4LRJA

Bacterial effector nleh1 kinase domain with amppnp and mg2+
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
163
structure length
160
Chain Sequence
RLSVPGNVIGKGGNAVVYEDAEDATKVLKMFTTSQSNEEVTSEVRCFNQYYGAGSAEKIYGNNGDIIGIRMDKINGESLLNISSLPAQAEHAIYDMFDRLEQKGILFVDTTETNVLYDRAKNEFNPIDISSYNVSWSESQIMQSYHGGKQDLISVVLSKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Effector NleH1
publication title NleH defines a new family of bacterial effector kinases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 51
structure length 160
sequence length 163
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4lrjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4lrjA01
4C2WA 2H34A 2ITZA 2W05A 1OGUA 2R7BA 3NX8A 3R8LA 3NR9A 4QMQA 3E62A 4RA4A 1M17A 3BGPA 5I4NA 1R78A 4XV2A 3LFEA 4HYHA 1FOTA 3ZMMA 3F82A 2E2BA 2QKRA 2WQEA 5DOSA 3POZA 3ZSIA 1DM2A 5IQDA 4GL9A 4O0VA 4AN2A 4EK8A 2DUVA 5CXZA 5I3RA 5T3QA 3VULA 3F9NA 5LMAA 3TTIA 3NUAA 4QQ5A 1RJBA 2BIKB 3P23A 4NKSA 4P90A 4TY1A 4C4IA 1ZYCA 2J5FA 4ZP5A 2W17A 4RFYA 5EOLA 4ZOGA 5J1WA 1WVYA 3OXZA 3KGAA 4EEVA 2BILB 2PYWA 2QOQA 4H3BA 4WNOA 5K5NA 4CMUA 3Q32A 4F0FA 3BWJA 4P5QA 4ASDA 1APME 2ZB1A 3QLFA 1P4OA 3BYVA 2VWWA 5DT4A 3JR1A 5D7AA 4ANOA 3LCDA 2WTIA 3MPTA 4IE9A 2YIWA 2IW6A 5AFVA 4M7IA 2XIRA 2YIYA 3PP1A 3MS9A 3N4VA 1ZZ2A 4I1ZA 3BI6A 4FV1A 4DEIA 3ORZA 2BRMA 3DXPA 1PYXA 2QKWB 4J97A 3PFQA 3EYGA 4XUFA 4DYMA 4LQMA 4RJ4A 5IISA 1NVQA 4JQEA 5HTCA 4XJ0A 4ZS4A 4DH7A 2QI8A 4QMYA 4YZBA 2E9VA 3PJ1A 3A62A 1YDTE 3R21A 4FK6A 5FTOA 5TOZA 4AT4A 3ZO3A 3E63A 3K3IA 4G6NA 5CAOA 4KWPA 5H3QA 2WKMA 4K9YA 2CCHA 4D9UA 4TNDA 4YC6A 4E5WA 1WBWA 4EOQA 3V51A 5F20A 2VTAA 2VN9A 3CPCA 2XF0A 2F7EE 5DH3A 5HQ0A 1XQZA 2IZSA 3SAYA 3NYOA 2EXCX 2YCFA 4XOYA 4CV9A 2QOHA 4E73A 4J96A 5DRBA 2BRGA 2YABA 4GFMA 4K6ZA 4LI5A 3GU8A 5M44A 3RK7A 4O91A 4YP8A 1OL6A 4YUQA 3VUHA 4BTKA 3AC1A 3DTWA 3GXLA 3BLRA 1VJYA 4FV0A 4NZWB 4AW5A 1GIJA 3DB6A 3I5NA 2G2HA 3Q4CA 1JSUA 2OK1A 3RP9A 5GIPE 1NXKA 3R73A 4R3RA 2B4SB 2CN5A 2HIWA 5CQUA 3IKAA 3JPVA 4AW2A 2W1IA 3DNEA 3I4BA 4FIJA 4EK5A 5J9YA 3ENHA 3F66A 3VBTA 4GK2A 4IB1A 1OIRA 5JH6A 2W1DA 3E88A 4O84A 3CCNA 4M66A 2XK8A 1OBGA 2PUUA 5M09A 3O8UA 4KS7A 4X2JA 4KAOA 4L9IA 4U80A 2GNGA 3C50A 2B9IA 4TN6A 1BMKA 4FC0A 5E91A 5BMMA 5AJQA 2OI4X 2J9MA 3QXOA 3IDCA 3P08A 1GZKA 3OT3A 1Q8TA 2HCKA 2VTSA 4L53A 5CS6A 5E8VA 5HCZA 4FEWA 3T8OA 1TQMA 4JAIA 2XNMA 5I9UA 3S3IA 2PUNA 3QQLA 3I6WA 4TYIA 1OL7A 4XG7A 3VO3A 3QA0A 1SNUA 1VYWA 5AAEA 5JGBA 3VBVA 2ZM4A 2C6DA 1OL5A 4FKPA 4I6HA 5IUHA 3M11A 4KRCA 4C33A 5CAVA 3FC1X 5JFSA 4ZTMA 2C6OA 4FTJA 4II5A 2QONA 2DS1A 4D2SA 2ZM1A 3HEGA 3HMOA 2OWBA 2UVZA 3R1NA 5EM7A 2VNWA 4TYHA 2SRCA 3H9RA 4H36A 3MY1A 3NCGA 3EH9A 3F5PA 1PF8A 2WTCA 3F3VA 3D2IA 3Q5ZA 4FNWA 4H3PA 2QLQA 4M0ZA 5HO6A 4ALUA 2R3RA 4NM5A 1Q99A 3EFKA 4U3ZA 5ICPA 1W83A 4KKEA 1JKKA 5AAFA 2R4BA 4Y8DA 4FL2A 5C1QB 1YW2A 2WGJA 2GS7A 2J4ZA 5IH4A 1W98A 3RNYA 5E8XA 2NRYA 3BU5A 3R1QA 3E64A 1Y6BA 5JZNA 3PUPA 3D4QA 3VS4A 4AE6A 1S9IA 4UMUA 3HLLA 3NNWA 4A7CA 5IEXA 4HJOA 4AOIA 1YDRE 1PXMA 3EMGA 2W0JA 2OFVA 4FK3A 4FT0A 4RX7A 4CD0A 3E5AA 5CVGA 2QODA 2Z2WA 2YM7A 4F6WA 2C0OA 2OZAB 4AGUA 4HVDA 2R64A 5C01A 1DAYA 3II5A 4F7JA 4EH4A 3HZTA 5EI8A 2WOTA 4JRVA 2PHKA 4ZTQA 2JITA 5HO8A 2JIVA 4XX9A 4F65A 2X8EA 4HCVA 3QQKA 4GVJA 4ZTLA 2QNJA 3IS5A 4QMWA 4CGAA 1UNHA 2VNYA 3FKNA 4L3PA 5E92A 4ZK5A 2VGPA 3R00A 3R7OA 5JEBA 4DT8A 4EUUA 2R0IA 1PMEA 4FEXA 3C9WA 4YJRA 3BYUA 3VUKA 1V0OA 3QXPA 5JT2A 3DA6A 1O9UA 2RF9A 4EH5A 3F2NA 4S32A 4EUTA 2BKKA 5I9VA 2C5YA 3UNKA 4R7BA 1Q8WA 3G90X 4KABA 4AAAA 4CTCA 2VWYA 2QC6A 2I0YA 2JKQA 3I81A 3A7HA 3VVHA 4EBVA 3R2BA 4FR4A 4C58A 4DEGA 4D2TA 2WAJA 3ORIA 4U5JA 4AN3A 2IZRA 2VU3A 3OTVA 4CFWA 5CNOA 4DAWA 4B0GA 3LFCA 3KRJA 2V22A 2WTWA 2XNNA 3BELA 3KA0A 4W9XA 4A4LA 4Z7GA 4RA5A 5HORA 3PJ2A 4C2VA 1KOBA 4HNIA 1UWHA 3OEFX 4NL0A 3O8PA 5EQYA 2JIUA 4K8AA 3ZC6A 2ONLA 5EHOA 5DFPA 2BZKB 5HE1A 2UZDA 3D9VA 5C9CA 3TWJA 5FEEA 3BIZA 4DGNA 4XP3A 2RFEA 5H2UA 5I0BA 2UW7A 4NM0A 4QMUA 5AX9A 2UZEA 5F4NA 4IZ7A 4QMXA 3RPYA 5HI2A 4GKIA 4CKRA 2YCSA 5D1JA 2BROA 3QZIA 1J1BA 5JK3A 5FBOA 5CX9A 2GS2A 4F0GA 4RSSA 3GNIB 5D7VA 3MV5A 5I9WA 3ZRMA 3ZZWA 3HP2A 3I7CA 2JKMA 4IJPA 3COHA 4ERWA 3IK3A 3ZONA 4YJNA 4C4GA 5DEWA 4BIEA 3OOGA 4KD1A 4EOKA 2HZIA 2ZV7A 2Y0AA 3HV5A 3HAVA 3ENMA 3TNIA 2H96A 2PZRA 4FSTA 5AA9A 4BZDA 4J95A 2JFMA 3DB8A 5CSVA 5AWMA 4WD5A 5CEQA 3ZM9A 2GU8A 3UOJA 3RMFA 1ZMUA 4D4YA 2O0UA 5DHJA 3HUCA 3TCPA 4ZLYA 3PPJA 1Z57A 1ZMVA 1WMKA 2P2HA 3R63A 3CY2A 4ANNA 5BYYA 4I41A 3FZOA 1H8FA 3AC8A 4XYFA 4AA0A 5AUUA 2BVAA 2VX1A 5HX8A 4KB8A 5HE0A 5J8IA 2JKOA 4MAOA 3MPAA 4EZ5A 1UV5A 3KC3A 3F3WA 2OW3A 4X6RA 4OBQA 3Q53A 5HBJA 2Z7QA 1I44A 2CGWA 1YQJA 3SRVB 2V62A 2YM3A 4RWJA 3NRMA 3QTIA 4MX9A 3OG7A 5EG3A 3WF7A 2CNVA 3RK5A 3O51A 3VBQA 3ZLSA 2OJGA 1A06A 1UU8A 2IVUA 2HZ0A 3QU0A 4RIWA 3ZLXA 5FP5A 3FPMA 3CJFA 3KXGA 4NM7A 5BYZA 1WBTA 5AP5A 4CFXA 4O0YA 2C6IA 4YHFA 5CSPA 1KV2A 3NNXA 3KK8A 1Q8ZA 3PIYA 4ACGA 3I7BA 2VTLA 2YDIA 5FP6A 3NW5A 3TG1A 3CY3A 4PUZA 3FL5A 5IU2A 3Q2JA 2PY3A 2Y6MA 1YRPA 4Y46A 4ZEGA 4E26A 5FDPA 5HD4A 2XYNA 3LQ8A 5CI7A 5HLNA 5JQ5A 1WBSA 3ORTA 4GW8A 5IH6A 2VTOA 4EH6A 3DY7A 2EXMA 2Y7JA 3A7FA 3FZPA 4L7SA 4Y5QA 3RI1A 3EFWA 5J5SA 4FTIA 4IW0A 3NS9A 2QQ7A 3OW3A 4JBQA 1NVSA 5EHYA 2C6LA 4F6UA 3HX4A 3K5VA 2GQSA 3AC3A 5L2QA 3COMA 4EJNA 2CN8A 3FMJA 3QF9A 4NKAA 2OZAA 2VWUA 2R5TA 4IEBA 1YHSA 4MNEB 5HG5A 2I0HA 3V5TA 5FXRA 4EZ3A 2C6MA 4XBUA 3MIAA 2ZM3A 4F6SA 4FSNA 5M53A 4I94A 3A8WA 4KBKA 3UMWA 3FMMA 3BE2A 4MF0A 5AP3A 4A4XA 3C4FA 4G34A 3KXHA 4FTOA 1YXXA 4GUBA 3FLQA 3P78A 4TRLA 4PMSA 4DEAA 4FT9A 4I5PA 4D4VA 4HGEA 3FJQE 4IXPA 4XH6A 2XYUA 3GQIA 4HOKA 4QMLA 4X3FB 5CEOA 4R78A 4ENXA 4W4WA 4W4VA 5IPJA 2P55A 2WPAA 2YN8A 4G31A 1H1RA 1M2RA 1PJKA 2EXEA 3VUMA 2C6KA 2QLUA 1B39A 4MF1A 2ZMDA 3FPQA 4LUDA 3OXIA 5BUIA 2G9XA 2XIKA 3OUKA 2ITOA 4EOOA 4XRLA 3R7YA 1WBVA 3FLZA 1G5SA 2CLQA 5CSXA 2Z02A 2GHGA 4J71A 4EC8A 1XBCA 2CHLA 1M2PA 4CFFA 4O7VA 1GNGA 3UIBA 2A0CX 2G2IA 2YEXA 3CSVA 4AOTA 4L45A 4XG9A 1XHAA 3I6UA 4UB7A 5TKDA 3E3PA 2DYLA 3UC3A 3D5VA 4GK3A 3SW4A 3WE4A 4ANBA 2E9PA 4M8TA 4NIFA 3NUXA 2RSVA 3VJNA 4LUEA 4WBBB 5BVFA 3Q9YA 2PE1A 2UZLA 2XKDA 5AR7A 4IH8A 4JIAA 3TEIA 4IAZA 3VNTA 3CTQA 3UODA 3ZC5A 3QCQA 3DV3A 4I5MA 4S33A 5DIAA 4EJ7A 2JAMA 3F61A 3OTUA 4O22A 3W16A 3DGKA 4ZJJA 4AZVA 1H25A 4YTIA 3VW6A 4EYJA 5J9ZA 4FKJA 3Q2MA 4GYIA 4GSBA 3UVQA 1KUTA 3NDMA 4GRBA 3DJ7A 4MD7E 4PWNA 3RCJA 4RJ5A 3UNJA 3UOKA 2PMIA 2V55A 3ZFMA 4AACA 1JKTA 3AD5A 4NJ3A 2ZYBA 5A4TA 2YM6A 4BCMA 5CU0A 2B0QA 4OR5A 3EQFA 3I0OA 3D83A 4C62A 4D1XA 5EI2A 4PNKA 4PF4A 3DPKA 3BCEA 1X8BA 2ETMA 4FV4A 3ERKA 4RGJA 1Q3WA 3RKBA 5EW9A 3PY3A 3VUGA 2OJ9A 4NJDA 2OZOA 3P79A 3NW7A 3Q52A 5L6OA 1R3CA 4DTAA 1HCLA 3S0OA 1NY3A 5AR5A 3C0IA 4F7NA 3V5JA 4Z3VA 3FUPA 4DH5A 4WRGA 5I9YA 4ZJIA 4TYGA 5CU6A 2VX3A 3NUSA 4LYNA 4RT7A 1FVVA 2JIIA 2RFDA 4JJRA 4ZSLA 3SRVA 3UQFA 2XKFA 3FKLA 2OF4A 4QQTA 2UUEA 5GZAA 5E8TA 3EN7A 2BZHB 4BRXA 3D7ZA 3OT8A 4F0IA 3F2AA 4LV8A 5G1XA 2ITQA 1YI4A 1MRVA 4BKYA 5KZ0A 3R8PA 3FQSA 5IMXA 2QO2A 2WO6A 3LVPA 4TWOA 3PXQA 4B4LA 5F1ZA 4N6YA 3T9IA 4R7IA 4J53A 3CPBA 3U6JA 4RWIA 4E1ZA 2R3GA 4NEUA 5C4LA 3ELJA 3PZHA 2PULA 5CY3A 5IA5A 1CSNA 3HUBA 3QZFA 3UZPA 2O63A 5IA3A 2X7GA 3AT4A 3QCXA 5DGZA 3W2QA 5CAQA 2Y4IB 3TIZA 2R3MA 2R3FA 1XH5A 3DKCA 4ZY5A 3WARA 4EOMA 2XA4A 4WSQA 4ACMA 4BDDA 5E9EA 3HNGA 3D2KA 2A2AA 4U41A 4L00A 4BCOA 2C1AA 4EWHA 3S95A 5IA4A 2I40A 2X4ZA 3LM5A 3EB0A 3U6IA 3A7IA 3ZO1A 1T45A 3F3ZA 3FSKA 3JS2A 2H8HA 3UO5A 2R3HA 2V5QA 3Q04A 1U54B 3BHYA 3RALA 1JSVA 2VTHA 4OLIA 3FMEA 3SC1A 3QFVA 4PL3A 3THBA 4FTMA 2W1HA 5IUGA 5HU3A 3PDTA 2R0UA 2B9JA 4MNEA 3V8WA 3EKNA 5FXSA 4PDSA 3LFQA 4UBAA 5LWMA 2WTVA 2X8DA 4BBMA 2REIA 2X0GA 5CTPA 2YITA 1B38A 1Q97A 3TKUA 5BVOA 3BHUA 4UV0A 4DFBA 3FE3A 5ETCA 4OTPA 2OIQA 4OTDA 4TNBA 4U9AA 2OIBA 3DS6A 3B8QA 4QYGA 1LUFA 1ND4A 1U46A 4I4FA 4GMYA 4L44A 5EDPA 2VZ6A 1E1XA 1CKJA 5ETFA 3WIGA 4KA3A 4BFMA 1CKPA 4X3FA 2F4JA 2OO8X 2IWIA 4RWKA 2XK7A 4DITA 3PJ3A 4KIQA 4YSJA 1TQPA 2FVDA 3QLGA 2JFLA 3QD0A 4R7HA 2OIDA 4MD9E 5CENA 4ANSA 4BCHA 5CANA 3TZ8A 2NNWB 4Y72A 3A4PA 3JY0A 4CZTA 3M42A 5L8JA 4CKIA 1SMHA 4DT9A 3C4ZA 1Y57A 2OFUA 2VTRA 2GNFA 3JY9A 4LGDA 5LVLA 3ATSA 2XKCA 3AQVA 3EQDA 3O17A 4C0TA 4JDKA 4JOAA 3TUBA 3WOWA 4FGBA 2R9SA 5AR8A 1CTPE 3BYOA 5EM5A 3TKHA 3ZFXA 4O81A 4AUAA 4ZMFA 5FBNC 4FEQA 4XG8A 2WELA 3KCFA 3OF0A 3NGAA 3ORXA 3T3UA 3QL8A 3QRTA 2YA9A 4LOQA 4QMNA 3QUDA 2XZSA 2CDZA 3ZYAA 4FGRA 5HE2A 5HVJA 3R8MA 3G9LX 3QCSA 4YJVA 2IN6A 4FZAB 1KE8A 1CM8A 4HCUA 4DEEA 3ANRA 5IQBA 4YPSA 2PZ5A 3OUNB 4O2ZA 5C8MA 3ZXTA 4HPUE 1IEPA 3A7JA 2CGVA 4TL0A 4XBRA 3AGMA 4AGCA 4JDHA 4PP7A 4FTLA 3R28A 1UU9A 3EFJA 4I4EA 3OZ6A 4PTCA 4QYYA 2YDKA 3OMVA 5E7RA 3RM6A 2XEYA 4FZ6A 4GT4A 4PMMA 3CGOA 4ASEA 1STCE 4DH3A 1JKSA 1U59A 5EFQA 2JBOA 3G6GA 5F9EA 2O3PA 3QQUA 5I3OA 5DR9A 2OICA 4FSWA 5CF8A 2OBJA 4WBOA 3ZO2A 1LR4A 4AZFA 5FTQA 4BCPA 3WILA 1A9UA 3LHJA 4QT1A 4RBLA 5HBEA 3HL7A 2BDWA 5HG8A 1OVEA 3UP2A 4FV7A 4G5PA 4QTDA 5E8SA 1L8TA 3BGQA 4FNXA 4GJ2A 2QU6A 3H10A 1FPUA 4FTUA 2XJ2A 3CQWA 4IWQA 4ALWA 2GQRA 4B7TA 3FMHA 1BX6A 5EYKA 4CNHA 3VIDA 4YLJA 1REKA 2WTKB 2C0TA 5CZIA 1FBNA 4DN5A 5B2KA 1SVHA 2J5EA 4NWMA 4D9TA 3FBVA 2W9FB 3VS6A 3FC2A 1QPEA 4FV3A 4AA4A 5EHLA 3FY2A 1QPJA 2VWBA 3QBNA 5DI1A 3RHXA 4FUYA 1J3HA 4BY9E 4Z7HA 3DT1A 4ZLZA 3EKKA 1GJOA 4R8QA 3O71A 1ZXEA 3DQWA 3QQFA 4DEBA 5E4HA 2W96B 3BQCA 3EQRA 3TNPC 4GJ3A 2UW0A 3CKWA 4MD8E 4U45A 2VWXA 5EH0A 2XNEA 3VUTA 4FTQA 4HVGA 5AP0A 3GBZA 2YIRA 3AOXA 1XR1A 5A14A 2HZNA 4X3JA 5J5TA 4MEDA 4QRCA 3ANQA 3PIZA 4V01A 4BCQA 2PVHA 5A4QA 3AXWA 2C5XA 1WVWA 1Q24A 2ITYA 3T9TA 4ZJVA 2BIYA 3O2MA 3AC4A 4QQCA 3LFDA 4L6QA 1PY5A 4QPMA 5FM3A 5HNGA 3UO6A 3H9FA 4BDJA 3OBGA 4NW5A 3AMAA 1OPLA 1U54A 2J0KA 4BVUA 3FKOA 1BI7A 2XRWA 5A4LA 5JZJA 3R9RA 3FZTA 4Y5HA 4E6AA 2J90A 4E8AA 1UA2A 4QP7A 5F94A 3H30A 4IZAA 5I9ZA 3VS5A 5DT3A 3QRKA 2ZV8A 4ZY4A 4MWIA 2PVYA 2QO7A 4V0GA 2IVSA 4YBJA 3BRBA 4ENYA 4APCA 2XK9A 3D15A 4BWPA 4Z55A 4C7TA 3VW8A 4PQNA 1BL7A 4AZEA 3C0GA 1W0XC 1Q8YA 4I6FA 4JX3A 1J7UA 4FT5A 5AUVA 5CWZA 2GFSA 1DS5A 3NYVA 5FGKA 3EQIA 4FIEA 5CQWA 4DBNA 2ZB0A 4Q5EA 2OLCA 4K11A 4O7NA 3MSSA 4UWBA 1QCFA 5AIRA 2G1TA 5H8BA 4S31A 4FTRA 5L6WL 4AE9A 4ORKA 3OVVA 4QMSA 4V05A 4DF3A 3TV7A 3R8VA 2XP2A 3UDBA 2VX0A 3TNQB 3SD0A 1MUOA 1PKGA 4FG9A 3QD4A 4E4LA 1W82A 5AR2A 1H24A 2BTRA 3NEWA 3POOA 3PLAE 3PXZA 2IVTA 1WBPA 2R3LA 3E8CA 3NZ0A 2X9EA 4M68A 4ARKA 3W32A 2XM9A 4DGMA 3HV6A 4BTFA 5DN3A 4AP7A 5IQHA 5DPVA 3FZRA 4I21A 5G6VA 1XH8A 3COIA 3PG3A 5HHWA 4F08A 3TM0A 5D41A 4FKGA 3OP5A 5CU4A 1BLXA 1WVXA 4YURA 5IA0A 4D5KA 3ZS5A 3EOCA 3OFMA 4BDBA 3BYSA 3RHKA 3ZU7A 3CE3A 3OBJA 3QD2B 4JT3A 3WZJA 5DRDA 3GCQA 4AW1A 3W18A 4I22A 4LOPA 3BLQA 5TO8A 4FZDB 5LCJA 4E5BA 4CFNA 3UPXA 2CKPA 3VS3A 4CCUA 4YU2A 4LV5A 1H01A 4KRDA 2I0VA 3FQEA 1YXTA 2F2UA 3WYYA 2ZOQA 4CTBA 3BZ3A 3MGYA 1IAJA 5B2LA 4EHEA 3KU2A 4QP1A 5IA2A 4PL5A 3GOKA 4U43A 2KTYA 1OIYA 3GU7A 4QMTA 2PVRA 3VHKA 3LLTA 4AGWA 3PRIA 3BV2A 3CD3A 3GFWA 1CDKA 4DFUA 2HZ4A 2O5KA 3OEZA 4JBVA 3LE6A 4YLKA 4MYGA 3QKKA 4U0IA 4ASXA 3WI6A 2YLFA 5J7BA 2BR1A 3VRZA 2OH0E 4RIWB 3ZCLA 1UU3A 3QTXA 4O0RA 3CQEA 3CQUA 4JR3A 4YSMA 3S2PA 2X9FA 3NNUA 3O0GA 1O6KA 3DU8A 4H05A 3R1SA 1CMKE 3SXRA 4A06A 1G8SA 3KF4A 3AD6A 4FKSA 4YTCA 2WU6A 3OW4A 4ZIMA 4H1JA 4ZZNA 1P14A 3CC6A 4OAVB 5JGAA 4CZUA 5B0XA 1REJA 1WAKA 4XEYA 3QYZA 2ZV9A 3E7OA 2IZTA 4PPCA 4PTGA 4TYJA 4QOXA 1Y8GA 3MFTA 3SDJA 2R3IA 5HKMA 1ZRZA 3VJOA 2J7TA 1OMWA 4DG2E 3IO7A 4YC8A 4DA5A 4M97A 3IW5A 3ORKA 2JBPA 2WMBA 3MYGA 3H3CA 1XO2B 4XHKB 4G17A 4GEOA 3N4TA 2BUJA 4CG8A 3VC4A 2GNJA 1FGIA 2GFCA 4CRSA 2W4JA 3Q96A 2YACA 5M4UA 4G9CA 4FSZA 5A6OA 4M13A 5K3YA 3W33A 5M07A 3PY1A 4B8MA 5CZHA 4M0YA 3ZH8A 1O6LA 4G3GA 4EH9A 4O7WA 1GAGA 3AT3A 2R3OA 5CU3A 1AGWA 2BAKA 2V0DA 5A6NA 3GVUA 3GC8A 2X6DA 1OZ1A 3HMIA 1MQ4A 5BNJA 3EJ1A 2X2KA 3ZTXA 4CZYB 5AP1A 3ZZEA 3ZSHA 3NAXA 5A3XA 1YOMA 2WMWA 5F95A 4C34A 4EORA 3QHWA 5ANEA 5GZ9A 3E8DA 3I0QA 5HVYA 3OCTA 2HW7A 2WQBA 3QC9A 2HAKA 4IVAA 3ID6C 4JQ7A 2QOCA 4GT5A 4OTRA 4UMPA 3QHRA 2PPQA 1H26A 4GCJA 3NVKI 1SZMA 5DNRA 3LPBA 4I6QA 5D11A 2QOIA 3R22A 1FGKA 2VTJA 3Q4TA 1KWPA 3BHHA 4YZMA 4D2WA 5AUZA 5AUWA 3QTQA 3WYXA 4FKLA 4UXQA 4B99A 4EOPA 1YI3A 1Q41A 2UZUE 3A99A 3FMLA 4PP9A 4YJSA 2JKKA 3E92A 4XLVA 3SX9A 4CXAA 2WOUA 4USDA 4R5YA 4KSQA 3LMHA 4USFA 3OOMA 2QHMA 3ZOSA 4L46A 5HTBA 2HELA 4C4HA 4FV9A 2O64A 1KV1A 2ACXA 4NIFB 3PLSA 3UQGA 4ERKA 1ZOGA 2UV2A 4EOJA 3RVGA 3F7ZA 3F3TA 3GC9A 3KL8A 3DBEA 4XG3A 4W4XA 4YO6A 4ZSEA 3V5LA 4F1TA 4AS0A 4R5SA 4GU6A 4GV1A 4O7SA 2WEIA 4AZSA 5GHVA 3LKMA 3WF5A 2CKOA 2XJ0A 4L8MA 3D5XA 3TI1A 3F3UA 1P4FA 5KBQA 4QMZA 3LCTA 3DKFA 5HNBA 4NU1A 4ZTHA 3W8QA 4KINA 4DH8A 2OKRA 3V6RA 4EKLA 5A4CA 3HV3A 4O0UA 4DTBA 2F7ZE 1KE7A 5CF4A 4DG3E 3IECA 4GVAA 2I0EA 2OF2A 2JLDA 3MH2A 4O0SA 4J8NA 4E6QA 3JVSA 3RZBA 4CRLA 5HNIX 3MB7A 1SM2A 1TQIA 5ACBC 3UVPA 2GMXA 4J99A 4BDIA 3BPRA 4C37A 2VTIA 2QHNA 3P86A 3UIUA 4A4OA 4IFGA 4QNYA 1XBBA 1UKIA 2C3JA 1YWNA 2QOLA 3K5UA 4M3QA 4U44A 4IM3A 3UYTA 3VRYA 2XNOA 4C4JA 4RX5A 4BI0A 4TYEA 3RM7A 2PZIA 4PMPA 4OTHA 1BYGA 4ZLOA 4XV1A 3KXXA 5CSWA 4QTEA 4PL4A 3IG7A 3R71A 3D14A 3NAYA 4BBFA 3P1AA 3OWJA 5HZNA 2YFXA 2R3NA 4BI1A 2ZVAA 3G5DA 4O1PA 3SXSA 4NUSA 4WT6A 3IDPA 5CEPA 2YERA 4APPA 3R8ZA 4NYEA 3TZMA 3Q9ZA 1GIHA 5CAUA 3QCYA 2XNPA 3BEGA 4PX6A 3SG8A 3LXLA 1GIIA 4I93A 3RWQA 4HZRA 2CKQA 3EQHA 4WNPA 3UMXA 4JXFA 5AUTA 4BDHA 2O8YA 3EN9A 2ONLC 2VTPA 3ORLA 4G3CA 4F9YA 3RPSA 3VN9A 3SVVA 2PSQA 4E4MA 4IX4A 4KIPA 5KKRB 4EWQA 2VD5A 4NTTA 3S1HA 5JSMA 3PSCA 4FTNA 2QG5A 4IZYA 2QVSE 3NYNA 3U87A 3HECA 4ZZOA 5AEPA 2HY0A 4E6DA 4HNFA 4KNBA 4YJQA 4LL5A 5LARA 4O96A 2B1PA 5CEKA 2H6DA 4IVBA 1M14A 4F09A 1U4DA 1JOWB 2C5NA 2GNLA 2IVVA 3W2PA 4OTIA 3PE1A 3RPRA 2XJ1A 1NVRA 5BUEA 4C36A 4L68A 4FSRA 5AADA 2WU7A 1JKLA 5EDQA 5C03A 4MHAA 3ZUTA 3OCSA 2YLEA 2QU5A 3TT0A 5EOBA 5BPYA 4EH2A 3CTHA 5HICA 2R3JA 4FYNA 3BBTB 3RJCA 4ZAUA 2PVJA 5J7HA 3PJ8A 3MJ2A 4QP4A 4FKIA 5CNNA 4Y95A 4IADA 3R9NA 3TDWA 5GJGA 4JVGA 4MH7A 5TR6A 1WCCA 3PTGA 3K3JA 4NT4A 4YNOA 4BGGA 5L2IA 4P2KA 1PKDA 3ITZA 1XKKA 3PIXA 4G3FA 4N4SA 1XH9A 3PXYA 3ZEWA 3QTZA 4QTCA 3L9MA 4IX3A 3WZDA 5J9LA 5ETIA 4CYIA 5IQCA 4ANMA 4C3FA 3JXWA 4U3YA 3CS9A 4O0XA 1URCA 3FYJX 3I5ZA 5EYMA 5CEIA 2PK9A 3WF9A 2FSLX 3JUHA 3K2LA 4G6LA 1WBNA 2IJMA 4GYGA 1W84A 4H1MA 2P3GX 4YJPA 5JRSA 3TKIA 5J79A 2P2IA 2UZTA 3P0MA 3LOKA 4G2FA 4U79A 3BEAA 3DNDA 3DK3A 1YWVA 3P5KA 3R04A 4FV5A 3LAUA 4RQVA 3EL8A 3O8TA 4FG8A 4LRMA 3CD8A 4NCTA 3DOGA 5DE2A 2B54A 2BTSA 3G6HA 3R7EA 5ITAA 3G0FA 2IZUA 4J98A 4FSUA 5HCYA 1IG1A 3KRXA 4O7TA 2VTTA 2JDOA 1JVPP 2BHEA 3BU3A 3PVGA 3WZKA 2ETRA 3GUBA 4DFZE 3NUUA 5DMZA 4IDVA 5HVKA 4FIGA 2AC5A 5K0KA 3ETAA 4NSTA 5K0XA 4NK9A 5C27A 4AXAA 3QC4A 4BCKA 4BHZA 3TUCA 2FGIA 3QYWA 2UZNA 3UOHA 4FOCA 5J1VA 2Y4PA 3E7VA 3KXMA 4U40A 4FYOA 4Y85A 5HD7A 3R7IA 3HMMA 3ZSGA 2OJFE 5ANDA 2FB8A 5T6KA 5EK7A 5DWRA 5EI6A 3F69A 4I0RA 4FKUA 3IW6A 2OSCA 4FV6A 3Q3BA 4A9YA 4EK4A 3RGFA 3S4QA 2RIOA 3LLAA 3DKOA 5EW3A 4KBCA 4O38A 5D9HA 2ITTA 3GCUA 3O7LD 3TTJA 4BWXA 3C4WA 1TVOA 3A60A 4HGLA 4R3PA 3R7GA 4BCNA 1FINA 2JEDA 4M12A 4DHFA 4FBXA 4HVIA 4RFZA 4UMQA 1H0VA 3R9OA 4CQGA 3IONA 4FUXA 5HU9A 5LVOA 3MFUA 3Q4ZA 2ZV2A 5LMKA 4U97A 1J91A 2R2PA 5KHXA 3UE4A 3PXKA 4WOVA 4RQKA 4DTKA 3UIMA 5EKNA 3A8XA 4X6QC 4PMTA 3NPCA 2JC6A 4OT5A 4PTEA 5FWKK 5KX8A 4EQCA 3U4UA 3MB6A 4WNMA 2X8IA 5FXQA 4EOSA 3HDNA 3UZTA 4EQUA 3MFRA 4BBEA 4YJUA 3DLZA 4FNYA 4LRJA 2P33A 2IO6A 1OBDA 3NLBA 5BVDA 2VTQA 3A7GA 3NIZA 3FMNA 5T68A 3DJ5A 3LM0A 3HMPA 3EN5A 3N9XA 3C0HA 4JR7A 1LEWA 2PZPA 4TW9A 3UJGA 4B6LA 2C47A 5CYIA 5L8LA 3ULIA 4EYMA 1XH7A 4XG4A 5K4JA 3HVCA 3UBDA 4LG4A 4FOBA 4YMJA 3MH3A 2OH4A 3RAWA 2C5VA 3B2TA 3CIKA 3LJ1A 4IAYA 3BX5A 3FWQA 3LFFA 4RJ6A 4UXLA 3R7VA 2R3QA 3PSBA 4UY9A 4ALVA 4X2NA 5KMIA 3U4WA 3QUPA 1R0PA 1YWRA 4XG2A 5EKOA 3GU4A 5AMNA 5FUTA 4AFJA 2AUHA 3R0TA 5KNJA 4O21A 2QG7A 3CTJA 2A4LA 2VV9A 3BHTA 4JG6A 1PHKA 4BGHA 5HGIA 3FMDA 3DZQA 3KEXA 3A61A 2HY81 2X81A 2PMLX 3ACKA 2B9HA 4HYIA 5AV3A 4L01A 2XRUA 3G2FA 3PE2A 4Y83A 5BUJA 3HA6A 3BHVA 5IKWA 1BL6A 3PVBA 2YAKA 4K77A 5CVFA 5EDRA 3FMKA 3AG9A 4O0TA 4FVQA 4C3PA 2C5OA 4Q9SA 5FTGA 2VWVA 1LEZA 1M7NA 3ZUVA 5M51A 1W8CA 3LZBA 4ZTRA 3PG1A 1AQ1A 3U8WA 4YGAA 4W4YA 4IAKA 4DLIA 4D28A 1W7HA 1H1PA 1UWJA 3DAJA 4RX8A 4V0GB 2HWOA 3HMNA 1PXPA 4BICA 2W1ZA 4Q9ZA 3FY0A 2OXDA 4DEHA 2CKEA 5AR4A 1IA8A 1WBOA 2VO6A 4FNZA 3EQBA 4D2PA 4UWYA 2QR8A 2BALA 5EYCA 4ACDA 3GU6A 5AP7A 2ITPA 4A07A 4F64A 4H39A 3MVHA 5L2WA 3EQPA 5TF9A 4DINA 1OKWA 1OECA 4I5HA 1IR3A 4IBMA 2PE2A 1FQ1B 2P4IA 3ACJA 1GOLA 1FVRA 2J50A 4FKQA 4UEUA 5CSHA 4BTJA 3LJ2A 4OAUC 2HYYA 1ZYDA 3ROYA 5JFVA 2YJRA 5JRQA 4CCBA 1RW8A 4QMPA 4A9UA 4HW7A 1XH6A 3HV4A 4WSYA 3SOCA 5IZFA 4ZTSA 2JDVA 2CNUA 3LXKA 3LW0A 5AV2A 4IFCA 4AT3A 5BMSA 3LFSA 3GEQA 3M1SA 2Z7SA 5BVKA 2YAAA 3NUPA 1A48A 3ZXZA 4BB4A 4X2KA 1DI9A 4JRNA 2QURA 1V0BA 4IAFA 2VTMA 4JS8A 5HG9A 2C3LA 2XBJA 5AA8A 5AAGA 4O7ZA 3PPZA 3O7LB 5A4EA 4IJ9A 4PV0A 4DFNA 4F7SA 3KRLA 3F5GA 5GJDA 1YHVA 2BZJA 3EN6A 4O0WA 4UZHA 1OIUA 2YM5A 3LFAA 1ZYJA 3NCZA 5AP2A 1G3NA 4GH2A 3U9NA 4EZ7A 4JG7A 4L52A 4PPBA 3V5PA 3SG9A 4R1VA 4D55A 3VQUA 1YI6A 3PPKA 4YJTA 4IVCA 1J7LA 4L43A 4RVLA 4O82A 3Q4UA 2YZLA 4EQMA 4FF8A 5M57A 4O7YA 2VAGA 2Y6OA 3NYXA 1JSTA 3FDNA 4HYSA 4FZFB 3G15A 5BVWA 1NW1A 3OY3A 3U9CA 3HP5A 4XCUA 3QZGA 3I1AA 5C26A 3GB2A 4AWIA 3Q6UA 1BKXA 3ULZA 3FXWA 4C3RA 2CSNA 5DT0A 4K2RA 3UYSA 3SW7A 4D2VA 1UNGA 2X2MA 3PWYA 4NM3A 1UVRA 4ZXTA 3DKGA 4XP0A 3GCPA 4WG4A 4U6RA 1M7QA 1YDSE 4KUJA 3V8TA 1SYKA 4S2ZA 2UVXA 4WUAA 2V7AA 4RZWA 3GGFA 3I79A 3PVUA 2B7AA 2XK6A 5HEZA 2BAJA 2PL0A 2Y9QA 1JQHA 1YOLA 3KMMA 4RJ8A 3SKCA 4JL9A 4MK0A 4WKQA 3V04A 2E9NA 4RJ7A 2BCJA 4BYJA 1ZYLA 4K18A 3VF9A 4C4FA 2W99B 4PDPA 4CT2A 4RIOA 3OCGA 4X3FC 3QAME 3DTCA 4RIYB 4E6CA 4U42A 4IX6A 3MI9A 4HCTA 3UP7A 4YC3A 2IW8A 3AMYA 3VF8A 2WMRA 4FKWA 2FSOX 4MXOA 3FI8A 1S9JA 4D4RA 4ITJA 3ZDIA 3C4EA 3ORPA 3MFSA 3QTSA 4EH7A 4MXAA 3NUNA 4AOJA 4C61A 4E4XA 3G51A 4N57A 1TKIA 4XMOA 1Z9XA 3R02A 3GC7A 2XIXA 3TDVA 2OXYA 3V5WA 4HYUA 4XRJA 2GNIA 3FSFA 3IOPA 5JMSA 4R1YA 4UN0C 1R0EA 4JNWA 3OCBA 1U5QA 1PXOA 3MVJA 4DCAA 3HAMA 4LMUA 3DFCB 3TZ9A 2GTNA 3FXZA 3WIKA 3LCSA 4J52A 3FQHA 2QR7A 2C0IA 3KB7A 2C6EA 4MNFA 4WG3A 4DFYA 2ITUA 3TNWA 2YM8A 2XVDA 4QO9A 4I3ZA 2HWPA 1UNLA 5LXMA 5BQ0A 3VS2A 3R2YA 4EC9A 1UU7A 4LM5A 4F1MA 2WMTA 5CEMA 1OPJA 5JFXA 4GG5A 3L9NA 1M2QA 5B7VA 2NRUA 5BVEA 1KOAA 2F49A 2X1NA 3MTFA 4A9RA 2PUPA 4I0TA 2XB7A 5AR3A 4BI2A 1DI8A 4RX9A 4ZTNA 3DBCA 4BTMA 4JIKA 4FI1A 2WMUA 2G15A 3L8PA 3MVMA 5C8NA 4AA5A 2FSTX 2BRNA 2JDSA 4CKJA 3CKXA 4ACHA 3Q5IA 4NW6A 4QP2A 5CAPA 3SQQA 2VTNA 3DBQA 4O2PA 4S30A 1OKVA 4O7LA 3F6XA 2GS6A 5FLFA 3QX2A 4CQEA 1NA7A 4FKOA 4RVMA 2JD5A 3DLSA 3RBWA 4TWPA 3ROCA 3QRUA 3RAHA 4UWCA 4OTWA 1F5QA 3H4JA 4RZVA 5IQFA 1OITA 2B55A 3PSDA 4RFMA 4EONA 3AD4A 2ZMCA 3ZFYA 4XLIA 3KQ7A 2C30A 2BKZA 3GQLA 1PRYA 1Y8YA 3ODZX 3NUYA 2Y8OA 3SLSA 3EFLA 4OUCA 3ZRKA 3AC2A 3GOPA 1OB3A 4KIKB 4BCGA 3HKOA 5H8GA 2DQ7X 4CSVA 4YZ9A 3F7WA 2YZAA 4QMOA 1PYEA 3ZLWA 3P7BA 5FG8A 4L7FA 3BE9A 4FV8A 2F9GA 2UZVA 3C4CA 5AP6A 4BDKA 3D7TA 3KREA 2CLXA 3KFAA 4OTGA 4GIHA 2EB3A 2J0JA 4QYEA 2VO0A 2JGZA 4FMQA 4IVDA 5AM7A 4IB5A 4AQCA 4EI4A 4F9CA 3NMUF 4EH3A 2ZDUA 2Y4IC 2J0MB 2GDOA 1VR2A 1ZARA 3IW4A 3KY2A 1XH4A 3W1FA 1SVEA 4BR3A 3TXOA 2XH5A 2W06A 2BDJA 4TTHB 4YZNA 2FSMX 3VAPA 4CYJA 4EL9A 2WQMA 3SV0A 3OHTA 2EWAA 3OS3A 4BDEA 4JAJA 5JGDA 3V5QA 3MDYA 3PWDA 5AV1A 3KXZA 5GZ8A 3QRJA 2X4FA 4QMVA 5GINE 2F2CB 3TNHA 4R3CA 2BMCA 4GIIA 5L4QA 2WXVA 3HRFA 1PMUA 5DLSA 5KMMA 5FRIA 1GZ8A 4DEDA 2WQOA 3RNIA 2C1BA 2OGVA 3QD3A 3OY1A 4PY1A 4CMTA 1WZYA 2VO3A 4CLIA 5CF6A 4FEUA 4DBXA 4YLLA 4YPDA 4E93A 3KCKA 3R01A 4KS8A 3Q6WA 1Y91A 3T3VA 4F1OA 2YJSA 1H0WA 1OM1A 3KVWA 4G6OA 1Q5KA 4EHZA 3VBXA 4M69B 4FL3A 3DBDA 3QWJA 1P2AA 4KIOA 3UVRA 1G8AA 2Q83A 5IA1A 3HDMA 3D5WA 4GG7A 3RTPA 3SXFA 1KSWA 5KMJA 2DWBA 5LMBA 4DGGA 3W8LA 4QP8A 1SVGA 5HX6A 1QPDA 3MY0A 2E9UA 3FI3A 3ORMA 4QNAA 3BYMA 4XV9A 5EM6A 4DG0E 4RIXB 4FV2A 2AYPA 5AM6A 1RQQA 2IPXA 3MTLA 1PXNA 5E1EA 3PA4A 4EKKA 2BAQA 4MXXA 3TIYA 2UZWE 4RIYA 3KK9A 5L2TA 1H1WA 3RCDA 2QD9A 3UO4A 3P7AA 4BF2A 2PVNA 3GP0A 4NFMA 3F88A 4OBOA 1R39A 5K9IA 3LXNA 2B52A 3KN5A 3VS0A 2C68A 3ODYX 3V6SA 5BYLA 5H8EA 5A46A 3FL4A 4F9WA 2XK4A 5KBRA 2PVFA 5M55A 5M4IA 1MRUA 1ZOEA 4QP9A 5E90A 1YXVA 4BKZA 5D12A 1RE8A 1Y6AA 3KRWA 4ZS0A 4W9WA 2CGUA 1OKYA 3FV8A 2X2LA 3KRRA 4LGHA 4IHPA 3PXFA 3R30A 5DEYA 1PXLA 2WIHA 5IUIA 4ANLA 1FMKA 4FSMA 4UYNA 1YHWA 3MY5A 4FVPA 4LOOA 4C57A 5CVHA 4X7QA 5GIOE 4DH1A 3IW7A 4BCIA 3MESA 3EN4A 3FI2A 2PZYA 3QQHA 3C4XA 4FTKA 4FVRA 3BU6A 3LXPA 4ITIA 5HESA 2G01A 3KKVA 4RMZA 2KULA 4IZ5A 4ZSAA 3DXQA 1ATPE 4QP6A 3VBYA 3PYYA 4X0MA 2XCHA 2I1MA 1K2PA 2PVLA 5E8WA 5C8KA 2HW6A 3QUEA 4MXCA 4XG6A 5CI6A 5ANIA 4XS2A 2EVAA 4EOIA 5LOHA 3IPHA 4EH8A 5A54A 5E8ZA 1LPUA 2C3KA 3DQXA 3D94A 4GK4A 4Y73A 5AUXA 4DC2A 4F9BA 2ITNA 5FQDC 5KMLA 3G9NA 4UMTA 3JYAA 1UKHA 1JNKA 3HV7A 5LVMA 4AT5A 2NO3A 1U5RA 3K54A 4F99A 2Z8CA 1J1CA 1QL6A 4JQ8A 4ONAA 5HIEA 4FKTA 2Z60A 4BDGA 1JLUE 4QTBA 1YOJA 5M06A 2WTKC 4HGTA 5E8UA 4QQJA 3AMBA 4X21A 5EM8A 1PMVA 4TWCA 4IWOA 3RINA 4AG8A 1IAHA 4M67A 3HA8A 5CF5A 3UZRA 3L8VA 1MP8A 4Z16A 4AZTA 4MBIA 3IDBA 4HZSA 5KCVA 4KIKA 2UW5A 1BI8A 4F70A 1IASA 4NTSA 3GC0A 3DDPA 3ORNA 2WD1A 4JDIA 4GFGA 3O96A 4OGRA 2CJMA 2GCDA 2F7XE 4AW0A 4E3CA 1Q62A 2BZIB 3GI3A 4IM2A 1F3MC 5EYDA 3TV4A 5JQ8A 2PVMA 2LAVA 4BGQA 2I7QA 4PPAA 4QPAA 1OI9A 2BHHA 2PTKA 2WMXA 2RG6A 3AC5A 4I92A 3CXWA 4AX8A 1QMZA 4Q5HA 3BGZA 4M15A 2GPHA 1VEBA 5E1SA 2WEVA 4CVAA 4NFNA 1ZWSA 2PVKA 3L8SA 2WMSA 2HENA 2ITWA 4O6LA 4ITHA 3BKBA 4IANA 3CJGA 1HOWA 4K33A 1P5EA 3SOAA 5BVNA 4FEVA 3MBLA 4G3DA 4EHVA 2FUMA 1H28A 5HTIA 5IDNA 3C7QA 2F57A 3KULB 3QWKA 4FTAA 4RLLA 4CEGA 2UVYA 5AUYA 3ALOA 4JBPA 3RK9A 3ZLYA 2YISA 3PA5A 1BUHA 1H1SA 5DR2A 4DGOA 2J0IA 4CT1A 3ZRLA 5JN2A 3CBLA 2R3KA 3ZEPA 4TKSA 3BLHA 3CP9A 3FEGA 5D10A 4HVHA 2EU9A 1V0PA 1XJDA 4YBKA 2BRBA 4FKVA 4M69A 3UQCA 3E8NA 3TN8A 2XNGA 4PDYA 3L1SA 3MWUA 1YVJA 3LJ0A 4IMYA 5CLPA 3LIJA 4GT3A 3VUIA 5IQGA 2W5BA 3R9HA 5KHWA 1J7IA 5CALA 1PW2A 2XUUA 3BV3A 4IIRA 4ZSGA 3UC4A 4I24A 4CLJA 4DCEA 3NVMB 4RIXA 4AU8A 2J51A 2YM4A 4WUNA 3MPMA 2HXLA 3AT2A 4BKJA 3QX4A 3VBWA 3QTWA 5IH5A 2QOKA 4IC8A 3R9DA 4CFVA 3LQ5A 2PWLA 5FM2A 4BWKA 2ITXA 5DA3A 2OXXA 3FXXA 3PY0A 3BBWA 5IEVA 5EQPA 2VRXA 4G5JA 4IWDA 5LVPA 1Z5MA 5M08A 2A19B 4ZZMA 5A9UA 1VYZA 3A4OX 3KVXA 1ZZLA 4OTQA 4V04A 2IG7A 4TZRA 3PRFA 4OW8A 4QYHA 2WTJA 1ZOHA 3QALE 4LGGA 3D0EA 4YTHA 3UGCA 4DFLA 2OJIA 1VZOA 3TL8A 4R77A 3VUDA 2HOGA 3U54A 3QRIA 4F4PA 2PUIA 1ZYSA 3A2CA 1YXSA 1URWA 3MH1A 5HCXA 1L3RE 5KMOA 2FYSA 5J95A 4C59A 3UNZA 4C8BA 2YWVA 4NH1A 3QQJA 1OL1A 4W8EA 2W7XA 3LCKA 4JI9A 3UOLA 2R7IA 3JVRA 4J1RA 3PZEA 3F5UA 3R7UA 3EYHA 4PRJA 4GFOA 2Z7LA 2W4KA 4EOLA 4RC3A 3E87A 3GCSA 3OROA 3UPZA 4IWPA 1Q3DA 5ANKA 2CNQA 2Z7RA 2UW4A 3FLSA 4H3QA 4MVFA 3UG1A 4FIIA 2W1EA 3DK7A 3E3BX 3FYKX 3C5UA 5FD2A 3ZM4A 1JAMA 4A9TA 4UMRA 3RPOA 2VUWA 2QCSA 5IF1A 2RFNA 3DZOA 4I20A 4R6VA 4O83A 4H58A 3C51A 4ZY6A 5ACKA 2WMVA 1GZNA 1T46A 3MVLA 5ETAA 4LFIA 2I6LA 2Q0BA 1B6CB 4FA2A 3WF6A 2RG5A 1V1KA 5LWNA 1DAWA 1JWHA 1R1WA 4U7ZA 4USEA 3RAIA 1E9HA 4YTFA 4WA9A 1JBPE 1ZY5A 2XK3A 3FLYA 5HO7A 4MBLA 5M4CA 4W8DA 5HOAA 5DBXA 4I5CA 4BHNA 3RWPA 1PXIA 4CG9A 3EIDA 4FIFA 3ZO4A 4KBAA 3HRCA 1CKIA 3HYHA 4O27B 4P4CA 4QP3A 4HVSA 3QQGA 5L2SA 5LVNA 5IQEA 4XV3A 3LQ3A 4X2GA 4CV8A 4QYFA 3L8XA 3DFAA 4AGDA 4G1WA 4BCJA 2ERZE 1F0QA 3ZBFA 4LL0A 3V01A 3FLNC 3MIYA 3F2RA 4YNEA 3WZUA 4QD6A 3MW1A 3QGWA 3SHEA 2OG8A 3FAAA 3HRBA 1ZLTA 4GUEA 4KSPA 4P5ZA 4EK6A 4D2RA 3L9PA 4HGSA 1Q8UA 3C5IA 4B9DA 3G0EA 4OTFA 1H07A 4U81A 5L6PA 4MQ2A 2WMQA 2X7FA 3EZRA 5IQIA 4DGLC 2JDTA 4YO4A 4LMNA 4IAIA 2WIPA 5IQAA 2C69A 4TPTA 4FX3A 4FKRA 3GENA 4OT6A 2WTDA 2UW9A 2ZAZA 3QKMA 5E8YA 2EUFB 4K1BA 4PDOA 5AX3A 5JFWA 2QO9A 2PMNX 2R3PA 5LCKA 4QTAA 3KMUA 1JPAA 2QOOA 3ALNA 1E1VA 4RPVA 5KMKA 3EQGA 1OUKA 4O6EA 4FSYA 1OKZA 5TE0A 2X6EA 4JX7A 4UYAA 2UW6A 4YHJA 4FL1A 4DLJA 4O7RA 3COKA 1KE9A 4K0YA 3DK6A 3KULA 3D5UA 2ZJWA 1YXUA 1FMOE 4RVKA 5ANJA 5J87A 3TZ7A 3WF8A 4BDAA 4F9AA 3DBFA 2NPQA 4UALA 3Q9XA 2XEZA 2XS0A 4X2FA 2FH9A 2QOBA 4MTAA 2RFSA 4RG0A 3ZDUA 4C35A 4E7WA 3EHAA 3NWWA 3DCVA 3R83A 2YCQA 2UW8A 1XWSA 3Q60A 4XOZA 4M14A 2GHLA 4WG5A 3MN3A 3QGYA 3H9OA 3RZFA 3W2RA 5KO1A 3P4KA 5EW8A 4WO5A 5K5XA 2XBAA 4KKGA 5HLPA 3GU5A 5FDXA 3BWFA 2O65A 4EBWA 2GHMA 4F63A 4MKCA 3ET7A 4BN1A 1H4LA 2G2FA 2RL5A 1Q4LA 3B2WA 2QOFA 5TT7A 2GQGA 1K3AA 1Q61A 2PE0A 3LFBA 4IM0A 3DXNA 4L67A 1XBAA 3VQHA 3M2WA 2JDRA 3IGGA 4MXZA 5DVRA 1PXKA 4NCTC 4TWNA 3TV6A 3V3VA 4RJ3A 3OWPA 5HE3A 4KKHA 4N6ZA 4J8MA 3QA8A 1QPCA 4JLCA 4QPSA 3W2CA 2OJJA 3CR0A 4D1SA 3UTOA 2PMOX 2HK5A 3U6HA 1PXJA 3QTRA 1H27A 4LRKA 3EL7A 1OIQA 2GTMA 3B8RA 3OD6X 2ETKA 3IQ7A 2JAVA 4EHGA 1M52A 2X7OA 4C4EA 3N4UA 1PMNA 5CU2A 2E9OA 5CXHA 3RAKA 5DYJA 3FZ1A 4I6BA 3L9LA 2W1FA 4MBJA 4I23A 4ZMEA 2A27A 2BFYA 4BCFA 3GFEA 3MA3A 4M84A 3C1XA 4YZCA 4RLKA 4MWHA 4YJOA 2CMWA 2RKUA 4RVTA 1FVTA 4BZNA 3ATTA 3LFNA 3W10A 2OU7A 4BIBA 3SA0A 4FICA 3GT8A 1O6YA 3G33A 3O23A 4E4NA 2C4GA 3N51A 3Q9WA 3ZBXA 5CASA 2W5AA 5LJJA 3E8EA 3OC1A 4ID7A 4WRSA 5KMNA 1WFCA 4N70A 1ZAOA 3MA6A 4FT3A 1ZMWA 3RPVA 5I9XA 4YZDA 2Q0NA 2C3IB 2W9ZB 4AN9A 5C4KA 3EZVA 3EWHA 4FIHA 4MCVA 5KUPA 4Q2AA 3U51A 4ACCA 5M56A 1ZY4A 5HIBA 3W2SA 3S00A 4PNIA 3FHRA 2XIZA 2P0CA 4DFXE 3U55A 2WZJA 5L8KA 3EQCA 4RWLA 4WIHA 1KE6A 3FZSA 4P7EA 2ITVA 3LCOA 4BDCA 4AFEA 4D5HA 2XM8A 2BDFA 5HLWA 2NP8A 4BDFA 1MQBA 3KF7A 1SNXA 1H1QA 5ANOA 2W5HA 5LMKC 1EH4A 4Z9LA 3PA3A 4L3JA 2BPMA 2W1GA 4YHTA 2YWPA 4IC7A 2XNBA 3W55A 4D4SA 3FI4A 2YIQA 5FEDA 4IB3A 4C02A 1K9AA 1IRKA 2UZOA 2VWZA 2BRHA 4CFUA 5IMEA 4TXCA 2YDJA 5AV4A 2W4OA 4O1OA 5IG1A 4L3LA 3NIEA 4U8ZA 4FT7A 3MJ1A 2B53A 2FO0A 2YHVA 4BL1A 5B2MA 4FODA 5M4FA 4BC6A 4AF3A 3KN6A 3VWAA 3WBLA 3BQRA 3VHEA 4TT7A 3PP0A 2LGCA 4BIDA 1OPKA 1IA9A 5AV0A 5I5ZA 4J7BA 3TJCA 2J2IB 3D7TB 3VS7A 2UZBA 4FG7A 2PU8A 1H00A 2O2UA 4XP2A 2XIYA 1LP4A 2YCRA 2HXQA 4I0SA 4RRVA 3TUDA 4FTTA 3O50A 3LMIA 3DDQA 3PJCA 5KKRC 3OWLA 1HCKA 2CGXA 2WFYA 3CGFA 3ZUUA 3NSZA 2V7OA 4OBPA 3FLWA 2B9FA 4HPTE 5GNKA 2CPKE 5HIDA 4N0SA 2W1CA 3QTUA 4E5AX 2YIXA 4JBOA 4RC2A 4G9RA 4S34A 4ZSJA 4ASZA 3F5XA 2ESMA 4JDJA 5HBHA 4F7LA 4B8LA 4FSQA 4FTCA 2IW9A 4D58A 4E20A 5AIKA 2GNHA 1KE5A 4D0WA 4EK3A 5GJFA 2WMAA 3KXNA 3UG2A 3VS1A 3NNVA 5EQEA 3DAKA 2XKEA 3GCVA 3H0YA 2J6MA 3PXRA 4WNKA 2GSFA 3P7CA 3REPA 3IOKA 2VO7A 3IGOA 3MH0A 3TACA 4ANQA 4GU9A 1ERKA 2EB2A 4YR8A 1NT2A 5CT0A 5IDPA 2XMYA 5BX0A 2AC3A 3AGLA 4IAAA 3NW6A 3CLYA 5DR6A 1I09A 4FZ7A 5HG7A 3TJDA 4AZWA 5FEQA 4BZOA 3OWKA 4G3EA 2UW3A 3W2OA 4A9SA 4CMOA 5ANGA 5AP4A 3CEKA 2ERKA 4D1ZA 4GKHA 1OL2A 3HGKA 4IACA 2C6TA 3WZEA 4IB0A 3IW8A 3OXTA 4IDTA 5IEYA 4UX9A 2WHBA 4FE2A 2RGPA 2A1AB 5K4IA 3I60A 4MQ1A 4QMMA 5KE0A 2BFXA 4MXYA 5KZIA 2J0LA 3V8SA 3SGCA 4GS6A 3P9JA 5L3AA 3R1YA 3H0ZA 3KMWA 3PVWA 1YKRA 5LQFA 3C13A 3DAEA 2ZDTA 2VWIA 1AD5A 5H9BA 3WE8A 4TYHB 2XCKA 4WHZA 4L42A 1OUYA 3DJ6A 4IQ6A 2H9VA 3LMGA 1GY3A 4XNEA 3E93A 3FHIA 1GZOA 2WB8A 4D0XA 2WNTA 3QZHA 3R8UA 4IX5A 4JG8A 3UIXA 2FA2A 5JKGA 3R6XA 4CFMA 4DE4A 5CT7A 4G16A 5DG5A 2VGOA 4BYIA 4C38A 2X39A 1MRYA 4O86A 1H08A 3ZHPC 1RDQE 4UZDA 2CCIA 3QKLA 4RC4A 2WQNA
chains in the Genus database with same CATH superfamily
4C2WA 2H34A 2ITZA 2W05A 1OGUA 2R7BA 3NX8A 3R8LA 3NR9A 4QMQA 3E62A 4RA4A 1M17A 3BGPA 5I4NA 1R78A 4XV2A 3LFEA 4HYHA 1FOTA 3ZMMA 3F82A 3AKJA 2E2BA 2QKRA 2WQEA 4F78A 5DOSA 3POZA 3ZSIA 1DM2A 5IQDA 4GL9A 4O0VA 4AN2A 4EK8A 2DUVA 5CXZA 5I3RA 5T3QA 3VULA 3F9NA 5LMAA 3TTIA 3NUAA 4QQ5A 1RJBA 2AQXA 2BIKB 3P23A 4NKSA 4P90A 4TY1A 4C4IA 1ZYCA 2J5FA 4ZP5A 2W17A 4RFYA 5EOLA 4ZOGA 5J1WA 1WVYA 3OXZA 3KGAA 4EEVA 2BILB 2PYWA 2QOQA 4H3BA 4WNOA 5K5NA 4CMUA 3Q32A 4F0FA 3BWJA 4P5QA 4ASDA 1APME 2ZB1A 3QLFA 1P4OA 3BYVA 2VWWA 5DT4A 3JR1A 5D7AA 4ANOA 3LCDA 2WTIA 3MPTA 4IE9A 2YIWA 2IW6A 5AFVA 4M7IA 2XIRA 2YIYA 3PP1A 3MS9A 3N4VA 1ZZ2A 4I1ZA 3BI6A 4FV1A 4DEIA 3ORZA 2BRMA 3DXPA 1PYXA 2QKWB 4J97A 3PFQA 3EYGA 4XUFA 4DYMA 4LQMA 4FJVA 4RJ4A 5IISA 1NVQA 4JQEA 5HTCA 4XJ0A 4ZS4A 4DH7A 2QI8A 4QMYA 4YZBA 2E9VA 3PJ1A 3A62A 1YDTE 3R21A 4FK6A 5FTOA 5TOZA 4AT4A 3ZO3A 3E63A 3K3IA 4G6NA 5CAOA 4KWPA 5H3QA 2WKMA 4K9YA 2CCHA 4D9UA 4TNDA 4YC6A 4E5WA 1WBWA 4EOQA 3V51A 5F20A 2VTAA 2VN9A 3CPCA 2XF0A 2F7EE 5DH3A 5HQ0A 1XQZA 2IZSA 3SAYA 3NYOA 2EXCX 2YCFA 4XOYA 4CV9A 2QOHA 4E73A 4J96A 5DRBA 2BRGA 2YABA 4GFMA 4K6ZA 4LI5A 3GU8A 5M44A 3RK7A 4O91A 4YP8A 1OL6A 4YUQA 3VUHA 4BTKA 2A98A 3AC1A 3DTWA 3GXLA 3BLRA 1VJYA 4FV0A 4NZWB 4AW5A 1GIJA 3DB6A 3I5NA 2G2HA 3Q4CA 1JSUA 2OK1A 3RP9A 5GIPE 1NXKA 3R73A 4R3RA 2B4SB 2CN5A 2HIWA 5CQUA 4DDGA 3IKAA 3JPVA 1ST0A 4AW2A 2W1IA 3DNEA 3I4BA 4FIJA 4EK5A 5J9YA 3UDZA 3ENHA 3F66A 3VBTA 4GK2A 4IB1A 1OIRA 5JH6A 2W1DA 3E88A 4O84A 3CCNA 4M66A 2XK8A 1OBGA 2PUUA 5M09A 3O8UA 4KS7A 4X2JA 4KAOA 4L9IA 4U80A 4DHIB 2GNGA 3C50A 2B9IA 4TN6A 1BMKA 4FC0A 5E91A 5BMMA 5AJQA 2OI4X 2J9MA 3QXOA 3IDCA 3P08A 1GZKA 3OT3A 1Q8TA 2HCKA 2VTSA 4L53A 5CS6A 5E8VA 5HCZA 4FEWA 3T8OA 1TQMA 4JAIA 2XNMA 5I9UA 3S3IA 2PUNA 3QQLA 3I6WA 4TYIA 1OL7A 4XG7A 3VO3A 3QA0A 1SNUA 1VYWA 5AAEA 5JGBA 3VBVA 2ZM4A 2C6DA 1OL5A 4FKPA 4I6HA 5IUHA 3M11A 4KRCA 4C33A 5CAVA 3FC1X 5JFSA 4ZTMA 2C6OA 4FTJA 4II5A 2QONA 2DS1A 4D2SA 2ZM1A 3HEGA 3HMOA 2OWBA 2UVZA 3R1NA 5EM7A 2VNWA 4TYHA 2SRCA 3H9RA 4H36A 3MY1A 3NCGA 3EH9A 3F5PA 1PF8A 2WTCA 3F3VA 3D2IA 3Q5ZA 4FNWA 4H3PA 2QLQA 4M0ZA 5HO6A 4ALUA 2R3RA 4NM5A 1Q99A 3EFKA 4U3ZA 5ICPA 1W83A 4KKEA 1JKKA 5AAFA 2R4BA 4Y8DA 4FL2A 5C1QB 1YW2A 2WGJA 2GS7A 2J4ZA 5IH4A 1W98A 3RNYA 5E8XA 2NRYA 3BU5A 3R1QA 3E64A 1Y6BA 5JZNA 3PUPA 3D4QA 3VS4A 4AE6A 1S9IA 4UMUA 3HLLA 3NNWA 4A7CA 5IEXA 4HJOA 4AOIA 1YDRE 1PXMA 3EMGA 2W0JA 2OFVA 4FK3A 4FT0A 4RX7A 4CD0A 3E5AA 5CVGA 2QODA 2Z2WA 2YM7A 4F6WA 2C0OA 2OZAB 4AGUA 4HVDA 2R64A 5C01A 1DAYA 3II5A 4F7JA 4EH4A 3HZTA 5EI8A 2WOTA 4JRVA 2PHKA 4FRFA 2JITA 4ZTQA 2JIVA 4XX9A 5HO8A 4F65A 2X8EA 4HCVA 3QQKA 4GVJA 4ZTLA 2QNJA 3IS5A 4QMWA 4CGAA 1UNHA 2VNYA 3FKNA 4L3PA 5E92A 4ZK5A 2VGPA 3R00A 3R7OA 5JEBA 4DT8A 4EUUA 2R0IA 1PMEA 4FEXA 3C9WA 4YJRA 3BYUA 3VUKA 1V0OA 3QXPA 5JT2A 3DA6A 1O9UA 2RF9A 4EH5A 3F2NA 4S32A 4EUTA 2BKKA 5I9VA 2C5YA 3UNKA 4R7BA 1Q8WA 3G90X 4KABA 4AAAA 4CTCA 2VWYA 2QC6A 2I0YA 2JKQA 3I81A 3A7HA 3VVHA 4EBVA 3R2BA 4FR4A 4C58A 4DEGA 4D2TA 2WAJA 3ORIA 4U5JA 4AN3A 2IZRA 2VU3A 3OTVA 4CFWA 5CNOA 4DAWA 4B0GA 3LFCA 3KRJA 2V22A 2WTWA 2XNNA 3BELA 3KA0A 4W9XA 4A4LA 4Z7GA 4RA5A 5HORA 3PFYA 3PJ2A 4C2VA 1KOBA 4HNIA 1UWHA 3OEFX 4NL0A 3O8PA 5EQYA 2JIUA 4K8AA 3ZC6A 2ONLA 5EHOA 5DFPA 2BZKB 5HE1A 2UZDA 3D9VA 5C9CA 1W2FA 3TWJA 5FEEA 3BIZA 4DGNA 4XP3A 2RFEA 5H2UA 5I0BA 2UW7A 4NM0A 4QMUA 5AX9A 2UZEA 5F4NA 4IZ7A 4QMXA 3RPYA 5HI2A 4GKIA 4CKRA 2YCSA 5D1JA 2BROA 3QZIA 1J1BA 5JK3A 5FBOA 5CX9A 2GS2A 4F0GA 4RSSA 3GNIB 5D7VA 3MV5A 5I9WA 3ZRMA 3ZZWA 3TMOA 3HP2A 3I7CA 2JKMA 4IJPA 3COHA 4ERWA 3IK3A 3ZONA 4YJNA 4C4GA 5DEWA 4BIEA 3OOGA 4KD1A 4EOKA 2HZIA 2ZV7A 2Y0AA 3HV5A 3HAVA 3ENMA 3TNIA 2H96A 2PZRA 4FSTA 5AA9A 4BZDA 4J95A 2JFMA 3DB8A 5CSVA 5AWMA 4WD5A 5CEQA 3ZM9A 2GU8A 3UOJA 3RMFA 1ZMUA 4D4YA 2O0UA 5DHJA 3HUCA 3TCPA 4ZLYA 3PPJA 1Z57A 1ZMVA 1WMKA 2P2HA 3R63A 3CY2A 4ANNA 5BYYA 4I41A 3FZOA 1H8FA 3AC8A 4XYFA 4AA0A 5AUUA 2BVAA 2VX1A 5HX8A 4KB8A 5HE0A 5J8IA 2JKOA 4MAOA 3MPAA 4EZ5A 1UV5A 3KC3A 3F3WA 2OW3A 4X6RA 4OBQA 3Q53A 5HBJA 2Z7QA 1I44A 2CGWA 1YQJA 3SRVB 2V62A 2YM3A 4RWJA 3NRMA 3QTIA 4MX9A 3OG7A 5EG3A 3WF7A 2CNVA 3RK5A 3O51A 3VBQA 3ZLSA 2OJGA 1A06A 1UU8A 2IVUA 2HZ0A 3QU0A 4RIWA 3ZLXA 5FP5A 3FPMA 3CJFA 3KXGA 4NM7A 5BYZA 1WBTA 5AP5A 4CFXA 4O0YA 2C6IA 4YHFA 5CSPA 1KV2A 3NNXA 3KK8A 1Q8ZA 3PIYA 4ACGA 3I7BA 2VTLA 2YDIA 5FP6A 3NW5A 3TG1A 3CY3A 4PUZA 3FL5A 5IU2A 3Q2JA 2PY3A 2Y6MA 1YRPA 4Y46A 4ZEGA 4E26A 5FDPA 5HD4A 2XYNA 3LQ8A 5CI7A 5HLNA 5JQ5A 1WBSA 3ORTA 4GW8A 5IH6A 2VTOA 4EH6A 3DY7A 2EXMA 2Y7JA 3A7FA 3FZPA 4L7SA 4Y5QA 3RI1A 3EFWA 5J5SA 4FTIA 4IW0A 3NS9A 2QQ7A 3OW3A 4JBQA 1NVSA 5EHYA 2C6LA 4F6UA 3HX4A 3K5VA 2GQSA 3AC3A 5L2QA 3COMA 4EJNA 1VLRA 2CN8A 3FMJA 3QF9A 4NKAA 2OZAA 2VWUA 2R5TA 4IEBA 1YHSA 4MNEB 5HG5A 2I0HA 3V5TA 5FXRA 4EZ3A 2C6MA 4XBUA 3MIAA 2ZM3A 4F6SA 4FSNA 5M53A 4I94A 3A8WA 4KBKA 3UMWA 3FMMA 3BE2A 4MF0A 5AP3A 4A4XA 3C4FA 4G34A 3KXHA 4FTOA 2ZFYA 1YXXA 4GUBA 3FLQA 3P78A 4TRLA 4PMSA 4DEAA 4FT9A 4I5PA 4D4VA 4HGEA 3FJQE 4IXPA 4XH6A 2XYUA 3GQIA 4HOKA 4QMLA 4X3FB 5CEOA 4R78A 4ENXA 4W4WA 4W4VA 5IPJA 2P55A 2WPAA 2YN8A 4G31A 1H1RA 1M2RA 1PJKA 2EXEA 3VUMA 2C6KA 2QLUA 1B39A 4MF1A 2ZMDA 3FPQA 4LUDA 3W0PA 3OXIA 5BUIA 2G9XA 2XIKA 4DHZA 3OUKA 2ITOA 4EOOA 4XRLA 3R7YA 1WBVA 3FLZA 1G5SA 2CLQA 5CSXA 2Z02A 2GHGA 4J71A 4EC8A 1XBCA 2CHLA 1M2PA 4O4BB 4CFFA 4O7VA 1GNGA 3UIBA 2A0CX 2G2IA 2YEXA 3CSVA 4AOTA 4L45A 4XG9A 1XHAA 3I6UA 4UB7A 5TKDA 3E3PA 2DYLA 3UC3A 3D5VA 4GK3A 3SW4A 3WE4A 4ANBA 2E9PA 4M8TA 4NIFA 3NUXA 2RSVA 3VJNA 4LUEA 4WBBB 5BVFA 3Q9YA 2PE1A 2UZLA 2XKDA 5AR7A 4IH8A 4JIAA 3TEIA 4IAZA 3VNTA 3CTQA 3UODA 3ZC5A 3QCQA 3DV3A 4I5MA 4S33A 5DIAA 4EJ7A 2JAMA 3F61A 3OTUA 4O22A 3W16A 3DGKA 4ZJJA 4AZVA 1H25A 4YTIA 3VW6A 4EYJA 5J9ZA 4FKJA 3Q2MA 4GYIA 4GSBA 3UVQA 1KUTA 3NDMA 4GRBA 3DJ7A 4MD7E 3AKKA 4PWNA 3RCJA 4RJ5A 3UNJA 3UOKA 2PMIA 2V55A 3ZFMA 4AACA 1JKTA 3AD5A 4NJ3A 2ZYBA 5A4TA 2YM6A 4BCMA 5CU0A 2B0QA 4OR5A 3EQFA 3I0OA 3D83A 4C62A 4D1XA 5EI2A 4PNKA 4PF4A 3DPKA 3BCEA 1X8BA 2ETMA 4FV4A 3ERKA 4RGJA 1Q3WA 3RKBA 5EW9A 3PY3A 3VUGA 2OJ9A 4NJDA 2OZOA 3P79A 3NW7A 3Q52A 5L6OA 1R3CA 4DTAA 1HCLA 3S0OA 1NY3A 5AR5A 3C0IA 4F7NA 3V5JA 4Z3VA 3FUPA 4DH5A 4WRGA 5I9YA 4ZJIA 4TYGA 5CU6A 2VX3A 3NUSA 4LYNA 4RT7A 1FVVA 2JIIA 2RFDA 4JJRA 4ZSLA 3SRVA 3UQFA 2XKFA 3FKLA 2OF4A 4QQTA 2UUEA 5GZAA 5E8TA 3NFGB 4AXCA 3EN7A 2BZHB 4BRXA 3D7ZA 3OT8A 4F0IA 3F2AA 4LV8A 5G1XA 2ITQA 1YI4A 1MRVA 4BKYA 5KZ0A 3R8PA 3FQSA 5IMXA 2QO2A 2WO6A 3LVPA 4TWOA 2IF8A 3PXQA 5F1ZA 4B4LA 3BLAA 4N6YA 3T9IA 4R7IA 4J53A 3CPBA 3U6JA 4RWIA 4E1ZA 2R3GA 4NEUA 5C4LA 3ELJA 3PZHA 2PULA 5CY3A 5IA5A 1CSNA 3HUBA 3QZFA 3UZPA 2O63A 5IA3A 2X7GA 3AT4A 3QCXA 5DGZA 3W2QA 5CAQA 2Y4IB 3TIZA 2R3MA 2R3FA 1XH5A 3DKCA 4ZY5A 3WARA 4EOMA 2XA4A 4WSQA 4ACMA 4BDDA 5E9EA 3HNGA 3D2KA 2A2AA 4U41A 4L00A 4BCOA 2C1AA 4EWHA 3S95A 5IA4A 2I40A 2X4ZA 3LM5A 3EB0A 3U6IA 3A7IA 3ZO1A 1T45A 3F3ZA 3FSKA 3JS2A 2H8HA 3UO5A 2R3HA 2V5QA 3Q04A 1U54B 3BHYA 1XMLA 3RALA 1JSVA 2VTHA 4OLIA 3FMEA 3SC1A 3QFVA 4PL3A 3THBA 4FTMA 2W1HA 5IUGA 5HU3A 3PDTA 2R0UA 2B9JA 4MNEA 3V8WA 3EKNA 5FXSA 4PDSA 3LFQA 4UBAA 5LWMA 2WTVA 2X8DA 4BBMA 2REIA 2X0GA 5CTPA 2YITA 1B38A 1Q97A 3TKUA 5BVOA 4MUQA 3BHUA 4UV0A 4DFBA 3FE3A 5ETCA 4OTPA 2OIQA 4OTDA 4TNBA 4U9AA 2OIBA 3DS6A 3B8QA 4QYGA 1LUFA 1ND4A 1U46A 4I4FA 4GMYA 4L44A 5EDPA 2VZ6A 1E1XA 1CKJA 5ETFA 3WIGA 4KA3A 4BFMA 1CKPA 4X3FA 2F4JA 2OO8X 2IWIA 4RWKA 2XK7A 4DITA 3PJ3A 4KIQA 4YSJA 1TQPA 2FVDA 3QLGA 2JFLA 3QD0A 4R7HA 2OIDA 4MD9E 5CENA 4ANSA 4BCHA 5CANA 3TZ8A 2NNWB 4Y72A 3A4PA 3JY0A 4CZTA 3M42A 5L8JA 4CKIA 1SMHA 4DT9A 3C4ZA 1Y57A 2OFUA 2VTRA 2GNFA 3JY9A 4LGDA 5LVLA 3ATSA 2XKCA 3AQVA 3EQDA 3O17A 4C0TA 4JDKA 4JOAA 3TUBA 3WOWA 4FGBA 2R9SA 5AR8A 1CTPE 3BYOA 5EM5A 3TKHA 3ZFXA 4O81A 4AUAA 4ZMFA 5FBNC 4FEQA 4XG8A 2WELA 3KCFA 3OF0A 3NGAA 3ORXA 3T3UA 3QL8A 3QRTA 2YA9A 4LOQA 4QMNA 3QUDA 2XZSA 2CDZA 3ZYAA 4FGRA 5HE2A 5HVJA 3R8MA 3G9LX 3QCSA 4YJVA 2IN6A 4FZAB 1KE8A 1CM8A 4HCUA 4DEEA 3ANRA 5IQBA 4YPSA 2PZ5A 3OUNB 4O2ZA 5C8MA 3ZXTA 4HPUE 1IEPA 3A7JA 2CGVA 4TL0A 4XBRA 3AGMA 4AGCA 4JDHA 4PP7A 4FTLA 3R28A 1UU9A 3EFJA 4I4EA 3OZ6A 4PTCA 4QYYA 2YDKA 3OMVA 5E7RA 3RM6A 2XEYA 4FZ6A 4GT4A 4PMMA 3CGOA 4ASEA 1STCE 4DH3A 1JKSA 1U59A 5EFQA 2JBOA 3G6GA 5F9EA 2O3PA 3QQUA 5I3OA 5DR9A 2OICA 4FSWA 5CF8A 2OBJA 4WBOA 3ZO2A 1LR4A 4AZFA 5FTQA 4O4FA 4BCPA 3WILA 1A9UA 3LHJA 4QT1A 4RBLA 5HBEA 3HL7A 2BDWA 5HG8A 1OVEA 3UP2A 4FV7A 4G5PA 4QTDA 5E8SA 1L8TA 3BGQA 4FNXA 4GJ2A 2QU6A 3H10A 1FPUA 4FTUA 2XJ2A 3CQWA 4IWQA 4ALWA 2GQRA 4B7TA 3FMHA 1BX6A 5EYKA 4CNHA 3VIDA 4YLJA 1REKA 2WTKB 2C0TA 5CZIA 1FBNA 4DN5A 5B2KA 1SVHA 2J5EA 4NWMA 4D9TA 3FBVA 2W9FB 3VS6A 3FC2A 1QPEA 4FV3A 4AA4A 5EHLA 3FY2A 1QPJA 2VWBA 3QBNA 5DI1A 3RHXA 4FUYA 1J3HA 4BY9E 4Z7HA 3DT1A 4ZLZA 3EKKA 1GJOA 4R8QA 3O71A 1ZXEA 3DQWA 3QQFA 4DEBA 5E4HA 2W96B 3BQCA 3EQRA 3TNPC 4GJ3A 2UW0A 3CKWA 4MD8E 4U45A 2VWXA 5EH0A 2XNEA 3VUTA 4FTQA 4HVGA 5AP0A 3GBZA 2YIRA 3AOXA 1XR1A 5A14A 2HZNA 4X3JA 5J5TA 4MEDA 4QRCA 3ANQA 1TZDA 3PIZA 4V01A 4BCQA 2PVHA 5A4QA 3AXWA 2C5XA 1WVWA 1Q24A 2ITYA 3T9TA 4ZJVA 2BIYA 3O2MA 3AC4A 4QQCA 3LFDA 4L6QA 1PY5A 4QPMA 5FM3A 5HNGA 3UO6A 3H9FA 4BDJA 3OBGA 4NW5A 3AMAA 1OPLA 1U54A 2J0KA 4BVUA 3FKOA 1BI7A 2XRWA 5A4LA 5JZJA 3R9RA 3FZTA 4Y5HA 4E6AA 2X0PA 2J90A 4E8AA 1UA2A 4QP7A 5F94A 3H30A 4IZAA 5I9ZA 3VS5A 5DT3A 3QRKA 2ZV8A 4ZY4A 4MWIA 2PVYA 2QO7A 4V0GA 2IVSA 4YBJA 3BRBA 4ENYA 4APCA 2XK9A 3D15A 4BWPA 4Z55A 4C7TA 3VW8A 4PQNA 1BL7A 4AZEA 3C0GA 1W0XC 1Q8YA 4I6FA 4JX3A 1J7UA 4FT5A 5AUVA 5CWZA 2GFSA 1DS5A 3NYVA 5FGKA 3EQIA 4FIEA 5CQWA 4DBNA 2ZB0A 4Q5EA 2OLCA 4K11A 4O7NA 3MSSA 4UWBA 1QCFA 5AIRA 2G1TA 5H8BA 4S31A 4FTRA 5L6WL 4AE9A 4ORKA 3OVVA 4QMSA 4V05A 4DF3A 3TV7A 3R8VA 2XP2A 3UDBA 2VX0A 3TNQB 3SD0A 1MUOA 1PKGA 4FG9A 3QD4A 4E4LA 1W82A 5AR2A 1H24A 2BTRA 3NEWA 3POOA 3PLAE 3PXZA 2IVTA 1WBPA 2R3LA 3E8CA 3NZ0A 2X9EA 4M68A 4ARKA 3W32A 2XM9A 4DGMA 3HV6A 4BTFA 5DN3A 4AP7A 5IQHA 5DPVA 3FZRA 4I21A 5G6VA 1XH8A 3COIA 3PG3A 5HHWA 4F08A 3TM0A 5D41A 4FKGA 3OP5A 5CU4A 1BLXA 1WVXA 4YURA 5IA0A 4D5KA 3ZS5A 3EOCA 3OFMA 4BDBA 3KIOC 3BYSA 3RHKA 3ZU7A 3CE3A 3OBJA 3QD2B 4JT3A 3WZJA 5DRDA 3GCQA 4AW1A 3W18A 4I22A 4LOPA 3BLQA 5TO8A 4FZDB 5LCJA 4E5BA 4CFNA 3UPXA 2CKPA 3VS3A 4CCUA 4YU2A 4LV5A 1H01A 4KRDA 2I0VA 3FQEA 1YXTA 2F2UA 3WYYA 2ZOQA 4CTBA 3BZ3A 3MGYA 1IAJA 5B2LA 4EHEA 3KU2A 4QP1A 5IA2A 4PL5A 3GOKA 4U43A 2KTYA 1OIYA 3GU7A 4QMTA 2PVRA 3VHKA 3LLTA 4AGWA 3PRIA 3BV2A 3CD3A 3GFWA 1CDKA 4DFUA 2HZ4A 2O5KA 3OEZA 4JBVA 3LE6A 4YLKA 4MYGA 3QKKA 4U0IA 3BL7A 4ASXA 3WI6A 2YLFA 5J7BA 2BR1A 3W0SA 3VRZA 2OH0E 4RIWB 3ZCLA 1UU3A 3QTXA 4O0RA 3CQEA 3CQUA 4JR3A 4YSMA 3S2PA 2X9FA 3NNUA 3O0GA 1O6KA 3DU8A 4H05A 3R1SA 1CMKE 3SXRA 4A06A 1G8SA 3KF4A 3AD6A 4FKSA 4YTCA 2WU6A 3OW4A 4ZIMA 4H1JA 1ST4A 4ZZNA 1P14A 3CC6A 4OAVB 5JGAA 4CZUA 5B0XA 1REJA 1WAKA 4XEYA 3QYZA 2ZV9A 3E7OA 2IZTA 4PPCA 4PTGA 4TYJA 4QOXA 1Y8GA 3MFTA 3SDJA 2R3IA 5HKMA 1ZRZA 3VJOA 2J7TA 1OMWA 4DG2E 4AXDA 3IO7A 4YC8A 4DA5A 4M97A 3IW5A 3ORKA 2JBPA 2WMBA 3MYGA 3H3CA 1XO2B 4XHKB 4G17A 4GEOA 3N4TA 2BUJA 4CG8A 3VC4A 2GNJA 1FGIA 2GFCA 4CRSA 2W4JA 3Q96A 2YACA 5M4UA 4G9CA 4FSZA 5A6OA 4M13A 5K3YA 3W33A 5M07A 3PY1A 4B8MA 5CZHA 4M0YA 3ZH8A 1O6LA 4G3GA 4EH9A 4O7WA 1GAGA 3AT3A 2R3OA 5CU3A 1AGWA 2BAKA 2V0DA 5A6NA 3GVUA 3GC8A 2X6DA 1OZ1A 3HMIA 1MQ4A 5BNJA 3EJ1A 2X2KA 3ZTXA 4CZYB 5AP1A 3ZZEA 3ZSHA 3NAXA 5A3XA 1YOMA 2X0OA 2WMWA 5F95A 4C34A 4EORA 3QHWA 5ANEA 5GZ9A 3E8DA 3I0QA 5HVYA 3OCTA 2HW7A 2WQBA 3QC9A 2HAKA 4IVAA 3ID6C 4JQ7A 2QOCA 4GT5A 4OTRA 4UMPA 3QHRA 2PPQA 1H26A 4GCJA 3NVKI 1SZMA 5DNRA 3LPBA 4I6QA 5D11A 2QOIA 3R22A 1FGKA 2VTJA 3Q4TA 1KWPA 3BHHA 4YZMA 4D2WA 5AUZA 5AUWA 3QTQA 3WYXA 4FKLA 4UXQA 4B99A 4EOPA 1YI3A 1Q41A 2UZUE 3A99A 3FMLA 4PP9A 4YJSA 2JKKA 3E92A 4XLVA 3SX9A 4CXAA 2WOUA 4USDA 4R5YA 4KSQA 3LMHA 4USFA 2XAOA 3OOMA 2QHMA 3ZOSA 4L46A 5HTBA 2HELA 4C4HA 3P5JC 4FV9A 2O64A 1KV1A 2ACXA 4NIFB 3PLSA 3UQGA 4ERKA 1ZOGA 2UV2A 4EOJA 3RVGA 3F7ZA 3F3TA 3GC9A 3KL8A 3DBEA 4XG3A 4W4XA 4YO6A 4ZSEA 3V5LA 4F1TA 4AS0A 4R5SA 4GU6A 4GV1A 4O7SA 2WEIA 4AZSA 5GHVA 3LKMA 3WF5A 2CKOA 2XJ0A 4L8MA 3D5XA 3TI1A 3F3UA 1P4FA 5KBQA 4QMZA 3LCTA 3DKFA 5HNBA 4NU1A 4ZTHA 3W8QA 4KINA 4DH8A 4QEBA 2OKRA 3V6RA 4EKLA 5A4CA 3HV3A 4O0UA 4DTBA 2F7ZE 1KE7A 5CF4A 4DG3E 3IECA 4GVAA 2I0EA 2OF2A 2JLDA 3MH2A 4O0SA 4J8NA 4E6QA 3JVSA 3RZBA 4CRLA 5HNIX 3MB7A 3UDTA 1SM2A 1TQIA 5ACBC 3UVPA 2GMXA 4J99A 4BDIA 3BPRA 4C37A 2VTIA 2QHNA 3P86A 3UIUA 4A4OA 4IFGA 4QNYA 1XBBA 1UKIA 2C3JA 1YWNA 2QOLA 3K5UA 4M3QA 4U44A 4IM3A 3UYTA 3VRYA 2XNOA 4C4JA 4RX5A 4BI0A 4TYEA 3RM7A 2PZIA 4PMPA 4AXFA 4OTHA 1BYGA 4ZLOA 4XV1A 3KXXA 5CSWA 1W2DA 4QTEA 4PL4A 3IG7A 3R71A 3D14A 3NAYA 4BBFA 3P1AA 3OWJA 5HZNA 2YFXA 2R3NA 4BI1A 2ZVAA 3G5DA 4O1PA 3SXSA 4NUSA 4WT6A 3IDPA 5CEPA 2YERA 4APPA 3R8ZA 4NYEA 3TZMA 3Q9ZA 1GIHA 5CAUA 3QCYA 2XNPA 3BEGA 4PX6A 3SG8A 3LXLA 1GIIA 4I93A 3RWQA 4HZRA 2CKQA 3EQHA 4WNPA 3UMXA 4JXFA 5AUTA 4BDHA 2O8YA 3EN9A 2ONLC 2VTPA 3ORLA 4G3CA 4F9YA 3RPSA 3VN9A 3SVVA 4DHJA 2PSQA 4E4MA 4IX4A 4KIPA 5KKRB 4EWQA 2VD5A 4NTTA 3S1HA 5JSMA 3PSCA 4FTNA 2QG5A 4IZYA 2QVSE 3NYNA 3U87A 3HECA 4ZZOA 5AEPA 2HY0A 4E6DA 4HNFA 4KNBA 4YJQA 4LL5A 5LARA 4O96A 2B1PA 5CEKA 2H6DA 4IVBA 1M14A 4F09A 1U4DA 1JOWB 2C5NA 2GNLA 2IVVA 3W2PA 4OTIA 3PE1A 3RPRA 2XJ1A 1NVRA 5BUEA 4C36A 4L68A 4FSRA 5AADA 2WU7A 1JKLA 5EDQA 5C03A 4MHAA 3ZUTA 4LDTA 3OCSA 2YLEA 2QU5A 3TT0A 5EOBA 5BPYA 4EH2A 3CTHA 5HICA 2R3JA 4FYNA 3BBTB 3RJCA 4ZAUA 2PVJA 5J7HA 3PJ8A 3MJ2A 4QP4A 4FKIA 5CNNA 4Y95A 4IADA 3R9NA 3BL9A 5GJGA 4JVGA 3TDWA 4MH7A 5TR6A 1WCCA 3PTGA 3K3JA 4NT4A 4YNOA 4BGGA 5L2IA 4P2KA 1PKDA 3ITZA 1XKKA 3PIXA 4G3FA 4N4SA 1XH9A 3PXYA 3ZEWA 3QTZA 4QTCA 3L9MA 4IX3A 3WZDA 5J9LA 5ETIA 4CYIA 5IQCA 4ANMA 4C3FA 3JXWA 4U3YA