PF8A 3QQKA 4CLIA 4L53A 2PVLA 3PIXA 3RAHA 3QRIA 2XYNA 1W7HA 3WF9A 4EOPA 4DF3A 4N70A 3P78A 1SVGA 4BC6A 3FZ1A 1BMKA 1T45A 3NYNA 2P3GX 4JDIA 4KS7A 5H8BA 3C50A 4Y8DA 5GJDA 1OI9A 2B55A 2W1FA 4JR7A 4TKSA 5DGZA 4AS0A 3A7FA 3D5WA 4FTMA 3PRIA 2X9EA 1H07A 3DK7A 3UQCA 3HV3A 4GG7A 3DNDA 5E8UA 2IZTA 3DK6A 4PDYA 3VBYA 2UW9A 4KKGA 2A19B 4D2TA 5TF9A 4YBJA 3C13A 1QPJA 2PHKA 5CS6A 5BVDA 3EFKA 1YWRA 2R2PA 4LOOA 1E9HA 3OXIA 4MVFA 5FG8A 4KUJA 4F6WA 4M7IA 3PSCA 2UW0A 4X3FB 5EI2A 2WD1A 3EZRA 4G3GA 4EYMA 5IF1A 5GINE 1WCCA 4GFGA 4QOXA 3VF9A 4C2VA 2I0YA 3QAME 2J9MA 5GZ9A 1VZOA 2OZAA 3TDWA 3FLSA 4DN5A 4EQUA 1IA9A 2WFYA 3GVUA 3P23A 4F70A 4FV0A 4FIFA 4FTNA 1CTPE 3KMWA 3VUKA 4O0TA 5M09A 4AT4A 2PVKA 4FV9A 4U97A 1XJDA 2PZRA 4W4YA 4ACHA 4YMJA 2GS7A 3VHKA 5L8LA 1K3AA 3ZDIA 5CVGA 4ERKA 3TXOA 3KULB 4KIKA 4UMUA 3PXFA 5BVWA 4GU9A 4MXYA 2C6MA 3N4UA 4GT4A 4I22A 3RINA 4NM3A 3RPSA 3WYYA 3PIZA 2QU5A 3R71A 4RX8A 2XEYA 1VEBA 3H30A 3TZ8A 3R9HA 4USDA 4TN6A 1YKRA 5EQPA 1YWNA 5CU0A 2OW3A 3TJCA 2OIQA 5ANEA 2CCHA 4PPBA 4RZVA 5AP7A 1XH9A 5LVNA 4PL5A 4RX7A 4MXXA 4XCUA 4FTQA 3C4XA 1IR3A 3ELJA 4JX3A 2PMLX 3NAXA 3WZUA 3TNPC 4WRSA 4C4IA 4KB8A 2ZM3A 2IW9A 3F3VA 2WIHA 1Q41A 3QL8A 4RIOA 2IPXA 1RDQE 3HLLA 1BX6A 2AUHA 5CYIA 5FEEA 4ZSLA 2C0TA 3GC9A 2J4ZA 4AZTA 5KZ0A 5A54A 4ZTRA 3MPTA 3S0OA 4OR5A 2YM5A 4K18A 3DLSA 2JKQA 5DT4A 4JL9A 3NS9A 5T6KA 4NH1A 5LVLA 1J7IA 4AZFA 1LUFA 3WZEA 3KA0A 3VRZA 3C4ZA 4FIHA 4D4RA 2WEVA 3NDMA 4GIHA 3L8VA 4AE9A 3FAAA 5C8MA 4DHFA 4RVKA 4YTFA 3TNWA 5C4LA 4BCJA 4ZLZA 3AMYA 3IOPA 4DCAA 3F7WA 5HVKA 1MRUA 4KBKA 5K3YA 5M4IA 4UMTA 3ZC6A 4APPA 1WBVA 2OWBA 3S1HA 2YM6A 5CAUA 5JZJA 3G5DA 4X6RA 5IA1A 5DMZA 1KE8A 3LFSA 4DFBA 4CFXA 3ULZA 1B39A 5DRBA 4M0YA 3LHJA 1JAMA 3JVSA 2FSOX 4Y83A 2YZLA 3IDCA 2UVZA 4AOIA 4QP6A 3S95A 2J2IB 4PTEA 3LXPA 4NJ3A 4UALA 3AC5A 4XHKB 1FVTA 1XH6A 3T3VA 3N4TA 1R0PA 3Q60A 3RK9A 4EQCA 2VWIA 3VNTA 4GYGA 4LV5A 3EL7A 5JKGA 4MAOA 4WO5A 5IUIA 1FGKA 1H25A 5IH6A 2VZ6A 3Q6UA 2XK3A 3QTQA 1Q3WA 5E8WA 4ZXTA 3O96A 3WBLA 2O64A 4J96A 3ZYAA 1JNKA 3DDQA 4MHAA 3K5VA 2B1PA 4M15A 4HYSA 2XUUA 3W16A 3QHWA 5A6NA 4J7BA 3RK5A 3DAEA 5I9WA 1MUOA 5J9LA 3K54A 3VC4A 4BWXA 4IW0A 4F63A 3FQHA 4CFFA 3G90X 3RPVA 4MNFA 2RG6A 3UO5A 3HYHA 2WOTA 3PY0A
chains in the Genus database with same CATH superfamily
3EKNA 1M2QA 4XJ0A 3CJGA 2HIWA 5H8EA 1R1WA 5E8TA 4XG7A 2VX3A 3LVPA 4ORKA 3QWJA 5TO8A 2R3KA 3OFMA 3DCVA 4XLIA 3OXZA 4C4FA 4X3JA 2J0MB 2PVRA 3GCVA 3IDBA 1EH4A 3DQXA 1OITA 2QD9A 4FE2A 4K0YA 3G15A 3IW7A 5HBJA 3DBDA 3DFAA 2BRBA 5DFPA 5JH6A 4QMSA 3GCUA 3IK3A 3Q52A 5DRDA 5CQWA 3SHEA 4BDCA 1ERKA 2F7ZE 3Q2MA 4Y46A 4YJQA 4C36A 2GQRA 4P4CA 5J7HA 3E8DA 3BPRA 2XBAA 5C27A 3AGLA 3KQ7A 4XV1A 1YXTA 3TV7A 1XBBA 2Z7SA 3GFWA 1W8CA 4FKLA 2OGVA 4EBVA 4M14A 3CKWA 5A4QA 4CZTA 5HNIX 2UW4A 2WTWA 3ZRKA 4C3PA 2NPQA 4KWPA 3VIDA 3PVWA 3ET7A 3R7GA 4FV7A 4EJ7A 4DLIA 2QR7A 1ZLTA 3OOGA 5ETAA 4BCIA 4FG7A 3U6JA 4JAIA 2BILB 4N57A 2XKDA 4ZZNA 4M68A 2FSLX 3MSSA 5E4HA 2ZJWA 3RVGA 3O71A 3GOPA 4ZTHA 1V0BA 2OZOA 4FTUA 3TIYA 4Y85A 5CZHA 5B0XA 5TT7A 3IECA 5CVFA 4AXFA 3SG8A 3CCNA 5AP4A 3EQRA 4C2WA 5JFWA 2X7FA 4ZTQA 2HW7A 2C1AA 3F82A 1KUTA 2XJ2A 4YZ9A 4OTFA 3PIYA 5DG5A 5HCYA 5IISA 4DH5A 4GH2A 4IAKA 2R3QA 3ANRA 1R0EA 3R63A 4OGRA 3TZ7A 3OWJA 1H1PA 1PHKA 4K6ZA 4ZY4A 3G2FA 3PJ3A 5DOSA 2QNJA 3U9CA 5K4IA 2YACA 3BHVA 2EUFB 4RBLA 2VTQA 3RWQA 1GZOA 3I0OA 4B7TA 3OWLA 4M13A 2ZV2A 4I5PA 4DINA 3R28A 1VYZA 1G3NA 3GQLA 5CT0A 4ANMA 3NFGB 3JY0A 1A9UA 4O2PA 5CSPA 5KNJA 3V8SA 4C0TA 4ZS0A 3Q9ZA 4KBCA 3BLAA 1UU7A 1UU8A 2UZEA 4GYIA 4BDGA 4JBVA 3PXQA 5L8KA 4AW1A 1M14A 5IEXA 4BCNA 1ZY4A 3POOA 5CEOA 4IQ6A 4U40A 2PVMA 2YZAA 2V7AA 5AUYA 2UW5A 3D5XA 1WVXA 3BU5A 3O8UA 3WILA 2WNTA 4NZWB 4YLLA 2GHMA 2PU8A 3IW8A 3OCSA 4FKWA 2AQXA 4R8QA 4EC9A 1FMKA 4L52A 2XNOA 4XG3A 4E6DA 2O3PA 4FUXA 3W33A 3F6XA 3ORXA 3KC3A 4BDDA 2F57A 5EK7A 5GIOE 2X0PA 5M4CA 2HELA 2UZVA 4WNKA 5CU3A 4X6QC 3FPMA 2CGXA 2R3IA 2RG5A 1OIRA 2HZ0A 2VNWA 2VTOA 3E92A 3PZHA 4FV4A 3M11A 3PA5A 5I9VA 2E9PA 2B0QA 2UUEA 1KV2A 1KE9A 2BFXA 4CKJA 4OTQA 5GIPE 2W1IA 3F5UA 4XH6A 3MY1A 5I9UA 4E20A 2ZYBA 3OVVA 3DJ5A 4IFGA 4L45A 2YWVA 4Y5QA 3OS3A 3DBQA 4RGJA 2X0GA 3MH0A 3OW3A 4BCPA 1OIYA 3BU3A 4RWKA 2W99B 1WFCA 4N4SA 2BDJA 3TI1A 4AGDA 4BDBA 4U44A 2J0JA 3L9NA 4FNXA 1SM2A 3KF7A 4PPCA 4PTCA 1CDKA 4U6RA 5HGIA 2LGCA 2O5KA 3UDTA 5JRSA 2O8YA 3H10A 4NK9A 3V5WA 1XH5A 4FYOA 4GK3A 4CG8A 3ODYX 4G34A 3MY5A 4RRVA 2JKKA 3RNYA 3HVCA 4DGOA 5I9XA 4DDIA 4BCOA 4I4EA 4K8AA 4GUBA 4LRMA 3TTIA 5M56A 3F2AA 2OH0E 3HUCA 3F3ZA 3OD6X 1Q5KA 3I1AA 4TNDA 5FXQA 2BR1A 4RVMA 1DS5A 4FSTA 3R1NA 3UIXA 2C3IB 1BKXA 2W1HA 4IC8A 4JX7A 4IXPA 5J87A 4CD0A 4RJ6A 4EOOA 4KD1A 4KIPA 5AWMA 4J95A 3L9LA 4MXZA 2HENA 2IZRA 4W4XA 3E3BX 4PRJA 5EI8A 5AUVA 5CQUA 5HBEA 5TOZA 4GKHA 2X9FA 2IZSA 4L46A 1JPAA 3RAKA 4O83A 3DGKA 3D14A 4QTDA 1OBGA 3LCOA 4DT9A 4RT7A 1YHWA 5LXMA 1PXLA 3QZHA 2ZDTA 4M3QA 3QKMA 5DWRA 3A99A 3D4QA 3PY3A 4DH1A 5K5NA 3ZHPC 4FT9A 3QYZA 4AGUA 1G8SA 3KXZA 3V5QA 5FBOA 5EKOA 3SD0A 4GT5A 3MPAA 4LQMA 5AR8A 4ZTMA 3RPOA 4NIFB 5M44A 3HRCA 2QO9A 4AZVA 3R6XA 3U4UA 4IX6A 4FTLA 4MD8E 4R3RA 4U8ZA 4D1SA 4GV1A 5AADA 4NTTA 2QCSA 4IAIA 5AMNA 2YIWA 4LRKA 4G5PA 4EHGA 1YOLA 3ROYA 4EL9A 3F66A 1NY3A 4WD5A 4FEUA 4JG8A 3VVHA 2IO6A 2AYPA 3H9RA 2JBOA 3PLSA 3FLNC 5DEYA 4JQ8A 3NUSA 4I0SA 5E8VA 2YISA 5FDPA 2IVUA 2EXMA 4QMQA 2C6DA 3KIOC 1WBNA 2YLFA 5IMXA 1V0PA 4WG4A 3SXRA 3ZM9A 2PUNA 4YHTA 3KCKA 1DI8A 5CAOA 2VTPA 4FZFB 2HWPA 2J6MA 3VUIA 3MIYA 3R7EA 3QQGA 3V3VA 4GUEA 2Z8CA 4MYGA 3DOGA 3U8WA 5BVNA 2NRUA 3NVMB 4U80A 2YIYA 3SRVA 3LJ2A 4USEA 1OIQA 4G9RA 4JG6A 4WSYA 3PUPA 2W17A 3MYGA 3GU6A 5EHYA 3EFWA 3DKOA 4FBXA 4U42A 1VR2A 1PXMA 2XMYA 3FLQA 3R22A 4FKVA 3QUEA 4FT0A 4N6YA 4S30A 4BN1A 4CFUA 2PVHA 4Y73A 4CEGA 3FYJX 3RALA 1OL7A 4AQCA 5LWMA 1MRYA 2OSCA 4C38A 5LVOA 3NUUA 5E91A 4JBQA 4B0GA 3TNQB 3U51A 1YW2A 3GOKA 4QMZA 2VO3A 4S2ZA 5L2TA 2H6DA 3LMHA 1JBPE 5J95A 2Z7QA 4QQCA 4E4MA 4BI1A 4OAUC 3MVJA 4FR4A 5IZFA 4FG9A 5AX3A 2YERA 5K0XA 3TKHA 2WB8A 5J5SA 4G2FA 4E1ZA 2CKQA 4ANQA 4ZY6A 5ANJA 4MUQA 4ACMA 4HZSA 1XMLA 4HNFA 4BKZA 2P2HA 5GJFA 2WMTA 3MWUA 4LOQA 2ACXA 1CKJA 4NFNA 3LFDA 3DU8A 3KMUA 4OTHA 3S2PA 5HU9A 2WMAA 4D1ZA 2YM4A 1GZ8A 4IM2A 2HAKA 5A3XA 1U5RA 4DLJA 5HU3A 2A1AB 2PYWA 1KSWA 3BGQA 4YNOA 2YAAA 3DXNA 3K3IA 5L8JA 2FA2A 1H01A 3FMKA 3GENA 3MFUA 2XCHA 4JIAA 5AM6A 4G3EA 3BL7A 3HMOA 4KIOA 3RAWA 4YTIA 4X2JA 1YQJA 2R9SA 1JVPP 3CTHA 3HDNA 4IMYA 3EQFA 2XALA 3V5TA 2P4IA 4X2GA 4IB5A 2WTCA 4WOVA 3VRYA 4XLVA 4R7BA 4D9UA 2WEIA 4I41A 2WELA 3QZFA 4QNAA 4NW5A 2J51A 3RZBA 5EG3A 4GSBA 4QP1A 4MKCA 5IUHA 3KVXA 3F9NA 2R5TA 3Q6WA 2HY81 3P7AA 4IM3A 3TNHA 3QC9A 4P7EA 3UNZA 2ITPA 4BGQA 2WMSA 3G0FA 4PV0A 4AGWA 1HCKA 3F5XA 1V0OA 3MFTA 3EN9A 4JQEA 5KX8A 3SOAA 3UBDA 4I94A 3UIUA 4ZOGA 5IKWA 4IAYA 4WT6A 4BBEA 4Q2AA 4PX6A 2IF8A 2DQ7X 3SKCA 2PWLA 4FKSA 1OKZA 4Z7HA 3MW1A 4DEDA 4F9BA 3NUXA 3PXZA 5AAGA 4HCVA 3FUPA 3U6IA 1JLUE 4H3QA 4L3PA 1KE7A 4QTBA 2XKCA 4GFOA 3QX4A 3EQGA 4DEAA 4BI0A 4DEGA 1Z5MA 3RCDA 3LQ3A 2F7EE 4ZZOA 5FM2A 3GP0A 1QMZA 4K33A 3R8PA 2OBJA 3ITZA 3CE3A 3BI6A 4HGSA 3ZLYA 4AWIA 4LRJA 4C3RA 4DTBA 3VS1A 2E9OA 2QOFA 1ZWSA 3EN5A 4Y72A 4BGHA 4XMOA 4YZMA 3LCDA 4H39A 3VBWA 3WZDA 5CEKA 3U54A 5CXHA 4ALUA 4TYHA 4DBXA 4O0UA 4O6LA 3NR9A 4U7ZA 2WTDA 2ITZA 3PPZA 5DT0A 5CXZA 2E2BA 4DHIB 3MH1A 3AMAA 3QCXA 5EFQA 4F7JA 5DR9A 1XR1A 4GK4A 5DT3A 1PXKA 3KN5A 4NUSA 3NNWA 4WG5A 5E8ZA 3OUKA 3FE3A 4O21A 4EH9A 2QONA 3VJNA 3DLZA 3NCZA 3OMVA 3UVPA 3QXOA 3PVBA 3H3CA 2G2IA 3COIA 1OUYA 4GT3A 3ZFMA 4R5YA 1XH4A 3UNKA 3EIDA 3W10A 3BGZA 2WMQA 3P86A 4FG8A 4MH7A 3TV6A 3Q2JA 1TQIA 1ZMWA 3Q9WA 3VS2A 5HTBA 5T68A 3WF8A 4BTJA 3GUBA 3A60A 4RC3A 1NVSA 4UEUA 4O84A 3DKFA 5DE2A 1Q24A 3RI1A 4QMTA 4RZWA 1BL6A 3W55A 3ML1A 4LI5A 4QP3A 3BHHA 1OVEA 1XBCA 2C30A 3PA3A 3IPHA 1QPCA 4FSYA 2C6IA 4RA4A 3SAYA 5E1EA 3LW0A 3OWPA 4IWPA 4F7LA 4DEIA 3HRFA 3O8PA 3R7VA 2GU8A 3LFAA 5FGKA 4F1OA 3KFAA 4M0ZA 2CHLA 1PW2A 5AEPA 4LV7A 2HCKA 1TQMA 4U41A 4BCFA 5BUIA 2W1DA 4CQGA 1LEZA 3C4WA 4XUFA 3LOKA 3KMMA 5L4QA 3QTZA 4Z3VA 3IW4A 2GNLA 2RFDA 3P7BA 3PFQA 4O0SA 3TUCA 1YWVA 4M67A 4C8BA 2OFVA 3ENMA 3A4OX 3UDBA 2YAKA 3RMFA 3R30A 5FLFA 3Q3BA 1S9IA 2W5AA 4IVCA 5C9CA 4YTCA 3LCTA 4PP7A 5AR7A 5LCJA 4A9RA 3LJ1A 1V1KA 5M08A 1X8BA 3V8TA 1CKPA 2OU7A 5HG7A 5HG8A 5CU4A 3RHKA 4V01A 2QOHA 2VUWA 4DGGA 5CAPA 5M51A 5AR4A 3DA6A 4H05A 3GXLA 5CVHA 1KWPA 1QPDA 2W0JA 3BV3A 2A98A 3ORLA 4C3FA 3AG9A 3C1XA 4GU6A 4YUQA 2P55A 3QTSA 4ENYA 3PUFC 5HIBA 4Z16A 5AV1A 1WVWA 4IX5A 4TYEA 3DJ7A 1SMHA 4FOCA 3VONA 3VS3A 3V8WA 5EKNA 4QMVA 1REKA 3KRXA 3LCKA 4YC6A 3UVQA 4P2KA 4YU2A 1VLRA 3LQ5A 4J1RA 2Y4IC 4QMWA 3F61A 4X3FA 5HVJA 4AU8A 5KBRA 1J7UA 3BYOA 5EW9A 3WARA 4R7IA 2VO7A 1UWHA 3A8WA 3M42A 2R3MA 4KNBA 4UYNA 5AX9A 4YR8A 4E4XA 2G1TA 2XJ1A 4L42A 4I21A 4ACGA 4AGCA 4C4GA 3OROA 3DXPA 1YRPA 4CYIA 4BZOA 4C58A 4HGTA 3K3JA 4GFMA 4QP4A 4RFYA 4D5HA 1OBDA 4X2NA 3O23A 3HECA 3QTXA 4HVDA 4HYIA 5C26A 4R5SA 2W1EA 2WMVA 4I24A 4QMOA 3W0QA 1GAGA 4O7LA 2IVVA 2WQBA 1CM8A 1ST0A 5JFXA 4XP2A 5AIKA 4BJJA 3MH3A 2F2UA 5GJGA 3DKCA 4BZNA 3U6HA 3UP2A 4BKJA 1BUHA 3ZUTA 5IPJA 3F5GA 3MB7A 1E1XA 4KKEA 3HP5A 3VULA 3PP1A 1A06A 4ZTSA 2R7IA 3NUPA 4GK2A 3W18A 4DFZE 2WTKB 4F9CA 4IAZA 5I0BA 4IFCA 3HP2A 5FD2A 4CT1A 2R3NA 5F9EA 2CKEA 3MTFA 4DITA 1PMEA 3RZFA 2WMXA 3C0HA 3S4QA 4AX8A 2C1BA 3R1SA 4G5JA 2ZV9A 4BY9E 3OBJA 4V05A 3MY0A 2X4ZA 1TFFA 2VX0A 2C6KA 4DGNA 4YO6A 3NCGA 3MIAA 4ZJIA 4JDHA 3VW6A 3WIGA 3KEXA 5BUEA 2FSTX 4CVAA 2H9VA 4YJUA 2QLUA 5A4LA 2NO3A 3POZA 3GGFA 3RKBA 4C62A 4CKRA 5M53A 4HNIA 4NCTA 4F08A 5AFVA 5LJJA 1RJBA 2ITTA 2XNEA 2BMCA 4L9IA 2IW8A 2Z7RA 4DGMA 2XCKA 1OL6A 3GI3A 5BYZA 1R78A 1PXIA 2PE2A 4MD7E 4CTBA 4FVPA 4RPVA 3OC1A 3SXSA 4EWHA 2YEXA 1ST4A 5EM6A 4F9WA 3DV3A 4DTKA 3VS7A 2SRCA 3HMIA 4DFUA 3MJ1A 4DT8A 5D9HA 5HG9A 1W98A 4YJSA 3TEIA 2QQ7A 3DAJA 2H8HA 4GJ3A 2XS0A 4CCBA 2I7QA 3HRBA 1H0WA 3BLHA 4W4WA 3RWPA 4YZBA 4EQMA 2JIUA 3QQFA 2JAMA 2E9NA 3SW4A 4IANA 3UYTA 2O0UA 1YXXA 2ITWA 3R73A 4DCEA 4EHVA 3ALNA 4YURA 4G6NA 4F09A 5L2WA 5HCXA 5JFSA 1G8KA 4C4JA 3TN8A 4FEVA 3GT8A 4EH2A 4MNEA 3EYHA 3WZKA 4ALWA 4EOKA 4CFMA 4TW9A 4UB7A 1JKLA 3KRLA 4APCA 2OF2A 3QD2B 4NEUA 5HLPA 5AV2A 3OEZA 4BDFA 5GZ8A 1GJOA 3FZSA 4B8MA 4CRSA 3ZEPA 4BYIA 3HZTA 2VV9A 3BHUA 4IVBA 2NP8A 2WMBA 3E3PA 1YDTE 4E4NA 3PXRA 5AUWA 3HAMA 1Q8TA 4O1PA 1Y8YA 4E6AA 3AKLA 1WBWA 2JDOA 3QRTA 5CWZA 3EL8A 3COHA 3KRWA 2OZAB 5D11A 4I4FA 4BL1A 5AP2A 4ITIA 3NNXA 3MGYA 3VBVA 3WE8A 2OJ9A 2ZMDA 2W4JA 2XIKA 3Q53A 2CLXA 4GW8A 5LARA 4BTKA 1ZOHA 4FV6A 3AC4A 3UNJA 3L8XA 4MBLA 2JKMA 1W84A 4LL5A 5CF5A 5BX0A 3NLBA 3KU2A 4NSTA 3ACJA 4FKOA 4E6QA 3OT8A 3EQIA 3OWKA 3ORIA 4F64A 4HVSA 4HZRA 4KIKB 5K5XA 3W0OA 4G1WA 4F0IA 3FKLA 4BF2A 4IDVA 5HX8A 4RC2A 4DHJA 2R0IA 3ERKA 2R3PA 4F9YA 2UZOA 2YCSA 2Z7LA 2GTMA 3BLRA 4IX3A 4J97A 3EJ1A 3FC2A 4O38A 5AIRA 4PMPA 1NA7A 1HOWA 3R9OA 3R01A 4OTWA 4FT7A 4MD9E 4NW6A 2BAKA 4JNWA 4FOBA 3T9IA 4O82A 1M2RA 3FSKA 4I5MA 2PVNA 4L43A 2B4SB 4ZSEA 5CAQA 1REJA 5HESA 3CKXA 3LFQA 4KRCA 5D41A 2CGWA 2WKMA 2R3JA 1H00A 3FJQE 5ANKA 4J8NA 3VJOA 3MVHA 5CEPA 4U45A 4UMPA 2B9JA 4HPUE 5FTQA 3A7HA 3RPYA 1FVVA 1UNLA 5TKDA 1IEPA 1FMOE 3TL8A 4YJNA 5JSMA 1PMNA 3W2QA 3D83A 2G01A 5E7RA 5EM5A 4D2WA 2CSNA 2WGJA 4ACCA 5K0KA 1ZZLA 3KKVA 1DAYA 4FTIA 3LJ0A 4IB3A 4M84A 4WBBB 2WQOA 2YDJA 3SQQA 4D2PA 1PY5A 3SOCA 2VO6A 3PG1A 4KSPA 4RJ3A 2V5QA 4E8AA 3U87A 1W82A 4L6QA 3W0NA 5EM8A 3LCSA 5FEQA 1XO2B 4UMRA 4R3CA 4AZEA 3W2SA 2PE0A 4FICA 5JEBA 4Z9LA 3AKKA 2XBJA 4XOZA 2CLQA 2BZIB 2XF0A 5HNGA 3LFFA 4G3FA 4JIKA 3H0ZA 3ZUUA 4O7RA 4IZYA 1U54B 5ANOA 3O50A 3V04A 2BPMA 4X2FA 2QVSE 3VUTA 3EN7A 3LM5A 3HMNA 4QMXA 1ZMUA 4TWCA 3S00A 2BRNA 3KVWA 3FKOA 3FLZA 3Q4TA 4D1XA 2C6LA 3BV2A 2QHNA 2GNJA 3MDYA 4R1YA 1TZDA 3TZ9A 4CG9A 3JYAA 2PL0A 2XK8A 1L3RE 3DZQA 4HGEA 4X3FC 5K9IA 3I5ZA 4FODA 2C68A 4S33A 5HE2A 3OCBA 5HTCA 3BRBA 3GNIB 4ZTLA 5K4JA 2RFEA 2OXXA 3UE4A 1B6CB 4IHPA 1XQZA 1M2PA 3Q96A 4FNYA 4ALVA 4ZAUA 4AP7A 5BNJA 5ANDA 5AUZA 3CTJA 3WF7A 1H26A 4XP0A 4KRDA 2UW7A 4U79A 5F94A 4KIQA 3WF5A 4NL0A 2Y7JA 3EKKA 2CKPA 4IEBA 4XP3A 3C5UA 4QMNA 3FC1X 4X0MA 5BV3A 3GCPA 3D94A 5AV4A 5CENA 4ASXA 3TV4A 4BIBA 5CLPA 5E92A 2UZUE 4ZSGA 2C5YA 5JGBA 2C3JA 3FL4A 4YP8A 5H9BA 3E7VA 3VWAA 3I0QA 4EOJA 5HORA 3ZLSA 4IDTA 4OTGA 3ID6C 3AQVA 5HE3A 4FEXA 4FYNA 1MQ4A 4GCJA 3QYWA 4CXAA 4PTGA 4LMNA 2BHHA 3NVKI 4L00A 1FINA 5BVKA 3RCJA 2HYYA 3PP0A 2A27A 4D4VA 2ITYA 3C5IA 5AP1A 4XG4A 1SVEA 3IW5A 3CPBA 4ZMEA 2X0OA 2IVTA 3DNEA 3QC4A 5AUXA 3Q32A 2XK9A 3DS6A 3GFEA 3CD3A 2QR8A 4L67A 1YOJA 2JDSA 4FSRA 4LUDA 4E73A 2FGIA 3EOCA 4O4EA 1F3MC 5J1VA 4OTRA 5LQFA 2P33A 3MJ2A 4N6ZA 3UJGA 4FT3A 3V5PA 4HVHA 3GBZA 2RFNA 3ZU7A 4RVLA 3AT3A 4FMQA 4TL0A 4NCTC 2V22A 4HPTE 1GZNA 3DTCA 4L3LA 4EUUA 1K9AA 4PDPA 5D7VA 4ASZA 2XNNA 2RFSA 5DR2A 4F0GA 5FRIA 1ZRZA 2HWOA 3G0EA 4QP9A 4L01A 3B2WA 4EYJA 2BRGA 1NVRA 5EM7A 4AUAA 1OUKA 4O1OA 3ZSIA 2EXCX 4LFIA 4E4LA 4H1JA 3QKKA 4F7NA 3A7GA 3E8NA 4UXLA 3JS2A 5HTIA 5I3RA 2BTRA 3OF0A 5KMNA 3LFEA 4CYJA 2XRUA 4UWBA 5HLNA 3W0RA 4FKJA 4DH8A 4BDKA 2RL5A 4NT4A 3G6GA 5I5ZA 1JOWB 5HE1A 2VGPA 3CLYA 5LMAA 4HOKA 4E5BA 4FEWA 4ZY5A 1O6YA 2QU6A 3NIEA 3ZBXA 2XB7A 2QO7A 1WBPA 5CASA 1J91A 3AC2A 4F1MA 3MB6A 4IE9A 4FF8A 4EOIA 2O63A 5AR3A 5HIEA 5AV0A 3TZMA 5CF8A 2HXLA 5C4KA 5LWNA 4E6CA 3VS0A 5M4UA 3LIJA 2GHLA 2CDZA 2UZTA 1YOMA 2IEWA 2PSQA 3UZRA 3OHTA 2C6OA 2DS1A 3DQWA 1R39A 1XBAA 2QC6A 3HL7A 3ORPA 4JDKA 4ASEA 3FI2A 3UYSA 3LLTA 1M52A 2FH9A 1GZKA 2BDWA 2IJMA 2YIXA 4DH3A 5KKRB 4NM5A 2WTVA 1Q8UA 3MPMA 4K77A 5HO7A 4ENXA 5KE0A 4NFMA 3GB2A 5CF4A 4GL9A 2JIIA 3U4WA 4QYFA 4EOMA 4MK0A 3WF6A 3BKBA 3MN3A 4BI2A 2IVSA 5CTPA 3E93A 2OJJA 1P4OA 4PY1A 4UYAA 3QD0A 3CTQA 3V6SA 4CTCA 3R8LA 3FY0A 4TTHB 3VBTA 3I5NA 1RE8A 5BVFA 3VUGA 4ANOA 2VWUA 3BBTB 3PJCA 5EYDA 3QZIA 3IGOA 3THBA 3N9XA 3LXLA 3V01A 3ZSHA 3W0MA 2B9IA 2UZDA 3FL5A 5EYMA 2R0UA 2KULA 3KK8A 3ROCA 4EC8A 3ZDUA 4Q9ZA 2VTAA 2QOOA 1F5QA 4IVDA 3VF8A 4BDJA 2WO6A 3LXKA 4H58A 4AOTA 3K5UA 5IEVA 4EH6A 4OUCA 1JKSA 3W8QA 1Q8YA 4ZS4A 4RIYA 1FOTA 2YFXA 3R00A 4IWOA 4RSSA 5L2SA 3FI8A 2FYSA 4R3PA 4M69A 3LM0A 5G6VA 2BRMA 2PZYA 3UGCA 2EVAA 4KS8A 1H0VA 3ANQA 4BZDA 1PXJA 5E8XA 4CZYB 3QU0A 4NM7A 4PMSA 3FI4A 3BCEA 1W0XC 4JG7A 4PWNA 5KZIA 3RGFA 2ITXA 2NYAA 3EWHA 1BI7A 4YZCA 4EKKA 5AUTA 3ZFXA 3PYYA 3GU8A 2I6LA 2UW3A 4FKGA 4XG9A 3H0YA 4OTIA 3ORTA 5IDPA 2B9HA 2OJGA 4GG5A 3FZTA 3KCFA 4JR3A 4ANBA 1OKWA 3QWKA 4EH4A 4DEHA 4FL2A 2OJIA 2W9FB 3U9NA 3KREA 5EQEA 5DPVA 4EONA 4UZHA 2PZ5A 4BCKA 4AXDA 2EXEA 4CCUA 3C7QA 2WTJA 3AOXA 3OUNB 2EB3A 3D2KA 3R7OA 3HV4A 5EOBA 1Y6BA 4ASDA 2ZMCA 2Q83A 4BDAA 5FXRA 3IGGA 5J9ZA 5BVOA 2VTSA 4I6HA 2YN8A 4UZDA 4RC4A 2PVFA 4ERWA 2PZPA 3AKJA 4U81A 3UTOA 4IWDA 4C59A 3EQPA 3A62A 3OCGA 5EYKA 4O4FA 2X81A 4A4XA 4RIXA 2OXYA 5IQEA 4OBPA 3K2LA 4TYJA 1FBNA 4W8DA 4FL3A 4GS6A 4DDGA 4FZ7A 5CI7A 4BDEA 1Q99A 5CT7A 3ZO1A 4EJNA 3LQ8A 1OL1A 3D5VA 4FK6A 4BDIA 3EQCA 5DNRA 1O6KA 3DTWA 5KMKA 3I7CA 3SLSA 4DFNA 5JK3A 4GMYA 4CFNA 1E1VA 5IQCA 3D7TA 2C47A 4F6SA 2YABA 5BUJA 2HXQA 3ALOA 2X8EA 4DFLA 2GNGA 5BPYA 2BZJA 3OY3A 1J1CA 4FSNA 1WVYA 2QODA 5CU6A 4QDVA 5KCVA 1OGYA 4IZAA 4II5A 1ZYLA 2NRYA 3VBQA 5L6PA 2B52A 3DJ6A 3AT2A 1WMKA 3BYUA 4NM0A 2CGUA 5AP5A 1GIHA 2E9VA 2GS6A 5B2LA 2PPQA 4E5WA 2YCRA 3BHTA 4L7SA 1SNUA 4N0SA 4V0GA 3GU7A 5HLWA 3P4KA 4JOAA 5HI2A 4EK8A 3KXMA 4G6OA 3EFJA 2QOQA 3OCTA 2BFYA 4FT5A 2XKFA 3NYXA 4JVGA 1ZXEA 4DH7A 2ETRA 1Y57A 3IDPA 4FIIA 4IH8A 3I4BA 2CCIA 3PWDA 3RPRA 3VUHA 3QXPA 4QP2A 4BBMA 4A9UA 4RIWA 3OTUA 3C0GA 3CGFA 4YPSA 3AD5A 3SRVB 3R7YA 1R3CA 2YJRA 2XKEA 3ZS5A 5ACBC 5HKMA 2BAQA 4C02A 5DBXA 2VWVA 4L68A 5M07A 3LFCA 1Z57A 4BDHA 3MA3A 1GY3A 2JEDA 4GEOA 3W0PA 5GNKA 4GJ2A 3PLAE 3UMWA 3T3UA 2RKUA 4GVAA 1DAWA 3V6RA 3AT4A 3IW6A 5AP0A 4I20A 3TTJA 3F7ZA 2HOGA 1M7QA 4I6QA 4S32A 1KOAA 3SVVA 1GNGA 3T8OA 3A2CA 4ZJJA 4CZUA 1I44A 2DYLA 4ZMFA 3HV5A 4A9TA 4BRXA 3R2BA 1L8TA 1LR4A 5AP3A 5EH0A 1AGWA 5D10A 4EEVA 2XRWA 5FQDC 3CBLA 2WMUA 4XV2A 5HOAA 4O0WA 1UA2A 4O7ZA 2UZLA 3EYGA 3QQUA 3PY1A 4I93A 5BVEA 4C34A 4A4LA 4QYHA 4DBNA 3I6WA 1BI8A 2IG7A 2B9FA 3QZGA 4PUZA 3O0GA 4JLCA