4LRJA

Bacterial effector nleh1 kinase domain with amppnp and mg2+
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
163
structure length
160
Chain Sequence
RLSVPGNVIGKGGNAVVYEDAEDATKVLKMFTTSQSNEEVTSEVRCFNQYYGAGSAEKIYGNNGDIIGIRMDKINGESLLNISSLPAQAEHAIYDMFDRLEQKGILFVDTTETNVLYDRAKNEFNPIDISSYNVSWSESQIMQSYHGGKQDLISVVLSKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NleH defines a new family of bacterial effector kinases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Effector NleH1
total genus 51
structure length 160
sequence length 163
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4lrjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4lrjA01
4FZDB 1H01A 5HG8A 2UW5A 3OY3A 4K9YA 2UZOA 3WYXA 4RWIA 3LQ8A 3GENA 3ZUTA 2OO8X 2HY0A 3I0OA 3UGCA 5CLPA 3TIZA 5E91A 4FTTA 5IA1A 2FUMA 3HUCA 3QQGA 5ETIA 4JG8A 3PFQA 1WBWA 4Y85A 3UG1A 4BYIA 3RPYA 4FGBA 4EH2A 5L8LA 1U54A 4XS2A 3S95A 4CFFA 4KIKB 4A9UA 2Y4PA 4FIJA 5BUJA 2J4ZA 1UU3A 3IPHA 4PDOA 5IH5A 3E64A 4BBMA 4B8LA 4XV2A 4D2PA 3FWQA 5CQUA 3A60A 1BL6A 4QMYA 4JRVA 3O8PA 1W84A 3CQWA 1CMKE 1Q8UA 2QOHA 3BU6A 5CEQA 3ZDIA 3A62A 4EOJA 1YXVA 4D2RA 4DINA 3FLWA 4E1ZA 5M57A 1P4FA 5CXZA 3L8XA 4IX3A 1OECA 1GOLA 4FT9A 4QYHA 4S34A 5EW3A 1XWSA 2BDJA 3NAYA 5DI1A 5DWRA 1PXOA 2GNJA 1REKA 4RFMA 2HZIA 2P55A 2QOOA 5FDXA 4B4LA 5K5NA 1OL7A 1TKIA 3RCDA 4QMZA 3L9LA 4PL5A 5FBNC 3LQ5A 3HKOA 2R4BA 2RKUA 5A6NA 4FZFB 3FKLA 5HIBA 3IW4A 5EDQA 4UZHA 4YHFA 2RFEA 4J95A 3Q9YA 3LFNA 4LMNA 3MH0A 5JFWA 3RM6A 3KXGA 5HCXA 4EL9A 1OKVA 3BGZA 2QG7A 5F4NA 1H26A 4HGEA 3TV4A 4RLKA 3RBWA 2ETKA 2HZNA 4I4FA 4YJSA 2VD5A 4PPAA 5KNJA 3R8ZA 3UOJA 3FHIA 4G3CA 3AMBA 3FXXA 1SVEA 3B8QA 4I6BA 4NFMA 2UW4A 3V5WA 3CIKA 2WEVA 2WMQA 5FP5A 3R9HA 3FV8A 3ZFXA 4TWNA 4ACDA 3TDWA 3BHYA 4FOCA 1WBNA 4R1VA 4HPUE 3UP7A 5LQFA 3KY2A 3MDYA 3ZLSA 3FMMA 2QKRA 3GCVA 3UODA 2OF2A 4NW6A 3W2PA 3D0EA 3L1SA 2R3PA 4WO5A 4DYMA 3TJCA 5JQ8A 3RPVA 4UV0A 5A6OA 2CKEA 2B7AA 4DEIA 2NNWB 2ITVA 4XG6A 4LGHA 3V01A 5E9EA 3GFWA 3QYWA 4PTCA 4OW8A 4YZ9A 1JKLA 4BZOA 4G3DA 3F88A 4C37A 5KBQA 3EZVA 4FE2A 3VBTA 2V7OA 3WOWA 4FTNA 3H30A 4PQNA 4EH5A 1OL5A 2QR8A 3D94A 3QGWA 1OPKA 2GNIA 2J6MA 3C0GA 4BCJA 4F6WA 4GV1A 1M2QA 3QRIA 4GIHA 4PTGA 3TN8A 4CKRA 5J9LA 2PK9A 2ZB1A 2ITWA 5FP6A 3COKA 3U9NA 3O17A 4CYIA 4FV8A 4K11A 2QONA 4Y95A 5M53A 2FSTX 4OTFA 3MS9A 4GJ2A 3U54A 1GY3A 3K3IA 3ZRLA 2OJGA 4BTJA 3MYGA 5AP2A 3QLFA 4MWHA 3QL8A 4PRJA 4Y5HA 3RAHA 3V5QA 3PJ8A 1XH7A 5HICA 4K8AA 3D5XA 3V51A 1LP4A 3COIA 4U80A 3M42A 5BMSA 2ZB0A 4JJRA 4GG7A 2XEZA 3HMOA 3ZS5A 5FDPA 3ETAA 3KXHA 3OHTA 4PTEA 3UIXA 4O21A 5EI6A 1W0XC 2JKMA 3QD2B 5L2TA 4G3GA 3G9LX 5CTPA 3KRJA 4D9TA 5HBJA 5LWNA 4DFBA 2ZM1A 5EFQA 2I0VA 1DM2A 2YM4A 3PRFA 4HVGA 3QYZA 4FG7A 5F20A 5CWZA 3V8SA 1Q3DA 3IW5A 4CMTA 4F7NA 2UZBA 2PMOX 3BEGA 2R5TA 2HWPA 4OTIA 5K9IA 4E20A 2WIHA 4CT1A 5CAOA 4D4SA 4ENXA 4EYJA 4ASXA 2YDIA 4EUTA 4L9IA 5J79A 2VTIA 2PL0A 4C4IA 5DE2A 4M3QA 3LCDA 4NH1A 5B2KA 3R7IA 3PXQA 3LCTA 3R8UA 3SW7A 4USDA 3VUTA 2JAVA 3B8RA 2W06A 5M4CA 3KC3A 4CQEA 2R3IA 2LAVA 1BL7A 3BU3A 3GEQA 1HCLA 3LFEA 3P4KA 5CF4A 3UIBA 5E4HA 4FKSA 4ZY5A 2CJMA 2OLCA 5GINE 3WZJA 1NW1A 2AC5A 1OBGA 4AGDA 1U4DA 5HNBA 3PA5A 3FSFA 3I1AA 5LVNA 4KS8A 4U6RA 2WMBA 3SXRA 4TZRA 1HCKA 3SDJA 3LFSA 4DFYA 5JH6A 1CKPA 4PNKA 4HVHA 4I93A 4BBEA 4BY9E 3F2RA 4F08A 4JAIA 4PDSA 3CE3A 3ORMA 1FOTA 3TNQB 1ZWSA 4XOYA 3TT0A 3E88A 3RHXA 2W0JA 4YJPA 1SVHA 3ZZEA 1X8BA 4G17A 4KRDA 1YI3A 2WU6A 4ZSLA 1E1XA 4M7IA 4QMSA 4PDPA 4KABA 2V62A 2DUVA 3FE3A 4UMUA 2W1IA 4R7HA 2IG7A 1PJKA 2ONLC 2W9ZB 3DY7A 4O0WA 4QMVA 3HUBA 4IW0A 5FBOA 4RC3A 3SOAA 4E5WA 4O0VA 2VTSA 3OC1A 3QKKA 1WAKA 5AV0A 3PXYA 3TZ8A 4AW2A 3BI6A 4G34A 4JVGA 3ZM9A 2FB8A 2Z02A 2PY3A 2XA4A 4D0WA 4ID7A 4ZMEA 4UB7A 3UQFA 3NX8A 4O81A 1CTPE 4HYIA 1M14A 2GDOA 3R9DA 3DKFA 2ONLA 4I20A 4BZDA 5A4LA 2WHBA 4YU2A 3OD6X 4GJ3A 4F1MA 5LJJA 3KK8A 2F7EE 4CZTA 4NEUA 2IPXA 5JKGA 1M7NA 4UN0C 1Q8WA 1L3RE 1QPJA 4O0RA 4FK3A 4PMMA 3BWFA 4GT4A 4KBCA 4E5BA 3EQFA 2W1HA 4G6LA 4TNDA 2XKDA 2QHMA 1TQIA 1LR4A 2ITUA 1XHAA 4O7TA 3BEAA 2BRNA 3OBJA 1O6KA 3NYXA 4FT0A 3Q4TA 4NCTC 4QMLA 4CTCA 3QXPA 4PP7A 4O86A 3O7LB 2J5FA 2J0IA 4O84A 2UVXA 3RK9A 3V5TA 3PLSA 5C03A 4KS7A 3O8TA 4XHKB 3V3VA 3HRFA 2PULA 2WB8A 5HE1A 5HZNA 5ETAA 1RW8A 2V55A 5DN3A 5EI2A 2IVTA 4EOSA 2YZLA 1E9HA 3AC5A 4FKPA 4FC0A 4CKIA 5L6PA 3E8CA 3FMDA 4TWCA 5HCYA 4AW0A 3EFJA 4QO9A 1U46A 3SOCA 4ANSA 4CTBA 3ENMA 5JFXA 3R0TA 3DBEA 2PMLX 3CD3A 4FNWA 4C4HA 3VHEA 1KV1A 3ERKA 4RVLA 2QD9A 3MIAA 2BZIB 4ZS0A 2GSFA 3UVRA 4EKLA 5D7VA 4Z16A 4D2WA 4QRCA 4JDHA 2XS0A 2IWIA 1VYWA 3LM5A 5L8JA 4AN3A 1DI9A 4YBKA 5C01A 2YZAA 1S9JA 2QOBA 1TVOA 3A7GA 3ACKA 3MH3A 5IQDA 4UWYA 3KGAA 3TACA 4ZY6A 3HV7A 3ZLWA 2OIQA 4PMPA 3QWJA 1J91A 1OM1A 4YSJA 4EUUA 4C38A 5ETCA 1XO2B 5FLFA 3U4UA 5AP1A 5J9ZA 1GIHA 3R21A 4IM2A 2HELA 1YKRA 5ACKA 4IB3A 2QOCA 3PIZA 4V01A 3VHKA 4RIWA 2BIYA 3CKXA 3P23A 1SYKA 4ZTNA 3BLRA 4FZ6A 5KZ0A 2C5NA 4FL1A 4BKYA 2WQEA 4D9UA 5IQIA 2ITOA 4F64A 2BMCA 4PMSA 3SXSA 3F6XA 3TKIA 5EI8A 4DEGA 2QR7A 3S1HA 2QOKA 2V7AA 3MH1A 3NW6A 4BIBA 4HW7A 4LV8A 4YR8A 2G1TA 5E8UA 3O51A 1JKSA 2X6EA 3SXFA 3PDTA 2PZ5A 4JNWA 5AR2A 3TTIA 2PZPA 4A9RA 5BVDA 2OZOA 5ACBC 3EQBA 3BZ3A 3NUUA 4B7TA 3ID6C 3QUPA 4DGOA 1KE9A 2BRHA 4F1TA 2XMYA 4FI1A 4F99A 5H8EA 4O7SA 4N6ZA 4ZMFA 4I5PA 4DTAA 4GRBA 2VGOA 4YPSA 3ALOA 5JRSA 2W1ZA 3H4JA 3I6UA 4TYJA 5HI2A 3ZZWA 5EQYA 4TW9A 2PMNX 3ITZA 1ZOGA 2ETRA 5T6KA 3MPMA 4AZWA 5AFVA 4IZYA 2GMXA 3RGFA 2XJ2A 2XNGA 3P7AA 4WRSA 1IAJA 4O7VA 4P90A 3DXNA 3HDNA 4F63A 4MKCA 1UA2A 2J0JA 1WMKA 2DYLA 5KKRB 1GZ8A 1E1VA 3RNIA 3RPSA 2OJJA 1MRVA 3IONA 3OMVA 3CPBA 5EOLA 2QI8A 4ZTRA 4H58A 5AUYA 4CKJA 2YIYA 3EIDA 3R7OA 4CXAA 2OIBA 4W9XA 3VRYA 4EC8A 3R1SA 5JGDA 3AD5A 4D2TA 5IF1A 5AIRA 3KMUA 2BALA 1H0WA 4F7SA 5HLWA 4D55A 4LG4A 3BPRA 3VS4A 5GZAA 2DS1A 3VBWA 5A54A 4L45A 4M66A 2W17A 4YZDA 5HBEA 4FL3A 3ZCLA 1MQ4A 3DJ6A 1V1KA 3IK3A 1SM2A 3KF4A 1W7HA 2XK9A 3TKUA 4TWPA 3KFAA 2G2IA 1XH8A 2IN6A 2PSQA 3EKKA 3G90X 4ASDA 2WU7A 4FR4A 5DT0A 3QHWA 4RJ3A 2ZV7A 1CDKA 2YHVA 4GT5A 1BX6A 4NWMA 2JC6A 3EZRA 4M69B 5JN2A 4KIOA 3V8WA 2RFNA 3O96A 5KCVA 4OUCA 4I4EA 4BGHA 3R02A 2UW9A 1AGWA 2C6EA 4JT3A 4FKTA 4DFXE 1J7IA 2NRUA 3POZA 3VQUA 3BHHA 4ENYA 1NVSA 1W8CA 2A2AA 3IOPA 2BVAA 3TDVA 3D83A 3W18A 4DTBA 3OXZA 2O3PA 2VU3A 2J0MB 3MJ1A 4BCIA 4BDCA 1PYXA 2R0IA 4J8MA 3R9RA 5DIAA 4QMPA 1YWVA 3DBCA 2WKMA 5J87A 4DCAA 3EJ1A 2B9HA 1Q5KA 3MA3A 3CGFA 2ITZA 2ACXA 2XIZA 4JAJA 1YHVA 2QNJA 4OT6A 4B9DA 3HGKA 4DEBA 3ZO2A 4R3CA 4FKRA 2UW6A 4FV3A 4JR7A 4G5JA 5DRBA 4ZZMA 3R1QA 3E7OA 1KE5A 2WD1A 3BE9A 3MPTA 4WNOA 2JDSA 4GKHA 4NIFA 4QTAA 4X2NA 3QTUA 4M84A 4QTCA 2WEIA 3EKNA 3EQDA 4L52A 3LFCA 3P79A 5BNJA 1IASA 4FV5A 4IC8A 3W1FA 3TZ7A 5CSXA 3QHRA 5A4CA 4FV9A 2YIRA 4AFJA 4KBAA 2E9OA 3GU7A 1M52A 4FTQA 4E4LA 4D28A 4D2SA 3LFAA 3O50A 4WKQA 2C30A 4AOTA 4EEVA 3Q60A 3VC4A 1K9AA 4J96A 3GNIB 2XKCA 3IO7A 2JBPA 3QTXA 4XBUA 5M4UA 4FEWA 2RGPA 4BCKA 4DBXA 5CEOA 5F1ZA 4YZNA 3LMIA 2F2CB 4ANOA 3T3UA 1LPUA 4P5QA 1FVTA 3UC3A 3ZLYA 2R3NA 4NK9A 3DAEA 3DDQA 3S3IA 4F9YA 2HXQA 5B2MA 3SLSA 3U6IA 2W99B 3RMFA 4FF8A 4YP8A 4IADA 5AIKA 3NW5A 4R7BA 4CG8A 3OVVA 5EYCA 1FMOE 4DTKA 3EQIA 5E8WA 5CEPA 3LE6A 4FVQA 5EKOA 5HG7A 4Q5HA 3CBLA 4YC6A 5HE0A 5I9WA 4EOKA 2HCKA 4NKAA 3R9NA 5M09A 2VTRA 5CASA 2OGVA 1J3HA 4YTIA 4GL9A 5BQ0A 2GQRA 3NNXA 4QYEA 1M17A 3UYSA 2Z8CA 1LEWA 4G2FA 5LVOA 3ZRKA 4TL0A 5J9YA 3BV2A 3VVHA 4TXCA 2HXLA 3HV3A 1ZMWA 3PP0A 4OTDA 5BMMA 3WF7A 5I9VA 5J7BA 5IA2A 2UZEA 4KKGA 4MEDA 4ZJVA 3PLAE 3NLBA 4QP4A 4JR3A 2ZM3A 1H0VA 4O96A 4QYGA 5AR3A 4BDKA 4GVJA 5AUWA 4AACA 4D1SA 4AA4A 5AAEA 3RVGA 3NAXA 3LM0A 4I5HA 3DOGA 4YC8A 4LOOA 4NW5A 2YISA 4KKEA 3BLQA 4QMUA 4WSYA 4MBIA 5ANGA 4C59A 4EK6A 4R5SA 3UO5A 2IVUA 3DBQA 4I5CA 4MTAA 3ZHPC 4RWJA 4IAKA 5ANEA 4XH6A 2HWOA 5IUGA 1FVRA 4FVPA 1Q41A 4ZEGA 2PVJA 4DLJA 1H28A 3OG7A 3R22A 2I40A 4G31A 3L9PA 3UPXA 2IW8A 4EHEA 2X2MA 5EYMA 2R2PA 4IE9A 2R3KA 4FIHA 4B8MA 3SV0A 5CXHA 4EQMA 5AM7A 2XK4A 3CP9A 3MSSA 4DF3A 3MVHA 1PXPA 2HOGA 3GC0A 2HW6A 2QOQA 3CY2A 3I81A 4HPTE 2GTNA 2FSOX 4GKIA 4AE6A 2C5YA 3SGCA 3FQSA 3W32A 5CAVA 2Q0NA 3KMMA 1FQ1B 2WFYA 4TYGA 2VZ6A 4FTOA 4BICA 2XJ1A 5LMBA 1CM8A 2PE0A 3VS6A 3BQCA 3FEGA 1NY3A 5L2SA 4R8QA 3L9MA 3RZFA 5HD4A 4B99A 3LZBA 4XP0A 2B4SB 2C4GA 3KEXA 3DCVA 2HZ0A 2Z7SA 2PUPA 4BKZA 3PZHA 3LCSA 3D7TB 1Q24A 5HBHA 5L6WL 4IACA 3UOLA 4AQCA 5GJGA 3F2NA 3FLQA 5IEYA 5HTIA 4FTKA 2B55A 3OWLA 4YJOA 4G6NA 5J8IA 4FTCA 4O7LA 4FEUA 3PYYA 2BIKB 4XX9A 4CEGA 3I4BA 1UKIA 4U9AA 3CS9A 5AJQA 5DG5A 1U5QA 1KE6A 2I0HA 4DGGA 5LXMA 4BWXA 3MESA 2EVAA 3T9IA 4M0YA 4ZSJA 2ITTA 5IDNA 1WZYA 4C2WA 4DC2A 3IQ7A 2QVSE 4FSYA 1PMEA 4ITHA 1OL2A 2XM8A 3FMJA 4I21A 4F9BA 4JBOA 5IH4A 5J1VA 2VWZA 2WXVA 2HYYA 2ZYBA 2XIRA 1UNLA 1XH6A 2YIQA 1ZYDA 3ZC5A 5LMKA 3E87A 5CSVA 1QCFA 4M14A 4YJNA 1OL6A 1UU9A 4I1ZA 5DBXA 5HO6A 4ZY4A 5C26A 5E8TA 1Q61A 3ORXA 3CQEA 4I41A 3RJCA 4CT2A 1PYEA 4ZLZA 4K77A 2HY81 2WPAA 4F0FA 5KMOA 3W8LA 3AD6A 4UMPA 1Q8YA 2YAAA 3LCKA 3F69A 5G1XA 4BN1A 2IW9A 4BDHA 4ZP5A 3RCJA 3VS7A 4RG0A 4QNYA 4BWKA 4KB8A 4BL1A 2WTKB 4AZVA 4AT3A 1ND4A 2UZVA 3UNKA 4L42A 5JZNA 3KULA 4DEHA 4RX5A 1BUHA 3TTJA 2ZV2A 3GU4A 5IQGA 4W4YA 3A61A 4DFNA 4H3QA 4YBJA 5DRDA 3F5XA 3LQ3A 4FV6A 3VUIA 1YQJA 2XVDA 3OCSA 4U41A 3SHEA 3FZ1A 4J99A 1YRPA 2PZIA 4CV9A 3LXKA 4IWOA 3SC1A 1JOWB 3VO3A 1WFCA 4FUYA 3P7CA 4QNAA 3WF8A 4LMUA 3MTLA 5HVKA 5JZJA 2CSNA 3EN4A 2ZJWA 4IXPA 2G9XA 4BF2A 1I09A 3FI3A 4GG5A 5H8GA 3OS3A 4M8TA 3SRVB 5FWKK 2YERA 2QO2A 3F5UA 4L3LA 2YAKA 3C1XA 4R3PA 1YI4A 3VWAA 1JPAA 4OGRA 4F9AA 3MB6A 2EXEA 3FMLA 3FL5A 4GK3A 2X2KA 3HMMA 3FKNA 4JDKA 4PMTA 3FY0A 4TYHA 3DJ7A 4XG2A 1H4LA 2GNLA 3CC6A 4H1JA 4UXQA 4O7RA 3WZUA 3NUNA 4GUBA 4JX7A 5JQ5A 4MXCA 4ANLA 4IM0A 2CNUA 2YEXA 3ORNA 4Z7HA 4WA9A 3LFFA 1H1SA 2XM9A 3UNJA 4J53A 4N70A 5DR9A 3NVKI 1AD5A 4AP7A 2WIPA 4FMQA 3RAKA 3V5PA 5CAQA 3CTHA 4RZWA 5JSMA 3KREA 1L8TA 2X4ZA 4QMNA 3KL8A 5JRQA 2IW6A 2H6DA 1IG1A 4MBJA 4PL3A 2VTHA 3M11A 2WTKC 3U51A 2CGUA 2WMVA 3EYGA 2ERZE 1SMHA 2EXMA 4IMYA 4KRCA 5K4IA 5ANDA 3E3BX 4EOOA 3RM7A 2XRUA 3ALNA 5EHOA 4X21A 2BAQA 1YWRA 2RG5A 2VUWA 5AAGA 4IZ7A 2EB3A 3UZPA 4V0GB 4BYJA 2C68A 1Y6AA 2C0TA 2YITA 4O1OA 1OKZA 4FG8A 4EOIA 1UWJA 5DFPA 4BCPA 4YNEA 2JDOA 2JKKA 4IDTA 4CRLA 4QP8A 1H07A 4YGAA 5J7HA 1VEBA 4RRVA 2ITQA 4KINA 3UO4A 3V6SA 4E73A 4WNPA 4ZK5A 3T3VA 5HORA 3FI2A 4DAWA 2JKOA 3P08A 4FICA 2XNNA 3R2YA 3MJ2A 4LL5A 4YO4A 1QMZA 4NUSA 2F9GA 1CKJA 1ZXEA 3OWJA 4LGDA 3IECA 4BZNA 4IAZA 4U97A 2CMWA 3DNDA 3QKLA 4FZAB 1OIQA 4BDJA 4HVSA 2VTAA 3JUHA 3CSVA 3NMUF 1WBOA 4YZBA 3DTCA 2VWXA 1PXNA 5E90A 3GGFA 1Y8GA 2H96A 3QQFA 2HZ4A 3PXRA 4QP7A 4HZRA 4FSUA 3LKMA 1ZY5A 4P7EA 4EH9A 1XJDA 2WMRA 3AGMA 3LAUA 2XH5A 5CSWA 3AT3A 3QTWA 1JWHA 4I22A 2NO3A 2OSCA 4MXXA 5D10A 4NTTA 3R7EA 3HECA 2BAKA 4L00A 2JBOA 5BYYA 4MVFA 3I5ZA 4QTDA 1XQZA 3HZTA 4EBVA 4ZZNA 5AP7A 3NCGA 2XNPA 5IISA 1ZAOA 3QUDA 4L7FA 4UXLA 4QYFA 4D5HA 3PVBA 2UW0A 3C4WA 4I24A 4O6EA 2GHMA 4QMWA 4GEOA 5AX9A 3B2WA 5CQWA 4NKSA 4J98A 2YCSA 4CCBA 3F3VA 1OGUA 3QTZA 4X6QC 4ZAUA 1LUFA 3MBLA 2W05A 3FXWA 4GMYA 4X7QA 3KRRA 4E4XA 1APME 1R3CA 4EK4A 2ZAZA 3FJQE 3UNZA 4FKWA 2C3IB 3GOPA 3DAJA 2BTRA 4ALWA 2YM3A 3CGOA 2VO3A 5A4EA 3H10A 4HJOA 2Y8OA 5DOSA 3Q5IA 1ATPE 1UU7A 4FTLA 4NM7A 5K4JA 2F57A 4RVTA 4Y73A 3AG9A 5E92A 2XYUA 3HAVA 4YNOA 4XP3A 4EORA 5HVJA 4FKQA 4MNEB 4YJQA 2WTJA 3V5JA 3OWKA 2O64A 4QOXA 3NS9A 1NXKA 4HCTA 5BYZA 4EYMA 5FGKA 4DFLA 2GU8A 2XNEA 3GFEA 5FTQA 4W8EA 3VIDA 4MXAA 4XG7A 4C57A 3TI1A 4RIWB 4CMOA 4CLIA 5IQHA 3QRJA 3Q9XA 4BDAA 1V0PA 2IJMA 5LCJA 1XR1A 2XRWA 2C3JA 4TYEA 3Q53A 1M2PA 1HOWA 2YIXA 3TNIA 4TTHB 1NVRA 5BUIA 2BRGA 5BVNA 3NUPA 4Z9LA 2PVNA 2QLQA 2WOTA 3R30A 3O71A 4MX9A 4RIOA 5DHJA 2XCKA 2G15A 4FYOA 2ZDUA 3ODYX 3IDPA 4AUAA 2BUJA 2FYSA 2OXDA 3EQPA 1OITA 2XNMA 3OROA 2UW3A 4FKGA 4HGSA 4M68A 3W8QA 4C33A 3C5IA 3IDBA 2AYPA 4RC4A 5HQ0A 4L8MA 2X2LA 4O7WA 3RPOA 2QOLA 2PZRA 2XP2A 2VTLA 2B52A 1OIUA 2Y6MA 3W33A 5AUVA 1M2RA 2W1CA 4MH7A 4DGMA 2QU5A 4X0MA 1W98A 4FK6A 3G51A 1H27A 3C4EA 3BBTB 3OWPA 4NIFB 4RMZA 4U3YA 3QQLA 4U40A 1H25A 5KX8A 3L8SA 4APPA 4XG3A 5AUTA 2JEDA 2I7QA 5EOBA 5HD7A 4D5KA 4M0ZA 5IH6A 2R3HA 3HMPA 3COHA 4C61A 2I6LA 2CGXA 1IA8A 4QQTA 3I7BA 4U7ZA 5D9HA 2OXXA 4RWKA 4EOPA 1YDSE 2QKWB 3DXQA 3VBVA 4QP3A 2W4JA 5I9XA 4EOQA 2GNFA 5JFSA 4MYGA 3U4WA 3E5AA 5FUTA 4RSSA 3ANRA 4C0TA 5GHVA 3QF9A 1Q3WA 3FI4A 3PSDA 3BYVA 4RX8A 3Q04A 4E8AA 5AP4A 5HESA 5J5SA 5IG1A 4FTUA 4XMOA 4UY9A 3QQHA 4ZTLA 3U6JA 1Y57A 4CFWA 4ZIMA 3LJ0A 2F2UA 2GFSA 3MY0A 2XIKA 2VTOA 4YJVA 5BVEA 1WVWA 3FHRA 2XUUA 4GS6A 3N51A 2PMIA 4GU9A 4IVBA 4O0YA 3DKCA 3ROCA 5HTBA 3F3TA 1O9UA 5FQDC 4F09A 5EKNA 3BYMA 2VWYA 2WMTA 5DPVA 3COMA 3QU0A 4TN6A 2WQBA 5T68A 4OTWA 5L6OA 2XK6A 5M08A 2WMWA 1UWHA 4FTRA 3MVJA 2FSLX 2WGJA 2O8YA 1WVXA 5CT7A 4MD9E 3NUAA 4AT5A 3AC8A 4EOLA 5IZFA 4U3ZA 5GIPE 4RPVA 2GQGA 5IEXA 3U9CA 1OUYA 2SRCA 4IFCA 3RALA 3AXWA 2XK7A 4EH6A 1BKXA 4AT4A 3NR9A 4JIAA 3ZTXA 3QD4A 3O8UA 3DBFA 4O7NA 2DWBA 4FSQA 3G9NA 2O5KA 4E3CA 4IANA 4BI0A 4X3FA 3H3CA 5CI7A 4EH7A 3OT8A 4CYJA 4Z55A 4QMXA 5HIEA 4AA5A 4IHPA 1DS5A 4NM3A 4S33A 5H9BA 5K3YA 4ANNA 4D4RA 3A8XA 2IVVA 4FSMA 4I6FA 3OUKA 3RK7A 4HYSA 3GCSA 3FLSA 3AC2A 2XZSA 1PW2A 3LFBA 3FDNA 4MXZA 3U87A 3IGGA 2X6DA 3P7BA 4CVAA 4CG9A 2PUUA 1B38A 3FLYA 4IX6A 1XH4A 3P9JA 4S30A 3O23A 4ONAA 2X9EA 3FZRA 5D11A 1K3AA 4FKUA 5AV3A 2C0IA 3GCQA 3P0MA 4RJ7A 2ITYA 2WO6A 3WZDA 4BIDA 2FVDA 3MGYA 4ZS4A 4YURA 1AQ1A 4IB5A 1OVEA 2H34A 2JGZA 3TV7A 3BQRA 4CNHA 3VS0A 3LMGA 3ACJA 1FINA 4FZ7A 3PE1A 4DGNA 3SVVA 4GFMA 5BVKA 2QOFA 4ZSGA 3Q9WA 2IZSA 3FL4A 4Y5QA 2JDVA 3EWHA 4E26A 3MV5A 4YLJA 2VWIA 5ICPA 3F2AA 3R2BA 4PPCA 2B53A 4TPTA 4LFIA 2WELA 2XK8A 3TIYA 3F3WA 2C1BA 5DLSA 2BPMA 3A4PA 3GC9A 3JYAA 4I94A 1Q8TA 3WF6A 3V8TA 4NL0A 3AGLA 1UNHA 2OJ9A 2X8IA 3OY1A 3RPRA 3WIGA 2VWUA 2EXCX 4RX7A 4WOVA 5E7RA 1H1PA 4JOAA 1ZYSA 5E8ZA 3ZFMA 4D2VA 4Q2AA 4QPSA 5BVWA 3FXZA 4EH4A 3ATTA 4NJ3A 1Q97A 1R1WA 1NT2A 4TYIA 4O2ZA 3RHKA 3VUKA 3F7WA 2OJIA 4I23A 4CQGA 4D1XA 4LGGA 2JIUA 3OT3A 4KIPA 4U0IA 4U44A 4YZCA 4QPMA 5EYDA 5K0KA 3W2OA 4YTFA 3D14A 2PVKA 2YCFA 1GAGA 2ZV9A 4H36A 1BYGA 5AUXA 4G16A 3F9NA 3HA6A 2EUFB 4JBVA 3QD3A 4TT7A 1PHKA 1YOLA 5CALA 3KRWA 4U43A 3ORLA 5CEIA 1F3MC 3AD4A 1YOJA 3Q4UA 4YUQA 5IA4A 4YJTA 4F65A 1QL6A 3U8WA 5F94A 5A14A 4ZOGA 4RIYA 4TNBA 4MF1A 4DLIA 3WZKA 3NIEA 4EI4A 4CZYB 1PF8A 4E6QA 5CANA 4RA4A 4RJ5A 2BROA 4UWCA 4M12A 4FKVA 4BCMA 3MVMA 3JS2A 4AZTA 3QTSA 4AU8A 3PJCA 3IDCA 1KUTA 2J2IB 4KKHA 5HNIX 3UZRA 3FYKX 4R78A 3RZBA 4FBXA 4FIIA 5AUUA 4ZZOA 4USEA 3CR0A 3D9VA 4K6ZA 1F0QA 3R7GA 3W2CA 3PP1A 4C62A 5ANOA 3KULB 3AQVA 4DH5A 1OKYA 2YM7A 4G6OA 5KMIA 5D7AA 3K5VA 3G2FA 3ZEPA 4LV5A 4U42A 3KXNA 3CTQA 2ZMCA 3AC3A 4H39A 4XRLA 3PXFA 3Q96A 5I0BA 4YMJA 4JS8A 2FO0A 4ZSEA 1Y8YA 4QQ5A 4RIXA 5HOAA 2BILB 4XG8A 4E93A 3AC4A 5CU0A 1MQBA 3PVWA 3TG1A 2ITXA 3EFLA 4Y72A 4D1ZA 4EK5A 4DEDA 5I5ZA 4IC7A 3U55A 3KXMA 2F49A 4IVCA 2UZNA 4OAVB 3EFKA 1VZOA 3DLZA 2CNQA 3PUPA 3N4TA 3FSKA 4BC6A 4DBNA 2UW8A 3E92A 4FSRA 4FV1A 2R3GA 4N0SA 4UALA 1OUKA 3GU8A 2QODA 4ZTSA 5IEVA 2XBAA 1XBCA 4QP9A 4BDIA 4F0GA 2PUIA 4O83A 2A19B 3LMHA 3DPKA 3H9FA 4RFYA 3QA0A 3QBNA 5DVRA 4DG2E 3IGOA 4I3ZA 4G3FA 5L8KA 4ZTMA 1YXTA 4C7TA 5HO8A 1IAHA 2JDRA 4O82A 3QTRA 2CCHA 3RINA 4JQ8A 2QURA 3LW0A 1JSUA 3ET7A 4FEQA 3PJ3A 1H24A 5TOZA 3TM0A 2VNWA 5HGIA 3NRMA 3Q52A 4H1MA 4X2GA 2W5BA 5AR4A 1PMVA 5LVMA 2CLXA 3A7JA 1YXXA 2W5HA 3FY2A 4MNFA 3FPQA 3MA6A 2P3GX 4TY1A 4S31A 4F1OA 4FYNA 2DQ7X 2B1PA 3DK7A 4YTHA 3DFAA 5HE3A 2VWWA 2P0CA 5EQEA 4AAAA 3R7UA 4QMQA 5CAPA 4JBQA 4BDDA 2HAKA 3EH9A 4J1RA 3QXOA 5KO1A 1DI8A 3D5UA 3E63A 3Q5ZA 3VRZA 1WBSA 4OTPA 4WNMA 4AF3A 5L4QA 4H05A 4ITJA 5A3XA 3TL8A 2WTWA 3EYHA 4J52A 4X3JA 3QUEA 4WBOA 1W82A 5M44A 4NJDA 3Q2JA 2VNYA 3PY3A 4MQ1A 5KMLA 4AOJA 3E3PA 4AW1A 3OCBA 4RGJA 2X7GA 4XCUA 2GFCA 3MH2A 5TF9A 3MW1A 4BCHA 4EQUA 2C69A 1T46A 3GU6A 3KCFA 3HV5A 4PUZA 2WTCA 5ITAA 3UMXA 3QKMA 2EWAA 4YC3A 4C4FA 3RWQA 3MY1A 3C4ZA 2CPKE 2OWBA 3VJOA 3UJGA 2W4KA 4JG6A 2CLQA 3OBGA 3Q9ZA 4G1WA 3VS1A 5AP6A 3ZXTA 2V5QA 4ACHA 3DKGA 4U45A 3TCPA 5HU9A 3C7QA 5IQCA 4C02A 2R3RA 2ZMDA 5CSPA 2Z7RA 4BTMA 4HYHA 2GS7A 2W1EA 3IKAA 4FODA 4HGLA 1Q62A 2RF9A 1PKGA 3B2TA 2C6IA 2JIVA 4NSTA 5D12A 4O1PA 3EOCA 5CF5A 3BLHA 4E6AA 1UVRA 1JNKA 3VULA 3ZBFA 4EJNA 1BLXA 4JXFA 3VS2A 3TUDA 3JXWA 1W83A 5AP0A 3KCKA 4BFMA 1ZOEA 4L67A 2JFLA 2BHHA 4MBLA 4V04A 3QRUA 4X2FA 3BWJA 4QTBA 4YJRA 5ETFA 1ZARA 4M67A 2Z7LA 5CEMA 4GFGA 4LQMA 2C6LA 3NUYA 3D5WA 4FX3A 4EWQA 4A9YA 1PXKA 4QT1A 4DFUA 3LJ2A 1H08A 5JEBA 5DH3A 3BYUA 1WBPA 2WTDA 1MRYA 4XG4A 5FEEA 3OEFX 5HE2A 4W4XA 4AX8A 2Z7QA 4EH8A 2GHGA 4QMOA 5EQPA 5HG5A 5DYJA 3VW6A 1ZZ2A 3R6XA 3HV6A 1G3NA 3IW7A 4EQCA 4W4VA 5CT0A 1YDTE 4UMTA 3DGKA 3H9RA 4WT6A 1SNXA 3POOA 5TE0A 3QRKA 3R28A 5FM3A 3FAAA 4OLIA 3R7YA 1B6CB 4H3BA 3LOKA 2JLDA 3P5KA 2OJFE 2XKFA 3A7IA 3NDMA 1PXLA 2IZUA 3A99A 3IOKA 4M97A 3EQRA 4QMTA 4C3PA 4D4YA 5DA3A 3R8VA 1UNGA 2PE1A 3MN3A 4I0TA 1Q4LA 1PXIA 2C3LA 4OBPA 4Q9SA 1WCCA 3PSCA 4S32A 1ZMUA 4F9CA 4BWPA 3BELA 4HCUA 3DXPA 5AMNA 3ORPA 4C8BA 3K2LA 4Z3VA 1J7LA 3GC7A 4R6VA 4F0IA 4KAOA 3FQHA 3MIYA 4WD5A 4W4WA 2P33A 3BE2A 5FG8A 4AW5A 5A9UA 5FTGA 2W1FA 1TQMA 4FKOA 4I6HA 2X1NA 4WUNA 1TQPA 4WG5A 3VQHA 1SVGA 4NT4A 2YDKA 1PKDA 4KWPA 1PMNA 5EW8A 1G8SA 5EM5A 1OL1A 3TZMA 1NVQA 3A2CA 4D4VA 3JR1A 1RDQE 3DA6A 4RA5A 2YLEA 5GJDA 3NYVA 4GSBA 2XNBA 4ZJJA 3QALE 4AZFA 5D41A 4ACGA 1PY5A 5LCKA 2GHLA 5J5TA 3F82A 2OBJA 4OR5A 4BI2A 2YIWA 2BAJA 3CLYA 3ZYAA 5AA8A 4J7BA 4RVMA 1GIJA 3TNWA 3FMKA 2Y6OA 3S2PA 4AOIA 1BI7A 1OZ1A 4ZSAA 5JGAA 3ZRMA 3EL8A 2IZRA 2GTMA 2WQOA 3VF8A 3QTQA 4QD6A 1JLUE 3UTOA 1H8FA 4XP2A 4ZTHA 2J90A 4IDVA 4ANQA 5C27A 4Q5EA 3R04A 2C6DA 2YCRA 4N6YA 1U59A 4C36A 4F7LA 4DEAA 5IUHA 5EH0A 5IA3A 3WIKA 2J5EA 3F66A 3QWKA 4IFGA 3FZPA 4BDEA 2QC6A 4FV7A 3RAWA 1YI6A 4IIRA 4FIEA 3VS3A 4FKLA 4KUJA 2RIOA 3FPMA 4PWNA 5AV4A 3HP2A 5M4FA 4DEEA 2QO7A 4O27B 4FKIA 4TWOA 4FEXA 3OZ6A 3QQJA 2O65A 1GNGA 3QFVA 1JKTA 4PX6A 4YZMA 3PIYA 3BU5A 2GPHA 5IA5A 5IUIA 5AWMA 2ZV8A 4Q9ZA 5KMJA 4ITIA 3NVMB 5A4TA 5FD2A 2UVYA 1JSTA 2ERKA 4AN2A 4FT5A 4AS0A 5L2QA 2XNOA 3KMWA 4PPBA 3LJ1A 1BI8A 4CCUA 3OW3A 2E9VA 4K33A 3KK9A 4HGTA 2YJRA 2BFYA 2GNGA 5IQBA 3F61A 1RQQA 1REJA 1ZYCA 2XK3A 5CI6A 3R8MA 1J1BA 2F7ZE 2J51A 4HVDA 5AR5A 2C5XA 2QOIA 4XNEA 5E8XA 3G0EA 3GP0A 3ORZA 4ERWA 4DA5A 2CHLA 5DEWA 1Q8ZA 2ZM4A 2VTTA 4N4SA 4V0GA 5EDRA 1GZKA 2R64A 3ORKA 3EQHA 4L6QA 4BCFA 2OG8A 4IWPA 4MAOA 1PRYA 2CKQA 4P5ZA 4DH7A 2Q83A 3K54A 3LFDA 3UG2A 1CSNA 4IAAA 4L3PA 3RAIA 5CNNA 2B9IA 4KA3A 3VN9A 3UVQA 4ALUA 5DGZA 3ROYA 1IEPA 4MXOA 3HL7A 2VV9A 4X6RA 4HVIA 5HNGA 4XJ0A 5JMSA 3DKOA 4BRXA 4JI9A 3Q4ZA 2WTIA 4O2PA 3D2IA 4OT5A 4E6DA 5GNKA 3HV4A 3JY9A 4NYEA 4U79A 3RNYA 2BDWA 1OPJA 4CMUA 4II5A 5BX0A 4JLCA 5CZHA 2JDTA 4KSQA 5HIDA 4KBKA 4O7YA 1OBDA 4EZ5A 5CSHA 3NEWA 4LOQA 1FPUA 1Y91A 5M55A 4A4OA 4XUFA 1KOAA 3K3JA 5K0XA 3BX5A 3CXWA 4G9CA 3OTVA 2BZKB 2OI4X 3PXZA 2YABA 4FNYA 1VR2A 2X4FA 4RZVA 1XBBA 4C4GA 3K5UA 1MUOA 4D0XA 2PVMA 3II5A 5BPYA 3H0ZA 3TUCA 3UPZA 4FSWA 4GUEA 4XLVA 3TZ9A 5B7VA 5KHXA 2PPQA 3ZONA 3R1YA 1KE7A 1MRUA 3R83A 4R1YA 5HTCA 2C5VA 4CSVA 2B9JA 3W10A 2WTVA 4QP1A 2O63A 1V0BA 3TV6A 2P2HA 3WF5A 3Q32A 4BHNA 2R9SA 2UZLA 4D58A 5IMEA 3BIZA 2VX1A 5D1JA 3THBA 4UMRA 2GNHA 3O0GA 2JD5A 5L2IA 3HDMA 4C4JA 3R01A 3VUGA 5M06A 4IWDA 2VN9A 3DDPA 3MFTA 3GCPA 1GZOA 2JITA 3DAKA 3N4VA 5B0XA 4EKKA 2AUHA 4LRJA 4O91A 5HHWA 4EBWA 2BZHB 4NTSA 4E4NA 3JVSA 2ZOQA 4YHTA 5GZ8A 2FGIA 3I0QA 3KN5A 1MP8A 4O38A 3ORIA 3VW8A 3KVWA 4G3EA 4AA0A 1IRKA 2QG5A 2QQ7A 3TEIA 3D4QA 3R63A 1KE8A 2PE2A 3H0YA 5CYIA 3LXPA 5AM6A 3R9OA 4AZSA 5I9ZA 5JK3A 2GQSA 1URWA 2W4OA 1P14A 3PY0A 3C4XA 3LVPA 2CN5A 4JRNA 4KD1A 3EL7A 3BHVA 4BCGA 5L3AA 4BGQA 3L8VA 2XIXA 2B9FA 4TYHB 1JSVA 4YJUA 3QQKA 5DR6A 3SD0A 2G2FA 5LOHA 3I7CA 4K2RA 4YTCA 3NIZA 3LPBA 2J0KA 2R3FA 3KRLA 5H3QA 4HNIA 4JX3A 1B39A 1R0PA 2VWBA 5HG9A 3EQGA 5CU4A 2Z2WA 2W1GA 4MXYA 3C0HA 4PP9A 2ESMA 2OKRA 4FTJA 3ZMMA 4IZAA 1CKIA 3HAMA 3OP5A 5DNRA 5F95A 1A9UA 3R1NA 4C3FA 2QO9A 4DHFA 4ZLYA 4LUDA 2X81A 3SX9A 2OFUA 3D7TA 2REIA 3QZHA 4JIKA 4QYYA 3ZO3A 2Y4IC 2VWVA 2Y7JA 2OZAA 3G33A 1EH4A 1XKKA 4IJ9A 2C5OA 4LOPA 4YO6A 3C4CA 4X3FC 3QX2A 3ZEWA 4CZUA 3UVPA 3OCTA 3LLAA 3PVGA 3I60A 4C34A 2ZVAA 1K2PA 4RIYB 4Z7GA 4EK3A 4M13A 4Y46A 4C58A 5GZ9A 2YLFA 2OH0E 4JBPA 2ETMA 2FA2A 2YDJA 5CENA 3DBDA 4O22A 5EM8A 3UQGA 3UYTA 3QGYA 3ZH8A 4DE4A 4X2JA 3KF7A 3Q6UA 4AXAA 5CVGA 2WMUA 4RLLA 4FV4A 1ERKA 5I4NA 3VNTA 5A46A 4GIIA 4HZSA 3UIMA 4Y83A 3A7HA 2PWLA 4MWIA 3FYJX 5E1EA 3W55A 4QPAA 1VYZA 3QC4A 4XBRA 2CKOA 2XYNA 1GJOA 5GIOE 5J95A 2CGVA 4NM0A 3KA0A 4OTHA 3DZOA 4RQVA 3W2QA 4YLKA 5I3OA 4UYAA 5G6VA 4DGLC 2VX0A 5DEYA 3ORTA 3D15A 4XG9A 5ANIA 4FTMA 4CRSA 2YWVA 3OEZA 4TRLA 3BBWA 3PJ2A 4GCJA 5LVLA 4BDBA 3U6HA 2G2HA 3NZ0A 3RK5A 4DFZE 3ELJA 3NWWA 3S4QA 4I5MA 2AC3A 1OIYA 3VAPA 4C4EA 5IMXA 4A9SA 4WSQA 2YM6A 3I5NA 4KIQA 3T8OA 3FI8A 3LXLA 1S9IA 3CQUA 4NFNA 5HX8A 4RVKA 2IO6A 3PXKA 4WUAA 2PZYA 5EHYA 5M07A 2IVSA 3LCOA 3E93A 4W9WA 4EH3A 4BHZA 5CU3A 2B0QA 4ANMA 4EZ3A 3TUBA 1YOMA 4F9WA 4CFUA 5JFVA 4BCQA 5AV1A 3ZUVA 3IG7A 2C6MA 3AT2A 1NA7A 1FMKA 4H3PA 3ZSHA 3DV3A 4ZXTA 4BCNA 3H9OA 4XYFA 5AR7A 1O6YA 3C5UA 3BGQA 4F4PA 5CX9A 4IB1A 3C0IA 3KN6A 4OTRA 4DG0E 1ZY4A 4J71A 4ZTQA 5AUZA 5FXRA 1OPLA 3OCGA 4E4MA 4R5YA 3HX4A 3LLTA 3C50A 3C51A 4DCEA 2OH4A 2O0UA 5AV2A 1OKWA 1Z5MA 2E9NA 4MNEA 5CZIA 5GJFA 5HCZA 4A4XA 4BTFA 4B6LA 4PNIA 5HLNA 2C1AA 3RKBA 4EWHA 3ZSGA 1RJBA 1FGIA 4QP2A 1G5SA 2E9PA 4HYUA 4RWLA 1SZMA 4IH8A 3NNUA 4A9TA 4IX4A 2I1MA 3BHUA 4JQ7A 3G6GA 3NCZA 3PWDA 3SRVA 4A4LA 3G15A 4FGRA 3GT8A 3FZTA 5AAFA 2VX3A 2Y4IB 2WOUA 3CKWA 3QCYA 4RIXB 1QPEA 5M51A 3ANQA 2A1AB 4AFEA 3QZFA 5CY3A 3LFQA 4X2KA 3FZOA 4ERKA 4ZLOA 3EB0A 5HKMA 4AN9A 2OZAB 3CY3A 3OUNB 3C9WA 4BI1A 2HENA 2BHEA 2XIYA 3SG8A 5EDPA 4GK4A 3NUXA 2R7IA 4BR3A 3FZSA 2X8EA 3HRCA 2B54A 1JBPE 4FT7A 3AOXA 3VS5A 4AE9A 4QMMA 4A7CA 2VTMA 4UYNA 3G5DA 4ASZA 1U5RA 4WBBB 3UBDA 3SKCA 4WNKA 2BTSA 4A06A 4DG3E 4IJPA 2BCJA 2C6KA 4I0RA 5AP3A 3LIJA 4B0GA 2QCSA 3DB8A 3PPZA 5HX6A 2UZWE 3VUDA 5BVFA 2VTPA 3GXLA 1RE8A 2F4JA 2LGCA 2UVZA 1YW2A 1ZYLA 1T45A 3BYOA 4O0XA 4M15A 4BGGA 5BVOA 3VBXA 4LYNA 4OAUC 3HNGA 4RFZA 3Q6WA 3NPCA 3HYHA 4MK0A 2NP8A 3NNVA 4C2VA 3DZQA 5BUEA 3PG3A 5E8SA 3MFRA 3KQ7A 4GK2A 4IB0A 3HEGA 3TJDA 5C8KA 3E8EA 4BVUA 1DAYA 2GCDA 3PWYA 4C3RA 3MPAA 2R0UA 3KB7A 1WBVA 3P78A 5H8BA 5KZIA 4MD8E 5C1QB 3WILA 4QQCA 2BFXA 3MB7A 3R7VA 1DAWA 2YN8A 3TKHA 4FNXA 3GU5A 2PVHA 2BR1A 2I0EA 4WG3A 4BDGA 4CGAA 4PY1A 1YVJA 4PF4A 4XOZA 2OIDA 5LWMA 4MQ2A 3HA8A 4I6QA 4ACMA 4PL4A 3KKVA 4FG9A 2XJ0A 4AGCA 5FEQA 4ARKA 2YCQA 3P86A 2UZTA 3F3UA 1FGKA 4RQKA 4L7SA 3QCSA 1JKKA 4R3RA 5EK7A 2W7XA 3HP5A 3Q3BA 5C8NA 4QP6A 3OOGA 5TKDA 3RTPA 5I9YA 2C3KA 3C4FA 2PYWA 2OXYA 5BYLA 3I79A 2Z60A 1H1QA 5HVYA 2W5AA 3RI1A 2NPQA 4E7WA 2PVFA 2G01A 4LRMA 3GVUA 4FUXA 3PJ1A 3ZUUA 4CFNA 5AEPA 3N4UA 3VUMA 4MHAA 5IPJA 4L43A 3E8DA 3UO6A 5LMKC 2RL5A 3GOKA 2FSMX 2PVYA 4IZ5A 3WYYA 4R7IA 2A27A 2WMSA 5KMNA 1XH5A 5KMMA 4CFXA 2HK5A 2Y0AA 1YWNA 2PVLA 4LL0A 3W16A 3KXZA 4GH2A 2OK1A 4PDYA 3QC9A 1UV5A 3TNPC 2X7FA 3PPJA 1R78A 3UMWA 4O6LA 4GU6A 3PZEA 2UZUE 5CS6A 5E1SA 3TXOA 4IAFA 4WIHA 4LM5A 1KWPA 1Z9XA 5M4IA 1QPCA 3OXTA 3IW6A 3AMYA 3BRBA 3W2SA 3CPCA 3PVUA 2UV2A 4BKJA 1OMWA 3ZBXA 4P4CA 4EK8A 3O2MA 1FBNA 5E8VA 3ZU7A 4USFA 3ENHA 4RJ8A 3FMHA 5C9CA 3I6WA 3R8PA 3ULIA 5CF8A 4K18A 2VO7A 4CD0A 5TO8A 4UMQA 3EN5A 5EM7A 1GZNA 3QQUA 2NRYA 3SQQA 5A4QA 5HLPA 5IU2A 3CJFA 4F6SA 2C47A 3WE4A 1J1CA 4ORKA 2WZJA 1JVPP 2GS2A 2UUEA 4DN5A 4IQ6A 3LXNA 3PPKA 4IVAA 4TKSA 4FEVA 4GFOA 1BMKA 3Q2MA 3ZDUA 2J0LA 1J7UA 3BGPA 2PTKA 4ASEA 3WE8A 3UOKA 3BCEA 3FLZA 3QD0A 4HNFA 5CU6A 4L3JA 4DH1A 3KVXA 3S00A 3E62A 2A0CX 4YPDA 2RFDA 5KHWA 3CD8A 2W9FB 3BHTA 3QZGA 2CKPA 3PY1A 2H9VA 1XBAA 4NZWB 4WRGA 3KXXA 2KULA 4ALVA 1A48A 3JPVA 2BDFA 2R3JA 4GT3A 4BDFA 3DK3A 1G8AA 3DB6A 3EQCA 3GCUA 3DJ5A 4ANBA 4V05A 1VJYA 3DT1A 4OTGA 4RC2A 2VAGA 4EONA 2JKQA 1JAMA 3VBYA 3HVCA 4K1BA 3GB2A 4FTAA 4EZ7A 2UW7A 3FUPA 1ZMVA 2YJSA 4DH3A 4ACCA 1OIRA 4RX9A 3UDBA 3RWPA 5JGBA 2VTQA 3FLNC 5EYKA 2WMXA 3OOMA 1U54B 3QAME 2J9MA 4AZEA 1UU8A 3NUSA 4L46A 1LEZA 2C0OA 3HMNA 5IDPA 3R00A 5J1WA 3R73A 4RBLA 2RG6A 4LI5A 4FTIA 5DMZA 4E6CA 3T9TA 4CV8A 2ITPA 2W96B 4MD7E 3F3ZA 5IQEA 3NW7A 3S0OA 1P4OA 3DLSA 4O0SA 4EHGA 2JAMA 1IR3A 1YHWA 2BRBA 3PA4A 2QU6A 2VGPA 2QHNA 2E9UA 4DT8A 4OBQA 4EC9A 4EHZA 5EHLA 3ZLXA 4G5PA 4JDIA 5DT3A 5HO7A 1ZOHA 3BV3A 3UOHA 4E5AX 3DS6A 5CVHA 5H2UA 5I9UA 2XBJA 4W8DA 4R77A 4DITA 5TR6A 3R8LA 2JIIA 5FXQA 3EN6A 1I44A 5AP5A 2CGWA 4XLIA 3OF0A 4APCA 4XV3A 3WF9A 2R7BA 3MWUA 4PV0A 3ODZX 2EB2A 5AADA 2WQNA 2WNTA 5L2WA 4MF0A 2XEYA 5EM6A 3ULZA 1KV2A 4U81A 4AWIA 2BKKA 2C6OA 2V22A 4ZJIA 2OU7A 5CU2A 3BYSA 4FKJA 2R3LA 1H1RA 4FA2A 3D2KA 3AC1A 3TWJA 4BCOA 4GVAA 3OXIA 3OW4A 3ZC6A 2PU8A 3P1AA 3A7FA 2YM8A 5CF6A 3RP9A 3UP2A 3HRBA 3EN7A 5EW9A 3GBZA 3FBVA 2C6TA 3CJGA 2Y9QA 3GQLA 2R3QA 2X7OA 3WBLA 2WQMA 3VBQA 1ZRZA 4XRJA 3PE2A 5ANJA 3E7VA 1WVYA 2OICA 3QLGA 5HU3A 3TNHA 4GYGA 1F5QA 3G0FA 3ZXZA 3WZEA 4FV0A 5LVPA 3UZTA 1JQHA 3DNEA 4RJ6A 3JY0A 4Y8DA 2I0YA 5IQAA 3MFUA 1H00A 1O6LA 1ZYJA 3WARA 4LRKA 5E8YA 3EFWA 5TT7A 4WG4A 2IZTA 4IAIA 3UE4A 4FIFA 4GYIA 1M7QA 3QX4A 3ZOSA 2BRMA 3NYNA 3F5PA 3G6HA 2J7TA 4FNZA 4NU1A 4YSMA 3JVRA 4O0TA 3C13A 4GW8A 2EU9A 4J97A 2H8HA 4NCTA 2XF0A 3VUHA 4FV2A 3PSBA 4L44A 3O7LD 3FMEA 3L9NA 3R71A 4M69A 4AGWA 5M56A 1IA9A 3MFSA 3CCNA 3FMNA 2WMAA 5CVFA 3EHAA 4XV1A 2CDZA 4J8NA 1KOBA 2Q0BA 1SNUA 4AG8A 5KBRA 4L68A 4OTQA 3F7ZA 2VO6A 3QCQA 3DFCB 2CN8A 3ZO1A 3E8NA 3QRTA 3A8WA 4BB4A 4UEUA 1R39A 4JQEA 4FT3A 5KKRC 2O2UA 2XKEA 4F70A 2OFVA 1PMUA 3NSZA 4UX9A 1ZZLA 4IAYA 2HIWA 4O7ZA 5DR2A 5AX3A 3Q4CA 4FIGA 3WI6A 3CEKA 5FRIA 3QA8A 4JDJA 2V0DA 2CNVA 2R3OA 4YLLA 4CLJA 1YXSA 4L01A 4HCVA 1WBTA 2R3MA 3NGAA 3GI3A 1P2AA 3W2RA 3ATSA 3NYOA 5C4KA 1Q99A 3DK6A 2FH9A 3FC2A 2VTJA 4QQJA 3KU2A 1PXJA 4U5JA 3VF9A 4FSNA 2E2BA 1H1WA 3MVLA 1KSWA 3F5GA 5FXSA 3PA3A 5T3QA 2X0GA 4QTEA 3OFMA 3D5VA 5FTOA 3N9XA 3QZIA 4NM5A 5FEDA 4IX5A 3SA0A 3AMAA 2ZDTA 4N57A 4X3FB 1XH9A 4MCVA 2P2IA 5IA0A 2YACA 2BZJA 2OW3A 4XV9A 3M2WA 2F7XE 4KIKA 3PIXA 3SG9A 4CFVA 2X8DA 4UZDA 2X39A 2OF4A 3GUBA 4RJ4A 5KUPA 5AR8A 3BKBA 2PUNA 2HW7A 2RFSA 4JL9A 4JG7A 3REPA 3V5LA 3EN9A 2JFMA 5ANKA 4XEYA 5FM2A 1PXMA 1QPDA 4IBMA 4KSPA 5DT4A 1ZLTA 3SAYA 3V04A 4CFMA 3A4OX 3DQXA 3OTUA 3MY5A 5KE0A 5LMAA 5CAUA 3QCXA 3NNWA 2VO0A 2W1DA 3D7ZA 4F7JA 1URCA 4EJ7A 4FSTA 3GC8A 4FOBA 4I92A 4IVDA 2BKZA 3HMIA 2WAJA 3UC4A 4AGUA 4BTKA 3PRIA 3UIUA 3V6RA 4DT9A 4P2KA 5C8MA 4EOMA 1P5EA 1OB3A 2X9FA 5EG3A 4I0SA 4C35A 1GIIA 3ZSIA 1YHSA 4IM3A 1Z57A 4U8ZA 5CEKA 5LARA 3ZM4A 1FVVA 3UQCA 3QTIA 5IKWA 2P4IA 2KTYA 2QLUA 3PTGA 1OI9A 2CCIA 3HLLA 4IWQA 3ZFYA 4K0YA 2YWPA 3IS5A 4BIEA 1STCE 1YXUA 3ZO4A 3FKOA 4BBFA 3FQEA 1YDRE 2PVRA 4HOKA 1Y6BA 3FC1X 2VTNA 4UWBA 5AA9A 4FL2A 2VRXA 5B2LA 3LHJA 5K5XA 2GS6A 4EHVA 3CTJA 3MTFA 5KMKA 4KNBA 2J50A 3SW4A 5F9EA 3IW8A 3PG1A 5HEZA 4UBAA 2PHKA 2RSVA 2ITNA 2XB7A 5I3RA 4F6UA 5CNOA 5IQFA 4LUEA 4O0UA 2XCHA 4WHZA 2YA9A 4L53A 4DH8A 1UKHA 5JT2A 1A06A 4YHJA 3L8PA 2UZDA 4FSZA 4G9RA 4RT7A 3MI9A 2YFXA 4FVRA 5C4LA 3DQWA 4IEBA 3KRXA 4S2ZA 3EMGA 3VJNA 3AT4A 4A07A 1R0EA 3M1SA 3DTWA 4OBOA 2YM5A 1V0OA 3DU8A 3GQIA 2A4LA
chains in the Genus database with same CATH superfamily
4FZDB 1H01A 5HG8A 2UW5A 3OY3A 4K9YA 2UZOA 3WYXA 4RWIA 3LQ8A 3GENA 3ZUTA 2OO8X 2HY0A 3I0OA 2IEWA 5CLPA 3UGCA 3TIZA 5E91A 4FTTA 5IA1A 2FUMA 3HUCA 3QQGA 5ETIA 4JG8A 3PFQA 1WBWA 4Y85A 3UG1A 4BYIA 3RPYA 4FGBA 4EH2A 5L8LA 1U54A 4XS2A 3S95A 4CFFA 4KIKB 4A9UA 2Y4PA 4FIJA 2AQXA 5BUJA 2J4ZA 1UU3A 3IPHA 4O4DA 4PDOA 3E64A 4BBMA 5IH5A 4B8LA 4XV2A 4D2PA 3FWQA 5CQUA 3A60A 1BL6A 4QMYA 4JRVA 3O8PA 1W84A 3CQWA 1CMKE 1Q8UA 2QOHA 3BU6A 5CEQA 3ZDIA 3A62A 4EOJA 1YXVA 4D2RA 4DINA 3FLWA 4E1ZA 5M57A 1P4FA 5CXZA 3L8XA 4IX3A 1OECA 1GOLA 4FT9A 4QYHA 4S34A 5EW3A 4AQKA 1XWSA 2BDJA 3NAYA 5DI1A 5DWRA 1PXOA 2GNJA 1REKA 4RFMA 2HZIA 2P55A 2QOOA 5FDXA 4B4LA 5K5NA 1OL7A 1TKIA 3RCDA 3BLAA 4QMZA 3L9LA 4PL5A 5FBNC 3LQ5A 3HKOA 2R4BA 2RKUA 5A6NA 4FZFB 3FKLA 5HIBA 3IW4A 5EDQA 4UZHA 4YHFA 2RFEA 4J95A 3Q9YA 3LFNA 4LMNA 3MH0A 5JFWA 3RM6A 3KXGA 5HCXA 4EL9A 1OKVA 3BGZA 2QG7A 3TYKA 5F4NA 1H26A 4HGEA 3TV4A 4RLKA 3RBWA 2ETKA 2HZNA 4I4FA 4YJSA 2VD5A 4PPAA 5KNJA 3R8ZA 3UOJA 3FHIA 4G3CA 3AMBA 3FXXA 1SVEA 3B8QA 4I6BA 4NFMA 2UW4A 3V5WA 3CIKA 2WEVA 2WMQA 5FP5A 3R9HA 3FV8A 3ZFXA 4TWNA 4ACDA 3TDWA 3BHYA 4FOCA 1WBNA 4R1VA 4HPUE 3UP7A 5LQFA 3KY2A 3MDYA 3ZLSA 3FMMA 2QKRA 3GCVA 3UODA 2OF2A 4NW6A 3W2PA 3D0EA 3L1SA 2R3PA 4WO5A 4DYMA 3TJCA 5JQ8A 3RPVA 4UV0A 5A6OA 2CKEA 2B7AA 4DEIA 2NNWB 2ITVA 4XG6A 4LGHA 3V01A 5E9EA 3GFWA 3QYWA 4PTCA 4OW8A 4YZ9A 1JKLA 4BZOA 4G3DA 1G8JA 3F88A 4C37A 5KBQA 3EZVA 4FE2A 3VBTA 2V7OA 3WOWA 4FTNA 3H30A 4PQNA 4EH5A 1OL5A 2QR8A 3D94A 3QGWA 1OPKA 2GNIA 2J6MA 3C0GA 4BCJA 4F6WA 4GV1A 1M2QA 3QRIA 4GIHA 4PTGA 3TN8A 4CKRA 5J9LA 2PK9A 2ZB1A 2ITWA 5FP6A 3COKA 3U9NA 3O17A 4CYIA 4FV8A 4K11A 2QONA 4Y95A 5M53A 2FSTX 4OTFA 3MS9A 4GJ2A 3U54A 1GY3A 3K3IA 3ZRLA 2OJGA 4BTJA 3MYGA 5AP2A 3QLFA 4MWHA 3QL8A 4PRJA 4Y5HA 3RAHA 3V5QA 3PJ8A 1XH7A 5HICA 4K8AA 3D5XA 3V51A 1LP4A 3COIA 4U80A 3M42A 5BMSA 2ZB0A 4JJRA 4GG7A 2XEZA 3HMOA 3ZS5A 5FDPA 3ETAA 3KXHA 3OHTA 4PTEA 3UIXA 4O21A 5EI6A 1W0XC 2JKMA 3QD2B 5L2TA 4G3GA 3G9LX 5CTPA 3KRJA 4D9TA 5HBJA 5LWNA 4DFBA 2ZM1A 5EFQA 2I0VA 1DM2A 2YM4A 3PRFA 4HVGA 3QYZA 4FG7A 5F20A 5CWZA 3V8SA 1Q3DA 3IW5A 4CMTA 4F7NA 2UZBA 2PMOX 3BEGA 2R5TA 2HWPA 4OTIA 5K9IA 4E20A 2WIHA 4CT1A 5CAOA 4D4SA 4ENXA 4EYJA 4ASXA 2YDIA 4EUTA 4L9IA 5J79A 2VTIA 2PL0A 4C4IA 5DE2A 4M3QA 3LCDA 4NH1A 5B2KA 3R7IA 3PXQA 3LCTA 3R8UA 3SW7A 4USDA 3VUTA 2JAVA 3B8RA 2W06A 5M4CA 3KC3A 4CQEA 2R3IA 2LAVA 1BL7A 3BU3A 3GEQA 1HCLA 3LFEA 3P4KA 5CF4A 1G8KA 3UIBA 5E4HA 4FKSA 4ZY5A 2CJMA 2OLCA 5GINE 3WZJA 1NW1A 2AC5A 1OBGA 4AGDA 2XANA 1U4DA 5HNBA 3PA5A 3FSFA 3I1AA 5LVNA 4KS8A 4U6RA 2WMBA 3SXRA 4TZRA 1HCKA 3SDJA 3LFSA 4DFYA 5JH6A 1CKPA 4PNKA 4HVHA 4I93A 4BBEA 4BY9E 3F2RA 4F08A 4JAIA 4PDSA 3CE3A 3ORMA 1FOTA 3TNQB 1ZWSA 4XOYA 3TT0A 3E88A 3RHXA 2W0JA 4YJPA 1SVHA 3ZZEA 1X8BA 4G17A 4KRDA 3UDTA 1YI3A 2WU6A 4ZSLA 1E1XA 4M7IA 4QMSA 4PDPA 4KABA 2V62A 2DUVA 3FE3A 4UMUA 2W1IA 4R7HA 2IG7A 1PJKA 2ONLC 2W9ZB 3DY7A 4O0WA 4QMVA 3HUBA 4IW0A 5FBOA 4RC3A 3NFGB 3SOAA 4E5WA 4O0VA 2VTSA 3OC1A 3QKKA 1WAKA 5AV0A 3PXYA 3TZ8A 4AW2A 3BI6A 4G34A 4JVGA 3ZM9A 2FB8A 2Z02A 2PY3A 2XA4A 4D0WA 4ID7A 4ZMEA 4UB7A 3UQFA 3NX8A 4O81A 1CTPE 4HYIA 1M14A 2GDOA 3R9DA 3DKFA 2ONLA 4I20A 4BZDA 5A4LA 2WHBA 4YU2A 3OD6X 4GJ3A 4F1MA 5LJJA 3KK8A 2F7EE 4CZTA 4NEUA 2IPXA 5JKGA 1M7NA 4UN0C 1Q8WA 1L3RE 1QPJA 4O0RA 4FK3A 4PMMA 3BWFA 4GT4A 4KBCA 4E5BA 3EQFA 2W1HA 4G6LA 4TNDA 2XKDA 2QHMA 1TQIA 1LR4A 2ITUA 1XHAA 4O7TA 3BEAA 2BRNA 3OBJA 1O6KA 3NYXA 4FT0A 3Q4TA 4NCTC 4QMLA 4CTCA 3QXPA 4PP7A 4O86A 3O7LB 2J5FA 2J0IA 4O84A 2UVXA 3RK9A 3V5TA 3PLSA 5C03A 4KS7A 3O8TA 4XHKB 3V3VA 3HRFA 2PULA 2WB8A 5HE1A 5HZNA 5ETAA 1RW8A 2V55A 5DN3A 5EI2A 2IVTA 4EOSA 2YZLA 1E9HA 3AC5A 4FKPA 4FC0A 4CKIA 5L6PA 3E8CA 3FMDA 4TWCA 5HCYA 4AW0A 3EFJA 4QO9A 1U46A 3SOCA 4ANSA 4CTBA 3ENMA 5JFXA 3R0TA 3DBEA 2PMLX 3CD3A 4FNWA 4C4HA 3VHEA 1KV1A 3ERKA 4RVLA 2QD9A 3MIAA 2BZIB 4ZS0A 2GSFA 3UVRA 4EKLA 5D7VA 4Z16A 4D2WA 4QRCA 4JDHA 2XS0A 2IWIA 1VYWA 3LM5A 5L8JA 4AN3A 1DI9A 4YBKA 5C01A 2YZAA 1S9JA 2QOBA 1TVOA 3A7GA 3ACKA 3MH3A 5IQDA 4UWYA 3KGAA 3TACA 4ZY6A 3HV7A 3ZLWA 2OIQA 4PMPA 3QWJA 1J91A 1OM1A 2ZFYA 4YSJA 4EUUA 4C38A 5ETCA 1XO2B 5FLFA 3U4UA 5AP1A 5J9ZA 1GIHA 3R21A 4IM2A 2HELA 1YKRA 5ACKA 4IB3A 2QOCA 3PIZA 4V01A 3VHKA 4RIWA 2BIYA 3CKXA 3P23A 1SYKA 4ZTNA 3BLRA 4FZ6A 5KZ0A 2C5NA 4FL1A 4BKYA 2WQEA 4D9UA 5IQIA 2ITOA 4F64A 2BMCA 4PMSA 3SXSA 3F6XA 3TKIA 5EI8A 4DEGA 2QR7A 3S1HA 2QOKA 2V7AA 3MH1A 3NW6A 4BIBA 4HW7A 4LV8A 4YR8A 2G1TA 5E8UA 3O51A 1JKSA 2X6EA 3SXFA 3PDTA 3W0NA 2PZ5A 4JNWA 5AR2A 3TTIA 2PZPA 4A9RA 5BVDA 2OZOA 5ACBC 3EQBA 3BZ3A 3NUUA 4B7TA 3ID6C 3QUPA 4DGOA 1KE9A 2BRHA 4F1TA 2XMYA 4FI1A 4F99A 5H8EA 3VONA 4O7SA 4N6ZA 4ZMFA 4I5PA 4DTAA 4GRBA 2VGOA 4YPSA 3ALOA 5JRSA 2W1ZA 3H4JA 3I6UA 4TYJA 5HI2A 3ZZWA 5EQYA 4TW9A 2PMNX 3ITZA 1ZOGA 2ETRA 5T6KA 3MPMA 4AZWA 5AFVA 4IZYA 2GMXA 3RGFA 2XJ2A 2XNGA 3P7AA 4WRSA 1IAJA 4O7VA 4P90A 3DXNA 3HDNA 4F63A 4MKCA 1UA2A 3W0RA 2J0JA 1WMKA 2DYLA 5KKRB 1GZ8A 1E1VA 3RNIA 3RPSA 2OJJA 1MRVA 3IONA 3OMVA 3CPBA 5EOLA 2QI8A 4ZTRA 4H58A 5AUYA 4CKJA 2YIYA 3EIDA 3R7OA 4CXAA 2OIBA 4W9XA 3VRYA 4EC8A 3R1SA 5JGDA 3AD5A 4D2TA 2X0PA 5IF1A 5AIRA 3KMUA 2BALA 1H0WA 4F7SA 5HLWA 4D55A 4LG4A 3BPRA 3VS4A 5GZAA 2DS1A 3VBWA 5A54A 4L45A 4M66A 2W17A 4YZDA 5HBEA 4FL3A 3ZCLA 1MQ4A 3DJ6A 1V1KA 3IK3A 1SM2A 3KF4A 1W7HA 2XK9A 3TKUA 4TWPA 3KFAA 2G2IA 1XH8A 2IN6A 2PSQA 3EKKA 3G90X 4ASDA 2WU7A 4FR4A 5DT0A 3QHWA 4RJ3A 2ZV7A 1CDKA 2YHVA 4GT5A 1BX6A 4NWMA 2JC6A 3EZRA 4M69B 5JN2A 4KIOA 3V8WA 2RFNA 3O96A 5KCVA 4OUCA 4I4EA 4BGHA 3R02A 3PFYA 2UW9A 1AGWA 2C6EA 4JT3A 4FKTA 4DFXE 1J7IA 2NRUA 3POZA 3VQUA 3BHHA 4ENYA 1NVSA 1W8CA 2A2AA 3IOPA 2BVAA 3TDVA 3D83A 3W18A 4DTBA 3OXZA 2O3PA 2VU3A 2J0MB 3MJ1A 4BCIA 4BDCA 1PYXA 2R0IA 4J8MA 3R9RA 5DIAA 4QMPA 1YWVA 3DBCA 2WKMA 5J87A 4DCAA 3EJ1A 4MUQA 2B9HA 1Q5KA 3MA3A 3CGFA 2ITZA 2ACXA 2XIZA 4JAJA 1YHVA 2QNJA 4OT6A 4B9DA 3HGKA 4DEBA 3ZO2A 4R3CA 4FKRA 2UW6A 4FV3A 4JR7A 4G5JA 5DRBA 4ZZMA 3R1QA 3E7OA 1KE5A 2WD1A 3BE9A 3MPTA 4WNOA 2JDSA 4GKHA 4NIFA 4QTAA 4X2NA 3QTUA 4M84A 4QTCA 2WEIA 3EKNA 3EQDA 4L52A 3LFCA 3P79A 5BNJA 1IASA 4FV5A 4IC8A 3W1FA 3TZ7A 5CSXA 3QHRA 5A4CA 4FV9A 2YIRA 4AFJA 4KBAA 2E9OA 3GU7A 1M52A 4FTQA 4E4LA 4D28A 4D2SA 3LFAA 3O50A 4WKQA 2C30A 4AOTA 4EEVA 3Q60A 3VC4A 1K9AA 4J96A 3GNIB 2XKCA 3IO7A 2JBPA 3QTXA 4XBUA 5M4UA 4FEWA 2RGPA 4BCKA 4DBXA 5CEOA 5F1ZA 4YZNA 1W2CA 2F2CB 4ANOA 3T3UA 3LMIA 1LPUA 4P5QA 1FVTA 3UC3A 3ZLYA 2R3NA 4NK9A 3DAEA 3DDQA 3S3IA 4F9YA 2HXQA 5B2MA 3SLSA 3U6IA 2W99B 3RMFA 4FF8A 4YP8A 4IADA 5AIKA 3NW5A 4R7BA 4CG8A 3OVVA 5EYCA 1FMOE 4DTKA 3EQIA 5E8WA 5CEPA 3LE6A 4FVQA 5EKOA 5HG7A 4Q5HA 3CBLA 4YC6A 1W2DA 5HE0A 4EOKA 2HCKA 4NKAA 3R9NA 5M09A 2VTRA 5CASA 2OGVA 1J3HA 4YTIA 4GL9A 5BQ0A 2GQRA 3NNXA 4QYEA 1M17A 3UYSA 2Z8CA 1LEWA 4G2FA 5LVOA 3ZRKA 4TL0A 5J9YA 3BV2A 3VVHA 4TXCA 4LV7A 2HXLA 3HV3A 1ZMWA 3PP0A 4OTDA 5BMMA 3WF7A 5I9VA 5J7BA 5IA2A 2UZEA 4KKGA 4MEDA 4ZJVA 3PLAE 3NLBA 4QP4A 4JR3A 2ZM3A 1H0VA 4O96A 4QYGA 5AR3A 4BDKA 4GVJA 5AUWA 4AACA 4D1SA 4AA4A 5AAEA 1ST4A 3RVGA 3NAXA 3LM0A 4I5HA 3DOGA 4YC8A 4LOOA 4NW5A 2YISA 4KKEA 3BLQA 4QMUA 4WSYA 4MBIA 5ANGA 4C59A 4EK6A 4R5SA 3UO5A 2IVUA 3DBQA 4I5CA 4MTAA 3ZHPC 4RWJA 4IAKA 5ANEA 4XH6A 2HWOA 5IUGA 1FVRA 4FVPA 1Q41A 4ZEGA 2PVJA 4DLJA 1H28A 3OG7A 3R22A 2I40A 4G31A 3L9PA 3UPXA 2IW8A 4EHEA 2X2MA 5EYMA 2R2PA 4IE9A 2R3KA 4FIHA 4B8MA 3SV0A 5CXHA 4EQMA 5AM7A 2XK4A 3CP9A 3MSSA 4DF3A 3MVHA 1PXPA 2HOGA 3GC0A 2HW6A 2QOQA 3CY2A 3I81A 4HPTE 2GTNA 2FSOX 4GKIA 4AE6A 2C5YA 3SGCA 3FQSA 3W32A 5CAVA 2Q0NA 3KMMA 1FQ1B 2WFYA 4TYGA 2VZ6A 4FTOA 4BICA 2XJ1A 5LMBA 1CM8A 2PE0A 3VS6A 3BQCA 3FEGA 1NY3A 5L2SA 4R8QA 3L9MA 3RZFA 5HD4A 4B99A 3LZBA 4XP0A 2B4SB 2C4GA 3KEXA 3DCVA 2HZ0A 2Z7SA 2PUPA 4BKZA 3PZHA 3LCSA 3D7TB 1Q24A 5HBHA 5L6WL 4IACA 3UOLA 4AQCA 5GJGA 3F2NA 3FLQA 5IEYA 5HTIA 4FTKA 2B55A 3OWLA 4YJOA 4G6NA 5J8IA 4FTCA 4O7LA 4FEUA 3PYYA 2BIKB 4XX9A 4CEGA 3I4BA 1UKIA 4U9AA 3CS9A 5AJQA 5DG5A 1U5QA 1KE6A 2I0HA 4DGGA 5LXMA 4BWXA 3MESA 2EVAA 3T9IA 4M0YA 4ZSJA 2ITTA 5IDNA 1WZYA 4C2WA 4DC2A 3IQ7A 2QVSE 4FSYA 1PMEA 4ITHA 1OL2A 2XM8A 3FMJA 4I21A 4F9BA 1OGYA 4JBOA 5IH4A 5J1VA 2VWZA 2WXVA 2HYYA 2ZYBA 2XIRA 1UNLA 1XH6A 2YIQA 1ZYDA 3ZC5A 5LMKA 3E87A 5CSVA 1QCFA 4M14A 4YJNA 1OL6A 1UU9A 4I1ZA 5DBXA 5HO6A 4ZY4A 5C26A 5E8TA 1Q61A 3ORXA 3CQEA 4I41A 3RJCA 4CT2A 1PYEA 4ZLZA 4K77A 2HY81 2WPAA 4F0FA 5KMOA 3W8LA 3AD6A 4UMPA 1Q8YA 2YAAA 3LCKA 3F69A 5G1XA 4BN1A 2IW9A 4BDHA 4ZP5A 3RCJA 3VS7A 4RG0A 5I9WA 4QNYA 4BWKA 4KB8A 4BL1A 2WTKB 4AZVA 4AT3A 1ND4A 2UZVA 3UNKA 4L42A 5JZNA 3KULA 4DEHA 4RX5A 1BUHA 3TTJA 2ZV2A 3GU4A 5IQGA 4W4YA 3A61A 4DFNA 4H3QA 4YBJA 5DRDA 3F5XA 3LQ3A 4FV6A 3VUIA 1YQJA 2XVDA 3OCSA 4U41A 3SHEA 3FZ1A 4J99A 1YRPA 2PZIA 4CV9A 3LXKA 4IWOA 3SC1A 1JOWB 3VO3A 1WFCA 4FUYA 3P7CA 4QNAA 3WF8A 4LMUA 3MTLA 5HVKA 5JZJA 2CSNA 3EN4A 2ZJWA 4IXPA 2G9XA 4BF2A 1I09A 3FI3A 4GG5A 5H8GA 3OS3A 4M8TA 3SRVB 5FWKK 2YERA 2QO2A 3F5UA 4L3LA 2YAKA 3C1XA 4R3PA 1YI4A 3VWAA 1JPAA 4OGRA 4F9AA 3MB6A 2EXEA 3FMLA 3FL5A 4GK3A 2X2KA 3HMMA 3FKNA 4JDKA 4PMTA 3FY0A 4TYHA 3DJ7A 4XG2A 1H4LA 2GNLA 3CC6A 4H1JA 4UXQA 4O7RA 3WZUA 3NUNA 4GUBA 4JX7A 5JQ5A 4MXCA 4ANLA 4IM0A 2CNUA 2YEXA 3ORNA 4Z7HA 4WA9A 3LFFA 1H1SA 2XM9A 3UNJA 4J53A 4N70A 5DR9A 3NVKI 1AD5A 3AKLA 4AP7A 2WIPA 4FMQA 3RAKA 3V5PA 5CAQA 3CTHA 4RZWA 5JSMA 3KREA 1L8TA 1W2FA 2X4ZA 4QMNA 3KL8A 5JRQA 2IW6A 2H6DA 1IG1A 4MBJA 4PL3A 2VTHA 3M11A 2WTKC 3U51A 2CGUA 2WMVA 3EYGA 2ERZE 1SMHA 2EXMA 4IMYA 4KRCA 5K4IA 5ANDA 3E3BX 4EOOA 3RM7A 2XRUA 3ALNA 5EHOA 4X21A 2BAQA 1YWRA 2RG5A 2VUWA 5AAGA 4IZ7A 2EB3A 3UZPA 4V0GB 4BYJA 2C68A 1Y6AA 2C0TA 2YITA 4O1OA 1OKZA 4FG8A 4EOIA 1UWJA 5DFPA 4BCPA 4YNEA 2JDOA 2JKKA 4IDTA 4CRLA 4QP8A 1H07A 4YGAA 5J7HA 1VEBA 4RRVA 2ITQA 4KINA 3UO4A 3V6SA 4E73A 4WNPA 4ZK5A 3T3VA 5HORA 3FI2A 4DAWA 2JKOA 3P08A 4FICA 2XNNA 3R2YA 3MJ2A 4LL5A 4YO4A 1QMZA 4NUSA 2F9GA 1CKJA 1ZXEA 3OWJA 4LGDA 3IECA 4BZNA 4IAZA 4U97A 2CMWA 3DNDA 3QKLA 4FZAB 1OIQA 4BDJA 4HVSA 2VTAA 3JUHA 3CSVA 3NMUF 1WBOA 4YZBA 5BV3A 3DTCA 2VWXA 1PXNA 5E90A 3GGFA 1Y8GA 2H96A 3QQFA 2HZ4A 3AKKA 3PXRA 4QP7A 4HZRA 4FSUA 3LKMA 1ZY5A 4P7EA 4EH9A 1XJDA 2WMRA 3AGMA 3LAUA 2XH5A 5CSWA 3AT3A 3QTWA 1JWHA 4I22A 2NO3A 2OSCA 4MXXA 5D10A 4NTTA 3R7EA 3HECA 2BAKA 4L00A 2JBOA 5BYYA 4MVFA 3I5ZA 4QTDA 1XQZA 3HZTA 4EBVA 4ZZNA 5AP7A 3NCGA 2XNPA 5IISA 1ZAOA 3QUDA 4L7FA 4UXLA 4QYFA 4D5HA 3PVBA 4DHIB 2UW0A 3C4WA 4I24A 4O6EA 2GHMA 4QMWA 4GEOA 5AX9A 3B2WA 5CQWA 4NKSA 4J98A 2YCSA 4CCBA 3F3VA 1OGUA 3QTZA 4X6QC 4ZAUA 1LUFA 3MBLA 2W05A 1TZDA 3FXWA 4GMYA 4X7QA 3KRRA 4E4XA 1APME 1R3CA 4EK4A 2ZAZA 3AKJA 3FJQE 3W0QA 3UNZA 4FKWA 2C3IB 3GOPA 3DAJA 2BTRA 4ALWA 2YM3A 3CGOA 2VO3A 5A4EA 3H10A 4HJOA 2Y8OA 5DOSA 3Q5IA 1ATPE 1UU7A 4FTLA 4NM7A 5K4JA 2F57A 4RVTA 4Y73A 3AG9A 5E92A 2XYUA 3HAVA 4YNOA 4XP3A 4EORA 5HVJA 4FKQA 4MNEB 4YJQA 2WTJA 3TMOA 3V5JA 3OWKA 3O5AA 2O64A 4LDTA 4QOXA 3NS9A 1NXKA 4HCTA 5BYZA 4EYMA 5FGKA 4DFLA 2GU8A 2XNEA 3GFEA 5FTQA 4W8EA 3VIDA 4MXAA 4XG7A 4C57A 3TI1A 4RIWB 4CMOA 4CLIA 5IQHA 3QRJA 3Q9XA 4BDAA 1V0PA 2IJMA 5LCJA 4DHZA 1XR1A 2XRWA 2C3JA 4TYEA 3Q53A 1M2PA 1HOWA 2YIXA 3TNIA 2A98A 4TTHB 1NVRA 5BUIA 2BRGA 5BVNA 3NUPA 4Z9LA 2PVNA 2QLQA 2WOTA 3R30A 3O71A 4MX9A 4RIOA 5DHJA 2XCKA 2G15A 4FYOA 2ZDUA 3ODYX 3IDPA 4AUAA 2BUJA 2FYSA 2OXDA 3EQPA 1OITA 2XNMA 3OROA 2UW3A 4FKGA 4HGSA 4M68A 3W8QA 4C33A 3C5IA 3IDBA 4O4BB 2AYPA 4RC4A 5HQ0A 4L8MA 2X2LA 4O7WA 3RPOA 2QOLA 2PZRA 2XP2A 2VTLA 2B52A 1OIUA 2Y6MA 3W33A 2XARA 5AUVA 1M2RA 2W1CA 4MH7A 4DGMA 2QU5A 4X0MA 1W98A 4FK6A 3G51A 1H27A 3C4EA 3BBTB 3OWPA 4NIFB 4RMZA 4U3YA 3PUFC 3QQLA 4U40A 3KIOC 1H25A 5KX8A 3L8SA 4APPA 4XG3A 5AUTA 2JEDA 2I7QA 5EOBA 5HD7A 4D5KA 4M0ZA 5IH6A 2XAOA 2R3HA 3HMPA 4F78A 3COHA 4C61A 2I6LA 2CGXA 1IA8A 4QQTA 3I7BA 4U7ZA 5D9HA 2OXXA 4RWKA 4EOPA 1YDSE 2QKWB 3DXQA 3VBVA 4QP3A 2W4JA 5I9XA 4EOQA 2GNFA 5JFSA 4MYGA 3U4WA 3E5AA 5FUTA 4RSSA 3ANRA 4C0TA 5GHVA 3QF9A 1Q3WA 3FI4A 3PSDA 3BYVA 4RX8A 3Q04A 4E8AA 5AP4A 5HESA 5J5SA 5IG1A 4FTUA 4XMOA 4UY9A 3QQHA 4ZTLA 3U6JA 1Y57A 4CFWA 4ZIMA 3LJ0A 2F2UA 2GFSA 3MY0A 2XIKA 2VTOA 4FRFA 4YJVA 5BVEA 4I6LA 1WVWA 3FHRA 2XUUA 4GS6A 3N51A 2PMIA 4GU9A 4IVBA 4O0YA 3DKCA 3ROCA 5HTBA 3F3TA 1O9UA 5FQDC 4F09A 5EKNA 3BYMA 2VWYA 2WMTA 5DPVA 3COMA 3QU0A 4TN6A 2WQBA 5T68A 4OTWA 5L6OA 2XK6A 5M08A 2WMWA 1UWHA 4FTRA 3MVJA 2FSLX 2WGJA 2O8YA 1WVXA 5CT7A 4MD9E 3NUAA 4AT5A 3AC8A 4EOLA 5IZFA 3W0MA 4U3ZA 5GIPE 4RPVA 2GQGA 5IEXA 3U9CA 1OUYA 2SRCA 4IFCA 3RALA 3AXWA 2XK7A 4EH6A 1BKXA 4AT4A 3NR9A 4JIAA 3ZTXA 3W0SA 3QD4A 3O8UA 3DBFA 4O7NA 2DWBA 4FSQA 3G9NA 2O5KA 4E3CA 4IANA 4BI0A 4QDVA 4AAYA 4X3FA 3H3CA 5CI7A 4EH7A 3OT8A 4CYJA 4Z55A 4QMXA 3BL7A 5HIEA 4AA5A 4IHPA 1DS5A 4NM3A 4S33A 5H9BA 5K3YA 4ANNA 4D4RA 3A8XA 2IVVA 4FSMA 4I6FA 3OUKA 3RK7A 4HYSA 3GCSA 3FLSA 3AC2A 2XZSA 1PW2A 3LFBA 3FDNA 4MXZA 3U87A 3IGGA 2X6DA 3P7BA 4CVAA 4CG9A 2PUUA 1B38A 3FLYA 4IX6A 1XH4A 3P9JA 4S30A 3O23A 4ONAA 2X9EA 3FZRA 5D11A 1K3AA 4FKUA 5AV3A 2C0IA 3GCQA 3P0MA 4RJ7A 2ITYA 2WO6A 3WZDA 4BIDA 2FVDA 3MGYA 4ZS4A 4YURA 1AQ1A 4IB5A 1OVEA 2H34A 2JGZA 3TV7A 3BQRA 4CNHA 3VS0A 3LMGA 3ACJA 1FINA 4FZ7A 3PE1A 4DGNA 3SVVA 4GFMA 5BVKA 2QOFA 4ZSGA 3Q9WA 2IZSA 3FL4A 4Y5QA 2JDVA 3W0PA 3EWHA 4E26A 3MV5A 4YLJA 2VWIA 5ICPA 3F2AA 3R2BA 4PPCA 2B53A 4TPTA 4LFIA 2WELA 2XK8A 3TIYA 3F3WA 2C1BA 5DLSA 2BPMA 3A4PA 3GC9A 3JYAA 4I94A 1Q8TA 3WF6A 3V8TA 4NL0A 3AGLA 1UNHA 2OJ9A 2X8IA 3OY1A 3RPRA 3WIGA 2VWUA 2EXCX 4RX7A 4WOVA 5E7RA 1H1PA 4JOAA 1ZYSA 5E8ZA 3ZFMA 4D2VA 4Q2AA 4QPSA 5BVWA 3FXZA 4EH4A 3ATTA 4NJ3A 1Q97A 1R1WA 1NT2A 4O4EA 4O2ZA 4TYIA 3RHKA 3F7WA 2OJIA 4I23A 3VUKA 4CQGA 1XMMA 4D1XA 4LGGA 2JIUA 3OT3A 4KIPA 4U0IA 4U44A 4YZCA 4QPMA 5EYDA 5K0KA 3W2OA 4YTFA 3D14A 2PVKA 2YCFA 1GAGA 2ZV9A 4H36A 1BYGA 5AUXA 4G16A 3F9NA 3HA6A 2EUFB 4JBVA 3QD3A