4LRJA

Bacterial effector nleh1 kinase domain with amppnp and mg2+
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
163
structure length
160
Chain Sequence
b'RLSVPGNVIGKGGNAVVYEDAEDATKVLKMFTTSQSNEEVTSEVRCFNQYYGAGSAEKIYGNNGDIIGIRMDKINGESLLNISSLPAQAEHAIYDMFDRLEQKGILFVDTTETNVLYDRAKNEFNPIDISSYNVSWSESQIMQSYHGGKQDLISVVLSKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Effector NleH1
publication title NleH defines a new family of bacterial effector kinases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 51
structure length 160
sequence length 163
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4lrjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4lrjA01
1OL6A 4XYFA 5CAOA 5JSMA 1OZ1A 2UVYA 2CLQA 5JQ5A 3G9LX 3N9XA 1CKJA 4YJOA 2VX1A 3E8NA 5DPVA 2GQSA 4XRJA 5BUJA 2QU6A 5AFVA 1YHWA 3ZUVA 2W1DA 3O0GA 4UEUA 4WO5A 3PE2A 4NFNA 4AP7A 4RVTA 4TYHA 4O82A 2QOOA 2WB8A 5CS6A 3ORNA 4RX7A 4XHKB 3TI1A 3QZGA 2VO6A 1IEPA 4XG9A 4KBAA 1Y91A 4EOLA 5CXZA 4H58A 4F9AA 3W1FA 4DGOA 4AS0A 4RMZA 3C4ZA 3COKA 3BLRA 3QRKA 4JQ8A 4XH6A 5C4LA 4J1RA 2R3JA 3D5VA 1CM8A 4C3PA 3AGMA 4KKHA 3RP9A 4XG6A 4YP8A 1YI4A 3SQQA 5CSXA 1PXIA 2QURA 3BEGA 4EK3A 1GOLA 2JD5A 3EZVA 1OL5A 4LGHA 5IA3A 3RGFA 4ZS4A 3WIKA 2QHNA 4FZ6A 5HX8A 4F99A 5AP5A 2PVFA 2E9UA 1KE8A 1REKA 4D58A 5CTPA 5L6OA 1QPDA 1PKDA 2W99B 3PPZA 4AOIA 4C37A 3PJ2A 5IQFA 1K3AA 1BL7A 2YITA 4FZDB 3LCSA 2CCHA 2OK1A 2OSCA 4QTBA 3VUMA 4BDKA 4G9CA 5HBEA 1Q4LA 3F3WA 2CCIA 4W9WA 4FG9A 1W82A 3BBTB 4BYJA 1YXTA 5C26A 3SGCA 2UVXA 4IZYA 3WILA 3S95A 3TEIA 5KNJA 4UALA 1URCA 4BGQA 5HE3A 2RGPA 3DDPA 4C4FA 2UUEA 4EK5A 3PRIA 4NM5A 4FSQA 3D7TA 1BX6A 4QYGA 5CY3A 3LMHA 5E4HA 3I6WA 3ZHPC 3DKOA 5JEBA 4DT8A 2BFYA 3E63A 3N51A 1DM2A 2JBOA 3KXMA 3K3JA 4QMPA 5EKNA 3U6JA 1OB3A 3BHTA 4QYEA 2ITQA 2J0LA 3UYSA 4I6HA 4JRNA 5GJFA 3DT1A 3I4BA 4ANNA 4NWMA 2JIVA 3WZEA 3MH2A 4Y95A 5M4FA 4ZSEA 3RM7A 4ASZA 4AXAA 3KXHA 3JY9A 3PUPA 5DT3A 4QMLA 4N6ZA 5D9HA 4M69B 4AW2A 4EYMA 4BCQA 4PX6A 4C58A 1JKSA 3ENMA 3LOKA 3I81A 2BFXA 3GQLA 5DIAA 1XH6A 5DYJA 2I0VA 2WMUA 3QWKA 5C8NA 4EOOA 2C47A 3NEWA 4J96A 4U97A 3VQUA 2CNQA 4D2PA 4F0FA 3TZMA 4L52A 3UOJA 3EMGA 3PTGA 1IA8A 3QCQA 5EDPA 3HAMA 2C1AA 3O8TA 5CT0A 3MWUA 3IO7A 3M2WA 3ZH8A 4W4XA 3LM5A 2OBJA 3CGFA 2QKRA 4TL0A 3WYYA 3HUBA 4W8EA 4LFIA 1OIYA 3Q52A 4GCJA 4IAAA 4IVDA 4KBCA 2WMAA 1JQHA 4YZ9A 3DXPA 1IRKA 4UMRA 5D7VA 5F95A 4ASDA 5IQIA 4IEBA 2E9VA 3BYVA 3E62A 5E8YA 3PWDA 4DEGA 4BDFA 3WZDA 1F0QA 2XM8A 3PVGA 3LXLA 4K11A 1J1BA 1AD5A 4W8DA 4BIBA 4L7SA 3QQKA 3BE2A 2YFXA 4U40A 4BN1A 5CANA 4L3JA 3IPHA 5LMKA 3QD0A 4BI2A 4IC7A 4ZMFA 4JX3A 2RL5A 4ACHA 3GENA 4OW8A 1PW2A 5TKDA 1Q41A 1WBPA 2XJ0A 3P5KA 4HZRA 4IHPA 3COIA 2BDJA 4NJ3A 4UMQA 3NAYA 2R3IA 3VW6A 3GC9A 4A07A 4WD5A 5FEDA 3HV6A 2HZ4A 2G2HA 4EH4A 3PA5A 3T3UA 2FSMX 5JRSA 4YZMA 3U9NA 4FV1A 2XIXA 4IX6A 2W9FB 2XNNA 3WOWA 2XIZA 3ETAA 4IACA 3A8WA 2CN8A 3CIKA 4MVFA 4EKKA 2HXLA 5EOBA 3A61A 3PY1A 3A4PA 4R6VA 2R4BA 2WIPA 4IM3A 2O64A 4DTBA 2XCKA 4GJ3A 3KXZA 3NAXA 2CDZA 3A7GA 3FZ1A 4FKTA 4NEUA 1E1XA 2PVRA 4KKGA 3TNHA 4C2WA 3FLSA 3AMAA 3VS2A 5ETFA 3O7LB 5HNBA 4Q5HA 3POZA 1ZXEA 2IZSA 2R3OA 4RVMA 4O83A 4CTCA 3BGPA 1FOTA 5EQEA 1LEWA 3NYNA 4RIXB 5CVFA 4EHGA 3I5NA 1KSWA 3NS9A 5GHVA 5IQDA 2V7OA 3NCGA 4UWYA 3QCYA 3HRFA 5M53A 2O2UA 3MDYA 3FLZA 2OXXA 5M56A 4WIHA 2GTMA 1OIUA 4ORKA 4BIDA 3QKKA 4TXCA 3NUUA 1H28A 4APCA 2JAVA 3MFSA 5A54A 4YNEA 1UNGA 1NXKA 1ZMVA 1V0OA 5CAUA 4UMTA 3C4EA 1PF8A 3NNWA 3B2TA 3ZXZA 4KBKA 3CJFA 3QLGA 3W16A 2XK6A 3RI1A 1H4LA 2ZV8A 4XRLA 4AN2A 2C69A 4PL4A 4JAIA 5I5ZA 2VWWA 5K5NA 3QYZA 5DEWA 5I9XA 4TWNA 4CEGA 3IOKA 5L6PA 4CMTA 2WD1A 4RA5A 1NA7A 3EL7A 5AP4A 3BCEA 1GAGA 4EOQA 5CSPA 2ITWA 4F7LA 2XYNA 3RM6A 4F1MA 4IADA 3Q96A 4R7IA 3R8ZA 2ITXA 2BKZA 2HY81 3MS9A 4YZNA 5KKRB 2W1EA 2QCSA 2JBPA 4LG4A 1G8SA 4UMPA 5EK7A 3VRYA 5C03A 4AT5A 3Q3BA 4CSVA 2BHHA 2WGJA 3SXSA 2LGCA 2OG8A 2WPAA 4FTAA 4G34A 3NNUA 5AR4A 5J1VA 5ANGA 4JT3A 2CGUA 2XIYA 2QKWB 4YPDA 5E8WA 2IPXA 5GJGA 1MRUA 3ZRMA 4C4GA 4RG0A 2Z02A 4N70A 3KF7A 4C0TA 5JGBA 4KIKB 4L53A 4X7QA 4PV0A 4FUYA 3LMGA 3S00A 2BTRA 4WNPA 3SOAA 4EK6A 4ANOA 2PE1A 2FB8A 3PRFA 4PWNA 4IVAA 4O6EA 3V6RA 2EXEA 2HWOA 1OKYA 5E90A 3V5WA 3D7ZA 2OKRA 4O7WA 3I0QA 4D9TA 4F09A 2GMXA 5K4IA 1QPEA 3BGZA 2PHKA 3Q5IA 3MFRA 4DBNA 4DN5A 1KOAA 3LVPA 3R8LA 3LXPA 3TUDA 5TR6A 4EZ7A 2R3HA 4HOKA 5G6VA 1ZRZA 1H1QA 3FV8A 3OWKA 3QL8A 4HVIA 3LKMA 4IDVA 4EK4A 3ORPA 3UC4A 4E7WA 4FT5A 3R83A 5DRBA 5CSHA 2CNUA 1KOBA 3TDVA 2JKOA 3QU0A 3GNIB 4IB3A 4YSJA 4QTEA 3R8PA 1VEBA 4O1OA 4PQNA 2X9FA 4CLJA 1UNLA 5CEMA 2GNLA 4O7ZA 3Q4TA 4PY1A 3F82A 4JIAA 1ZY5A 4FICA 2GFSA 3V6SA 2YLFA 2JIIA 3PA3A 5DN3A 3E7OA 5CU6A 4WG3A 1WBNA 5DRDA 1PJKA 2BDFA 4F7SA 1IAHA 2RG5A 2PVLA 3ZDIA 1WBSA 4L42A 4NZWB 3F3TA 4FMQA 3OY1A 2UW5A 2W05A 4IM2A 4R7HA 1JLUE 3OP5A 3OW4A 4UBAA 3EKNA 4YJVA 2GQRA 4OTRA 4LL0A 4WT6A 4BYIA 2XZSA 4E5BA 5BUIA 5J9YA 3COHA 3NSZA 2BR1A 3AD5A 4AA0A 4LGDA 4FGRA 4C3RA 4A4XA 4XV9A 3AC4A 4WUNA 3NMUF 4JR3A 3C4CA 2B1PA 4I5PA 5BNJA 3VUDA 2Z7QA 4PDYA 3FQEA 2I0HA 3IDCA 5A4TA 4CFWA 4WSQA 4ASEA 4FZAB 3PWYA 3RPYA 5KUPA 1P14A 5DVRA 2XNGA 3TZ8A 2W5HA 3BHVA 2YM7A 4AACA 1R0PA 4LGGA 4O86A 5DT0A 2E9OA 5IH6A 2OF4A 1QPCA 4IWDA 4TYHB 4CCUA 1FVTA 2F2UA 4FV3A 2UZBA 4BDDA 3MV5A 2UW0A 3F2NA 4A9UA 3NYXA 4CFVA 3KL8A 3QALE 5IQHA 2JKMA 2GFCA 4DAWA 3FI2A 3L9MA 4EWQA 2CKPA 4JDJA 5BVNA 2J5FA 1DI9A 4Y83A 3E7VA 1ZLTA 2C0OA 2C6EA 2VGOA 3GCPA 4FIGA 2QODA 3PZHA 3IW6A 1FGKA 3P08A 5AA9A 3QC9A 3F5XA 3PSCA 4FUXA 2QO2A 3FPMA 3I0OA 4I41A 5D12A 4BCOA 3PPKA 3W18A 4IBMA 4GL9A 5T3QA 3FKNA 4FVQA 4IDTA 4IH8A 3IW4A 2YM8A 2PSQA 4J97A 4HVSA 4X3JA 4I6FA 4HGEA 3L9LA 3ZO2A 4CV8A 5I3RA 1WCCA 4DE4A 3AQVA 4MXYA 4DFUA 4X2FA 3RKBA 1ZOHA 3NW5A 4EK8A 5A46A 4HVGA 2J0JA 4NM0A 3GQIA 4L43A 1O9UA 1XH5A 3EN5A 1NY3A 2ITZA 1CSNA 3MVHA 4NCTC 1EH4A 4PMTA 2R7BA 3A7JA 4IX5A 4RPVA 1AGWA 4PMSA 3DBDA 3D7TB 4MAOA 5H8GA 3V5QA 2JDRA 4RX8A 2ZB1A 4G3FA 5IEYA 3SLSA 2PUUA 4JS8A 4ONAA 3FAAA 2PMNX 3FPQA 4FKGA 1OIQA 4F9WA 1O6LA 3JYAA 4MD7E 2A27A 2X81A 1BL6A 5IG1A 2SRCA 3AOXA 3QTZA 3CP9A 2VWUA 4I24A 3QQLA 4O0RA 1GY3A 4EQCA 1UNHA 4JBPA 3VJNA 5JMSA 4YTFA 5EQYA 4L3PA 3G90X 3PDTA 3KFAA 4FIFA 4DTKA 5CF5A 1Y8GA 3PXKA 2YAAA 4BHZA 3OCSA 5CI6A 2YM6A 3LM0A 3QUEA 4F64A 3NVMB 5EYDA 5IMEA 4ITHA 1Z9XA 2IVSA 4AOJA 3FXWA 1JBPE 2QOLA 5FM3A 3IK3A 3DTCA 2F49A 5ANDA 4MK0A 1ND4A 5AP2A 1BMKA 4E3CA 3D2KA 1L3RE 3JY0A 5GIOE 1Q97A 3UBDA 3BHHA 4DINA 3FZSA 1H1WA 2DYLA 3KCKA 4BDIA 3JS2A 3UODA 2PZRA 2V55A 5GJDA 4E4MA 1W7HA 1JKTA 3MIYA 3DNDA 4FTLA 4U3ZA 3ZFMA 5CAPA 3NUNA 5HLWA 4IZ5A 5M51A 4RSSA 3KVXA 4A9SA 5KMOA 4F0IA 2PZPA 2ZDUA 3PXQA 4MD9E 3UQFA 3SG8A 4L3LA 4K1BA 4XBRA 3ZFXA 5IQEA 2W9ZB 4DTAA 3F5PA 3TZ9A 1NVQA 3VWAA 3NPCA 2Z7LA 5FTGA 4I0SA 4G9RA 2JDVA 2XKCA 3R8UA 5J87A 3ANQA 4FKUA 3NCZA 4TN6A 1PRYA 4FV8A 3EJ1A 3VUGA 4G3GA 4U44A 4Q9SA 3OY3A 5A3XA 4YBJA 5BYLA 2WO6A 4S34A 3OEFX 3V5JA 4AT4A 4CYJA 4EUUA 3GUBA 4OT6A 5HLNA 4GMYA 5IQGA 1P4FA 4FL2A 4X6RA 5KE0A 4MCVA 4K33A 1CKPA 2VTHA 3UO5A 5HVJA 2XK3A 3KU2A 3FYJX 4LOPA 5B7VA 2H96A 3FC1X 4YSMA 3GOKA 3CQUA 2C6KA 3FBVA 4WUAA 4M8TA 2BZHB 3DJ7A 3HVCA 4UZDA 1B38A 2VTQA 4N6YA 5B2KA 3TV4A 5DI1A 3U9CA 2IO6A 3KRLA 4KKEA 3TNIA 5HTBA 4U9AA 5IUHA 4FNYA 4WNMA 2IZRA 4QYHA 1TQPA 3Q4CA 4F9YA 1WBWA 1W98A 2W1FA 3EQIA 3HRCA 4I21A 3V8WA 1YXVA 4EH8A 5CQWA 3GB2A 3PY3A 4G31A 4GJ2A 4BI0A 1H08A 4IAZA 1V1KA 4M0ZA 3WF6A 4E4NA 2JAMA 2QOFA 2QO9A 5H8BA 1Q99A 2WMSA 4AZFA 3A99A 3SDJA 2ONLC 3EQPA 2C5NA 4KS8A 2G15A 4USDA 1OBGA 2DQ7X 3DBEA 4FC0A 4EORA 3HKOA 3ORXA 1Q3WA 4NKAA 3GCSA 4NSTA 4JX7A 4E93A 4FNWA 5FBNC 4YTIA 2XNPA 3RINA 4KIPA 2BCJA 2X8DA 3BPRA 5CEPA 4Y46A 3DQWA 3ZSHA 3KULA 4OGRA 2P4IA 4A9YA 3DAJA 4JJRA 5CQUA 3V5LA 4ARKA 3F66A 3IW7A 3QTQA 4BF2A 2VTJA 2YACA 2G01A 2ITNA 2VWVA 1GIJA 2GDOA 2VRXA 5E8ZA 2ERZE 4FL1A 4D55A 5HG9A 4G1WA 2AUHA 4FV5A 3W2SA 4ZTMA 4DEAA 5FQDC 1L8TA 2XNEA 4NW6A 3ZU7A 2QR8A 4F6SA 4ZZOA 3TT0A 4EOIA 5CAQA 2YDKA 3Q53A 2QOBA 3VN9A 5T6KA 4AGWA 2W0JA 4J7BA 3ACJA 4L6QA 4PF4A 1UV5A 5K0KA 4CFUA 4BGGA 3LQ5A 3NUPA 3P1AA 5AIKA 3ZO4A 5GIPE 1VYZA 4FTIA 3QQGA 5EG3A 5FDPA 1FMKA 5EYCA 4O2ZA 2BZKB 3GFWA 4HJOA 4JBQA 3QGYA 2NNWB 2CGWA 3MJ2A 4GRBA 3HUCA 2FSOX 3QKMA 4GV1A 1Y8YA 2WAJA 5KHWA 3FQHA 4RJ3A 3RAKA 1H1RA 2QLQA 3NUYA 2C0IA 4TTHB 3W32A 4MXCA 3TJDA 4CZUA 3DZOA 4H1MA 4GG7A 4O0SA 1YWNA 3WZJA 4ITIA 1I44A 4AT3A 3ZLXA 2HW7A 1Q8YA 3A7IA 4WNOA 3PVWA 3RAWA 3ZYAA 3W8LA 4H36A 4W4WA 3P0MA 4XJ0A 4CRSA 4DH8A 4JIKA 4HYUA 4DLJA 4ZMEA 5CLPA 3ZXTA 4I22A 3EQCA 4LRKA 1VYWA 3A2CA 1IG1A 3PJCA 3VHKA 3O2MA 3SA0A 1RW8A 2PK9A 2X8EA 1O6YA 4BDAA 3B8RA 3QQHA 3UVQA 4RIWA 5C8KA 2CSNA 2J0IA 2RSVA 4FSYA 5GZ8A 3FMNA 2YIQA 2GNFA 5JZNA 3TTIA 4YJQA 4A9TA 2JDSA 3G5DA 3DKFA 3O17A 4S2ZA 4EONA 5IZFA 3GU5A 3FLNC 3NYVA 2PE0A 3ACKA 3P7AA 2E9NA 4YBKA 2OH0E 2HZ0A 3KKVA 3Q6WA 3R1QA 4OTDA 3V8TA 4GU9A 2NP8A 3CEKA 3VBXA 1FINA 2BRNA 3UQGA 3HGKA 1H0VA 4UX9A 1RQQA 3QTSA 4QYFA 5DFPA 5J5TA 2GS6A 1PYEA 2P3GX 4Z9LA 3D4QA 1JSVA 4FYOA 1CTPE 4H1JA 4IXPA 1V0BA 4K0YA 5AM6A 4EBVA 3G33A 5EM7A 2PPQA 3HP2A 3PJ1A 5J8IA 2C4GA 4V0GA 2GHLA 4OTPA 4OBPA 3ZLSA 4E6QA 5JFWA 5EM5A 2GHGA 3QZFA 3LXKA 1YWVA 4BWXA 5M07A 1UU9A 3CE3A 3MY5A 3QD4A 4YO6A 3UVPA 4CMUA 3NVKI 2X6DA 5GNKA 3HL7A 2XKEA 4PPAA 2ZJWA 5HCZA 3CXWA 4BWPA 4O0WA 3DY7A 2YM4A 4ZP5A 4XV1A 3IGGA 1H0WA 4O38A 1NT2A 5EM8A 3QXOA 5CVGA 3UDBA 3JVSA 5HESA 4S32A 1Q61A 4OTFA 3ATTA 5IQCA 1PXMA 5AA8A 5CF6A 3OT3A 4KWPA 3OZ6A 5FP6A 4NIFA 4U79A 4BCMA 4USEA 1WBTA 2F7EE 4KRDA 2P2HA 2WMBA 4N0SA 3ODZX 4F9CA 4ZJVA 5AAGA 4F08A 4RA4A 5CU0A 4I5CA 2V22A 3LFEA 4XG3A 3CY2A 4U80A 2PY3A 3CLYA 3TACA 4QRCA 3F7ZA 3ELJA 5AX3A 4CKRA 3OEZA 3ZBFA 4EH7A 5EDQA 4FR4A 5IA0A 2F9GA 5AV4A 4IAYA 4ACCA 5HORA 3RJCA 4BFMA 3R7IA 4O96A 5LOHA 4I3ZA 2QNJA 5IQBA 1A48A 4NK9A 3MTFA 3KRJA 3NUAA 4AW5A 4FT0A 3GCVA 5HTIA 4QNYA 4JG8A 4YJNA 3TTJA 3QX4A 2EVAA 4BDGA 1KE7A 2I1MA 3VRZA 4JG7A 4TPTA 5EOLA 4AE6A 2OIDA 2IVUA 3GU8A 2QQ7A 3K3IA 4TW9A 4FV7A 3HV7A 5DWRA 1OVEA 3LPBA 4I23A 4ANLA 5CNOA 2YWPA 2HYYA 3ZEWA 3BHUA 2WTJA 2PUIA 3DQXA 4DLIA 1BYGA 3PYYA 4M67A 4QP4A 4ERKA 4O27B 4GFGA 4E5WA 5B0XA 4CKIA 5HBHA 2BHEA 4L7FA 5K9IA 3TV6A 2QO7A 4EC8A 4F6WA 5DE2A 1YXXA 2Z2WA 4UWBA 4QP2A 3ZLYA 4WBOA 4D1ZA 3LXNA 3OWLA 4F4PA 5BUEA 5LWNA 3HLLA 4O7VA 2ITPA 2PWLA 5BMSA 3VW8A 4WBBB 5CT7A 4ZSAA 1GJOA 2VTSA 4KIOA 4TZRA 3ZUTA 5JFVA 4QMQA 2VZ6A 2GU8A 3GP0A 2OGVA 1Y6BA 3WF5A 4FSRA 1BUHA 3FMKA 2PVHA 1WMKA 2QR7A 3HP5A 3TXOA 2WELA 4FEVA 3MH1A 5I9WA 2H8HA 2J7TA 4NUSA 2WU6A 2JFMA 4YLKA 5FEQA 3TZ7A 3KK9A 5J1WA 2IWIA 5AUZA 4CG8A 4LL5A 1MRVA 4RJ4A 4XCUA 1QCFA 5K3YA 2JIUA 3AT2A 3UVRA 4CFXA 4D2VA 5AADA 3UYTA 2HAKA 5JFSA 4RX5A 2OZAA 4FTNA 2YWVA 4GK2A 5IMXA 4L45A 5ANEA 4FKQA 4G6NA 3QX2A 1GZKA 3ULZA 4BVUA 1YXSA 3MIAA 3S3IA 1UU8A 4DYMA 5DR2A 5J5SA 4I4FA 3I5ZA 2H6DA 4YC6A 3WBLA 1UVRA 4RQKA 3KXNA 3OCTA 5AEPA 5HIEA 1V0PA 3Q9WA 5HG7A 3EOCA 3U8WA 4O0TA 3VAPA 3VJOA 2YIRA 3C0IA 4U43A 4BI1A 4EI4A 3C4FA 3LE6A 2CLXA 4C34A 2YLEA 3H0ZA 3UPZA 5HU3A 4NKSA 4EH6A 2J90A 3LCKA 4LQMA 2IW9A 5TT7A 4XX9A 3ZOSA 4O7RA 3NUSA 3WI6A 4USFA 1U59A 1WBVA 3UZPA 3EFWA 2VTRA 5DGZA 1XHAA 4ZLZA 4U0IA 4H3BA 5FGKA 4XLIA 5HKMA 2FSTX 3D15A 3GOPA 2B9JA 3CTQA 4X2GA 4X2KA 1W8CA 2LAVA 4MXXA 5J7BA 2FA2A 4BBEA 3OXZA 2CHLA 3FMJA 2IW6A 2J0KA 5KBQA 5CVHA 3C0HA 3UOHA 4FEXA 3QUPA 4NM7A 3UOKA 4AUAA 5LJJA 3H3CA 4DA5A 4M66A 1FBNA 3HNGA 4D5HA 1NW1A 1YDRE 3C51A 5HLPA 3MFTA 4D2WA 3P7BA 3IDPA 4J95A 4ZXTA 3UMXA 4RFYA 1URWA 3IGOA 4ID7A 1UWHA 3VULA 1WZYA 4ENYA 4RC3A 5AR5A 5EI6A 1S9IA 3ZO1A 3ZM9A 5EW3A 5LXMA 5IQAA 5EKOA 2CJMA 4ZTHA 5E8TA 1LP4A 4UXQA 5AJQA 2UV2A 4FVPA 1Z5MA 2YZLA 4O7TA 1DS5A 3D83A 3MPTA 3NIEA 2XNMA 3LFCA 5DR6A 4G3DA 4WNKA 3EB0A 2ITTA 3VUTA 4L44A 4NFMA 1JWHA 5HQ0A 1YVJA 4ZTLA 1ZOEA 5LVPA 5KBRA 3D5UA 4YHTA 2UW6A 3BI6A 1IAJA 3FXXA 4MXZA 1G8AA 3UC3A 3RK7A 4JRVA 4X0MA 1GZOA 3LCTA 3FJQE 4IB5A 4EUTA 2P0CA 4IZ7A 3QYWA 2Y6MA 1R3CA 4O0XA 3NIZA 2PL0A 4C62A 2F7XE 5BVFA 2XIKA 3GI3A 4Y73A 4EOKA 4GT4A 2X8IA 2XS0A 4I0TA 5DT4A 5L8LA 3DS6A 2YEXA 3OC1A 5AAEA 3AC1A 3E8DA 3R00A 2RKUA 1RJBA 3LJ1A 3QHRA 4EQUA 2X1NA 3WZKA 4MTAA 3FL4A 3KULB 1E9HA 4R5SA 3LFSA 1J7LA 3EQBA 3ERKA 1YQJA 4AZVA 2OU7A 4XS2A 5HD7A 3T3VA 2C3LA 3UMWA 4M0YA 1OITA 2XK8A 4R3RA 2Y6OA 3LIJA 5FG8A 3OBJA 2XB7A 1STCE 2BAKA 2R7IA 3EQGA 3RHXA 3CSVA 1GZ8A 2B55A 2UW9A 3REPA 4YJRA 1IR3A 2VNWA 4A06A 2VAGA 3AD6A 2ITUA 5AIRA 3TIYA 5HD4A 3GXLA 2ZOQA 3BLHA 4ASXA 4PL5A 2W17A 2BZJA 3OXTA 5HOAA 3AC2A 4BC6A 2XK9A 4IE9A 3O23A 4QPSA 3OF0A 4CQGA 2A0CX 1PXPA 2YISA 4C61A 4KUJA 5L8KA 2Y7JA 2YCRA 2W1ZA 1PY5A 2XCHA 2UW8A 4DG3E 3OOGA 3A7FA 1ZWSA 3HEGA 1OKVA 2Y4IB 5CU4A 4DFZE 3R7UA 3WZUA 4GFMA 4B4LA 4MXOA 2WTCA 2W5AA 4XV3A 4L67A 3ZSIA 2HZNA 1F5QA 3QQJA 4FTJA 4QPAA 1BI7A 3P78A 2ZV7A 4EZ5A 5KZ0A 4PP9A 1ZZLA 2VV9A 4QTAA 4NT4A 3W8QA 2F7ZE 4JDHA 4EEVA 4D2TA 1YKRA 4J99A 2QONA 5BVOA 5ANJA 3DXNA 2G1TA 3R04A 3R1SA 4TYEA 4DH1A 1TKIA 2FGIA 2V5QA 4DH5A 4FOBA 3ZSGA 4XOZA 2ETRA 4JQ7A 1XJDA 4RIWB 3DBFA 2X2MA 3MH3A 4RBLA 2PYWA 5HO6A 4HVDA 5HGIA 4ENXA 3C7QA 3EHAA 4QMNA 4EWHA 4IZAA 4QO9A 3VVHA 4DFXE 3FL5A 5K0XA 2YAKA 3B2WA 3KXXA 3CJGA 3QFVA 4CXAA 4KSPA 2WTKC 5HE2A 5F4NA 5LARA 5IA4A 4MD8E 1YI3A 3FY2A 4IW0A 4FKRA 3ZRLA 5E8SA 3VS3A 2J6MA 4C57A 2W06A 4DT9A 3NDMA 3AMYA 5HX6A 4B8MA 5L3AA 2QLUA 4V0GB 3EN7A 3HZTA 4NTSA 3UIBA 3ZRKA 4U41A 3RHKA 4BBFA 5LCKA 3Q6UA 3U55A 3W2OA 4AFEA 1Q3DA 3KF4A 2XKFA 3FHIA 4K18A 3ZLWA 3DLZA 3UIMA 5ITAA 3NNVA 3ZBXA 4FSTA 3HDNA 4JG6A 4IC8A 3GC7A 3P23A 3DZQA 2WMVA 4O1PA 1XH9A 4LV8A 5F20A 3W10A 4DEHA 2VTOA 4AQCA 4AZWA 3C50A 2QG7A 2WEIA 4FKLA 4RZVA 3ZEPA 4NTTA 3T9TA 4EL9A 5LWMA 4IAFA 3KN6A 3UIUA 4DEEA 4JLCA 4UY9A 4NIFB 2WFYA 4RQVA 4V04A 2YDIA 3FE3A 1SZMA 2EB2A 1GZNA 4GIHA 3MH0A 4QQJA 3TV7A 3NGAA 2BRBA 4RWJA 4F1TA 4GSBA 5L2QA 3QWJA 4GUBA 3UIXA 2QOHA 3Q60A 4YTHA 2OWBA 4E1ZA 5J9LA 3EN9A 2HK5A 1NVRA 2XEYA 4ZAUA 4X3FC 3KEXA 2ZM1A 3QTUA 4BIEA 3UPXA 3F3UA 4BZOA 1DAYA 5HTCA 2WMWA 4PDSA 3DK7A 3R7EA 2RFDA 4AF3A 3QHWA 3O96A 2HCKA 5IEXA 4FEUA 2VO7A 3R8VA 2C1BA 4P5ZA 3FZPA 4FBXA 4R3PA 5B2LA 4BDHA 4IANA 3G0EA 5J95A 3ZDUA 3LLTA 1WVYA 4B6LA 5LVNA 4TYIA 3FLYA 4AFJA 4FKWA 4Y85A 5H2UA 1OUYA 3MN3A 3PIZA 1MQ4A 3ALOA 3FDNA 5A4CA 4E8AA 4HYSA 3VNTA 1ZARA 3FMEA 4UMUA 2R0UA 5JGAA 3D0EA 3HMIA 4RFMA 2BIYA 5FTQA 5KO1A 5JRQA 1OMWA 3G6GA 4YPSA 5JKGA 2J2IB 2R3FA 3MGYA 4FV4A 4ZTNA 3TCPA 3PVBA 3DPKA 3MA6A 1M2RA 2IVTA 2UW7A 4ZTSA 4AW1A 2HENA 4UXLA 4M13A 2QVSE 4S30A 4DFNA 1SVGA 1S9JA 4QTCA 4O0VA 4MWHA 4Y5QA 4F7JA 1IA9A 3F6XA 4ITJA 4LRJA 3TG1A 3UG1A 4DF3A 2YA9A 4YZBA 3R7VA 4WG5A 5AP1A 4FSMA 5H9BA 3MVLA 2X9EA 2Q0NA 2PVJA 4O84A 5FUTA 4O0UA 4BKYA 4DHFA 5CEIA 4EC9A 1ZYDA 3VS1A 2GHMA 3H9FA 2R3PA 5HIBA 1PXKA 2C3KA 2XA4A 4FSWA 4C36A 2W4OA 4ZZMA 4O7LA 2ZV2A 5KMKA 4DGLC 5L8JA 4Z55A 2ZB0A 4NCTA 3T8OA 3OMVA 5HICA 3D94A 4FTUA 1ZZ2A 1YOJA 2W1GA 3E3BX 1MUOA 5A4EA 3FLWA 4MX9A 3QRTA 5E1EA 5BQ0A 3P86A 3C13A 3M1SA 3R22A 3F3VA 5EYKA 4FV6A 2A4LA 4I94A 5DA3A 4OTHA 4NW5A 5I0BA 3F9NA 3KN5A 3OUKA 4M68A 3UG2A 4DH3A 2X2LA 5M09A 3EL8A 2PUNA 1U46A 2KTYA 1SMHA 3P9JA 4IWPA 2WZJA 4RGJA 5ACBC 4GS6A 3PXYA 4A4OA 2BILB 1OI9A 2VO3A 3PP0A 1YOMA 4YMJA 4BL1A 4F63A 3DXQA 3ODYX 1JSTA 4FIIA 2I0YA 2O3PA 2J0MB 3AC5A 5EM6A 5EQPA 4C59A 2B7AA 3SVVA 3SRVA 3VS6A 5ANIA 3AC8A 2WOTA 5AV2A 4CZTA 2OH4A 3HYHA 1E1VA 4EH2A 3V01A 3C5UA 3M42A 3WE8A 1TQMA 1XKKA 3R7GA 1ZYJA 4FKJA 1UA2A 1H25A 3QQUA 4Z7GA 3BYUA 4O22A 3PG3A 3MB6A 4RWLA 3TNQB 4FG8A 3E88A 4G3CA 2X39A 4HGLA 3CC6A 3K5VA 4G2FA 4L00A 4XV2A 4MQ1A 2RF9A 4K9YA 5CZHA 2YJRA 1H8FA 2F57A 2R3QA 5IA2A 5HEZA 1ZYLA 5HZNA 5LQFA 3V04A 4FX3A 4FK6A 3A60A 5EI2A 5CNNA 2BALA 2E9PA 2A19B 1PYXA 3FWQA 4PP7A 3V3VA 4XLVA 4FG7A 3RK9A 3SG9A 1P2AA 4AW0A 1PXNA 2EB3A 3BV3A 4QOXA 4FKVA 4GFOA 4CCBA 1H27A 1U5QA 4DCEA 2NRUA 4P5QA 4YU2A 2C6TA 4MNEA 2C5VA 4OBOA 1HCLA 3LCDA 1JAMA 1M7NA 3HMNA 3NX8A 2VX3A 1OL1A 3H9RA 3KRXA 4ZK5A 4QQCA 5CX9A 3FI3A 3WYXA 3E5AA 4XP3A 2F2CB 4ALUA 4BCNA 2C68A 3I1AA 3NR9A 3D2IA 2OZOA 4LMUA 4D9UA 1OM1A 1XBBA 4Y72A 4LUEA 4ZY4A 3EWHA 3WIGA 5AV0A 2H34A 3KMUA 3O7LD 4KAOA 3SHEA 3ZZWA 3RCJA 2VNYA 4QYYA 4BDCA 2GS2A 3ITZA 4MKCA 4MF1A 4G6LA 5AUVA 3CS9A 5LVLA 3FC2A 4ERWA 2X7FA 5EI8A 3Q04A 2BRHA 4WSYA 2QC6A 1AQ1A 5AUYA 1J7IA 5HCXA 2WTVA 2Q0BA 5HNIX 3K2LA 2J5EA 2P33A 5HU9A 3PLAE 5EH0A 4MHAA 3RPOA 4AZTA 4HGTA 3E64A 5GZ9A 5HG5A 2PVKA 5BVKA 3HMPA 2ONLA 3KMMA 4GVAA 3TIZA 4J98A 3R9NA 3WF8A 5DMZA 3FZOA 5IH4A 3A8XA 4OTWA 1H00A 4XP2A 1XR1A 4ZZNA 4GK3A 3R0TA 3ORKA 3UE4A 3HV3A 4C33A 2QOIA 3PSBA 5JH6A 3V8SA 3EQRA 3EN4A 4XOYA 4FTMA 2VO0A 4F7NA 2XVDA 5FWKK 2VWZA 4ACDA 2X7OA 1B6CB 1ZYCA 2PMOX 3PJ3A 4P2KA 4QT1A 5E1SA 3SKCA 3GCUA 5K4JA 4FNXA 1JPAA 1J3HA 3PLSA 1M17A 5I3OA 4ZIMA 3FMLA 3M11A 3AC3A 3C0GA 3OW3A 1WVXA 3BWJA 4FKPA 5E8VA 3VUHA 4YURA 2EU9A 5ANKA 5AX9A 4EHEA 4EJNA 3U51A 3BGQA 4RC2A 3RWQA 3VBQA 4K6ZA 2YZAA 3VBTA 2RFNA 4EOPA 3VUIA 3R9DA 3DBCA 3BQRA 4R3CA 4YJPA 5M57A 4TYJA 5C8MA 4XG2A 2XH5A 3DLSA 2C5XA 3OVVA 4BCPA 3MFUA 3PXFA 4HPUE 2B9FA 4F6UA 5EW8A 4FI1A 4YJTA 5J9ZA 3ORMA 3BWFA 4BCGA 2WMQA 3BU3A 4GG5A 3OFMA 2GNIA 3BX5A 4JI9A 4M14A 5ETIA 3UZTA 3L8PA 2WQMA 2YM3A 4H05A 5LVOA 3UGCA 3CGOA 5CYIA 2RFSA 1RDQE 2ACXA 2XMYA 2PVNA 3CKXA 3F3ZA 1GIHA 5EFQA 2ZV9A 5IH5A 3HRBA 4EH3A 2B53A 3QCXA 2QD9A 3RTPA 3DNEA 3I6UA 4R1VA 3U87A 3GGFA 3UNZA 5CEQA 2JKQA 3N4TA 5G1XA 4TT7A 3FZTA 4EH9A 2OXYA 5M08A 4FTTA 2J9MA 2UZDA 1LPUA 1W83A 3PY0A 4D4VA 4KSQA 2I7QA 4CFNA 5K5XA 4RRVA 3VF9A 1ZMWA 4UV0A 5BYZA 3CPBA 1BLXA 4PTGA 3D14A 4BDEA 3KC3A 4R7BA 1PMUA 3HV4A 4RT7A 2Y4IC 2Q83A 1APME 3AT3A 3BYSA 3FKOA 3KK8A 4RWKA 3ZONA 1OL2A 3G6HA 4NJDA 1PMVA 3QRJA 5AMNA 3EIDA 3S4QA 4WKQA 2WMXA 4B9DA 3R02A 3UTOA 3D5WA 3DU8A 2HW6A 3AT4A 5JGDA 2BTSA 3RBWA 4EHZA 3R28A 2OF2A 4PRJA 2OLCA 3EZRA 4MNFA 5IUIA 3U4UA 5KKRC 1YI6A 2ZM3A 2O65A 2BVAA 4MQ2A 2UW4A 4C35A 4BGHA 4CV9A 4E20A 4EQMA 4RLLA 3OTVA 4JOAA 4G16A 5A9UA 5H3QA 3QAME 2CKQA 2QG5A 3W33A 3DAKA 4C2VA 1YDSE 4O7NA 5C9CA 4FE2A 2YDJA 4BZDA 5AR7A 2UZVA 5HE1A 4TNBA 4MBIA 3VC4A 4YC3A 5HI2A 2DWBA 2I0EA 1P5EA 5HCYA 3VIDA 3S0OA 1LR4A 1U4DA 4QMWA 3Q32A 4O6LA 1J1CA 4J71A 2PE2A 2GCDA 1H26A 3QUDA 3EH9A 2FH9A 4X2JA 2P2IA 3DJ6A 3P7CA 3POOA 1M2PA 4QNAA 3KVWA 2IZTA 4QP7A 4E26A 4M12A 1QPJA 3VS7A 1BI8A 3R71A 5ANOA 3JVRA 2OIQA 3WF7A 2OFUA 1Q8WA 4EBWA 4PDOA 1KWPA 5IDNA 2WEVA 3OTUA 3R8MA 2R64A 2DUVA 3MPAA 4MH7A 3D9VA 5CZIA 2JGZA 4YLJA 2PZYA 4CRLA 1OGUA 5FLFA 4DGMA 3PG1A 3QA0A 4JBOA 4HNIA 4CG9A 3CD3A 4EHVA 4M3QA 2UZWE 1UKHA 3OWJA 3MESA 2OJFE 5EHLA 3SX9A 3DGKA 3MVJA 3QLFA 4YHFA 2FVDA 2HELA 1FGIA 2X2KA 3R1YA 4IFCA 5DEYA 2R9SA 1CDKA 3EQHA 4QMUA 5ETAA 5FRIA 1U54A 4M97A 4RJ5A 3PE1A 3WF9A 1K9AA 3H30A 3G2FA 1YW2A 2GNJA 2REIA 2WTWA 4JBVA 4GIIA 3H4JA 5CEKA 3ZC5A 3DKGA 1R1WA 3QTRA 1KV1A 2IW8A 3TNPC 5BVDA 1PMNA 4AOTA 4IAKA 3O51A 4LOOA 3VS0A 4UB7A 3MSSA 2XEZA 3Q2JA 3G9NA 4V05A 2XRUA 1OECA 5C01A 2BIKB 2PZIA 1SYKA 3VQHA 4D0WA 4MYGA 4N4SA 3L8VA 3FUPA 3HA8A 5DR9A 3HMOA 4O21A 1H01A 5A6NA 3ZO3A 5M4IA 3IW5A 4FTQA 3FHRA 5CWZA 5M55A 3R6XA 1XH7A 5E9EA 2ESMA 3NRMA 1A9UA 1U5RA 4NH1A 5EW9A 3JR1A 2C3IB 4OT5A 5FXSA 2Z60A 5AAFA 4YLLA 4BY9E 4EOMA 1UU7A 4AZSA 2C0TA 3BYOA 4ACMA 3SRVB 1T46A 4D1XA 4FKIA 2UZTA 4FTOA 5E8UA 4M15A 4A7CA 5H8EA 5IU2A 5KMNA 1JKLA 3QTIA 2ZVAA 3ENHA 4LM5A 4ZY5A 3ATSA 2Y0AA 5JN2A 1YHSA 3B8QA 3NW6A 4AAAA 4PUZA 5CSWA 4JL9A 5AWMA 3QF9A 4RIOA 5AV3A 3DB6A 5IEVA 4FGBA 1CMKE 2VTAA 4G3EA 2XKDA 3SW4A 4AE9A 4GUEA 4EYJA 5AUUA 4FL3A 4FTKA 4DFBA 4BCJA 1YHVA 4NM3A 4PNIA 4CD0A 4D1SA 4H3PA 2ZM4A 4ZS0A 4BTFA 3BE9A 5CF8A 3W2PA 4JDIA 4AX8A 2W7XA 2RIOA 4DITA 2XK7A 2C6OA 2PMIA 1MP8A 3KXGA 4R8QA 4ZSJA 4C8BA 5AUTA 4U5JA 2B54A 5DNRA 4U42A 3MY1A 2JLDA 4ZTQA 3FEGA 4AG8A 1TVOA 1YWRA 4MNEB 1YDTE 4WOVA 3T9IA 5DLSA 4DG0E 2PU8A 3KA0A 2OIBA 3V51A 5HG8A 3EFJA 4FT3A 4IJPA 1HOWA 3UZRA 5E91A 3VS5A 4EJ7A 5E7RA 4GW8A 3E8CA 1FVRA 5M4UA 5JFXA 4HGSA 4RFZA 5A4LA 3KREA 3MTLA 3CCNA 2UW3A 3SD0A 5J7HA 3FSKA 3MI9A 5KMLA 4Q5EA 4BCHA 4QP6A 3F88A 4BDJA 4M7IA 4FEQA 2ITVA 2JDTA 4B7TA 4LI5A 3VBYA 3CR0A 2HWPA 4EZ3A 4DEDA 5CF4A 3PVUA 1VR2A 4CT1A 3QRIA 2XUUA 4H39A 2VUWA 3NW7A 3EKKA 3Q9YA 5CEOA 3FMMA 4GU6A 5D11A 5FXRA 1ZAOA 1R0EA 2YERA 4ZEGA 1QMZA 4OTIA 2X0GA 5CENA 4RZWA 2W4KA 4YZDA 3RPSA 3GU4A 4RLKA 5F9EA 4QQ5A 3N4VA 3BHYA 1H07A 4BICA 3EQFA 3LFDA 2KULA 3RAHA 4Z7HA 4IVCA 2GQGA 3PFQA 3LQ3A 4OBQA 3FI4A 3VF8A 3NYOA 4HCTA 2BZIB 4A4LA 3TNWA 2O8YA 5LVMA 4TRLA 2XF0A 3ALNA 2QI8A 2P55A 3CD8A 3ORTA 4FF8A 4FV9A 2CGXA 4ALWA 4HCUA 5IDPA 2OI4X 3RVGA 3C4XA 4JDKA 1O6KA 2J51A 4RIYA 2Y4PA 1OUKA 3WE4A 3OOMA 4UYNA 5E8XA 2VWXA 5TE0A 2CKEA 1SVEA 1FVVA 5LMKC 3SW7A 5ACKA 5L6WL 1PXLA 3R01A 4PNKA 4OTQA 4FEWA 4ZJJA 1LEZA 4HYIA 4TWOA 3JXWA 1UU3A 1XWSA 1HCKA 4X6QC 4XG4A 3RNIA 3FXZA 2BROA 3DDQA 3F61A 4DCAA 4HVHA 3OXIA 2ZMCA 4FNZA 2B9HA 3ROYA 3BRBA 3MPMA 4HZSA 3RPRA 3GCQA 3OG7A 2R3RA 2YCSA 1JKKA 3F7WA 3Q5ZA 4OR5A 3IOPA 4QP1A 3L1SA 4C4HA 3U6HA 5HVKA 5JQ8A 2OO8X 3GVUA 4GYGA 4EH5A 5A6OA 3QTXA 5BMMA 4LMNA 4E4XA 2WQBA 4MF0A 4MEDA 4ALVA 2HZIA 3QGWA 5AP3A 1JOWB 5ICPA 3CTHA 3Q9ZA 2QOKA 4LOQA 4MBLA 1WAKA 2EXMA 2VGPA 4C4JA 3C4WA 2WTDA 4CKJA 4IX4A 4YO4A 2CMWA 4PTEA 1ERKA 3PXRA 4QP9A 4CMOA 3TKIA 2J4ZA 4L01A 4DEIA 3E3PA 4G5JA 4LYNA 5FD2A 4C02A 3ZC6A 2OJ9A 3TJCA 5A14A 1KV2A 4ANQA 1SM2A 5JZJA 5J79A 3BU5A 4Q9ZA 4U6RA 5HNGA 1VJYA 3GC8A 4P90A 3FYKX 3RCDA 4J8NA 4WRGA 4GKIA 4O81A 4S33A 3HMMA 3GC0A 3MA3A 3SXRA 3F69A 2HIWA 1Q5KA 2GS7A 3A7HA 4W9XA 2UZNA 4DGGA 1OL7A 2X6EA 4PMPA 4JQEA 3GBZA 2VD5A 2OICA 2BRGA 3OHTA 3R7YA 1LUFA 4F65A 2VWIA 2YHVA 4OAUC 2VTLA 4JR7A 2Z7SA 3IQ7A 4XG7A 4B99A 1DI8A 3D5XA 4WA9A 3OUNB 4DEBA 3PJ8A 5EHYA 4QPMA 3BQCA 1Y6AA 4R1YA 1R78A 3QD2B 5DBXA 5AUWA 4GEOA 5FM2A 4TWPA 3TUCA 5BVEA 1RE8A 4ZLYA 2B52A 4KA3A 4FYNA 4BTJA 4FSZA 3R2YA 3IG7A 3NUXA 4TY1A 3ORLA 2I6LA 5CU3A 4FKSA 4QTDA 2PVYA 4HYHA 3U54A 1BKXA 2WU7A 5AP6A 5BYYA 1M52A 4BCKA 3ZZEA 4D0XA 2G2FA 2JC6A 3VS4A 3LMIA 2PULA 3FI8A 2GSFA 2UZEA 4G5PA 4RJ6A 3II5A 3L9NA 5BPYA 1R39A 4IAIA 4D4RA 4FZ7A 5AUXA 3DB8A 2DS1A 4KD1A 4ANSA 1ATPE 2OJIA 2GTNA 2V7AA 3OCGA 3MBLA 4BBMA 3HDMA 2PTKA 3R1NA 3LFAA 4S31A 2F4JA 2HXQA 3S2PA 1M14A 2O63A 3CQEA 4U81A 1UWJA 3QC4A 4Y8DA 4I1ZA 4D2SA 1KUTA 5CALA 4O91A 1Q8ZA 3H9OA 3RALA 2AC3A 4BR3A 5FEEA 3DBQA 2QU5A 2YCQA 5F94A 1OKWA 4X3FA 3Q2MA 1M2QA 5KMMA 3CY3A 2XBJA 3RZBA 4QMVA 2WIHA 5IUGA 2O5KA 4J53A 1QL6A 4FT9A 2VTNA 3PIYA 4J8MA 4C4EA 4FV2A 4RJ7A 3HAVA 1PMEA 4GYIA 2BDWA 4HPTE 3TKHA 5T68A 3LCOA 4DG2E 5L2IA 2C6LA 3C9WA 4FZFB 4FOCA 3ROCA 2YJSA 3VO3A 3VUKA 1GIIA 4ANBA 4TWCA 4DGNA 3ZCLA 3I7CA 3LQ8A 2YIYA 2XK4A 4GK4A 4WHZA 4W4VA 4UN0C 2AC5A 3G15A 4DBXA 3JPVA 1U54B 2YN8A 4XEYA 4C7TA 4U8ZA 3EFLA 2BUJA 1SNXA 1F3MC 3IS5A 3N4UA 3KQ7A 4GH2A 3R9RA 2QOQA 3SXFA 2IVVA 3R73A 4R77A 3ET7A 4YTCA 3QCSA 4YR8A 2W1IA 3VBVA 3OROA 5C27A 2W5BA 2OW3A 4BCIA 4F70A 2IZUA 2CNVA 3FLQA 2CN5A 3ZUUA 4RVLA 4NYEA 2C6MA 2WMTA 4BDBA 1KE5A 3LFNA 2ZDTA 4FIHA 3KGAA 4AGDA 5M44A 1OIRA 3QBNA 1OBDA 3DOGA 4YC8A 2XNBA 3EYGA 3OD6X 4YZCA 2XRWA 2R3NA 2IN6A 3MB7A 4E6DA 4BHNA 4MBJA 4II5A 2WKMA 3G0FA 3C5IA 4F0GA 2R3MA 4C3FA 1JSUA 4R5YA 5JK3A 3QZIA 3MY0A 2W1HA 4TYGA 1NVSA 1PXJA 3FY0A 2R2PA 3UQCA 4LV5A 2C6DA 5LMBA 3ID6C 2PZ5A 1KE9A 3QRUA 2VTTA 4CYIA 2OZAB 4PPCA 2OFVA 3DTWA 3HX4A 2JKKA 4IB1A 2ETMA 4AN9A 4CFFA 5B2MA 2BAQA 3DAEA 3PXZA 5D10A 1IASA 3VBWA 2A2AA 3H0YA 4E4LA 3OS3A 3IDBA 1H1SA 4IMYA 3THBA 5AR2A 4BKZA 3MVMA 4DH7A 4B8LA 3AGLA 3EN6A 3V5TA 1WBOA 1OKZA 2EWAA 4IFGA 4Z16A 5L2WA 4RVKA 3DK3A 2ZMDA 5KCVA 4B0GA 5IKWA 4DC2A 1Z57A 2R0IA 3FMDA 4XP0A 5IISA 3DK6A 4JNWA 5I4NA 3BZ3A 4MWIA 4PMMA 4CQEA 3RK5A 3RZFA 2R3GA 5FP5A 3U6IA 2XBAA 2YCFA 5FXQA 4CT2A 2VWYA 4F1OA 5HIDA 4FV0A 4I4EA 5IA5A 1MQBA 3SOCA 3ZMMA 3BU6A 2XJ2A 3L8SA 2ERKA 4WRSA 2VTPA 3TKUA 1MRYA 4CLIA 4H3QA 2YABA 1T45A 3ZFYA 2R5TA 4IX3A 5CI7A 5I9VA 4QMOA 4ZTRA 3R30A 3R21A 3HECA 3DKCA 4BRXA 4CGAA 3QZHA 3BELA 4NL0A 3S1HA 4XUFA 3BBWA 3SV0A 3DFCB 5F1ZA 4JXFA 1FMOE 4KB8A 4E6AA 3K54A 5IPJA 4A9RA 2XP2A 3DJ5A 4D4SA 2O0UA 4P4CA 3SAYA 3IECA 4O7SA 4F9BA 1XH8A 3KB7A 4TKSA 3ORIA 4I0RA 3TWJA 2OXDA 4FT7A 4AWIA 3BEAA 4DFLA 4YUQA 3U4WA 2GNHA 4FTCA 2WQEA 5EDRA 4O7YA 4APPA 5I9YA 2XM9A 4BZNA 4ZLOA 3BV2A 3QXPA 3BIZA 4RC4A 5FBOA 3PP1A 3KRWA 3ANRA 2WHBA 1OPJA 4FVRA 3W2QA 2R3LA 3AMBA 5CU2A 1Y57A 4UZHA 3UNJA 2C5OA 2GPHA 1OPKA 1ZY4A 2EXCX 4K77A 3CTJA 3E8EA 1PHKA 3QD3A 4QMYA 1TQIA 2VTIA 3LJ0A 5EYMA 4MXAA 5CAVA 1JNKA 5EHOA 3UP7A 3R9HA 4AA4A 3LJ2A 2Z8CA 3UP2A 2JITA 1GNGA 5I9ZA 4V01A 3W2RA 3NWWA 4QMXA 2H9VA 3DFAA 5E92A 1W84A 3QTWA 3E87A 4M69A 2UVZA 1FPUA 3LFQA 1P4OA 3PSDA 2B4SB 3A62A 4QQTA 3I60A 4IVBA 5KMJA 4AN3A 2OJGA 4AA5A 4IIRA 4RIYB 4L9IA 1PXOA 2RG6A 2VN9A 4KINA 1Q8UA 1J91A 4X21A 1YRPA 4FKOA 1I09A 3DA6A 4IB0A 2QHMA 3GU6A 4I93A 4UYAA 5GINE 4FK3A 3ZS5A 3NNXA 2UZUE 4ZSGA 3NLBA 1B39A 3IW8A 3KCFA 3BLQA 4O0YA 3UOLA 5D41A 5HVYA 4R78A 1XO2B 4XNEA 2NPQA 3EYHA 4EOJA 3Q9XA 4GT3A 4PPBA 3VHEA 4YNOA 2W96B 2NRYA 5ETCA 3L9PA 2PMLX 5FDXA 4CFMA 5M06A 2Z7RA 2W4JA 4Y5HA 2IJMA 2C6IA 1OPLA 2OJJA 1Q62A 2G9XA 3E93A 2ITYA 5IF1A 3EFKA 4KNBA 4BB4A 2YM5A 4YJSA 5IA1A 3HV5A 4L68A 4BWKA 1ZOGA 4RWIA 2ZAZA 5L2SA 4IJ9A 4KRCA 5DOSA 1XBCA 4W4YA 2CGVA 3R2BA 4KIQA 4PDPA 2XYUA 3F5GA 5TF9A 1H24A 2WNTA 4YGAA 2HOGA 4CNHA 3O71A 4G17A 4I5HA 4Z3VA 4AGCA 1X8BA 2X4FA 2BPMA 4G6OA 5KZIA 2XIRA 3RPVA 4CTBA 3SC1A 3KRRA 5M4CA 2B0QA 4D5KA 2C5YA 2C30A 2X7GA 1XH4A 2E2BA 5LMAA 3ZM4A 4K2RA 3EQDA 2CPKE 4EKLA 3MW1A 2FSLX 5AR3A 2NO3A 3QQFA 3GU7A 3IONA 2WOUA 3I79A 3AG9A 4E5AX 4QMSA 1SNUA 4I20A 4PTCA 4RX9A 1DAWA 2WMRA 4LUDA 5L4QA 4CZYB 3KY2A 4BTKA 2GNGA 4D28A 2W1CA 3OWPA 4D4YA 1J7UA 3DCVA 2V62A 2VTMA 5LCJA 1SVHA 2WTKB 2PUPA 4DFYA 4ZY6A 2R3KA 4I6QA 4RIXA 3P4KA 2A1AB 3IKAA 4QP3A 3PA4A 3P79A 4I92A 4HNFA 4IWOA 5DG5A 2WQNA 4U3YA 1YXUA 2C3JA 4L46A 3WARA 4FSUA 3TN8A 1A06A 4FSNA 5L2TA 5KMIA 5C4KA 3TDWA 1G5SA 4D2RA 3W55A 4RJ8A 3UJGA 1M7QA 2UZLA 4AGUA 3RNYA 4O2PA 2ZYBA 1REJA 3F2RA 4TNDA 3Q4UA 4ZSLA 4AZEA 4NU1A 5C1QB 4HCVA 5DH3A 2JFLA 3R9OA 4E73A 5HHWA 2BKKA 3MJ1A 3GT8A 2YIXA 2XJ1A 1Q24A 3LFBA 3LAUA 5D1JA 3UO4A 1VZOA 2BRMA 3QKLA 5CSVA 5HBJA 4JVGA 3PPJA 2JEDA 4K8AA 4BTMA 2EUFB 3R7OA 2YIWA 2X4ZA 4LRMA 3H10A 3LW0A 3NZ0A 4XBUA 2Y9QA 1Q8TA 3UO6A 4EOSA 4ZJIA 5AM7A 5TOZA 4I5MA 3ULIA 2HY0A 4GT5A 4IM0A 2BAJA 4QD6A 4FIJA 1W0XC 4JAJA 5KHXA 4QP8A 3O8UA 2AYPA 3LHJA 4IWQA 4C4IA 4OAVB 2IG7A 4GVJA 3G51A 1YOLA 4XMOA 4HW7A 4X3FB 3JUHA 3FQSA 3FSFA 3LFFA 5D7AA 3R63A 3DV3A 4KIKA 1KE6A 2FYSA 1ZMUA 3AXWA 4IQ6A 5HO7A 2VWBA 1ZYSA 3COMA 5AV1A 3QA8A 1FQ1B 3FKLA 4WG4A 3TM0A 4BCFA 3OCBA 3RMFA 1JVPP 3BYMA 3RAIA 4Q2AA 3I7BA 5HO8A 5FTOA 5HE0A 1PKGA 4CVAA 4GKHA 4ZOGA 2CKOA 2V0DA 3AD4A 5DHJA 2WQOA 1CKIA 2ETKA 5AP7A 4FTRA 3CKWA 4E6CA 2G2IA 3F5UA 4ACGA 3K5UA 5BVWA 4BKJA 4N57A 4L8MA 1XBAA 4PL3A 4AU8A 2VU3A 3Q4ZA 4UWCA 4C38A 4U7ZA 2B9IA 4QMTA 3O8PA 3O50A 5I9UA 2QOCA 2VX0A 3ORZA 4QMMA 4ANMA 1UKIA 5KX8A 4OTGA 5AR8A 3L8XA 3CBLA 3GFEA 3PIXA 1G3NA 5A4QA 3V5PA 3FZRA 3ZTXA 4P7EA 5GZAA 2J50A 4J52A 1WFCA 3BKBA 1WVWA 4QMZA 3MYGA 3TUBA 3RWPA 4FODA 3E92A 2WXVA 3UNKA 3LZBA 4M84A 4YJUA 5CXHA 2I40A 4OLIA 4FIEA 3CPCA 5CASA 3CQWA 3C1XA 4XG8A 4FA2A 2RFEA 4I6BA 2PVMA 2Y8OA 2FO0A 3KMWA 3OT8A 5BX0A 1K2PA 4KABA 4YHJA 3A4OX 3FMHA 3F2AA 2WTIA 3PZEA 5TO8A 3LLAA 3OBGA 1XQZA 2XNOA 1H1PA 4KS7A 2BMCA 5AP0A 2JDOA 3W2CA 2UZOA 2ITOA 3GEQA 4OUCA 2FUMA 4X2NA 5JT2A 3HA6A 4U45A 3TL8A
chains in the Genus database with same CATH superfamily
1OL6A 4XYFA 5CAOA 5JSMA 1OZ1A 2UVYA 2CLQA 5JQ5A 4DHJA 3G9LX 3N9XA 3W0PA 1CKJA 4YJOA 2VX1A 3E8NA 4LDTA 5DPVA 2GQSA 4XRJA 5BUJA 2QU6A 5AFVA 1YHWA 3ZUVA 2W1DA 3O0GA 4UEUA 4WO5A 3PE2A 4NFNA 4AP7A 4RVTA 4TYHA 4O82A 2QOOA 2WB8A 5CS6A 3ORNA 4RX7A 4XHKB 3TI1A 3QZGA 2VO6A 1IEPA 4XG9A 4KBAA 1Y91A 4EOLA 5CXZA 4H58A 4F9AA 3W1FA 4DGOA 4AS0A 4RMZA 3C4ZA 3COKA 3BLRA 3QRKA 4JQ8A 4XH6A 5C4LA 4J1RA 2R3JA 3D5VA 1CM8A 4C3PA 3AGMA 4KKHA 3RP9A 4XG6A 4YP8A 1YI4A 3SQQA 5CSXA 1PXIA 2QURA 3BEGA 4EK3A 1GOLA 2JD5A 3EZVA 1OL5A 4LGHA 5IA3A 3RGFA 4ZS4A 3WIKA 2QHNA 4FZ6A 5HX8A 4F99A 5AP5A 2PVFA 2E9UA 1KE8A 1REKA 4D58A 5CTPA 5L6OA 1QPDA 1PKDA 2W99B 3PPZA 4AOIA 4C37A 3PJ2A 5IQFA 1K3AA 1BL7A 2YITA 3BL7A 4FZDB 3LCSA 2CCHA 2OK1A 2OSCA 4QTBA 3VUMA 4BDKA 4G9CA 5HBEA 1Q4LA 3F3WA 2CCIA 4W9WA 4FG9A 1W82A 3BBTB 4BYJA 1YXTA 5C26A 3SGCA 2UVXA 4IZYA 3WILA 3S95A 3TEIA 5KNJA 4UALA 1URCA 4BGQA 5HE3A 2RGPA 3DDPA 4C4FA 2UUEA 4EK5A 3PRIA 4NM5A 4FSQA 2IEWA 1BX6A 3D7TA 4QYGA 5CY3A 3LMHA 3I6WA 3ZHPC 3DKOA 5JEBA 4DT8A 2BFYA 3E63A 3N51A 1DM2A 2JBOA 3KXMA 3K3JA 4QMPA 5EKNA 3U6JA 1OB3A 3BHTA 4QYEA 2ITQA 2J0LA 3UYSA 4I6HA 4JRNA 5GJFA 3DT1A 3I4BA 4ANNA 4NWMA 2JIVA 3WZEA 3MH2A 4Y95A 5M4FA 4ZSEA 3RM7A 4ASZA 4AXAA 3KXHA 3JY9A 3PUPA 5DT3A 4QMLA 4N6ZA 5D9HA 4M69B 4AW2A 4EYMA 4BCQA 4PX6A 4C58A 1JKSA 3ENMA 3LOKA 3I81A 2BFXA 3GQLA 5DIAA 1XH6A 5DYJA 2I0VA 2WMUA 3QWKA 5C8NA 4EOOA 2C47A 3NEWA 4J96A 4U97A 3VQUA 2CNQA 4D2PA 4F0FA 3TZMA 4L52A 3UOJA 3EMGA 3PTGA 1IA8A 3QCQA 5EDPA 3HAMA 2C1AA 3O8TA 5CT0A 3MWUA 3IO7A 3M2WA 3ZH8A 4W4XA 3LM5A 2OBJA 3CGFA 2QKRA 4TL0A 3WYYA 3HUBA 4W8EA 4LFIA 1OIYA 3Q52A 4GCJA 4IAAA 4IVDA 4KBCA 2WMAA 1JQHA 4YZ9A 3DXPA 1IRKA 4UMRA 5D7VA 5F95A 4ASDA 5IQIA 4IEBA 2E9VA 3BYVA 3E62A 5E8YA 3PWDA 4DEGA 4BDFA 3WZDA 1F0QA 2XM8A 3PVGA 3LXLA 4K11A 1J1BA 1AD5A 4W8DA 4BIBA 4L7SA 3QQKA 3BE2A 2YFXA 4U40A 4BN1A 5CANA 4L3JA 3IPHA 5LMKA 3QD0A 4BI2A 4IC7A 4ZMFA 4JX3A 2RL5A 4ACHA 3GENA 4OW8A 1PW2A 5TKDA 1Q41A 1WBPA 2XJ0A 3P5KA 4HZRA 4IHPA 3COIA 2BDJA 4NJ3A 4UMQA 3NAYA 2R3IA 3VW6A 3GC9A 4A07A 4WD5A 5FEDA 3HV6A 2HZ4A 2G2HA 4EH4A 3PA5A 3T3UA 2FSMX 5JRSA 4YZMA 3U9NA 4FV1A 2XIXA 4IX6A 2W9FB 2XNNA 3WOWA 2XIZA 3ETAA 4IACA 3A8WA 2CN8A 3CIKA 4MVFA 4EKKA 2HXLA 5EOBA 3A61A 3PY1A 3A4PA 4R6VA 2R4BA 2WIPA 4IM3A 2O64A 4DTBA 2XCKA 4GJ3A 3KXZA 3NAXA 2CDZA 3A7GA 3FZ1A 4FKTA 4NEUA 1E1XA 2PVRA 4KKGA 3TNHA 4C2WA 3FLSA 3AMAA 3VS2A 5ETFA 3O7LB 5HNBA 4Q5HA 3POZA 1ZXEA 2IZSA 2R3OA 4RVMA 4O83A 4CTCA 3BGPA 1FOTA 5EQEA 1LEWA 3NYNA 4RIXB 5CVFA 4EHGA 3I5NA 1KSWA 3NS9A 5GHVA 5IQDA 2V7OA 3NCGA 4UWYA 3QCYA 3HRFA 5M53A 2O2UA 3MDYA 3FLZA 2OXXA 5M56A 4WIHA 2GTMA 1OIUA 4ORKA 4BIDA 3QKKA 4TXCA 3NUUA 1H28A 4APCA 2JAVA 3MFSA 5A54A 4YNEA 1UNGA 1NXKA 1ZMVA 1V0OA 5CAUA 4UMTA 3C4EA 1PF8A 3NNWA 3B2TA 3ZXZA 4KBKA 3PFYA 3CJFA 3QLGA 3W16A 2XK6A 3RI1A 1H4LA 2ZV8A 4XRLA 4AN2A 2C69A 4PL4A 4JAIA 5I5ZA 2VWWA 1W2FA 5K5NA 3QYZA 5DEWA 5I9XA 3AKLA 4TWNA 4CEGA 3IOKA 5L6PA 4CMTA 3KIOC 2WD1A 4RA5A 1NA7A 3EL7A 5AP4A 3BCEA 1GAGA 4EOQA 5CSPA 2ITWA 4F7LA 2XYNA 3RM6A 4F1MA 4IADA 3Q96A 4R7IA 3R8ZA 2ITXA 2BKZA 2HY81 3MS9A 4YZNA 5KKRB 2W1EA 2QCSA 2JBPA 4LG4A 1G8SA 4UMPA 5EK7A 3VRYA 5C03A 4AT5A 3Q3BA 4CSVA 2BHHA 2WGJA 3SXSA 2LGCA 2OG8A 2WPAA 4FTAA 4G34A 3NNUA 5AR4A 3ML1A 5J1VA 5ANGA 4JT3A 2CGUA 2XIYA 2QKWB 4YPDA 5E8WA 2IPXA 5GJGA 1MRUA 3ZRMA 4C4GA 4RG0A 2Z02A 4N70A 3KF7A 4C0TA 5JGBA 4KIKB 4L53A 4X7QA 4PV0A 4FUYA 3LMGA 3S00A 2BTRA 4WNPA 3SOAA 4EK6A 4ANOA 2PE1A 2FB8A 3PRFA 4PWNA 4IVAA 4O6EA 3V6RA 2EXEA 2HWOA 1OKYA 5E90A 3V5WA 3D7ZA 2OKRA 4O7WA 3I0QA 4D9TA 4F09A 2GMXA 5K4IA 1QPEA 3BGZA 2PHKA 3Q5IA 3MFRA 4DBNA 4DN5A 1KOAA 3LVPA 3R8LA 3LXPA 3TUDA 5TR6A 4EZ7A 2R3HA 4HOKA 5G6VA 1ZRZA 1H1QA 3FV8A 3OWKA 3QL8A 4HVIA 3LKMA 4IDVA 4EK4A 3ORPA 3UC4A 4E7WA 4FT5A 3R83A 5DRBA 5CSHA 2CNUA 1KOBA 3TDVA 2JKOA 3QU0A 3GNIB 4IB3A 4YSJA 4QTEA 3R8PA 1VEBA 4O1OA 4PQNA 2X9FA 4CLJA 1UNLA 5CEMA 2GNLA 4O7ZA 3Q4TA 4PY1A 3F82A 4JIAA 1ZY5A 4FICA 2GFSA 3V6SA 2YLFA 2JIIA 3PA3A 5DN3A 3E7OA 5CU6A 4WG3A 1WBNA 5DRDA 1PJKA 2BDFA 4F7SA 1IAHA 2RG5A 2PVLA 3ZDIA 1WBSA 4L42A 4NZWB 3F3TA 4FMQA 3OY1A 3TMOA 2UW5A 2W05A 4IM2A 4R7HA 1JLUE 3OP5A 3OW4A 4UBAA 3EKNA 4YJVA 2GQRA 4OTRA 4LL0A 4WT6A 4BYIA 2XZSA 4E5BA 5BUIA 5J9YA 3COHA 3NSZA 2BR1A 4LV7A 3AD5A 4AA0A 4LGDA 4FGRA 4C3RA 4A4XA 4XV9A 3AC4A 4WUNA 4BJJB 4JR3A 3C4CA 3NMUF 2B1PA 4I5PA 5BNJA 3VUDA 2Z7QA 4PDYA 3FQEA 2I0HA 3IDCA 5A4TA 4CFWA 4WSQA 4ASEA 4FZAB 3PWYA 3RPYA 5KUPA 1P14A 5DVRA 2XNGA 3TZ8A 2W5HA 3BHVA 2YM7A 4AACA 1R0PA 4LGGA 4O86A 5DT0A 2E9OA 5IH6A 2OF4A 1QPCA 4IWDA 4TYHB 4CCUA 1FVTA 2F2UA 4FV3A 2UZBA 4BDDA 3MV5A 2UW0A 3NFGB 3F2NA 4A9UA 3NYXA 4CFVA 3KL8A 3QALE 5IQHA 2JKMA 2GFCA 4DAWA 3FI2A 3L9MA 4EWQA 2CKPA 4JDJA 5BVNA 2J5FA 1DI9A 4Y83A 3E7VA 1ZLTA 2C0OA 2C6EA 2VGOA 3GCPA 4FIGA 2QODA 3PZHA 3IW6A 1FGKA 3P08A 5AA9A 3QC9A 3F5XA 3PSCA 4FUXA 2QO2A 3FPMA 3I0OA 4I41A 5D12A 4BCOA 3PPKA 3W18A 4IBMA 4GL9A 5T3QA 3FKNA 4FVQA 4IDTA 4IH8A 3IW4A 2YM8A 2PSQA 4J97A 4HVSA 4X3JA 4I6FA 4JMQA 4HGEA 3L9LA 3ZO2A 4CV8A 5I3RA 1WCCA 4DE4A 3AQVA 4MXYA 4DFUA 4X2FA 3RKBA 1ZOHA 3NW5A 4EK8A 5A46A 4HVGA 2J0JA 4NM0A 3GQIA 4L43A 1O9UA 1XH5A 3EN5A 1NY3A 2ITZA 1CSNA 3MVHA 4NCTC 1EH4A 4PMTA 2R7BA 3A7JA 4IX5A 4RPVA 1AGWA 4PMSA 3DBDA 3D7TB 4MAOA 5H8GA 3V5QA 2JDRA 4O4EA 2ZB1A 4G3FA 4RX8A 5IEYA 3SLSA 2PUUA 4JS8A 4ONAA 3FAAA 2PMNX 3FPQA 4FKGA 1OIQA 4F9WA 1O6LA 3JYAA 4MD7E 2A27A 2X81A 1BL6A 5IG1A 2SRCA 3AOXA 3QTZA 3CP9A 2VWUA 4I24A 3QQLA 4O0RA 1GY3A 4EQCA 1UNHA 4QDVA 4JBPA 3VJNA 5JMSA 4YTFA 5EQYA 4L3PA 3G90X 3PDTA 3KFAA 4FIFA 4DTKA 5CF5A 1Y8GA 3PXKA 2YAAA 4BHZA 3OCSA 5CI6A 2YM6A 3LM0A 3QUEA 3UDTA 4F64A 3NVMB 5EYDA 5IMEA 4ITHA 1Z9XA 2IVSA 4AOJA 3FXWA 1JBPE 2QOLA 5FM3A 3IK3A 3DTCA 2F49A 5ANDA 4MK0A 1ND4A 5AP2A 1BMKA 4E3CA 3D2KA 1L3RE 3JY0A 5GIOE 1Q97A 3UBDA 3BHHA 4DINA 3FZSA 1H1WA 2DYLA 3KCKA 4BDIA 3JS2A 3UODA 2PZRA 2V55A 5GJDA 4E4MA 1JKTA 1W7HA 3MIYA 3DNDA 4FTLA 4U3ZA 3ZFMA 5CAPA 3NUNA 5HLWA 4IZ5A 5M51A 4RSSA 3KVXA 4A9SA 5KMOA 4F0IA 2PZPA 2ZDUA 3PXQA 4MD9E 3UQFA 3SG8A 4L3LA 4K1BA 4XBRA 3ZFXA 5IQEA 2W9ZB 4DTAA 3F5PA 3TZ9A 1NVQA 3VWAA 1OGYA 3NPCA 2Z7LA 5FTGA 4I0SA 4G9RA 2JDVA 2XKCA 3R8UA 5J87A 3ANQA 4FKUA 3NCZA 4TN6A 1PRYA 4FV8A 3EJ1A 3VUGA 4G3GA 4U44A 4Q9SA 3OY3A 5A3XA 4YBJA 5BYLA 2WO6A 4S34A 3OEFX 3V5JA 4AT4A 4CYJA 4EUUA 3GUBA 4OT6A 5HLNA 4GMYA 5IQGA 1P4FA 4FL2A 4X6RA 5KE0A 4MCVA 4K33A 1CKPA 2VTHA 3UO5A 5HVJA 2XK3A 3KU2A 3FYJX 4LOPA 5B7VA 2H96A 3FC1X 4YSMA 3GOKA 3CQUA 2C6KA 3FBVA 4WUAA 4M8TA 2BZHB 3DJ7A 3HVCA 4UZDA 1B38A 2VTQA 4N6YA 5B2KA 3TV4A 5DI1A 3U9CA 2IO6A 3KRLA 4DDIA 4KKEA 3TNIA 5HTBA 4U9AA 5IUHA 4FNYA 4WNMA 2IZRA 4QYHA 1TQPA 3Q4CA 4F9YA 1WBWA 1W98A 2W1FA 3EQIA 3HRCA 4I21A 3V8WA 1YXVA 4EH8A 5CQWA 3GB2A 3PY3A 4G31A 4GJ2A 4BI0A 1H08A 4IAZA 1V1KA 4M0ZA 3WF6A 4E4NA 2JAMA 2QOFA 2QO9A 5H8BA 1Q99A 2WMSA 4AZFA 3A99A 3SDJA 2ONLC 3EQPA 2C5NA 4KS8A 2G15A 4USDA 1OBGA 2DQ7X 3DBEA 4FC0A 4EORA 3HKOA 2A98A 3ORXA 1Q3WA 4NKAA 3GCSA 4NSTA 4JX7A 4E93A 4FNWA 5FBNC 4YTIA 2XNPA 3RINA 4KIPA 2BCJA 2X8DA 3BPRA 3W0QA 5CEPA 4Y46A 3DQWA 3ZSHA 3KULA 4OGRA 2P4IA 4A9YA 3DAJA 4JJRA 5CQUA 3V5LA 4ARKA 3F66A 3IW7A 3QTQA 4BF2A 2VTJA 2YACA 2G01A 2ITNA 2VWVA 1GIJA 2GDOA 2VRXA 5E8ZA 2ERZE 4FL1A 4D55A 5HG9A 4G1WA 2AUHA 4FV5A 3W2SA 4ZTMA 4DEAA 5FQDC 1L8TA 2XNEA 4NW6A 3ZU7A 2QR8A 4F6SA 4ZZOA 3TT0A 4EOIA 5CAQA 2YDKA 3Q53A 2QOBA 3VN9A 5T6KA 4AGWA 2W0JA 4J7BA 3ACJA 4L6QA 4PF4A 1UV5A 5K0KA 4CFUA 4BGGA 3LQ5A 4I6LA 3NUPA 3P1AA 5AIKA 3ZO4A 5GIPE 1VYZA 4FTIA 4AXCA 3QQGA 5EG3A 5FDPA 1FMKA 5EYCA 4O2ZA 2BZKB 3GFWA 4HJOA 4JBQA 3QGYA 2NNWB 2CGWA 3MJ2A 4GRBA 3HUCA 2FSOX 3QKMA 4GV1A 1Y8YA 2WAJA 5KHWA 3FQHA 4RJ3A 3RAKA 1H1RA 2QLQA 3NUYA 2C0IA 4TTHB 3W32A 4MXCA 3TJDA 4CZUA 3DZOA 4H1MA 4GG7A 4O0SA 1YWNA 3WZJA 4ITIA 1I44A 4AT3A 3ZLXA 2HW7A 1Q8YA 3A7IA 4WNOA 3PVWA 3RAWA 3ZYAA 3W8LA 4H36A 4W4WA 3P0MA 4XJ0A 4CRSA 4DH8A 4JIKA 4HYUA 4DLJA 4ZMEA 5CLPA 3ZXTA 4I22A 3EQCA 4LRKA 1VYWA 3BLAA 3A2CA 1IG1A 3PJCA 3VHKA 3O2MA 3SA0A 1RW8A 2PK9A 2X8EA 1O6YA 4BDAA 3B8RA 3QQHA 3UVQA 4RIWA 5C8KA 2CSNA 2J0IA 2RSVA 4FSYA 5GZ8A 3FMNA 2YIQA 2GNFA 5JZNA 3TTIA 4YJQA 4A9TA 2JDSA 3G5DA 3DKFA 3O17A 4S2ZA 4EONA 5IZFA 3GU5A 3FLNC 3NYVA 2PE0A 3ACKA 3P7AA 2E9NA 4YBKA 2OH0E 2HZ0A 3KKVA 3Q6WA 3R1QA 4OTDA 3V8TA 4GU9A 2NP8A 3CEKA 3VBXA 1FINA 2BRNA 3UQGA 3HGKA 1H0VA 4UX9A 1RQQA 3QTSA 4QYFA 5DFPA 5J5TA 2GS6A 1PYEA 2P3GX 4Z9LA 3D4QA 1JSVA 4FYOA 1CTPE 4H1JA 4IXPA 1V0BA 4K0YA 5AM6A 4EBVA 3G33A 5EM7A 2PPQA 3HP2A 3PJ1A 5J8IA 2C4GA 4V0GA 2GHLA 4OTPA 4OBPA 3ZLSA 4E6QA 5JFWA 3UDZA 5EM5A 2GHGA 3QZFA 3LXKA 1YWVA 4BWXA 5M07A 1UU9A 3CE3A 3MY5A 3QD4A 4YO6A 3UVPA 4CMUA 3NVKI 2X6DA 5GNKA 3HL7A 2XKEA 4PPAA 2ZJWA 4AAYA 5HCZA 3CXWA 4BWPA 4O0WA 3DY7A 2YM4A 4ZP5A 4XV1A 3IGGA 1H0WA 4O38A 1NT2A 5EM8A 3QXOA 5CVGA 3UDBA 3JVSA 5HESA 4S32A 1Q61A 4OTFA 3ATTA 5IQCA 1PXMA 5AA8A 5CF6A 3OT3A 4AXFA 4KWPA 3OZ6A 3VONA 5FP6A 4NIFA 4U79A 2NYAA 4BCMA 4USEA 1WBTA 2F7EE 4KRDA 2P2HA 2WMBA 4N0SA 3ODZX 4F9CA 4ZJVA 5AAGA 4F08A 4RA4A 5CU0A 4I5CA 2V22A 3LFEA 4XG3A 3CY2A 4U80A 2PY3A 3CLYA 3TACA 4QRCA 3F7ZA 3ELJA 5AX3A 4CKRA 3OEZA 3W0SA 3ZBFA 4EH7A 5EDQA 4FR4A 5IA0A 2F9GA 5AV4A 4IAYA 4ACCA 5HORA 3RJCA 4BFMA 3R7IA 4O96A 5LOHA 4I3ZA 2QNJA 5IQBA 1A48A 4NK9A 3MTFA 3KRJA 3NUAA 4AW5A 4FT0A 3GCVA 5HTIA 4QNYA 4JG8A 4YJNA 3TTJA 3QX4A 2EVAA 4BDGA 1KE7A 2I1MA 3VRZA 4JG7A 4TPTA 5EOLA 4AE6A 2OIDA 2IVUA 3GU8A 2QQ7A 3K3IA 4TW9A 4FV7A 3HV7A 5DWRA 1OVEA 3LPBA 4I23A 4ANLA 5CNOA 2YWPA 2HYYA 3ZEWA 3BHUA 2WTJA 2PUIA 3DQXA 4DLIA 1BYGA 3PYYA 4M67A 4QP4A 4ERKA 4O27B 4GFGA 4E5WA 5B0XA 4CKIA 5HBHA 2BHEA 4L7FA 5K9IA 2ZFYA 3TV6A 4MUQA 2QO7A 4EC8A 4F6WA 5DE2A 1YXXA 2Z2WA 4UWBA 4QP2A 3ZLYA 4WBOA 4D1ZA 3LXNA 3OWLA 4F4PA 5BUEA 5LWNA 3HLLA 4O7VA 2ITPA 2PWLA 5BMSA 3VW8A 4WBBB 5CT7A 4ZSAA 1GJOA 2VTSA 4KIOA 4TZRA 3ZUTA 5JFVA 4QMQA 2VZ6A 2GU8A 3GP0A 2OGVA 1Y6BA 3WF5A 4FSRA 1BUHA 3FMKA 2PVHA 1WMKA 2QR7A 3HP5A 3TXOA 2WELA 4FEVA 3MH1A 5I9WA 2H8HA 2J7TA 4NUSA 2WU6A 2JFMA 4YLKA 5FEQA 3TZ7A 3KK9A 5J1WA 1G8JA 2IWIA 5AUZA 4CG8A 4LL5A 1MRVA 4RJ4A 4XCUA 1QCFA 5K3YA 2JIUA 3AT2A 3UVRA 4CFXA 4D2VA 5AADA 3UYTA 2HAKA 5JFSA 4RX5A 2OZAA 4FTNA 2YWVA 4GK2A 5IMXA 4L45A 5ANEA 4FKQA 4G6NA 3QX2A 1GZKA 3ULZA 4BVUA 1YXSA 3MIAA 3S3IA 1UU8A 4DYMA 5DR2A 5J5SA 4I4FA 3I5ZA 2H6DA 4YC6A 3O5AA 3WBLA 1UVRA 4RQKA 3KXNA 3OCTA 5AEPA 5HIEA 1V0PA 3Q9WA 5HG7A 3EOCA 3U8WA 4O0TA 3VAPA 3VJOA 2YIRA 3C0IA 4U43A 4BI1A 4EI4A 3C4FA 3LE6A 2CLXA 4C34A 2YLEA 3H0ZA 3UPZA 5HU3A 4NKSA 4EH6A 2J90A 3LCKA 4LQMA 2IW9A 5TT7A 4XX9A 3ZOSA 4O7RA 3NUSA 3WI6A 4USFA 1U59A 1WBVA 3UZPA 3EFWA 2VTRA 5DGZA 1XHAA 4ZLZA 4U0IA 4H3BA 5FGKA 4XLIA 5HKMA 3W0NA 2FSTX 3D15A 3GOPA 2B9JA 3CTQA 4X2GA 4X2KA 1W8CA 2LAVA 4MXXA 5J7BA 2FA2A 4BBEA 3OXZA 2CHLA 3W0OA 3FMJA 2IW6A 2J0KA 5KBQA 5CVHA 3C0HA 3UOHA 4FEXA 3QUPA 4NM7A 3UOKA 4AUAA 5LJJA 3H3CA 4DA5A 4M66A 1FBNA 3HNGA 4D5HA 1NW1A 1YDRE 3C51A 5HLPA 3MFTA 4D2WA 3P7BA 3IDPA 4J95A 4ZXTA 3UMXA 4RFYA 1URWA 3IGOA 4ID7A 1UWHA 3VULA 1WZYA 4ENYA 4RC3A 5AR5A 5EI6A 1S9IA 3ZO1A 3ZM9A 5EW3A 5LXMA 5IQAA 5EKOA 2CJMA 4ZTHA 5E8TA 1LP4A 4UXQA 5AJQA 2UV2A 4FVPA 1Z5MA 2YZLA 4O7TA 1DS5A 3D83A 3MPTA 3NIEA 2XNMA 3LFCA 5DR6A 4G3DA 4WNKA 3EB0A 2ITTA 3VUTA 4L44A 4NFMA 1JWHA 5HQ0A 1YVJA 4ZTLA 1ZOEA 5LVPA 5KBRA 3D5UA 4YHTA 2UW6A 3BI6A 1IAJA 3FXXA 4MXZA 1G8AA 3UC3A 3RK7A 4JRVA 4X0MA 1GZOA 3LCTA 3FJQE 4IB5A 4EUTA 2P0CA 4IZ7A 3QYWA 2Y6MA 1R3CA 4O0XA 3NIZA 2PL0A 4C62A 2F7XE 5BVFA 2XIKA 3GI3A 4Y73A 4EOKA 4GT4A 2X8IA 2XS0A 4I0TA 5DT4A 5L8LA 3DS6A 2YEXA 3OC1A 5AAEA 3AC1A 3E8DA 3R00A 2RKUA 1RJBA 3LJ1A 3QHRA 4EQUA 2X1NA 3WZKA 4MTAA 3FL4A 3KULB 1E9HA 4R5SA 3LFSA 1J7LA 3EQBA 3ERKA 1YQJA 4AZVA 2OU7A 4XS2A 5HD7A 3T3VA 2C3LA 3UMWA 4M0YA 1OITA 2XK8A 4R3RA 2Y6OA 3LIJA 5FG8A 3OBJA 2XB7A 1STCE 2BAKA 2R7IA 3EQGA 3RHXA 3CSVA 1GZ8A 2B55A 2UW9A 3REPA 4YJRA 1IR3A 2VNWA 4A06A 2VAGA 3AD6A 2ITUA 5AIRA 3TIYA 5HD4A 3GXLA 2ZOQA 3BLHA 4ASXA 4PL5A 2W17A 2BZJA 3OXTA 5HOAA 3AC2A 4BC6A 2XK9A 4IE9A 3O23A 4QPSA 3OF0A 4CQGA 2A0CX 1PXPA 2YISA 4C61A 4KUJA 5L8KA 2Y7JA 2YCRA 2W1ZA 1PY5A 2XCHA 2UW8A 4DG3E 3OOGA 3A7FA 1ZWSA 3HEGA 1OKVA 2Y4IB 5CU4A 4DFZE 3R7UA 3WZUA 4GFMA 4B4LA 4MXOA 2XANA 2WTCA 2W5AA 4XV3A 4L67A 3ZSIA 2HZNA 1F5QA 3QQJA 4FTJA 4QPAA 1BI7A 3P78A 2ZV7A 4EZ5A 5KZ0A 4PP9A 1ZZLA 2VV9A 4QTAA 4NT4A 3W8QA 2F7ZE 4BJJA 4JDHA 4EEVA 4D2TA 1YKRA 4J99A 2QONA 5BVOA 5ANJA 3DXNA 2G1TA 3R04A 3R1SA 4TYEA 4DH1A 1TKIA 2FGIA 2V5QA 4DH5A 4FOBA 3ZSGA 4XOZA 2ETRA 4JQ7A 1XJDA 4RIWB 3DBFA 2X2MA 3MH3A 4RBLA 2PYWA 5HO6A 4HVDA 5HGIA 4ENXA 3C7QA 3EHAA 4QMNA 4EWHA 4IZAA 4QO9A 3VVHA 4DFXE 3FL5A 5K0XA 2YAKA 3B2WA 3KXXA 3CJGA 3QFVA 4CXAA 4KSPA 2WTKC 5HE2A 5F4NA 5LARA 5IA4A 4MD8E 1YI3A 3FY2A 4IW0A 4FKRA 3ZRLA 5E8SA 3VS3A 2J6MA 4C57A 2W06A 4DT9A 3NDMA 3AMYA 5HX6A 4B8MA 5L3AA 2QLUA 4V0GB 3EN7A 3HZTA 4NTSA 2X0OA 3UIBA 3ZRKA 4U41A 3RHKA 4BBFA 5LCKA 3Q6UA 3U55A 3W2OA 4AFEA 1Q3DA 3KF4A 2XKFA 3FHIA 4K18A 3ZLWA 3DLZA 3UIMA 5ITAA 3NNVA 3ZBXA 4AXEA 4FSTA 3HDNA 4JG6A 4IC8A 3GC7A 3P23A 3DZQA 2WMVA 4O1PA 1XH9A 4LV8A 5F20A 3W10A 4DEHA 2VTOA 4AQCA 4AZWA 3C50A 2QG7A 2WEIA 4FKLA 4RZVA 3ZEPA 4NTTA 3T9TA 4EL9A 5LWMA 4FJVA 4IAFA 3KN6A 3UIUA 4DEEA 4JLCA 4UY9A 4NIFB 2WFYA 4RQVA 4V04A 2YDIA 3FE3A 1SZMA 2EB2A 1GZNA 4GIHA 3MH0A 4QQJA 3TV7A 3NGAA 2BRBA 4RWJA 4F1TA 1W2DA 4GSBA 5L2QA 3QWJA 4GUBA 3UIXA 2QOHA 3Q60A 4YTHA 2OWBA 4E1ZA 5J9LA 3EN9A 2HK5A 1NVRA 2XEYA 4ZAUA 4X3FC 3KEXA 2ZM1A 3QTUA 4BIEA 3UPXA 3F3UA 4BZOA 1DAYA 5HTCA 2WMWA 4PDSA 3DK7A 3R7EA 2RFDA 4AF3A 3QHWA 3O96A 2HCKA 5IEXA 4FEUA 2VO7A 3R8VA 2C1BA 4P5ZA 3FZPA 4FBXA 4R3PA 5B2LA 4BDHA 4IANA 3G0EA 5J95A 3ZDUA 3LLTA 1WVYA 4B6LA 5LVNA 1TFFA 4TYIA 3FLYA 4AFJA 4FKWA 4Y85A 5H2UA 1OUYA 3MN3A 3PIZA 1MQ4A 3ALOA 3FDNA 5A4CA 4E8AA 4HYSA 3VNTA 1ZARA 3FMEA 4UMUA 2R0UA 5JGAA 3D0EA 3HMIA <