4LRJA

Bacterial effector nleh1 kinase domain with amppnp and mg2+
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
163
structure length
160
Chain Sequence
RLSVPGNVIGKGGNAVVYEDAEDATKVLKMFTTSQSNEEVTSEVRCFNQYYGAGSAEKIYGNNGDIIGIRMDKINGESLLNISSLPAQAEHAIYDMFDRLEQKGILFVDTTETNVLYDRAKNEFNPIDISSYNVSWSESQIMQSYHGGKQDLISVVLSKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Effector NleH1
publication title NleH defines a new family of bacterial effector kinases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 51
structure length 160
sequence length 163
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4lrjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4lrjA01
1TQIA 2P55A 2ITQA 4F09A 3H9OA 5M4CA 4X2FA 4C57A 3TNWA 3DBCA 4XV9A 3R8MA 4U44A 4D4YA 3CJGA 4DTKA 4ZMFA 3DGKA 1J1BA 4FTUA 2PZRA 4HYUA 3ANRA 5IMEA 2CNQA 5GHVA 3U55A 3DLZA 4RJ4A 1OM1A 2VAGA 2FYSA 3GU7A 4CXAA 4U81A 5J5SA 1B39A 3IW6A 3AT3A 4K6ZA 4TYHB 5JEBA 2BDWA 1RJBA 4GT4A 3F3ZA 3NDMA 3RGFA 4USDA 3G6GA 3E88A 5M4FA 2VTLA 3FQEA 2UZLA 3BBWA 1L3RE 3PXZA 3GI3A 3QD3A 4OTQA 5LMKC 2PUNA 5E4HA 5IISA 3KF7A 3ZO3A 2W05A 4UX9A 2X0GA 4RC2A 5JMSA 5D41A 4QYGA 1FINA 4JLCA 3R8UA 3TTJA 4M84A 3HA8A 4UY9A 2GS6A 4I4EA 4QMMA 1J1CA 3NUYA 1QPJA 4AGCA 4E3CA 2BIYA 4FKRA 4PUZA 1XKKA 4E6CA 3QWJA 1GJOA 2ZOQA 3GU6A 2UVXA 3I81A 2E9UA 3LCDA 2WOUA 5M44A 3MTLA 4GH2A 2XIXA 3LPBA 4S34A 3TV4A 3DKOA 3HV3A 4YHFA 5DRBA 3TTIA 3L8SA 3LW0A 5J9ZA 1M14A 3CP9A 4ZXTA 1PXIA 4GS6A 1HCKA 2JGZA 2PE1A 5FBOA 4AW0A 4C4IA 5IU2A 1V0OA 2C69A 1P2AA 2XVDA 2O5KA 5A6NA 5AV1A 5BX0A 3Q3BA 3KA0A 2XJ0A 4R8QA 4ZIMA 3BPRA 3JUHA 2Q0BA 1TVOA 5AV2A 4N0SA 4DBNA 3TEIA 2X7FA 2XJ2A 4NM3A 4J53A 4NZWB 4XG8A 2HK5A 4FV3A 4YGAA 5DRDA 1KV1A 5F4NA 3TWJA 5AV4A 2OJGA 4CT2A 2C5YA 4OUCA 5CY3A 5ACKA 4WHZA 2JD5A 4IH8A 1H1QA 1W84A 4FSNA 3Q96A 1NVQA 5FTGA 5EM8A 2QO9A 3R1SA 4S33A 3S0OA 2C5XA 2VWUA 2R3PA 1NA7A 4S32A 3WF9A 3E63A 3HZTA 4XCUA 4BIEA 4ACDA 4MXZA 4WOVA 4FV0A 3DT1A 1P14A 3V5TA 1OL5A 3BU5A 4OBOA 4DEAA 2GS2A 3EFWA 3SLSA 4F9WA 3NUAA 4NM0A 2ITYA 2GSFA 4ZS4A 5HLWA 2BVAA 4M3QA 3W2OA 1K2PA 2BTRA 2IWIA 4L42A 2VWWA 5AP5A 5GIPE 3JYAA 5LCKA 3VN9A 5IG1A 2O65A 3UOLA 4USFA 3V5PA 3B8RA 4N6YA 3RJCA 4IAKA 4KINA 4MD9E 5AAFA 5GZAA 3VS1A 4NKAA 2JFMA 3ZM9A 3PLAE 3AG9A 4DGGA 3PG3A 1JVPP 4KD1A 4MCVA 4DAWA 2E9OA 2WEIA 5HE1A 2YDJA 3M11A 2I0VA 4FKJA 2FSLX 3OOMA 1FQ1B 4QMYA 3V5LA 1SZMA 2RGPA 2W1EA 3CLYA 4ONAA 1WBTA 2EXCX 2PY3A 3OXIA 3F2RA 2J9MA 4MQ1A 4TWPA 4Z7HA 3HL7A 1KV2A 4RJ6A 2XNBA 1YHSA 4AW5A 2YWVA 1PXNA 4MAOA 4X3FA 4EOIA 4DFNA 4L3LA 4EOOA 4IVAA 3ZBFA 3OVVA 4FG8A 4I41A 4BGGA 4O0WA 4L52A 4YJVA 4KKHA 4RG0A 5CSVA 5DG5A 1GZ8A 1WBOA 3TKHA 4CKRA 4PDYA 3ENHA 4FSTA 3ZLWA 4G3DA 4NT4A 1GZOA 5AP4A 5TOZA 5TR6A 1ZYJA 3ZXZA 3GU4A 4ANLA 4DTBA 5HIBA 3CGFA 3ODZX 4R5YA 4AT3A 4DA5A 3JR1A 5CAPA 4PDPA 3SRVA 3CD3A 2B53A 3NEWA 1FGKA 4ZJIA 3RWPA 3W18A 4NCTA 5FLFA 3VW8A 1OL7A 4EK6A 3WARA 4EOLA 5J9YA 4QMOA 4O84A 2W06A 4D0WA 1JOWB 5BUEA 4KIKA 3DFCB 4KWPA 1JKSA 3TIYA 2QU5A 4GJ2A 5CEMA 4R7HA 5AUYA 4UV0A 3OG7A 1M7QA 3ETAA 3V6RA 4L6QA 2YLEA 2PMLX 3QQKA 4RWJA 3P23A 5HICA 5IEYA 5L8KA 3O2MA 1YI4A 3VC4A 4D28A 4ZTSA 3RK5A 4HVSA 4ITHA 5DH3A 1WFCA 2JDRA 2VTRA 4M97A 2XB7A 3ULIA 2C6OA 2BPMA 4FTQA 2G1TA 4P7EA 3T9TA 3ZSHA 4YNEA 1UA2A 4XG7A 3LFNA 3RVGA 4QMTA 3ZC6A 4GW8A 4F65A 4ANOA 2BRBA 3FYKX 3PY0A 3WE4A 4BCIA 5IPJA 2C68A 5ETFA 4FKPA 4AN9A 2JKOA 3UQCA 3AC3A 4I1ZA 4O96A 3AMBA 3NUSA 1WCCA 3VUKA 4A4OA 3QCSA 1BL6A 3O51A 5CZIA 4EH9A 1O6LA 5CU4A 3ORZA 3EWHA 4I5CA 3RBWA 4JOAA 3R04A 2XKCA 3NRMA 5T6KA 3QTWA 5BYZA 3RCJA 4WBOA 4FKOA 3BZ3A 5ITAA 3UNKA 2C0OA 2VO3A 5C1QB 4E4LA 2QOBA 5JSMA 5IQEA 5FTOA 3EN4A 4NIFB 4DGNA 3A7HA 3O50A 1UU3A 4CT1A 3N4TA 2OH4A 4CV9A 3VJNA 4DHFA 5EI8A 1YOJA 3UYSA 4YTIA 3LFQA 5CEOA 4BVUA 3QD4A 4IFGA 3V5QA 3CQUA 4PWNA 3H0YA 3R22A 3GFWA 4JDKA 4X21A 1CKPA 1M2PA 1TQPA 4BC6A 3LZBA 4PPBA 2IW9A 2BZHB 3A7IA 3LFSA 2VTPA 4HVGA 3HECA 5I3RA 5FEQA 1WVWA 4LMUA 3S95A 4U3YA 1XBBA 5I4NA 5JK3A 1JAMA 3Q6UA 4BBEA 4LYNA 4I94A 4IJPA 4BKJA 1SVGA 3LFBA 5HLPA 2Y4PA 2YCRA 1OKZA 3P9JA 2XK7A 2UZEA 1O6KA 1QCFA 4KS8A 2OLCA 4IWDA 2R3IA 4R5SA 3FE3A 4DH7A 5FM2A 3S00A 1UU8A 2OXXA 1Q61A 2R3LA 2YDKA 1ZAOA 4HJOA 5FTQA 3I4BA 4CZTA 3UZPA 2X9FA 1W7HA 4NKSA 5T3QA 4IWOA 3ROYA 2IN6A 4EKKA 3LJ0A 3K5VA 2F2CB 4GFMA 3HMMA 2WTCA 3FI3A 3VBXA 3GC0A 4D4RA 5JZJA 1YRPA 2OSCA 3DFAA 2FB8A 2OIQA 4RX7A 4RIWB 4YC6A 3IW4A 1M52A 1ZYDA 2UW7A 5HG9A 1LEWA 4F70A 4YTFA 5M4IA 4PMSA 3HV6A 2ETRA 1W8CA 2A1AB 4FZ6A 1GIJA 2OFVA 4PTEA 4EH6A 2Z02A 3BU3A 3FZOA 3C1XA 1PMEA 4FSRA 2BFXA 4D5KA 4IM3A 2V22A 2RG6A 3HP2A 1BI8A 4OW8A 4HGLA 2P4IA 4FICA 4RQVA 5GNKA 4BCMA 4WNKA 4AN3A 3RZBA 3ANQA 5CNOA 5AV3A 4F6UA 2CNVA 4HOKA 3BWJA 3FQSA 4GUBA 4M0YA 3E8EA 4JVGA 4CFXA 3P79A 4K18A 2YM5A 3LE6A 4V0GA 3VQHA 3LXKA 1PXMA 4HYHA 2QOFA 5HOAA 4L00A 3MW1A 4KIQA 4LL5A 3FKLA 4B9DA 3NPCA 1YHWA 5DE2A 5L3AA 1AGWA 4IWPA 4E4XA 3PJ8A 3TIZA 4FTKA 4I5PA 4M8TA 4QP6A 5LVLA 2WTKC 4FOBA 4D1XA 4DEDA 4E4MA 3WILA 3FLNC 4M68A 2OIDA 5JN2A 3VBWA 2JAMA 2BMCA 4MF1A 3KK8A 3TUCA 3AT2A 3M42A 3RNIA 3VHKA 3UNZA 4O7NA 5J87A 3FLQA 4PPAA 3V5WA 3UMWA 4GYIA 5IUHA 5LMKA 3GP0A 5HZNA 2QG7A 4Z3VA 2EB3A 1GIHA 1M2QA 2ZB0A 4TY1A 3R9OA 1L8TA 1BMKA 2PE2A 3N9XA 4I93A 4UALA 4AU8A 3WE8A 1ZY5A 5BPYA 2ZDUA 1WVYA 2UZUE 4A06A 5AP7A 3OCGA 1U54B 3EQGA 3EQDA 5IA2A 4RIYA 4MEDA 4QMLA 2WOTA 3WZUA 4FODA 5IDNA 4AXAA 2IZSA 5G6VA 3N4VA 3HV5A 4L3JA 4EOMA 4O81A 2WTVA 4EORA 3UQFA 4AE9A 3R28A 5AR8A 3RAHA 3LMHA 4TXCA 2W1IA 2GFSA 4CRLA 4M15A 3RP9A 3FHRA 4MVFA 4F9YA 4MNEB 2VTIA 3F9NA 2YAAA 3W33A 4NFMA 5EI2A 3ZLSA 2VTMA 3U6HA 1IAJA 4FG9A 4JQEA 5AUXA 1CTPE 2WU6A 5CU0A 5A4EA 1IA8A 1KE7A 1XH5A 3HYHA 2ITVA 5KBQA 1U4DA 4YC3A 4ANSA 5BVDA 3GQIA 3DBDA 1OMWA 1YXXA 3VF9A 4WNOA 4FIIA 3O8UA 4OBPA 2VNWA 4U41A 4V05A 4WUNA 5K3YA 3OY1A 2XBJA 4L68A 2DQ7X 5C9CA 3KXZA 2GNLA 4FK6A 4BWXA 4YHJA 3SV0A 4O0TA 3F7ZA 4EC8A 4E1ZA 5EQEA 3PLSA 5HIEA 1HOWA 3ZCLA 3D15A 5T68A 4RX5A 3PRIA 4CSVA 3Q60A 3NUXA 4WIHA 4U43A 4BDBA 1CM8A 4XV3A 4N57A 5AA9A 3D5VA 2JDSA 3NIEA 3RM7A 4DGOA 3MS9A 2QKWB 4LGGA 2OJ9A 3H9RA 1H8FA 3ZRKA 4BBMA 2C5VA 4FC0A 4BDKA 3DQXA 3L9PA 2OH0E 2OXDA 4E20A 5GINE 2R3RA 4EH4A 2DS1A 5HVYA 3WBLA 4DYMA 1GZNA 4M12A 1ZOHA 3MY1A 5I9VA 2XNMA 2C6TA 3NGAA 5H3QA 3D2IA 4QMNA 4RGJA 3OEZA 5DI1A 3V8SA 2XNEA 4JAJA 2XJ1A 3TZ9A 3I60A 2PZYA 2UZTA 2ZJWA 4ANBA 4WG5A 4QTEA 5M53A 4RMZA 4IW0A 2IW6A 3A99A 3EN7A 5C27A 1F5QA 2OI4X 4FVPA 3M2WA 3MB7A 5BVEA 3PXRA 1IAHA 2QD9A 1DAWA 3C13A 3FXWA 3OROA 3OW3A 2W1GA 4L8MA 4BTKA 3IOKA 4EUTA 2IZRA 3QTXA 5KMKA 3MFUA 2QOKA 2IVTA 2OW3A 5FP5A 3BE2A 3B8QA 3LJ1A 3WYYA 3BIZA 3BHTA 3BGZA 2QR7A 4AZFA 4BWKA 1Q99A 2GHGA 4M7IA 5J95A 4FV5A 4KABA 1BUHA 3W32A 3R7IA 3NYVA 3UVRA 2G9XA 3TNQB 3FPQA 3R00A 3QHRA 2GHLA 2W5BA 3RK9A 2JEDA 4CFUA 5IH4A 5LCJA 5CLPA 4MXCA 4P90A 2WKMA 3RHXA 3FUPA 5CX9A 5EYKA 4ARKA 3C5IA 1MRYA 1QL6A 3Q4TA 2HXLA 4O0XA 2QG5A 3QCQA 1DAYA 2BZJA 4MXOA 3G6HA 1H0VA 3OUKA 1PY5A 4L67A 4KS7A 2H9VA 4ANQA 3HUBA 4Z55A 4TKSA 3OWJA 3QQLA 4XHKB 1ZOEA 3E5AA 2QOCA 5G1XA 3ZO1A 3OS3A 4C02A 2PUPA 3BV2A 2WQOA 2WXVA 3OT3A 3LFEA 1A9UA 2ITXA 2Y6OA 4LL0A 4ORKA 4BY9E 2WMTA 5CI6A 5FUTA 3AOXA 4EWHA 4JNWA 3KEXA 1FVVA 5FG8A 4FGRA 5JKGA 4J1RA 4BHZA 3HMIA 3PVGA 4J99A 1Q3WA 3QFVA 3FWQA 4IACA 4FSUA 5I9UA 2GU8A 1KWPA 3C51A 2ITWA 4JR7A 4FYNA 4JR3A 2CNUA 3TKUA 3ZRMA 3MI9A 3C4ZA 4YJRA 5CWZA 4D58A 1Q8UA 2IZUA 4EBVA 2GS7A 4ZTNA 4A9SA 3C4FA 4Y85A 4K0YA 2YERA 4L45A 3Q4ZA 5HU9A 3OHTA 3SG8A 2X4ZA 3KMMA 4O91A 1OIYA 2BFYA 4ZLOA 2OU7A 2UZOA 2VGOA 2J0KA 4WG3A 3ZDUA 3I5NA 5HO6A 3EFJA 4TN6A 2ITNA 5LVPA 4N4SA 5F94A 3A61A 3O8TA 4I6HA 5EFQA 5IKWA 4L53A 5EM7A 3SXFA 4EI4A 4F1OA 5DEWA 3TI1A 3DJ5A 4D9UA 3OFMA 1H1PA 4CZUA 3QQGA 4U8ZA 2Y7JA 5L2SA 4YSJA 5CXHA 5CAVA 4CGAA 2O2UA 4FK3A 2A0CX 3V51A 3ZLYA 3R9DA 2XP2A 4QP1A 3QD2B 5L2QA 4DN5A 3QQFA 3DBFA 3DB8A 3NAYA 3OWKA 4Q5HA 2HZ4A 4YP8A 4IAYA 3QA0A 4FV4A 5EDPA 3RAIA 1M7NA 3IW8A 5IA4A 3DAEA 2X2LA 4ZZOA 2ZV2A 3DOGA 4ZTQA 3P7BA 3PXKA 2OGVA 2NRYA 1PJKA 5K0KA 2XEYA 3PVWA 2EUFB 3Q2JA 3FMNA 1P4FA 4GMYA 3VRYA 4AW2A 4TYJA 3EFKA 3UO6A 1YWNA 5K9IA 5AR2A 3QTSA 1UU9A 2SRCA 3AXWA 4JBOA 5CI7A 4I3ZA 3IQ7A 5HESA 5HTBA 2FH9A 4MYGA 2WEVA 4MXYA 3UOJA 2HZNA 4ZLYA 4FKVA 1U46A 2GTNA 2GPHA 2QOQA 3FZRA 3HGKA 3IGGA 4JX3A 5FP6A 4JX7A 2Z7RA 2QVSE 4FIEA 4XG4A 3GXLA 4IE9A 3LMGA 2BDFA 4Y73A 3EYHA 4FNYA 3GU5A 5AP6A 4TYHA 1ZMVA 2F7XE 2WZJA 2PMOX 2R3QA 5C8MA 3V6SA 3PA3A 3PPJA 4ANMA 4CEGA 4EOJA 4APPA 4QQTA 5CF5A 3OBJA 3RHKA 1YVJA 5M4UA 3ID6C 1UVRA 4IAFA 4HGSA 2JFLA 2C6EA 2XF0A 3BHVA 4KAOA 4P2KA 4QMWA 3C4EA 5HO7A 3MVLA 2XIRA 2PZIA 3E87A 4DEGA 2QCSA 4O86A 2G01A 3E64A 4FV6A 2GNJA 2UW8A 4JBPA 5CTPA 2W1ZA 3FKNA 4XX9A 2XK8A 4KB8A 3UC3A 1FBNA 3HUCA 5LMBA 4AOIA 1H00A 1PKDA 3KMUA 2KTYA 1OIRA 4BDCA 4RZVA 4R78A 5L6WL 1GOLA 3LM0A 4YMJA 4E73A 1OZ1A 4G34A 4Y72A 4YZBA 4OTGA 4GRBA 2WTDA 2XK4A 4B6LA 3PXQA 2UW0A 2BIKB 3FHIA 2XIZA 2W1HA 2RL5A 4IANA 3JXWA 3NVKI 4H1MA 4IAAA 3W2RA 1SNUA 4EZ7A 5EM5A 3C4CA 4BF2A 3PA4A 2JLDA 4GV1A 5GZ8A 3PIZA 3AGLA 5E92A 4OAUC 4QTDA 4W4WA 4EQUA 4EQMA 5M09A 2BAJA 2W0JA 4C7TA 4W8DA 1W98A 2B7AA 3CJFA 3QLGA 5I9ZA 1SM2A 3ORPA 3DXQA 4GSBA 5HEZA 1OECA 3FEGA 2I0YA 4FVQA 2PVFA 4PNIA 4C34A 3AD5A 4OBQA 2ZDTA 4RX9A 4BZDA 3SW4A 3F6XA 2QC6A 2BKZA 4WSQA 3NW5A 4IZYA 2C6DA 3V8TA 3UZTA 1J7IA 4M69B 1XR1A 3PG1A 4XH6A 2C0IA 4O0UA 3ELJA 3MH1A 5CF4A 3IDCA 4FT7A 4A9TA 3U4WA 2X6EA 3HP5A 3SXSA 4BTFA 2UZVA 3ZO2A 4GT3A 2IG7A 5KMIA 2ZB1A 4XLIA 3GCSA 4HZSA 5KMMA 4ZK5A 3SX9A 2CPKE 5KZ0A 4DH1A 2HWOA 5DVRA 3QAME 1XH8A 3W1FA 3WOWA 3O23A 4IX3A 1YXUA 4AT5A 2PSQA 3Q9WA 3T8OA 2HOGA 3BHYA 3A4OX 1ZRZA 4FIJA 4JT3A 2XRWA 3IW7A 1NVRA 4KSQA 4Q5EA 5DBXA 5A3XA 3HA6A 1CKJA 5C8KA 4QP4A 2HYYA 4G1WA 3VUDA 3LQ8A 1G3NA 4PX6A 2LGCA 2W1DA 4FOCA 4DH5A 2UW4A 3ORXA 4U6RA 1YW2A 4CMTA 3ZUVA 3LFFA 2HXQA 3HVCA 3OWLA 4JIAA 4HGTA 3L9NA 4L46A 3V04A 2W99B 2QOOA 5A4LA 5C26A 4AA4A 4BHNA 2R3KA 3D7TA 2YJSA 2QOIA 5AWMA 3NZ0A 2C6IA 2CGUA 4FZ7A 3POOA 4IBMA 3IDPA 2NRUA 4IADA 4IB5A 3DBEA 4O1OA 1G8SA 4C2WA 4L7SA 4AX8A 2WTIA 3BYOA 3UODA 3UQGA 1G5SA 1JWHA 4FEVA 2CGXA 5EW9A 3BX5A 1SNXA 3EQPA 4G2FA 3VWAA 1OL2A 2I40A 2X7OA 4F1MA 4LOOA 2VTNA 1ZYLA 3PJ3A 1OIUA 3L8XA 5EDQA 3OTUA 1H1RA 3SC1A 3TNIA 4GG5A 4FSZA 1JLUE 1X8BA 3JY0A 2PMIA 2I7QA 2J2IB 2V7AA 4O7YA 3SOAA 3NYNA 3D0EA 3D94A 5DLSA 4D9TA 1PYXA 1OKWA 4FKIA 1E1XA 2IO6A 3QXOA 4BDFA 5KKRB 4O7WA 5IQHA 4R3RA 1KOBA 2QU6A 3A7FA 3H4JA 4G3CA 3AC5A 4DCEA 2CLXA 3FC2A 3W2SA 4IM2A 4RVLA 4NTTA 5KCVA 1FMOE 4NW5A 3KY2A 5HBHA 5HCXA 4FTAA 1VYZA 2Y4IB 2UV2A 2J0IA 3O7LD 4CQGA 2PU8A 5B2LA 4QQCA 2PVYA 4UMUA 4JIKA 4E26A 5KMLA 5IZFA 3KMWA 4XBRA 5IA3A 2VTJA 2Y8OA 2VO6A 4L43A 2OJJA 2J6MA 2QO7A 1Z5MA 1Q4LA 1ZZLA 1SYKA 4K9YA 4X3JA 3SHEA 1J7LA 3HEGA 3VBTA 1JSTA 3PY1A 3RPVA 4M13A 4PL4A 1Y8GA 4ZSJA 1ZXEA 3MFSA 4YNOA 2OK1A 2X39A 3O7LB 5HVJA 1YQJA 5TO8A 2V62A 3VS2A 3VHEA 2BROA 1OPKA 3W2QA 1BLXA 4XG9A 2PZ5A 5L4QA 1PHKA 4NYEA 2WQMA 2VD5A 4RIXA 4B8MA 2E9PA 5JFVA 5EHYA 3UDBA 2XIYA 3R83A 4GU6A 5FQDC 5HG7A 3VS5A 4NIFA 4B8LA 3PY3A 4IC8A 5IQGA 4X2KA 4JJRA 1OPLA 3ULZA 4FGBA 2GCDA 2PVLA 4BZNA 4YTCA 3NCZA 4Z7GA 4ZJJA 1MUOA 5LWNA 4RVTA 1YXSA 3AC8A 5CT0A 3N4UA 4HYIA 5FEDA 2XNPA 3OCBA 3DA6A 4U40A 5EHOA 5EK7A 1S9IA 4CFFA 1UKIA 3NUPA 5IA0A 5BMMA 3R6XA 4ASDA 4TWOA 4F0IA 4C33A 3R01A 4C4EA 4EEVA 4K2RA 1GAGA 2VRXA 4PMMA 3S3IA 1BX6A 3JVRA 5B7VA 2OZOA 2WMSA 3SW7A 5LQFA 4RA4A 1DI9A 5C03A 4QYEA 3QTUA 1KE5A 4LQMA 4UMTA 1IG1A 1NT2A 4IVBA 3VVHA 5LVMA 4ZSLA 4O27B 1YXVA 3DTCA 4IB0A 3GOPA 4O0VA 1XBCA 4RBLA 3VIDA 4GFOA 3TV7A 3VS6A 3PXYA 3EQBA 3Q9ZA 2YM8A 1PMUA 4FNXA 3GOKA 4BDGA 3QCXA 4MXXA 2W4JA 2CMWA 1G8AA 4XNEA 3NMUF 4PNKA 4DLJA 4QMZA 3F2AA 4YC8A 4QPAA 2JAVA 5C4LA 2ZAZA 4BBFA 4U7ZA 3HMOA 3LXLA 4ID7A 2PVRA 3VQUA 5AP1A 3HX4A 4EH5A 4QTAA 1LPUA 3ORLA 1H25A 1HCLA 5BVKA 3TG1A 2IPXA 4ZTLA 3QGYA 4IFCA 3UP7A 2XCKA 3F3UA 5JQ8A 4DLIA 3DDPA 4LGHA 5I0BA 4H3PA 4JDIA 4WBBB 5AP0A 1F3MC 2W5HA 3P4KA 2AC3A 4BDEA 2B9FA 3CY3A 4U42A 5AAEA 2E9NA 4AFEA 2YCSA 5HI2A 2H96A 3FBVA 5ANGA 4MQ2A 1UNHA 1KSWA 4GK4A 4OTPA 1SVEA 3R1NA 4HNFA 4H36A 4I24A 3OTVA 4MHAA 4PV0A 2ZYBA 5J8IA 2B9HA 3HRCA 2PVKA 1XH9A 4WUAA 1P5EA 3BELA 3O17A 3ORKA 5HE3A 3RMFA 2PTKA 4CKJA 3VUIA 5KBRA 5L2WA 3RAWA 2GTMA 3UPZA 4TT7A 4C2VA 4H39A 1RDQE 3NYOA 2XK3A 4DT8A 4BWPA 2HY0A 4FKTA 3L8VA 3PZHA 1H0WA 4EOKA 4W9XA 4WO5A 1NW1A 2VTQA 2JBPA 3R02A 3F5GA 4CRSA 1GY3A 4LUEA 2EXMA 3D5XA 1JPAA 2UVZA 4MNFA 4EZ3A 4JQ8A 3P86A 4E4NA 5IQAA 1IA9A 2RSVA 4ENYA 4OLIA 5GIOE 3IO7A 2X9EA 4X2JA 5DR2A 4E93A 3SVVA 4YLJA 4GK3A 2HZ0A 5BVWA 4QMUA 4JRNA 2ETKA 3NUNA 3FMDA 3GQLA 4OTHA 2C5OA 4G6OA 4IHPA 5EI6A 3E8CA 3QRJA 4ZJVA 5K0XA 4X3FB 3DLSA 3FI8A 2V7OA 3UG1A 3NUUA 4AUAA 3LFAA 3GC9A 4UXLA 4FV2A 5DT4A 5HTCA 2C4GA 4XV2A 3IK3A 5EM6A 1BKXA 3PJ1A 4CD0A 3LXNA 4QYFA 3C5UA 2IW8A 3VW6A 5DMZA 2PVMA 5HX6A 5C4KA 2HY81 3E8DA 3AMAA 4YJNA 5JRQA 3VUTA 4MNEA 1QPCA 4D0XA 3PDTA 3F5UA 5F20A 3UOKA 3GB2A 3OOGA 4RLLA 4D2SA 3F2NA 4MWIA 2XKEA 2W96B 4QTCA 1URWA 3SRVB 4CKIA 5A46A 3ORNA 3U4UA 1PXJA 2YDIA 5FWKK 4OGRA 3DCVA 5CSWA 4TYEA 4A9YA 2X7GA 2XM8A 4RRVA 2C6KA 2PL0A 3E93A 4FF8A 2C0TA 1M17A 4EK4A 4KIKB 2C3KA 5FXRA 4JI9A 4K11A 4GG7A 3Q2MA 5CAUA 3UO5A 3WYXA 1J7UA 4F7JA 4LUDA 5BVFA 4XMOA 4UMQA 4TNBA 5JGBA 5J1WA 4QQJA 2X6DA 2WQEA 4Y95A 5CU2A 3P5KA 4F9BA 4F0FA 5AUZA 4ZAUA 3F3TA 3H3CA 3NIZA 1RW8A 2ITUA 4TNDA 5CVFA 2ONLA 3R7GA 4DG0E 4HVIA 4R3CA 4N6ZA 4C61A 2B9IA 3UVQA 3WF8A 4RZWA 3P1AA 2WMUA 3NW6A 3V5JA 5IQBA 4KRCA 3TN8A 3FSKA 3IKAA 4AOJA 3R0TA 3CE3A 4PMTA 4R77A 4BDDA 3VBQA 3FL5A 3WIKA 3BCEA 3G9LX 4DH8A 4EHEA 2X1NA 1PF8A 4ANNA 2Z7LA 3BGPA 3A62A 1Z57A 3NVMB 3UC4A 1O9UA 3GCPA 1PXLA 3JY9A 1PKGA 2JDTA 5HIDA 3RCDA 4E7WA 4CVAA 4C58A 2RFNA 4QP9A 1R1WA 2ITOA 3EFLA 5HCZA 5AA8A 3ACKA 4FIFA 2YFXA 2REIA 3UVPA 2JKMA 3FL4A 5CQUA 4F63A 2VWYA 3GCUA 4O0YA 2VO0A 5TF9A 4X6RA 5ANEA 3MPAA 4DEHA 4FNWA 2YM7A 2XIKA 3QKKA 2NPQA 3NX8A 4BCQA 3SD0A 2HAKA 1Q8YA 4X0MA 3QRKA 3BYSA 3ZDIA 4G16A 4GIHA 3UMXA 3G51A 1EH4A 3D5WA 1DM2A 2C1BA 2BDJA 2YZAA 3CTQA 3QX4A 3O96A 1OL6A 3FYJX 3LFDA 2CGVA 1W82A 1TKIA 4FKSA 5DGZA 3PSBA 5CANA 4JDHA 2QQ7A 3LVPA 4LG4A 4TL0A 4DFLA 4O7TA 2YA9A 2IVVA 1WBPA 3CQEA 2EB2A 2ZV8A 3GVUA 1A06A 1E9HA 4V01A 5DT0A 1JKTA 1UNLA 2BRNA 2H6DA 2WMBA 3R8PA 4BGQA 2J0MB 1ND4A 2X81A 4MBJA 3IOPA 4J98A 3Q4CA 3A60A 3NW7A 3MVHA 4BKZA 1YDRE 2VN9A 1H08A 5L6OA 4O2ZA 3QL8A 4W8EA 3G90X 5L8LA 3IGOA 3OZ6A 3WF6A 4CFMA 2W4OA 2X8DA 4OTWA 3DTWA 2QI8A 4H3BA 2B4SB 1M2RA 4APCA 3WIGA 3JVSA 5EH0A 4I5MA 3UBDA 4MH7A 5FXQA 3ODYX 1V1KA 4AA0A 4BDHA 2F7ZE 3MH2A 4FVRA 4LV8A 2BAQA 5DNRA 3W16A 3BHHA 5KZIA 3W2PA 4BB4A 4QMQA 3ATSA 3DU8A 3VULA 3LJ2A 4UB7A 3FMEA 4P5ZA 2JIIA 4AGWA 1NVSA 1YHVA 3CKXA 3DAKA 2WMQA 3DBQA 5DT3A 1WVXA 3ORIA 4RVMA 3BBTB 3I79A 2WB8A 3G0FA 2WMVA 2ZMCA 3QCYA 1LEZA 3TJDA 3Q6WA 3CIKA 1OGUA 4D2VA 3ORMA 3FZSA 1Q3DA 4UZHA 4RLKA 4QNAA 3QRUA 4CFVA 3QC4A 2F4JA 3K2LA 3CTJA 2YM6A 4FL2A 3LQ3A 3NYXA 4YU2A 4PTCA 4S31A 1U59A 5M51A 3MVMA 3TL8A 3I0QA 4J71A 4ZY6A 4NW6A 3UIUA 3ZFXA 4BDIA 5IEVA 3CKWA 3CEKA 3W55A 2WMXA 1MRUA 4I0RA 2BUJA 4F4PA 3E92A 4DFUA 4ZSEA 4FR4A 3UPXA 3CQWA 2BCJA 4IVCA 5I3OA 1W0XC 2R64A 4LMNA 5E8XA 5HNBA 5J7BA 1DI8A 5D7AA 1F0QA 5A4QA 5HKMA 4V0GB 4BI1A 3SOCA 3P78A 3Q9YA 3I6UA 4C35A 2PVJA 4PRJA 4JBVA 4PDOA 4ZEGA 4C3PA 2ZM3A 3PP0A 4I23A 3OY3A 5CEQA 3ALOA 3ZLXA 1FOTA 2JIVA 1KE8A 3RTPA 3EQRA 4EH8A 4UWCA 4BTJA 4HZRA 4U45A 4DITA 4BYIA 5B2KA 5IDPA 5HD7A 4UN0C 5IA1A 3VUMA 2C6MA 3DY7A 3NNUA 4BZOA 4FL1A 2WQBA 5D11A 3KULB 3OMVA 4IX6A 3IS5A 3MBLA 5AMNA 4W4XA 3IDBA 2F9GA 4IM0A 1ZY4A 3NR9A 4RJ8A 5HO8A 5BYLA 1UU7A 5CASA 2ZVAA 3FXXA 3FMMA 1OPJA 4YJTA 1RE8A 5AUUA 3R1YA 3IW5A 1VYWA 2BRGA 2YISA 2ERZE 4YURA 3ATTA 4UMRA 2OXYA 4YO4A 2A27A 4MBIA 4YBKA 3U9NA 4TZRA 4EKLA 2QR8A 4LM5A 4ZY5A 3G2FA 2RIOA 1MRVA 2C3JA 2WQNA 3ORTA 2PULA 4FTIA 5TKDA 5BNJA 2PVHA 1I09A 4CLIA 4DCAA 4TYGA 4B7TA 4RIYB 3QYZA 5AJQA 5M08A 3QRIA 4FYOA 4JG6A 3R7VA 4G31A 3BLHA 2QURA 2ZMDA 4TYIA 3B2TA 4TWCA 2F57A 3NWWA 5FDXA 3GGFA 4KUJA 4FSMA 3R71A 2Y0AA 5AEPA 3SGCA 3TJCA 3EN9A 4L01A 3F3VA 4TW9A 1YOMA 1Q62A 2OZAA 2F7EE 4FMQA 5AP2A 1B38A 3UIXA 5CVGA 2VTSA 5D1JA 5A9UA 4O83A 4QOXA 1YI6A 2C5NA 3EKNA 3ENMA 4RT7A 5CSPA 2EXEA 4FEUA 3Q04A 3A7JA 2PWLA 3FQHA 4FV8A 3UP2A 3H0ZA 4O7SA 5ACBC 2OFUA 2I0HA 3TKIA 3BE9A 4QMPA 3EQFA 2R3NA 3CY2A 3HNGA 4EHVA 2XCHA 4EHZA 3I1AA 2HENA 3I7BA 4O0SA 3FMKA 5CENA 2C3LA 3ZXTA 1GNGA 5JH6A 3EIDA 1O6YA 2V55A 3KRXA 3Q53A 4AAAA 3R73A 4XG2A 5JGAA 3VUGA 4NH1A 4QP3A 3RPSA 4EYJA 3S4QA 5LARA 2GMXA 4Y8DA 4D2RA 4USEA 3TCPA 5CAQA 2PZPA 4NUSA 1RQQA 3ZYAA 5AADA 5HD4A 5CU3A 5A4CA 4GU9A 2FO0A 2Z2WA 3LFCA 5F9EA 4RA5A 3FMHA 1PMVA 3GU8A 1BYGA 3FLWA 1XJDA 4YPDA 4DFXE 3PE1A 2IJMA 3VF8A 2W1CA 3GUBA 4DF3A 3HKOA 3RWQA 1T46A 2O63A 3BYUA 3LLTA 2FA2A 3BLQA 3ZFYA 4FT3A 3NLBA 1H4LA 4RJ3A 2OF2A 3L9LA 4JRVA 1SVHA 3I0OA 4AF3A 4G6NA 4PY1A 3UO4A 2QHMA 3N51A 3QA8A 4IEBA 4CFWA 4D1SA 3TDWA 3KREA 2A2AA 4IWQA 3BEAA 2P2HA 2J5EA 3KRJA 3FLZA 4BYJA 5BUIA 2UZDA 3VJOA 2ERKA 4FG7A 2NO3A 3BHUA 4JBQA 3AT4A 4BCNA 1PXPA 3MTFA 4IB1A 5CS6A 1XBAA 2VWIA 4EH3A 4D4VA 2WU7A 4BGHA 2O3PA 5JFSA 1YWVA 3DDQA 3PPKA 2O64A 4W4VA 5DOSA 4RWKA 3RPYA 4FTJA 4Q9SA 4HYSA 1T45A 4E5WA 5A4TA 2HCKA 4IXPA 2X8IA 3KB7A 4WNMA 5E8VA 5CEIA 4A9RA 3TZMA 4RVKA 3FLYA 4ACMA 5IA5A 1OUYA 3QC9A 2OICA 3JPVA 3ACJA 4FEWA 4CZYB 3TUBA 2FSTX 5D9HA 2YIYA 4FTOA 4J97A 1GIIA 2G2HA 1XQZA 4QP2A 3C7QA 3P7CA 1DS5A 1H24A 1QPDA 4CFNA 2YEXA 4I0TA 5E91A 5AFVA 2B54A 5AIRA 5E8YA 5DIAA 5IF1A 3KVWA 2CN5A 5EKNA 2CCHA 3FAAA 1UWHA 4I21A 5BUJA 3CSVA 3A7GA 2OJIA 3LCTA 5HCYA 3ZS5A 5CU6A 2XM9A 3KRRA 3WZEA 3KC3A 4H1JA 3DPKA 4C3RA 4FKLA 1Q8ZA 1FMKA 3DQWA 3RPOA 3EHAA 1V0PA 4YSMA 2VTTA 5FM3A 4FZDB 2KULA 4J96A 2ETMA 3U6JA 2RFDA 3C0IA 2YLFA 3HV4A 3LHJA 2VX0A 4O22A 2YIQA 5D7VA 1ZZ2A 3OEFX 4AT4A 3QU0A 4ZS0A 5BVNA 4BCPA 3KXHA 3MESA 3CCNA 3PVUA 4BIDA 3UG2A 4EL9A 3I7CA 2EVAA 4RC3A 4GJ3A 2XMYA 4ALUA 4ZP5A 4LV5A 3OXTA 1BL7A 1MP8A 4O2PA 4R3PA 5JT2A 4UYNA 3OWPA 2BKKA 3MH0A 2J7TA 1OI9A 4ZY4A 4JS8A 4G5JA 1ZOGA 2ONLC 2W1FA 4PP9A 5CYIA 2RKUA 3BWFA 2Q83A 4C8BA 3G33A 4FKWA 4XS2A 4BDAA 3DJ6A 4CTCA 3MIYA 4EOQA 2B1PA 3PP1A 2I6LA 5L6PA 3F88A 3UYTA 1VZOA 3LCKA 4QYYA 3CXWA 4XJ0A 3WZKA 2E2BA 4YZNA 3OBGA 4CMOA 1IR3A 4EH2A 4RJ7A 2QO2A 5EQYA 2CN8A 4IB3A 4ZZMA 2PE0A 3HMPA 3RAKA 4O21A 2J90A 3OXZA 4B99A 3FLSA 3OF0A 1PXOA 3DJ7A 1WMKA 3PTGA 3MWUA 2VX3A 5J5TA 3NNWA 2QLUA 1Q24A 1YDSE 3PZEA 1JBPE 1Q5KA 4IVDA 2VO7A 4O7LA 4GK2A 4Y83A 5D10A 1R78A 2GQGA 3UIBA 2R3JA 4OT6A 3R7OA 3L1SA 4J8NA 3S2PA 4F7SA 3QXPA 4XUFA 4DEBA 5EYMA 1TQMA 4AZWA 3FI2A 4FTNA 2I1MA 3QZGA 5ICPA 3DNDA 4BL1A 4A4XA 4X7QA 3NCGA 4KSPA 3MY5A 5LWMA 1LP4A 2YIWA 4H3QA 3DKFA 1R3CA 3UOHA 4ASEA 4A9UA 4FTTA 2C6LA 3NNXA 2R2PA 4FV7A 4D5HA 3WZDA 3LXPA 3OCTA 4YZMA 4DEIA 5LVOA 4E6QA 5JRSA 3BKBA 4U97A 3PWYA 3PWDA 4PPCA 2FVDA 1OBGA 4XRLA 2P2IA 3VO3A 2CCIA 4A4LA 2IZTA 4AQCA 2YJRA 4AZSA 5JQ5A 1IRKA 2G2FA 4I6FA 5EG3A 3FMJA 5ANKA 2J0JA 2H8HA 2OKRA 4CG8A 3U9CA 2UZBA 3R21A 3BGQA 5AUTA 3Q5ZA 4RJ5A 2BZIB 3RINA 3ZU7A 5KHXA 4Y5QA 3PIYA 4IX4A 4YO6A 5GZ9A 3LCOA 3S1HA 4MF0A 3RALA 3VBVA 3SQQA 3T9IA 4U0IA 4C37A 3REPA 4FL3A 3ZC5A 3GENA 5M55A 4AWIA 1IEPA 4NK9A 4GIIA 3WF5A 4CQEA 4MD7E 2B0QA 2XZSA 3ZHPC 4DGMA 1E1VA 1OUKA 5HORA 4UWBA 4DFZE 1VEBA 3QUEA 3FDNA 4XV1A 3F7WA 5AM6A 1ATPE 3FZ1A 3O0GA 2OJFE 5ETCA 3KN6A 2CJMA 4XOZA 2PUUA 3R8ZA 4WG4A 3PSDA 5BQ0A 2ITTA 4FKUA 3HRFA 5HLNA 4IX5A 5EHLA 2PK9A 3QTRA 3QTIA 4TPTA 3PRFA 4Z16A 4H05A 2O0UA 4FT9A 5E8ZA 1JKKA 4O7ZA 1FPUA 4IQ6A 3HLLA 2YACA 4EJ7A 4FV1A 4BCFA 2WTKB 3COMA 3HRBA 4GYGA 4FTCA 5DR9A 1JNKA 2VZ6A 3VRZA 4EZ5A 3DXNA 4P4CA 4OTIA 4C59A 5E8TA 3HMNA 2YITA 2W7XA 4H58A 4TRLA 4CCUA 4ITJA 4ZOGA 2WHBA 5HGIA 4FUYA 2X2KA 1JSVA 4II5A 3IONA 3KK9A 4LOQA 1CDKA 3F82A 2HW7A 3O71A 4O0RA 3ZRLA 2VNYA 4WRSA 3IPHA 4CYJA 2EWAA 1J91A 3E8NA 4UXQA 2XBAA 2AYPA 4G9CA 3GC8A 4L7FA 4PDSA 4DH3A 4P5QA 2PYWA 3QF9A 3UJGA 4CNHA 5M57A 4O7RA 2WGJA 5E90A 1MQ4A 4MWHA 4FZAB 4CYIA 1WAKA 5M56A 2FUMA 4K8AA 4OT5A 2JKKA 4F08A 3AMYA 4CCBA 4QP8A 2NNWB 1CKIA 4I6QA 5H9BA 3MA3A 1REKA 3CTHA 4HCUA 2WTJA 2ZV9A 5E1SA 1PYEA 2PVNA 3LOKA 3MPTA 4NEUA 5F1ZA 3TNPC 1FVRA 2QLQA 3MH3A 4G3FA 4G6LA 3SXRA 4FSQA 2VU3A 3QZHA 4C4GA 1JSUA 4LI5A 3CPBA 4E5AX 4DT9A 2CDZA 4RWLA 4TWNA 3FPMA 2YM3A 1XO2B 1QMZA 4B4LA 4YJSA 4X6QC 2GQRA 3WZJA 4I92A 4KRDA 3EB0A 2YWPA 5KNJA 3K54A 3EOCA 2C30A 3ZM4A 5EYCA 2CKQA 4R7BA 2QNJA 3U8WA 2VTHA 4F1TA 3A4PA 3AC1A 5AUVA 1H1SA 3RK7A 5IQCA 3D7TB 3P0MA 1MQBA 3EN5A 2WO6A 4AOTA 4OAVB 4BFMA 4DE4A 4Q2AA 4KNBA 4J8MA 5KO1A 4IMYA 2LAVA 2DUVA 3KCFA 4BCHA 4QMXA 3TT0A 4B0GA 5CVHA 4CG9A 3OP5A 4DBXA 5DR6A 3ERKA 2IVSA 2R7BA 2X4FA 5I9YA 5KMOA 4L3PA 4OTFA 2GFCA 4JG7A 4AFJA 3LQ5A 2R3GA 4I22A 3AC4A 5HG5A 2B55A 4OR5A 3W2CA 5A54A 3OC1A 3R2YA 2JBOA 3CR0A 5IQIA 1FVTA 2QODA 4RIWA 2XH5A 4NTSA 2YIXA 3QWKA 5HNIX 4FKGA 4EWQA 2IVUA 2JIUA 3CC6A 4U80A 3DAJA 2P3GX 3KRWA 2BALA 5J1VA 2CKEA 3ZH8A 2WFYA 3AD6A 4EQCA 5AX3A 4OTDA 3ZUUA 5FD2A 4KKGA 1H07A 5ETAA 1Q41A 2YIRA 3BV3A 3THBA 1YWRA 5HE0A 4E5BA 4DGLC 4MX9A 4LRMA 3EZRA 1Q97A 3W8QA 3MGYA 2R5TA 3MJ1A 5C8NA 4DTAA 4LGDA 3R7UA 4ACGA 3ZBXA 5ANJA 1JQHA 4M67A 3A2CA 4XYFA 2ITZA 4YZCA 4DG2E 3AD4A 5K5XA 3KCKA 3VNTA 4EJNA 3HV7A 4MK0A 2A19B 4BRXA 5HU3A 2R0IA 4GEOA 1KE6A 4ZLZA 3R9RA 3KRLA 5AAGA 4KA3A 3QX2A 3VAPA 2B52A 5H8EA 1ZYSA 3NS9A 3TV6A 3ZSGA 4ACCA 5AIKA 3HDMA 3VUHA 2P0CA 4XP2A 4RIXB 4M14A 3DK7A 4IDTA 1QPEA 1PRYA 2Z7SA 2GNGA 3G5DA 1U5QA 5GJFA 4RQKA 5EKOA 5JFWA 4RSSA 4J52A 4J7BA 4YJPA 1H1WA 5HBEA 5IEXA 4GVJA 4ERWA 1ZYCA 4RFYA 4C38A 4CV8A 1U54A 2VWVA 3DZQA 4BCOA 3E7VA 3Q52A 3MDYA 2AC5A 4BKYA 3DKGA 5CNNA 1WZYA 3E62A 5I5ZA 3QZIA 1UV5A 2GQSA 1S9JA 4BICA 4KKEA 4X2NA 5EW8A 1Y57A 3H10A 1PXKA 2Y9QA 3QHWA 1CMKE 5AM7A 5FGKA 2J4ZA 2J50A 5H8GA 4NSTA 1NY3A 3H9FA 4S2ZA 4KBKA 5J7HA 2QHNA 4FSWA 3QD0A 4HVHA 3MVJA 5E7RA 5J9LA 3GCQA 4FE2A 4K33A 3CGOA 5TE0A 4O38A 4RC4A 3D7ZA 3ROCA 2X8EA 3EZVA 1YDTE 3RNYA 2XKFA 3VS3A 4JL9A 5A6OA 3C4XA 1Q8TA 4PQNA 3GEQA 3IECA 1Y6BA 1XHAA 2W17A 3OCSA 2J0LA 4HPUE 4YJOA 3QKMA 5FEEA 4F9AA 3D14A 3LLAA 3VS0A 3UIMA 5FDPA 5JZNA 1R0PA 5GJGA 2W9FB 4I5HA 2OBJA 3D83A 3R7YA 3ITZA 3TDVA 3F5XA 4XRJA 2EU9A 4YPSA 4W9WA 1R39A 3MFRA 3PIXA 4FZFB 1FGIA 4BI0A 4EYMA 5LJJA 3EYGA 4O7VA 5DPVA 4F64A 3C50A 3MJ2A 3PYYA 5DN3A 2R9SA 2HZIA 4GCJA 4QRCA 4U9AA 3SKCA 4IC7A 5M06A 4WT6A 3R2BA 5EOLA 5HG8A 4ZTMA 5K4IA 4DC2A 4IAZA 3FMLA 4EK5A 4LOPA 3BLRA 3G15A 4R6VA 4BCGA 5IH6A 5CAOA 5KKRC 3ZMMA 2RFEA 2PHKA 2GHMA 2YCFA 2Z8CA 3MSSA 3ET7A 4N70A 2W5AA 2WNTA 5D12A 4PL3A 5F95A 4ZSAA 3MFTA 2BAKA 2UW9A 4G3EA 2Y4IC 4C4JA 3FXZA 1XH7A 2Y6MA 2J5FA 3COKA 3MY0A 2CKPA 4D4SA 5LVNA 4GKIA 3F3WA 2DYLA 5KMNA 4C3FA 3EJ1A 3FV8A 4NJ3A 1UNGA 2X2MA 4C4FA 1PW2A 2WMWA 2C3IB 4YBJA 3KULA 3EQHA 3MA6A 4QT1A 3E7OA 4DG3E 4FEXA 3Q5IA 3AC2A 1J3HA 4FV9A 4BN1A 5CZHA 2C1AA 2A4LA 3EL7A 4IZ5A 2WMRA 2YABA 4EUUA 5C01A 4FT0A 3D9VA 4AE6A 2FGIA 3P08A 4PTGA 4F7NA 5EQPA 4QMSA 3TM0A 2F49A 4R7IA 4LRJA 2QKRA 2PMNX 3FZTA 4HCVA 1ZLTA 4XP3A 3ZFMA 1ZARA 4HPTE 5E8UA 2F2UA 3WF7A 4FIHA 4IZAA 4MKCA 1OL1A 2R3FA 4G3GA 4FEQA 3TUDA 3LCSA 4UMPA 4RFZA 3QUPA 4XLVA 2Z7QA 4DFBA 5AUWA 3DB6A 2ACXA 4WA9A 4K1BA 3T3UA 3PXFA 1YXTA 4Y5HA 1K9AA 3K3IA 3KGAA 4FUXA 4D2TA 4ZTHA 4ACHA 3B2WA 5B2MA 3LKMA 3DNEA 3L8PA 3Q32A 1YOLA 4FNZA 5DEYA 5DFPA 4HVDA 3HAVA 1XH4A 1GZKA 5E8SA 3BI6A 4FBXA 4AGUA 3BYVA 5IMXA 4E6DA 4MBLA 5DWRA 2O8YA 5AR7A 3TXOA 2NP8A 4V04A 4JDJA 4ALWA 3L9MA 4JAIA 1P4OA 2YZLA 4YZDA 4KIPA 2R3MA 4QNYA 3O8PA 4GVAA 3QBNA 2CHLA 4L44A 3QYWA 4IAIA 3UE4A 3RKBA 2VTAA 4NJDA 5L2IA 4I6BA 5M07A 3UGCA 5HVKA 2I0EA 4MD8E 1BI7A 4C0TA 3QGWA 2JKQA 3KL8A 2GDOA 5HHWA 3RI1A 3RPRA 3D2KA 3GC7A 3GBZA 4WSYA 3LIJA 4D2PA 1Y91A 4RFMA 3ALNA 4QO9A 3ZSIA 5A14A 4JG8A 4W4YA 3CS9A 4G9RA 5AR5A 4ZZNA 1Y8YA 2UZNA 2XA4A 3C0GA 3KXMA 5L2TA 3QRTA 2YM4A 3KVXA 3TZ8A 3E3PA 4AACA 4Q9ZA 2V0DA 3QTQA 4O6LA 3C9WA 4YLKA 1B6CB 3MIAA 4BI2A 4F0GA 1YI3A 5GJDA 5TT7A 4OTRA 4ZSGA 5E1EA 3SDJA 3BEGA 4F99A 3BQCA 4J95A 2WMAA 3PJCA 4HW7A 2UW3A 3NNVA 4IZ7A 4KBCA 3RZFA 4O6EA 5I9WA 4DEEA 4U5JA 4CTBA 3QQUA 2XNNA 4AA5A 4MTAA 3PUPA 3K3JA 3QTZA 4I0SA 3DZOA 3I5ZA 4FIGA 3OT8A 4G17A 4AP7A 2PUIA 3R7EA 5E9EA 2WELA 2VUWA 3LAUA 3PFQA 4YUQA 4YJQA 1IASA 2OIBA 5FXSA 2AUHA 2YHVA 2OO8X 1K3AA 3C4WA 1LUFA 3D5UA 3QKLA 4FTLA 1R0EA 2XNOA 4FSYA 4IJ9A 4UYAA 3VS4A 3R30A 5EOBA 5BVOA 2CSNA 2FSOX 2BILB 3DS6A 4HNIA 3V01A 5IH5A 4BTMA 2QONA 4XG3A 4AW1A 3TZ7A 4BCKA 4JQ7A 2DWBA 3U51A 4DFYA 4FI1A 5KX8A 4O82A 4RWIA 2UUEA 3SAYA 2B9JA 2ZV7A 3KN5A 3NSZA 4QPMA 4RPVA 2CKOA 2ESMA 1I44A 5BMSA 5IQFA 4YR8A 2XYNA 2WTWA 1XWSA 3TACA 1W83A 1ERKA 2WIPA 2WPAA 4D55A 3VS7A 4E6AA 5H8BA 1AQ1A 1ZMUA 3I6WA 4ZMEA 2XKDA 4UBAA 2XS0A 3DK6A 3WI6A 1ZWSA 4F6WA 5FRIA 3R63A 2UW6A 3F5PA 4EH7A 5AX9A 5CQWA 4CLJA 3KKVA 3ZUTA 4AS0A 3UTOA 3CD8A 3BYMA 4XP0A 3H30A 5ANIA 4Z9LA 3U6IA 2XUUA 5CSHA 4GKHA 3M1SA 3CPCA 4FTRA 5HNGA 3QALE 3QLFA 5CEKA 3MPMA 1WBWA 2VGPA 3OUNB 3DK3A 3PA5A 4GFGA 5DHJA 4KIOA 3R9NA 3W10A 4ERKA 1UKHA 3HAMA 3UZRA 4WKQA 1H27A 3A8XA 4U3ZA 3BQRA 1KE9A 4GT5A 1STCE 2BHHA 4HCTA 4MXAA 4X3FC 2BRMA 2H34A 3GNIB 3OD6X 3ZZWA 4XG6A 5ETIA 1Z9XA 5HE2A 4YJUA 4QMVA 3PPZA 3GCVA 2GNIA 1URCA 5LMAA 4WRGA 4LRKA 4QYHA 1KUTA 5AR4A 3PVBA 4WNPA 1A48A 2J51A 2ZM1A 4L9IA 4GUEA 2XK6A 5ANOA 3ZO4A 4BDJA 1OIQA 4QP7A 4NL0A 3GFEA 3AGMA 4UWYA 3FKOA 4UZDA 3ZEPA 4EK3A 1REJA 4F6SA 5JFXA 3U87A 5K4JA 2V5QA 4NCTC 4BIBA 5CALA 3HDNA 4ENXA 3FI4A 3W8LA 2YCQA 4AGDA 2XK9A 4X2GA 4IDVA 4ASXA 4E8AA 2R4BA 4K77A 2CGWA 4NFNA 3V8WA 5HBJA 5IQDA 5KHWA 3FY0A 1VJYA 4FX3A 1OVEA 2R7IA 4NM5A 3EQCA 2W9ZB 1H01A 3QQHA 3UNJA 1OKYA 5DYJA 3ZZEA 1OB3A 4RX8A 5KE0A 4F7LA 3R1QA 1JKLA 4A7CA 3GT8A 3KFAA 4QTBA 5AR3A 2E9VA 4ASZA 2JDVA 3E3BX 3G9NA 4EBWA 2JDOA 2HWPA 1Y6AA 2XNGA 2BRHA 4I20A 5E8WA 5KMJA 4GL9A 4F9CA 5JGDA 4M69A 3MN3A 5EYDA 4C36A 5IUGA 1WBVA 4D1ZA 4ALVA 4EC9A 3VBYA 2HW6A 3KXGA 1U5RA 4S30A 4U79A 5EW3A 2PPQA 3LM5A 2R3HA 2QOHA 4M66A 3KF4A 4EOSA 2XRUA 4NM7A 5I9XA 5AV0A 3QZFA 3FZPA 3SA0A 3SG9A 2VWBA 2UZWE 3F66A 4ITIA 3OW4A 3R8LA 2CLQA 4XBUA 4YLLA 3K5UA 3U54A 3AQVA 4QD6A 3P7AA 3KQ7A 3POZA 2WIHA 4RIOA 3FSFA 3EN6A 5FBNC 1PMNA 5HQ0A 5LOHA 4R1YA 1OITA 3BRBA 1H26A 4O1PA 2VTOA 5CXZA 2R0UA 1OKVA 5AP3A 1ZMWA 2HIWA 4AN2A 1NXKA 4CMUA 5CEPA 4HGEA 2VX1A 4FKQA 3DXPA 2VWZA 4AZEA 4D2WA 1H28A 3COIA 3CBLA 1LR4A 5ANDA 3A8WA 4XEYA 2BR1A 4BCJA 3ZEWA 4PP7A 5KUPA 4YHTA 2QOLA 1Q8WA 2BZKB 2RF9A 4ZTRA 2XYUA 4FTMA 4NWMA 4R1VA 4PL5A 1XH6A 3COHA 3QQJA 3MB6A 4QQ5A 4A07A 5LXMA 2Q0NA 5DA3A 2C47A 2UVYA 4QPSA 2ITPA 2OZAB 3IG7A 3EMGA 3KU2A 4YZ9A 3D4QA 1YKRA 2RFSA 3JS2A 4TTHB 2VV9A 4PMPA 4DINA 4EONA 4G5PA 3C0HA 2YAKA 2Z60A 2OWBA 2WAJA 3EKKA 3PSCA 2P33A 3ZONA 3FJQE 3NAXA 5H2UA 2G2IA 3FY2A 4FA2A 2GNFA 4M0ZA 4C4HA 1OBDA 3EL8A 2WD1A 1V0BA 3F69A 4UEUA 3V3VA 4EK8A 3II5A 3T3VA 4AG8A 2YN8A 4IIRA 1KOAA 2BHEA 4XOYA 2OG8A 4BR3A 4AZTA 2ZM4A 3Q4UA 3LMIA 3PE2A 3RM6A 3DV3A 3DKCA 3BU6A 2W4KA 5L8JA 5CF6A 4C62A 4LFIA 2UW5A 2G15A 4YTHA 5EDRA 1UWJA 3EQIA 3KXNA 1WBSA 5IUIA 2JITA 5CF8A 5J79A 4I4FA 5B0XA 2RG5A 4NU1A 3ZTXA 2VWXA 1VR2A 3Q9XA 2BTSA 4PF4A 3TNHA 4EOPA 3PJ2A 1APME 5HTIA 3F61A 3MV5A 4AZVA 1SMHA 4FT5A 2HELA 2FSMX 1WBNA 3MYGA 2GNHA 2R3OA 3R8VA 5HX8A 5BYYA 4Y46A 2OF4A 1AD5A 3FC1X 5CT7A 4EHGA 4JXFA 3QUDA 3G0EA 1CSNA 5K5NA 3R9HA 4KBAA 3ZOSA 3KXXA 5CSXA 2XEZA 4WD5A 2JC6A 3EH9A
chains in the Genus database with same CATH superfamily
1TQIA 2P55A 2ITQA 4F09A 3H9OA 5M4CA 4X2FA 4C57A 3TNWA 3DBCA 4XV9A 3R8MA 4U44A 4D4YA 3CJGA 4DTKA 4ZMFA 3DGKA 1J1BA 4FTUA 2PZRA 4HYUA 3ANRA 5IMEA 2CNQA 5GHVA 3U55A 3DLZA 4RJ4A 1OM1A 2VAGA 2FYSA 3GU7A 4CXAA 4U81A 4AXCA 4DHIB 5J5SA 1B39A 3IW6A 3AT3A 4K6ZA 4TYHB 5JEBA 2BDWA 1RJBA 4GT4A 3F3ZA 3NDMA 3RGFA 4USDA 3G6GA 3E88A 5M4FA 2VTLA 3FQEA 2UZLA 3BBWA 1L3RE 3PXZA 3GI3A 3QD3A 4OTQA 5LMKC 2PUNA 5E4HA 5IISA 3KF7A 3ZO3A 2W05A 4UX9A 2X0GA 4RC2A 5JMSA 5D41A 4QYGA 1FINA 4JLCA 3R8UA 3TTJA 4M84A 3HA8A 4UY9A 2GS6A 4I4EA 4QMMA 1J1CA 3NUYA 1QPJA 4AGCA 4E3CA 2BIYA 4FKRA 4PUZA 1XKKA 4E6CA 3QWJA 1GJOA 2ZOQA 3GU6A 2UVXA 3I81A 2E9UA 3LCDA 2XAMA 2WOUA 5M44A 3MTLA 4GH2A 2XIXA 3LPBA 4S34A 3TV4A 3DKOA 3HV3A 4YHFA 5DRBA 3TTIA 3L8SA 3LW0A 5J9ZA 1M14A 3CP9A 4ZXTA 1PXIA 4GS6A 1HCKA 2JGZA 2PE1A 5FBOA 4AW0A 4C4IA 5IU2A 1V0OA 2C69A 1P2AA 2XVDA 2O5KA 5A6NA 5AV1A 5BX0A 3Q3BA 3KA0A 2XJ0A 4R8QA 4ZIMA 3BPRA 3JUHA 2Q0BA 1TVOA 5AV2A 4N0SA 4DBNA 3TEIA 2X7FA 2XJ2A 4NM3A 4J53A 4NZWB 4XG8A 2HK5A 4FV3A 4YGAA 5DRDA 1KV1A 5F4NA 3TWJA 5AV4A 2OJGA 4CT2A 2C5YA 4OUCA 5CY3A 5ACKA 4WHZA 2JD5A 4IH8A 1H1QA 1W84A 4FSNA 3Q96A 1NVQA 5FTGA 5EM8A 2QO9A 3R1SA 4S33A 3S0OA 2C5XA 2VWUA 2R3PA 1NA7A 4BJJA 4S32A 3WF9A 3E63A 3HZTA 4XCUA 4BIEA 4ACDA 4MXZA 4WOVA 4FV0A 3DT1A 1P14A 3V5TA 1OL5A 3BU5A 4OBOA 1W2DA 2GS2A 3EFWA 4DEAA 3SLSA 4F9WA 3NUAA 4NM0A 2ITYA 2GSFA 4ZS4A 5HLWA 2BVAA 4M3QA 3W2OA 1K2PA 2BTRA 2IWIA 4L42A 2VWWA 5AP5A 5GIPE 3JYAA 5LCKA 3VN9A 5IG1A 2O65A 3UOLA 4USFA 3V5PA 3B8RA 4N6YA 3RJCA 4IAKA 4KINA 4MD9E 5AAFA 5GZAA 3VS1A 4NKAA 2JFMA 3ZM9A 3PLAE 3AG9A 4DGGA 3PG3A 1JVPP 4KD1A 4MCVA 4DAWA 2E9OA 2WEIA 5HE1A 2YDJA 3M11A 2I0VA 4FKJA 2FSLX 3OOMA 1FQ1B 4QMYA 3V5LA 1SZMA 2RGPA 2W1EA 3CLYA 4ONAA 3UDZA 1WBTA 2EXCX 2PY3A 3OXIA 3F2RA 2J9MA 4MQ1A 4TWPA 4Z7HA 3HL7A 1KV2A 4RJ6A 2XNBA 1YHSA 4AW5A 2YWVA 1PXNA 4MAOA 4X3FA 4EOIA 4DFNA 4L3LA 4EOOA 4IVAA 3ZBFA 3OVVA 4FG8A 4I41A 4BGGA 4O0WA 4L52A 4YJVA 4KKHA 4RG0A 5CSVA 5DG5A 1GZ8A 1WBOA 3TKHA 4CKRA 4PDYA 3ENHA 4FSTA 3ZLWA 4G3DA 4NT4A 1GZOA 5AP4A 5TOZA 5TR6A 1ZYJA 3ZXZA 3GU4A 4ANLA 4DTBA 5HIBA 3CGFA 3ODZX 4R5YA 4AT3A 4DA5A 3JR1A 5CAPA 4PDPA 3SRVA 3CD3A 2B53A 3NEWA 1FGKA 4ZJIA 3RWPA 3W18A 4NCTA 5FLFA 3VW8A 1OL7A 4EK6A 3WARA 4EOLA 5J9YA 4QMOA 4O84A 2W06A 4D0WA 1JOWB 5BUEA 4KIKA 3DFCB 4KWPA 1JKSA 3TIYA 2QU5A 4GJ2A 5CEMA 4R7HA 5AUYA 4UV0A 3OG7A 1M7QA 3ETAA 3V6RA 4L6QA 2YLEA 2PMLX 3QQKA 4RWJA 3P23A 5HICA 5IEYA 5L8KA 3O2MA 1YI4A 3VC4A 4D28A 4ZTSA 3RK5A 4HVSA 4ITHA 5DH3A 1WFCA 2JDRA 2VTRA 4M97A 2XB7A 3ULIA 2C6OA 2BPMA 4FTQA 2G1TA 4P7EA 3T9TA 3ZSHA 4YNEA 1UA2A 4XG7A 3LFNA 3RVGA 4QMTA 3ZC6A 4GW8A 4F65A 4ANOA 2BRBA 3FYKX 3PY0A 3WE4A 3W0SA 4BCIA 5IPJA 2C68A 5ETFA 4FKPA 4AN9A 2JKOA 3UQCA 3AC3A 4I1ZA 4O96A 3AMBA 3NUSA 1WCCA 3VUKA 4A4OA 3QCSA 1BL6A 3O51A 5CZIA 4EH9A 1O6LA 5CU4A 3ORZA 3EWHA 4I5CA 3RBWA 4JOAA 3R04A 4AAYA 2XKCA 3NRMA 5T6KA 3QTWA 5BYZA 3RCJA 4WBOA 4FKOA 3BZ3A 5ITAA 3UNKA 2C0OA 2VO3A 5C1QB 4E4LA 2QOBA 5JSMA 5IQEA 5FTOA 3EN4A 4NIFB 4DGNA 3A7HA 3O50A 1UU3A 4CT1A 3N4TA 2OH4A 4CV9A 3VJNA 4DHFA 5EI8A 1YOJA 3UYSA 4YTIA 3LFQA 5CEOA 4BVUA 3QD4A 4IFGA 3V5QA 3CQUA 4PWNA 3H0YA 3R22A 3GFWA 4JDKA 4DHJA 4X21A 1CKPA 1M2PA 1TQPA 4BC6A 3LZBA 4PPBA 2IW9A 2BZHB 3A7IA 3LFSA 2VTPA 4HVGA 3HECA 5I3RA 5FEQA 1WVWA 4LMUA 3S95A 4U3YA 1XBBA 5I4NA 5JK3A 1JAMA 3Q6UA 4BBEA 4LYNA 4I94A 4IJPA 4BKJA 1SVGA 3LFBA 5HLPA 2Y4PA 2YCRA 1OKZA 3P9JA 2XK7A 2UZEA 1O6KA 1QCFA 4KS8A 2OLCA 4IWDA 2R3IA 4R5SA 3FE3A 4DH7A 5FM2A 3S00A 1UU8A 2OXXA 1Q61A 2R3LA 2YDKA 1ZAOA 4HJOA 5FTQA 3I4BA 4CZTA 3UZPA 2X9FA 1W7HA 4NKSA 5T3QA 4IWOA 3ROYA 2IN6A 4EKKA 3LJ0A 3K5VA 2F2CB 4GFMA 3HMMA 2WTCA 3FI3A 3VBXA 3GC0A 4D4RA 5JZJA 1YRPA 2OSCA 3DFAA 2FB8A 2OIQA 4RX7A 4RIWB 4YC6A 3IW4A 1M52A 1ZYDA 2UW7A 5HG9A 1LEWA 4F70A 4YTFA 5M4IA 4PMSA 3HV6A 2ETRA 1W8CA 2A1AB 4FZ6A 1GIJA 2OFVA 4PTEA 4EH6A 4AXDA 2Z02A 3BU3A 3FZOA 3C1XA 1PMEA 4FSRA 1W2FA 2BFXA 4D5KA 4IM3A 2V22A 2RG6A 3HP2A 1BI8A 4OW8A 4HGLA 2P4IA 4FICA 4RQVA 5GNKA 4BCMA 4WNKA 4AN3A 3RZBA 3ANQA 5CNOA 5AV3A 4F6UA 2CNVA 4HOKA 3BWJA 3FQSA 4GUBA 4M0YA 3E8EA 4JVGA 4CFXA 3P79A 4K18A 2YM5A 3LE6A 4V0GA 3VQHA 3LXKA 1PXMA 4HYHA 2QOFA 5HOAA 4L00A 3MW1A 4KIQA 4LL5A 3FKLA 4B9DA 3NPCA 1YHWA 5DE2A 5L3AA 1AGWA 4IWPA 4E4XA 3PJ8A 3TIZA 4FTKA 4I5PA 4M8TA 4QP6A 5LVLA 2WTKC 4FOBA 4D1XA 4DEDA 4E4MA 3WILA 3FLNC 4M68A 2OIDA 5JN2A 3VBWA 2JAMA 2BMCA 4MF1A 3KK8A 3TUCA 3AT2A 3M42A 3RNIA 3VHKA 3UNZA 4O7NA 5J87A 3FLQA 4PPAA 3V5WA 3UMWA 4GYIA 5IUHA 5LMKA 3GP0A 5HZNA 2QG7A 4Z3VA 2EB3A 1GIHA 1M2QA 2ZB0A 4TY1A 3R9OA 1L8TA 1BMKA 2PE2A 3N9XA 4I93A 4UALA 4AU8A 3WE8A 1ZY5A 5BPYA 2ZDUA 1WVYA 2UZUE 4A06A 5AP7A 3OCGA 1U54B 3EQGA 3EQDA 5IA2A 4RIYA 4MEDA 4QMLA 2WOTA 3WZUA 4FODA 5IDNA 4AXAA 2IZSA 5G6VA 3N4VA 3HV5A 4L3JA 4EOMA 4O81A 2WTVA 4EORA 3UQFA 4AE9A 3R28A 5AR8A 3RAHA 3LMHA 4TXCA 2W1IA 2GFSA 4CRLA 4M15A 3RP9A 3FHRA 4MVFA 4F9YA 4MNEB 2VTIA 3F9NA 2YAAA 3W33A 4NFMA 5EI2A 3ZLSA 2VTMA 3U6HA 1IAJA 4FG9A 4JQEA 5AUXA 1CTPE 2WU6A 5CU0A 5A4EA 1IA8A 1KE7A 1XH5A 3HYHA 2ITVA 5KBQA 1U4DA 4YC3A 4ANSA 5BVDA 3GQIA 3DBDA 1OMWA 1YXXA 3VF9A 3TMOA 4WNOA 4FIIA 3O8UA 4OBPA 2VNWA 4U41A 4V05A 4WUNA 5K3YA 3OY1A 2XBJA 4L68A 2DQ7X 5C9CA 3KXZA 2GNLA 4FK6A 4BWXA 4YHJA 3SV0A 4O0TA 3F7ZA 4EC8A 4E1ZA 5EQEA 3PLSA 5HIEA 1HOWA 3ZCLA 1TFFA 3D15A 5T68A 4RX5A 3PRIA 4CSVA 3Q60A 3NUXA 4WIHA 4U43A 4BDBA 1CM8A 4XV3A 4N57A 5AA9A 3D5VA 2JDSA 3NIEA 3RM7A 4DGOA 3MS9A 2QKWB 4LGGA 2OJ9A 3H9RA 3PFYA 1H8FA 3ZRKA 4BBMA 2C5VA 4FC0A 4BDKA 3DQXA 3L9PA 2OH0E 2OXDA 4E20A 5GINE 2R3RA 4EH4A 2DS1A 5HVYA 3WBLA 4DYMA 1GZNA 4M12A 1ZOHA 3MY1A 5I9VA 2XNMA 3BL7A 2C6TA 3NGAA 5H3QA 3D2IA 4QMNA 4RGJA 3OEZA 5DI1A 3V8SA 4QDVA 2XNEA 4JAJA 2XJ1A 3TZ9A 3I60A 2PZYA 2UZTA 2ZJWA 4ANBA 4WG5A 4QTEA 5M53A 4RMZA 4IW0A 2IW6A 3A99A 3EN7A 5C27A 1F5QA 2OI4X 4FVPA 3M2WA 3MB7A 5BVEA 3PXRA 1IAHA 2QD9A 1DAWA 3C13A 3FXWA 3OROA 3OW3A 2W1GA 4L8MA 4BTKA 3IOKA 4EUTA 2IZRA 3QTXA 5KMKA 3MFUA 4DHZA 2QOKA 2IVTA 2OW3A 5FP5A 3BE2A 3B8QA 3LJ1A 3WYYA 3BIZA 3BHTA 3BGZA 2QR7A 4AZFA 4BWKA 1Q99A 2GHGA 4M7IA 5J95A 4FV5A 4KABA 1BUHA 3W32A 3R7IA 3NYVA 3UVRA 2G9XA 3TNQB 3FPQA 3R00A 3QHRA 2GHLA 2W5BA 3RK9A 2JEDA 4CFUA 5IH4A 5LCJA 5CLPA 4MXCA 4P90A 2WKMA 3RHXA 3FUPA 5CX9A 5EYKA 4ARKA 1W2CA 1MRYA 1QL6A 3C5IA 3Q4TA 2HXLA 4O0XA 2QG5A 3QCQA 1DAYA 2BZJA 4MXOA 3G6HA 1H0VA 3OUKA 1PY5A 4L67A 4KS7A 2H9VA 4ANQA 3HUBA 4Z55A 4TKSA 3OWJA 3QQLA 4XHKB 1ZOEA 3E5AA 2QOCA 5G1XA 4O4DA 3ZO1A 3OS3A 4C02A 2PUPA 3BV2A 2WQOA 2WXVA 3OT3A 3LFEA 1A9UA 2ITXA 2Y6OA 4LL0A 4ORKA 4BY9E 2WMTA 5CI6A 5FUTA 3AOXA 2X0OA 4EWHA 4JNWA 3KEXA 1FVVA 5FG8A 4FGRA 5JKGA 4J1RA 4BHZA 3HMIA 3PVGA 4J99A 1Q3WA 3QFVA 3FWQA 4IACA 4FSUA 5I9UA 3NFGB 2GU8A 1KWPA 3C51A 2ITWA 4JR7A 4FYNA 4JR3A 2CNUA 3TKUA 3ZRMA 3MI9A 3C4ZA 4YJRA 5CWZA 4D58A 1Q8UA 2IZUA 4EBVA 2GS7A 4ZTNA 4A9SA 3C4FA 4Y85A 4K0YA 2YERA 4L45A 3Q4ZA 5HU9A 3OHTA 3SG8A 2X4ZA 3KMMA 4O91A 1OIYA 2BFYA 4ZLOA 2OU7A 2UZOA 2VGOA 2J0KA 4WG3A 3ZDUA 3I5NA 5HO6A 3EFJA 2IEWA 4TN6A 2ITNA 5LVPA 4N4SA 5F94A 3A61A 3O8TA 4I6HA 5EFQA 5IKWA 4L53A 5EM7A 3SXFA 4EI4A 4F1OA 5DEWA 3TI1A 3DJ5A 4D9UA 3OFMA 1H1PA 4CZUA 3QQGA 4U8ZA 2Y7JA 5L2SA 4YSJA 5CXHA 5CAVA 4CGAA 1VLRA 2O2UA 4FK3A 2A0CX 3V51A 3ZLYA 1TZDA 3R9DA 2XP2A 4QP1A 3QD2B 5L2QA 4DN5A 3QQFA 3DBFA 3DB8A 3NAYA 3OWKA 4Q5HA 2HZ4A 4YP8A 4IAYA 3QA0A 4FV4A 5EDPA 3RAIA 1M7NA 3IW8A 5IA4A 3DAEA 2X2LA 4ZZOA 2ZV2A 3DOGA 4ZTQA 3P7BA 3PXKA 5BV3A 2OGVA 2NRYA 1PJKA 5K0KA 3VONA 2XEYA 3PVWA 2EUFB 3Q2JA 3FMNA 1P4FA 4GMYA 3VRYA 4AW2A 4TYJA 3EFKA 3UO6A 1YWNA 5K9IA 5AR2A 3QTSA 1UU9A 2X0PA 2SRCA 3AXWA 4JBOA 5CI7A 4I3ZA 3IQ7A 5HESA 5HTBA 2FH9A 4MYGA 2WEVA 4MXYA 3UOJA 2HZNA 4ZLYA 4FKVA 1U46A 2GTNA 2GPHA 2QOQA 3FZRA 3HGKA 3IGGA 4JX3A 5FP6A 4JX7A 2Z7RA 2QVSE 4FIEA 4XG4A 3GXLA 4IE9A 3LMGA 2BDFA 4Y73A 3EYHA 4FNYA 3GU5A 5AP6A 4TYHA 1ZMVA 2F7XE 2WZJA 2PMOX 2R3QA 5C8MA 3V6SA 3PA3A 3PPJA 4ANMA 4CEGA 4EOJA 4APPA 4QQTA 5CF5A 3OBJA 3RHKA 1YVJA 5M4UA 3ID6C 1UVRA 4IAFA 4HGSA 2JFLA 2C6EA 2XF0A 3BHVA 4KAOA 4P2KA 4QMWA 3C4EA 5HO7A 3MVLA 2XIRA 2PZIA 3E87A 4DEGA 2QCSA 4O86A 2G01A 3E64A 4FV6A 2GNJA 2UW8A 4JBPA 5CTPA 2W1ZA 3FKNA 4XX9A 2XK8A 4KB8A 3UC3A 1FBNA 3HUCA 5LMBA 4AOIA 1H00A 1PKDA 3KMUA 2KTYA 1OIRA 4BDCA 4RZVA 4R78A 5L6WL 1GOLA 3LM0A 4YMJA 4E73A 1OZ1A 4G34A 4Y72A 4YZBA 4OTGA 4GRBA 2WTDA 2XK4A 4B6LA 3PXQA 2UW0A 2BIKB 3FHIA 2XIZA 2W1HA 2RL5A 4IANA 3JXWA 3NVKI 4H1MA 4IAAA 3W2RA 1SNUA 4EZ7A 5EM5A 3C4CA 4BF2A 3PA4A 2JLDA 4GV1A 5GZ8A 3PIZA 3AGLA 5E92A 4OAUC 4QTDA 4W4WA 4EQUA 4EQMA 5M09A 3W0RA 2BAJA 2W0JA 4C7TA 4W8DA 1W98A 2B7AA 3CJFA 3QLGA 5I9ZA 1SM2A 3ORPA 3DXQA 3W0MA 4GSBA 5HEZA 1OECA 3FEGA 2I0YA 4FVQA 2PVFA 4PNIA 4C34A 3AD5A 4OBQA 2ZDTA 4RX9A 3AKLA 4BZDA 4LDTA 3SW4A 3F6XA 2QC6A 2BKZA 4WSQA 3NW5A 4IZYA 2C6DA 3V8TA 3UZTA 1J7IA 4M69B 1XR1A 3PG1A 4XH6A 2C0IA 4O0UA 3ELJA 3MH1A 5CF4A 3IDCA 4FT7A 4A9TA 3U4WA 2X6EA 3HP5A 3SXSA 4BTFA 2UZVA 3ZO2A 4GT3A 2IG7A 5KMIA 2ZB1A 4XLIA 3GCSA 4HZSA 5KMMA 4ZK5A 3SX9A 2CPKE 5KZ0A 4DH1A 2HWOA 5DVRA 3QAME 1XH8A 3W1FA 3WOWA 3O23A 4IX3A 1YXUA 4AT5A 2PSQA 3Q9WA 3T8OA 2HOGA 3BHYA 3A4OX 2IF8A 1ZRZA 4FIJA 4JT3A 2XRWA 3IW7A 1NVRA 4KSQA 4Q5EA 5DBXA 5A3XA 3HA6A 1CKJA 5C8KA 4QP4A 2HYYA 4G1WA 3VUDA 3LQ8A 1G3NA 4PX6A 2LGCA 2W1DA 4FOCA 4DH5A 2UW4A 3ORXA 4U6RA 1YW2A 4CMTA 3ZUVA 3LFFA 2HXQA 3HVCA 3OWLA 4JIAA 4HGTA 3L9NA 4L46A 3V04A 2W99B 2QOOA 5A4LA 5C26A 4AA4A 4BHNA 3W0QA 2R3KA 3D7TA 2YJSA 2QOIA 5AWMA 3NZ0A 2C6IA 2CGUA 4FZ7A 3POOA 4IBMA 3IDPA 2NRUA 4IADA 4IB5A 3DBEA 4O1OA 1G8SA 4C2WA 4L7SA 4AX8A 2WTIA 3BYOA 3UODA 3UQGA 1G5SA 1JWHA 4FEVA 2CGXA 5EW9A 3W0NA 3BX5A 1SNXA 3EQPA 4G2FA 3VWAA 1OL2A 2I40A 2X7OA 4F1MA 4LOOA 2VTNA 1ZYLA 3PJ3A 1OIUA 3L8XA 5EDQA 3OTUA 1H1RA 3SC1A 3TNIA 4GG5A 4FSZA 1JLUE 1X8BA 3JY0A 2PMIA 2I7QA 2J2IB 2V7AA 4O7YA 3SOAA 3NYNA 3D0EA 3D94A 5DLSA 4D9TA 1PYXA 1OKWA 4FKIA 1E1XA 2IO6A 3QXOA 4BDFA 5KKRB 4O7WA 5IQHA 4R3RA 1KOBA 2QU6A 3A7FA 3H4JA 4G3CA 3AC5A 4DCEA 2CLXA 3FC2A 3W2SA 4IM2A 4RVLA 4NTTA 5KCVA 1FMOE 4NW5A 3KY2A 5HBHA 5HCXA 4FTAA 1VYZA 2Y4IB 2UV2A 2J0IA 3O7LD 4CQGA 2PU8A 5B2LA 4QQCA 2PVYA 4UMUA 4JIKA 4E26A 5KMLA 1OGYA 5IZFA 3KMWA 4XBRA 5IA3A 2VTJA 2Y8OA 3AKKA 2VO6A 4L43A 2OJJA 2J6MA 2QO7A 1Z5MA 1Q4LA 1ZZLA 1SYKA 4K9YA 4X3JA 3SHEA 1J7LA 3HEGA 3VBTA 1JSTA 3PY1A 3RPVA 4M13A 4PL4A 1Y8GA 4ZSJA 1ZXEA 3MFSA 4YNOA 2OK1A 2X39A 3O7LB 5HVJA 1YQJA 5TO8A 2V62A 3VS2A 3VHEA 2BROA 1OPKA 3W2QA 1BLXA 4XG9A 2PZ5A 5L4QA 1PHKA 4NYEA 2WQMA 2VD5A 4RIXA 4B8MA 2E9PA 5JFVA 5EHYA 3UDBA 2XIYA 3R83A 4GU6A 5FQDC 5HG7A 3VS5A 4NIFA 4B8LA 3PY3A 4IC8A 5IQGA 4X2KA 4JJRA 1OPLA 3ULZA 4FGBA 2GCDA 2PVLA 4BZNA 4YTCA 3NCZA 4Z7GA 4ZJJA 1MUOA 5LWNA 4RVTA 1YXSA 3AC8A 5CT0A 3N4UA 4HYIA 5FEDA 2XNPA 3OCBA 3DA6A 4U40A 5EHOA 5EK7A 1S9IA 4CFFA 1UKIA 3NUPA 5IA0A 5BMMA 3R6XA 4ASDA 4TWOA 4DDIA 4F0IA 4C33A 3R01A 4C4EA 4EEVA 3BLAA 4K2RA 1GAGA 2VRXA 4PMMA 3S3IA 1BX6A 3JVRA 5B7VA 2OZOA 2WMSA 3SW7A 5LQFA 4RA4A 1DI9A 5C03A 4QYEA 4JMQA 3QTUA 1KE5A 4LQMA 4UMTA 1IG1A 1NT2A 4IVBA 3VVHA 5LVMA 4ZSLA 4O27B 1YXVA 3DTCA 4IB0A 3GOPA 4O0VA 1XBCA 4RBLA 3VIDA 4GFOA 3TV7A 3VS6A 3PXYA 3EQBA 3Q9ZA 2YM8A 1PMUA 4FNXA 1G8KA 3GOKA 4BDGA 4QDEA 3QCXA 4MXXA 2W4JA 2CMWA 1G8AA 4XNEA 3NMUF 4PNKA 4DLJA 4QMZA 3F2AA 4YC8A 4QPAA 2JAVA 5C4LA 2ZAZA 4BBFA 3W0PA 4U7ZA 3HMOA 3LXLA 4ID7A 2PVRA 3VQUA 5AP1A 3HX4A 4EH5A 4QTAA 1LPUA 3ORLA 1H25A 1HCLA 5BVKA 3TG1A 2IPXA 4ZTLA 3QGYA 4IFCA 3UP7A 2XCKA 3F3UA 5JQ8A 4DLIA 4BJJB 3DDPA 4LGHA 5I0BA 4H3PA 4JDIA 4WBBB 5AP0A 1F3MC 2W5HA 3P4KA 2AC3A 4BDEA 2B9FA 3CY3A 4U42A 5AAEA 2E9NA 4AFEA 2YCSA 5HI2A 2H96A 3FBVA 5ANGA 4MQ2A 1UNHA 1KSWA 4GK4A 4OTPA 1SVEA 3R1NA 4HNFA 4H36A 4I24A 3OTVA 4MHAA 4PV0A 2ZYBA 5J8IA 2B9HA 3HRCA 2PVKA 1XH9A 4WUAA 1P5EA 3BELA 3O17A 3ORKA 5HE3A 3RMFA 2PTKA 4CKJA 3VUIA 5KBRA 5L2WA 3RAWA 2GTMA 3UPZA 4TT7A 4C2VA 4H39A 1RDQE 3NYOA 2XK3A 4DT8A 4BWPA 2HY0A 4FKTA 3L8VA 3PUFC 3PZHA 1H0WA 4EOKA 4W9XA 4WO5A 1NW1A 2VTQA 2JBPA 3R02A 3F5GA 1G8JA 4CRSA 1GY3A 4LUEA 2EXMA 3D5XA 1JPAA 2UVZA 4MNFA 4EZ3A 4JQ8A 3P86A 4E4NA 4O4BB 5IQAA 1IA9A 2RSVA 4ENYA 4OLIA 5GIOE 3IO7A 2X9EA 4X2JA 5DR2A 4E93A 3SVVA 4YLJA 4GK3A 2HZ0A 5BVWA 4QMUA 4JRNA 2ETKA 3NUNA 3FMDA 3GQLA 4OTHA 2C5OA 4G6OA 4IHPA 5EI6A 3E8CA 3QRJA 4ZJVA 5K0XA 4X3FB 3DLSA 3FI8A 2XAOA 2V7OA 3UG1A 3NUUA 4AUAA 3LFAA 3GC9A 4UXLA 4FV2A 5DT4A 5HTCA 2C4GA 4XV2A 3IK3A 5EM6A 1BKXA 3PJ1A 4CD0A 3LXNA 4QYFA 3C5UA 2IW8A 3VW6A 5DMZA 2PVMA 5HX6A 5C4KA 2HY81 3E8DA 3AMAA 4YJNA 5JRQA 3VUTA 4MNEA 1QPCA 4D0XA 3PDTA 3F5UA 5F20A 3UOKA 3GB2A 3OOGA 4RLLA 4D2SA 3F2NA 4MWIA 2XKEA 2W96B 4QTCA 1URWA 3SRVB 4CKIA 4O4FA 5A46A 3ORNA 3U4UA 1PXJA 2YDIA 5FWKK 4OGRA 3DCVA 5CSWA 4TYEA 4A9YA 2X7GA 2XM8A 4RRVA 2C6KA 2PL0A 3E93A 4FF8A 2C0TA 1M17A 4EK4A 4KIKB 2C3KA 5FXRA 4JI9A 4K11A 4GG7A 3Q2MA 5CAUA 3UO5A 3WYXA 1J7UA 4F7JA 4LUDA 5BVFA 4XMOA 4UMQA 4TNBA 5JGBA 5J1WA 4QQJA 2X6DA 2WQEA 4Y95A 5CU2A 3P5KA 4F9BA 4F0FA 5AUZA 4ZAUA 3F3TA 3H3CA 3NIZA 1RW8A 2ITUA 4TNDA 5CVFA 2ONLA 3R7GA 4DG0E 4HVIA 4R3CA 4N6ZA 4C61A 2B9IA 3UVQA 3WF8A 4RZWA 3P1AA 2WMUA 3NW6A 3V5JA 5IQBA 4KRCA 3TN8A 3FSKA 3IKAA 4AOJA 3R0TA 3CE3A 4PMTA 4R77A 4BDDA 3VBQA 3FL5A 3WIKA 3BCEA 3G9LX 4DH8A 4EHEA 2X1NA 1PF8A 4ANNA 2Z7LA 3BGPA 3A62A 1Z57A 3NVMB 3UC4A 1O9UA 3GCPA 1PXLA 3JY9A 1PKGA 2JDTA 5HIDA 3RCDA 4E7WA 4CVAA 2NYAA 4C58A 2RFNA 4QP9A 1R1WA 2ITOA 3EFLA 5HCZA 5AA8A 3ACKA 4FIFA 2YFXA 2REIA 3UVPA 2JKMA 3FL4A 5CQUA 4F63A 2VWYA 3GCUA 4O0YA 2VO0A 5TF9A 4X6RA 5ANEA 3MPAA 4DEHA 4FNWA 2YM7A 2XIKA 3QKKA 2NPQA 3NX8A 4BCQA 3SD0A 2HAKA 1Q8YA 4X0MA 3QRKA 3BYSA 3ZDIA 4G16A 4GIHA 3UMXA 3G51A 1EH4A 3D5WA 1DM2A 2C1BA 2BDJA 2YZAA 3CTQA 3QX4A 3O96A 1OL6A 3FYJX 3LFDA 2CGVA 1W82A 1TKIA 4FKSA 5DGZA 3PSBA 5CANA 4JDHA 2QQ7A 3LVPA 4LG4A 4TL0A 4DFLA 4O7TA 2YA9A 2IVVA 1WBPA 3CQEA 2EB2A 2ZV8A 3GVUA 1A06A 1E9HA 4V01A 5DT0A