4LRJA

Bacterial effector nleh1 kinase domain with amppnp and mg2+
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
163
structure length
160
Chain Sequence
RLSVPGNVIGKGGNAVVYEDAEDATKVLKMFTTSQSNEEVTSEVRCFNQYYGAGSAEKIYGNNGDIIGIRMDKINGESLLNISSLPAQAEHAIYDMFDRLEQKGILFVDTTETNVLYDRAKNEFNPIDISSYNVSWSESQIMQSYHGGKQDLISVVLSKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Effector NleH1
publication title NleH defines a new family of bacterial effector kinases.
pubmed doi rcsb
source organism Escherichia coli
total genus 51
structure length 160
sequence length 163
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4lrjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4lrjA01
1XH4A 2BDWA 3COHA 3EHAA 2XJ1A 4CV8A 3OW3A 4X2KA 5HTBA 4ZJVA 3MJ2A 3QTRA 2IZSA 3BU6A 1HOWA 3ORIA 3R2BA 5AV3A 4EH8A 3HAVA 4CFNA 2W1IA 5AUWA 2V7AA 2G01A 2BUJA 5EHOA 3MY1A 4N6YA 3LJ0A 4BDHA 2OZOA 4ANMA 4HCVA 3RBWA 5HNBA 3R73A 3W2QA 2BMCA 1M2PA 3D5UA 1R0EA 3TZ9A 2UVZA 3ERKA 2WMSA 4BBMA 4F1MA 3L8PA 4XEYA 5CLPA 4G17A 1H1SA 5DT3A 2BAQA 2EU9A 3TV6A 2C3KA 1PKDA 4XG2A 1OKYA 5GZ8A 5GJFA 3RWPA 2W1EA 4FR4A 4O27B 5M08A 2VTPA 4C59A 5AP1A 5DIAA 3RMFA 4MTAA 3IPHA 4XG9A 3EKKA 2QURA 4A4LA 5FBOA 3HECA 3I4BA 4NFMA 5TT7A 2YCSA 3OROA 3V5LA 5F95A 4ERKA 5K0XA 1IEPA 2EVAA 4CTBA 4EUUA 5DR9A 3R28A 1OKZA 4XP3A 4NFNA 5B0XA 4DLIA 4LRKA 5D12A 4KS7A 1IRKA 4YLJA 3WZJA 1PXMA 2GQRA 2J0JA 2VTQA 3UDBA 5CALA 3AC5A 3NWWA 4ZMFA 1XWSA 4HNIA 4M67A 4U3YA 2R7BA 4PWNA 3HA8A 1PXJA 5EDQA 3UNKA 4YZBA 3UVQA 4O0TA 4QMUA 3D94A 1BKXA 4FSTA 5CSVA 1DM2A 3HL7A 3U51A 3KQ7A 2BKKA 4IMYA 4NU1A 4O96A 4EH2A 4D2SA 5CEMA 2VTIA 3OMVA 5M4CA 3ORTA 4IVAA 2XK4A 5KHWA 4IE9A 4MVFA 1BL7A 4FIJA 3OCBA 4FT5A 4IX4A 2ZB0A 2YHVA 1XJDA 4FT7A 4RJ8A 5KZ0A 5HX6A 3FXWA 4QP3A 2UZTA 5D11A 4GYGA 2UW0A 4NM5A 4E6QA 3QRJA 2QHNA 5L4QA 4YJPA 4I0RA 4J71A 1JKKA 2WO6A 3PZEA 4FV1A 5E8TA 3KC3A 4WUAA 2E9UA 3KEXA 4BKZA 5FXSA 5EYDA 4PMMA 3KRJA 1OL5A 5CSWA 3A8WA 1L3RE 4RG0A 1DS5A 1SVEA 3QRUA 1XH9A 3MA6A 3MA3A 3FYJX 2VWBA 4GFGA 4KB8A 5TOZA 4AZWA 4F63A 3UMXA 1B39A 4YC8A 2BFXA 3ZTXA 4I4EA 3NUPA 4TZRA 4G3FA 4XRLA 4DTAA 4V05A 3FLZA 2UZWE 4PPAA 3DBDA 4GCJA 3A60A 3B2TA 2OF4A 2UW8A 1A06A 4IW0A 4MXYA 2XNPA 2C5YA 4O0VA 2R3LA 1Q41A 2XZSA 4O38A 3DDPA 4ANOA 2BZIB 3O17A 3DBQA 1NVSA 4EYMA 1H1RA 2JLDA 2Y4IC 3QQKA 1YRPA 1WBVA 4C38A 4FI1A 3ZZEA 3G2FA 5K9IA 1H27A 3DFAA 2WKMA 3O71A 3UQCA 2HOGA 4TKSA 3N4TA 2WB8A 3DCVA 4QYEA 4ALUA 3R6XA 3DZQA 3D2IA 3VS5A 5CEIA 3MSSA 4WBOA 5K4JA 2O2UA 5EKNA 2QHMA 4O6LA 2DUVA 5FM3A 2EXCX 2O5KA 2R3FA 2LAVA 4U5JA 3CTHA 3KMMA 3NSZA 2B53A 2J4ZA 4FUXA 4RA5A 3VS1A 4D55A 4ZS0A 4HVGA 3IK3A 3COIA 2RGPA 3LJ2A 3TACA 5A46A 5KBRA 3PJ3A 3V5QA 4X3JA 4MX9A 4D0WA 3CGOA 4WO5A 3E62A 3HMPA 2Q0BA 2YAKA 4GFOA 3MTFA 5EQEA 3OY1A 4EJ7A 4HVSA 5E91A 4M3QA 2BCJA 1J1CA 2CJMA 3C13A 4IAKA 4KIKA 5AIRA 3TZ8A 3WF5A 3GC9A 3F2NA 3OWJA 5L2IA 4KD1A 2HW7A 3KVWA 3TIZA 4ZTNA 3VW6A 4F99A 4FG8A 5L6WL 1J91A 4I0SA 3E7OA 2QU5A 3ORMA 2QOKA 3P0MA 2GQSA 5M07A 1REKA 3F5XA 1KOBA 3HUBA 3HEGA 3KCFA 4ZXTA 3C4EA 3VO3A 4EHVA 3MIYA 5IQEA 4K11A 2R3QA 3ZFYA 3QHWA 4CSVA 2C6IA 3V6SA 3ID6C 3RPYA 2CHLA 4XLVA 1JAMA 2QO7A 4BI2A 1OZ1A 3B2WA 4JI9A 2UZLA 2G15A 3I6WA 2PZPA 3OZ6A 2CKQA 2YZLA 3I7BA 4FMQA 3D9VA 2ZMDA 2WIHA 1PXKA 4MXOA 5D7VA 1NVRA 4A4OA 5AP4A 5TE0A 4U0IA 3R1NA 1UWJA 3VBWA 4FKQA 3QD3A 3OD6X 5AADA 5L2WA 2PUNA 3CBLA 1PXNA 3DFCB 1H24A 4FTMA 2VTNA 2XJ0A 2QOOA 4LV8A 1LR4A 1P2AA 3R8LA 3FMEA 3R7IA 2GSFA 3A62A 4PTGA 4QNAA 5J8IA 1GZOA 3B8RA 5IA2A 3AT2A 2Q0NA 4W4VA 2WMQA 3OW4A 3WOWA 4CYIA 4DCAA 4G6LA 3OUKA 3NVKI 5C03A 4Y72A 1KSWA 4FSQA 3IO7A 3OT3A 5IDNA 2BVAA 4F09A 1PF8A 3KXXA 2C5OA 4IANA 5AUYA 4BTJA 2JGZA 2Z60A 3FUPA 3V8WA 4PL5A 4YR8A 4QYHA 4FEVA 3LQ3A 3BEGA 1YWRA 3E87A 4ALWA 2FA2A 4JRNA 3CSVA 3CPCA 3IOPA 4BWKA 5DYJA 4PNKA 5I9ZA 1BYGA 2WMUA 3VQHA 1STCE 4EH9A 3P1AA 4L52A 1Q5KA 4DG0E 2WMTA 2ZV9A 3SVVA 3KB7A 4F9WA 3F2AA 2E2BA 4JRVA 2YLFA 1APME 2GS2A 2P2HA 4TWOA 3LCTA 3QZFA 1ZARA 2X8DA 4RJ3A 1LP4A 5BVKA 5KMLA 3FHIA 5IMXA 3OOGA 3FLYA 4XUFA 2ITUA 5T6KA 4FA2A 3F69A 4BVUA 2WQEA 4FEQA 4FBXA 4RVMA 3W1FA 4CCUA 4DITA 2FSTX 2QC6A 2VGPA 2X6DA 3Q52A 2ZJWA 2FSMX 4RFYA 5CF6A 3R22A 3TKIA 4EQMA 5K4IA 2QNJA 4ANLA 4MWHA 3RPOA 2C5XA 4BDKA 4C3RA 4RVTA 3W2OA 3DV3A 3FQSA 1JKTA 3ZUTA 5GJGA 4WSQA 4U41A 5CAPA 4G3CA 4BFMA 5AAGA 5M53A 4IB1A 1UNLA 1WBOA 3RP9A 3DBEA 2QLUA 3ULIA 4AN9A 4OR5A 1U54B 2W4OA 5DT0A 3QQUA 4FV5A 2W99B 2PE0A 5D1JA 2X0GA 4ZY4A 4C58A 3CQUA 5EYMA 5DI1A 5HLNA 3I7CA 1NVQA 2PE2A 4BY9E 4BF2A 2PHKA 4BCKA 5A54A 3DU8A 4G31A 3Q9YA 4G9CA 5AUZA 4C4HA 4CFFA 4NK9A 4UMUA 1Q99A 2I0HA 5FP6A 4FIHA 3PY1A 1RQQA 3SHEA 4O2ZA 2G2HA 4QMWA 5L8KA 2VTOA 2PMIA 5A6OA 1W8CA 2HAKA 4DEAA 3ZDUA 3K5VA 5C01A 3RK9A 3U8WA 3LCSA 5EYKA 3BQCA 4JG6A 4EONA 2OGVA 5CY3A 3VS7A 1KUTA 4LG4A 5BYZA 2CPKE 4F0IA 3I81A 5HNGA 3QXOA 2J90A 2OSCA 4IFGA 4RWIA 5C4LA 2R2PA 3BPRA 4ACCA 4S2ZA 2XJ2A 4IX6A 1FOTA 4DGGA 3BGZA 1PXOA 1BMKA 2AC5A 3QCQA 3WILA 2JEDA 4AW5A 3TJCA 4EORA 3I5ZA 4YC6A 3S4QA 3QA8A 3FY0A 4WG3A 4A9TA 1KE7A 1VJYA 3QUEA 4DEHA 4NL0A 4QMZA 3G9NA 4O0YA 5CI6A 3IGGA 3LHJA 1ZZLA 4RWKA 4QP4A 3NAYA 2X81A 5HVYA 3T3VA 3LM5A 5IA0A 3A4PA 3R7GA 4YJUA 5FEDA 4IJ9A 3DXPA 3EFJA 2C6OA 3FI3A 4M13A 3F9NA 3MBLA 4PF4A 2OK1A 4B99A 2W1DA 3Q6WA 3I1AA 1Z5MA 3NNUA 5IA5A 2YWPA 4FX3A 5D9HA 4KBAA 4XBUA 5FDPA 1Y8YA 5KMJA 5DEYA 2HIWA 3Q60A 1M2RA 5AM6A 3KVXA 3SC1A 4L01A 4Y83A 4K8AA 5FWKK 4TT7A 5JGAA 3E8EA 3LFSA 5JSMA 5I9UA 2JIVA 3BZ3A 4UX9A 2YERA 3GU6A 2P33A 4U9AA 3PPKA 5DLSA 3ZU7A 4F1OA 3DQXA 5JMSA 2C1AA 2C0IA 4O0UA 4TL0A 3TM0A 3T9TA 2YCFA 3D5WA 3KL8A 3EYHA 3DOGA 4DYMA 2V62A 4WIHA 5FUTA 2HK5A 4MCVA 2C5NA 3LXKA 4NEUA 4J96A 3V5WA 5L2QA 4AN3A 3OY3A 2OFUA 4ZZMA 5I9VA 4TPTA 1Y8GA 5DEWA 2OU7A 1YQJA 2RFSA 4G5JA 4AZTA 5LWNA 3F3VA 2GFSA 3ANQA 4H3PA 2B9JA 5FTOA 3I0OA 4UALA 3C0IA 3ZSIA 4H3QA 3I6UA 1MRUA 3MVHA 2PUUA 4YZDA 2ZDUA 4GJ2A 4E5WA 3DZOA 4UXQA 3VC4A 4CMUA 4QYFA 3R9OA 5IEYA 3O8UA 3R7VA 3GU8A 5GZAA 4MH7A 2Y4IB 4BDIA 2I1MA 1JOWB 1QMZA 2BKZA 2W1ZA 1ERKA 4RIXB 4IACA 4BYIA 3R1SA 4D58A 5CANA 4NZWB 3FXXA 5JKGA 5FG8A 5F20A 2UZOA 4OTWA 3GT8A 5H3QA 4CGAA 3A7JA 3OUNB 3MI9A 1R78A 2P0CA 5E9EA 3ZO3A 2BIYA 2NP8A 3EWHA 3GB2A 2RG6A 4JG8A 4Y95A 2PVLA 2PL0A 4QTDA 3FV8A 2YM4A 4O0RA 4YSJA 5KMKA 4IM0A 2E9NA 1PXPA 3WI6A 1URCA 3BIZA 3D83A 4KBKA 4EH4A 3NRMA 3U55A 2IZUA 2WD1A 2JC6A 3QWJA 4IEBA 4GK2A 4BCGA 4O83A 2V7OA 2X8IA 5LOHA 2R3IA 3PG3A 2ERKA 3TV7A 5I9XA 5T3QA 5E90A 3VNTA 4FK6A 4CG9A 1ZMWA 4IWQA 1Q4LA 4QMPA 2C30A 1IA8A 3MH0A 2J6MA 3D4QA 2A2AA 3NIZA 3ATTA 1URWA 3LW0A 4X6QC 3EH9A 4E73A 5K5XA 4UMPA 2R3PA 2NRUA 3BLRA 1FMKA 3QCSA 2YIYA 4JBOA 4M7IA 4U81A 5EM5A 5CT0A 5KNJA 3F3TA 3IW6A 2YN8A 3FHRA 3R21A 5FBNC 2UVYA 2OXXA 3VUDA 4ENYA 3QTZA 1H1WA 2BAKA 3O96A 3S00A 4HGLA 5L8JA 4L45A 5BX0A 3Q9ZA 1AQ1A 5M57A 1VYWA 4TYHB 1I44A 1M7QA 2RKUA 1NT2A 1JKSA 1H4LA 2BZHB 2Y8OA 2UVXA 4U45A 1H1PA 4WNOA 3VBQA 5HZNA 3CQEA 4DGNA 4QYYA 3PJ8A 3TDVA 3QUDA 1M2QA 2YCQA 3DK3A 4BDDA 2W96B 4MD9E 3D14A 4FZDB 4JDIA 3KN5A 2WQBA 3FZPA 3UIMA 5BVEA 5GZ9A 2JIUA 1U54A 4DEIA 3PRFA 4IHPA 3GP0A 1ZXEA 2CNVA 4WG5A 3DLSA 5IQDA 3TNPC 2CSNA 3FBVA 4D0XA 3O8PA 4U3ZA 2VWXA 4FEUA 4QTCA 3MH2A 3FLSA 5EW3A 2OKRA 1GIJA 4IADA 5EM6A 4FNXA 4M97A 3TZMA 3UG1A 2ITPA 4R3CA 3NVMB 4GSBA 3FMLA 3FLNC 5ANJA 4FKVA 3Q53A 4AZFA 2KTYA 3BE9A 5IG1A 4R5SA 1WVYA 2F49A 3PJCA 2XKDA 4C3FA 3PIXA 4NM3A 3JPVA 3E8CA 3GC7A 3Q4TA 4R7BA 4IB0A 2AYPA 3O8TA 4N57A 2GNIA 4EOJA 3QRKA 2QR7A 2UW7A 2GCDA 2ACXA 3M11A 3V5PA 2X2KA 4E5AX 3TNQB 1NXKA 2XS0A 3FSKA 5DH3A 4JIKA 3UNJA 1XR1A 3CY3A 4X3FB 3VJOA 4YJOA 4PDOA 3SD0A 2C3IB 5JFWA 2J7TA 1RE8A 4R8QA 5AP6A 3ATSA 4GIIA 2YAAA 3RAHA 4EOQA 4XCUA 2IVTA 3ZLWA 1PW2A 4IAFA 4I5PA 4O7YA 2OW3A 2QONA 2R3MA 3QTWA 4RSSA 2XNOA 5BMSA 3CY2A 2C68A 5C9CA 4FEXA 5FRIA 3IOKA 4RJ7A 3C51A 2QOLA 2VO7A 3IW5A 3GU5A 3O23A 4HJOA 2W5HA 3LVPA 4AN2A 1ZYSA 2UZNA 4RIOA 3E88A 3PFQA 2J5FA 4PTEA 3RNIA 1YWVA 2PVMA 1ZOGA 3VUTA 4NSTA 3CIKA 5BPYA 4OTRA 1IASA 5J87A 3BELA 3H0ZA 2R3NA 4G6NA 2YEXA 3ZRMA 4B6LA 4FTTA 4DFLA 5IH4A 3GC0A 1WBSA 4QTEA 4OUCA 5JFXA 4GJ3A 3VWAA 4KIOA 4AACA 4F70A 2XIZA 2YCRA 4G3EA 4BCNA 4C4IA 3RALA 4NJDA 4PP7A 2C0TA 4NM7A 4U7ZA 4O6EA 4LM5A 5CQUA 3BCEA 2PWLA 4FKUA 4CFXA 4F08A 4UWBA 3PUPA 3VS2A 5AV4A 2X8EA 4L00A 1DI9A 3FL5A 4FF8A 3SXSA 4C61A 3T8OA 4EH3A 2GNGA 4G34A 4I5HA 1YXUA 3M1SA 5C27A 3G0FA 4A07A 3IGOA 3NUYA 3ITZA 3QKKA 3NYOA 4JL9A 3FMDA 4FV0A 2IZTA 4N4SA 4PQNA 4D9UA 3O7LD 5BVDA 2VGOA 3BE2A 3ZCLA 2PVFA 1IA9A 4IZ5A 4C4FA 1OIQA 4D1XA 5KX8A 2XEYA 4TWPA 1ZAOA 5KKRC 3PSDA 3NLBA 2ZM3A 2CMWA 5FXQA 3VN9A 2B4SB 4UN0C 3PY3A 4F7SA 3CEKA 5DA3A 4AXAA 5CU3A 2YZAA 4IAAA 2PMOX 3DPKA 4D2RA 5IEXA 5ACKA 4F9AA 3QUPA 2QOFA 3HV6A 3QALE 4UWYA 4EBVA 5M44A 5IQAA 3ORLA 4G16A 2JD5A 3TDWA 3PJ1A 4YPDA 4D4SA 1YXXA 1F3MC 3F5UA 4FGBA 3R00A 2WTDA 4IX5A 4CLIA 1ND4A 4NKAA 4S31A 4UMTA 2A19B 2J0IA 3IW8A 4MWIA 2C3LA 2XVDA 3FAAA 4WT6A 3Q4UA 5AJQA 5ETCA 4G2FA 3GC8A 3ZUVA 4H05A 1XH6A 3QZGA 3F7ZA 2ESMA 2WMVA 5FP5A 2W05A 3R8ZA 3CD3A 4USDA 3DNEA 4XS2A 2Y7JA 4IVCA 3EFKA 2G1TA 4L3LA 4KSPA 4M66A 1WVWA 5IA3A 3UE4A 2DWBA 2F7ZE 4EL9A 4TW9A 4ZLZA 1ZZ2A 4PP9A 4PV0A 5M4FA 3KCKA 5DFPA 3V01A 2YITA 1PMEA 1I09A 3PXRA 2PSQA 4D2VA 4DT9A 4CKRA 3TZ7A 2BRBA 4FYOA 4GT3A 4EBWA 5CEPA 4CZUA 5KCVA 3OG7A 3LFCA 1KV1A 4F4PA 2XBJA 4I22A 4CMOA 2W1FA 2H6DA 1F5QA 3Q9WA 3QKLA 2YFXA 4FTJA 2Q83A 4R7HA 3G90X 4ZZNA 4XP2A 3BV3A 2HCKA 5JGDA 4M15A 3NYVA 4GH2A 3OCGA 3GCQA 3PSBA 4ASDA 4JG7A 5CQWA 4BC6A 2WQNA 1JSVA 1O6KA 2ZV7A 3ZBFA 4AT4A 2P2IA 3Q04A 3VUMA 1P4FA 3QAME 4CZTA 1WBPA 2B52A 1OIYA 2JFMA 2X2MA 3GUBA 2OH0E 3QHRA 4FK3A 4BCFA 3U6HA 4NM0A 4TYHA 1MRYA 4I1ZA 1TVOA 5KMMA 3Q2JA 5ETAA 4DFZE 4R1VA 5ICPA 3L9NA 2W7XA 3DJ7A 3CP9A 4EHGA 5DR6A 4UWCA 3ENMA 4YTHA 2Y6MA 3OT8A 4W8DA 3E7VA 4QMMA 3QXPA 4E4NA 2XRUA 3EQDA 3BYUA 1VEBA 4MNEA 4P5QA 1FVRA 4TYEA 5IPJA 3HNGA 3Q9XA 1V0BA 4FVRA 3BYMA 3HYHA 4KIQA 3E93A 4AGWA 2HWOA 3FPQA 4NT4A 3ODZX 4AWIA 4BIBA 4KKEA 3S0OA 4OTHA 4DG2E 3GEQA 4J7BA 3QRTA 5BQ0A 3F5GA 5HVKA 4GL9A 4BR3A 3KKVA 1P4OA 1TQMA 4ZIMA 3VS4A 2SRCA 3Q5ZA 1VYZA 3SX9A 3LMHA 1P14A 3OF0A 5DBXA 4YGAA 3R30A 3IW7A 3CD8A 3HA6A 4Q9SA 2QQ7A 3KRRA 3LFEA 4I23A 4ANNA 3FZOA 1G8AA 1NW1A 3U4WA 3RAKA 2IG7A 1Q97A 4DEGA 2ETMA 4YZCA 5J9YA 4MD8E 4QOXA 1GZ8A 2BAJA 2OI4X 1OL7A 1TQIA 5HIEA 1U59A 3OXZA 4WNPA 3QD0A 4EZ5A 4DFXE 4RLLA 2CKOA 3ROCA 3JXWA 5HE0A 4YMJA 5TF9A 3WE4A 3EJ1A 4X3FA 3LFDA 4JX7A 5CU2A 4I6QA 5AM7A 5AUXA 4DN5A 1H0VA 2QOQA 4H1JA 5HG5A 3S1HA 4OTGA 4UZHA 3HGKA 4OT6A 4RJ6A 5CVHA 4R77A 5BVOA 4BRXA 4KRCA 4F9YA 3DQWA 4C4EA 5H8GA 4RIYB 2VTRA 3D7TA 2GS7A 3V3VA 5CXZA 3HV5A 5M4UA 5FTQA 3NW7A 4ZJIA 4RX9A 3ZXTA 3SW7A 1T46A 4Y5QA 5LMKA 3UG2A 4QQTA 2GNLA 4I0TA 4L44A 4GVJA 2VTJA 4HGSA 2WU7A 3FZSA 4I5MA 4PY1A 4DTBA 1R1WA 1GIIA 2B1PA 2YM8A 4HCTA 5DVRA 4KRDA 2WAJA 3WARA 3GU4A 5AP2A 3QWKA 4JDKA 4YJVA 2CGUA 2QODA 5HO8A 3NMUF 2C6EA 4G5PA 2B9FA 1UNGA 5I3RA 4FGRA 2ZB1A 3ODYX 5KMIA 2RG5A 1OVEA 3FZRA 5HE2A 1R0PA 3QFVA 5D7AA 3N51A 4QMSA 3RZBA 3JUHA 2XIYA 5IUIA 3MPMA 3ZOSA 4ZTMA 1Q62A 2F7EE 5CZHA 3ALNA 5AR8A 4EKLA 2Z02A 1IG1A 2VWVA 4KINA 5HIDA 2JDRA 2XK7A 3C9WA 4MXZA 4E4LA 2BALA 2OIQA 2Z7QA 2ITNA 4CRLA 2XF0A 1PKGA 2C5VA 2ITWA 2R3RA 4ZSAA 5DMZA 3A7IA 3QTSA 5J1VA 1QL6A 2W0JA 2PUIA 2IN6A 3JY9A 3C0GA 4WNKA 4JLCA 2UV2A 2OF2A 3NNXA 3P4KA 5E1SA 3V51A 3BRBA 1R39A 1FGIA 2YDIA 3A2CA 4LYNA 4TNDA 4XG8A 4E5BA 4YTCA 2PVYA 4FTQA 1YDSE 2VTHA 3HP2A 1SM2A 4OAVB 3OWLA 1WBTA 2XK3A 4B8MA 2Z8CA 4L7FA 5G1XA 3V8TA 4IVDA 3PXZA 2CKPA 2G2FA 4FKOA 4ZAUA 4X2GA 4MAOA 3ELJA 2WMWA 3EQGA 3CJGA 2ITOA 4PMTA 2B7AA 3LE6A 1GOLA 4FG9A 3C5UA 3DTCA 5ETIA 5C8NA 4RIWA 4JQ7A 4ONAA 4R6VA 3BHVA 4OTDA 2XCHA 4WA9A 4OBOA 5HEZA 5KZIA 4BCHA 5BYYA 3DBCA 1Z9XA 4FTCA 1G8SA 3HRFA 4ID7A 3NIEA 5B7VA 1ZWSA 2JAVA 5HHWA 4RFZA 4DBNA 1WZYA 3RK5A 4UYNA 4D5HA 5BVWA 5J9LA 1K2PA 4IAZA 2YM6A 3FYKX 3W8LA 4AZEA 4JS8A 5AMNA 4GU9A 3WZKA 3P79A 2GU8A 4EZ3A 4LV5A 2HW6A 4O1PA 4GT5A 4HOKA 4Z7GA 4OLIA 4YJTA 4XG3A 3FLQA 3CKXA 1XH8A 2GNHA 2HENA 4H39A 3W2RA 4M68A 5HLPA 3C50A 4DINA 4CT1A 4ZP5A 5CI7A 3TUDA 5JQ8A 1KWPA 3UTOA 5E7RA 3KXZA 1H1QA 4JIAA 3IDBA 2QR8A 2P4IA 5K3YA 5LMBA 3FE3A 1Y57A 4AF3A 2IVUA 2IZRA 4AFEA 2BZKB 3W55A 2FH9A 5A6NA 4FOBA 3OBJA 2EUFB 3DKGA 1BX6A 2JITA 3AC1A 3OFMA 3CTQA 4GG5A 5FDXA 2X4FA 4DTKA 4BGQA 4X3FC 4Z9LA 3EFLA 4AW1A 1XO2B 4FKGA 3VS6A 3D2KA 3F61A 2BRGA 2PVNA 4FOCA 1PRYA 3OVVA 4ZTHA 5L3AA 3KMUA 3W2CA 3RM6A 5CT7A 3LCOA 5KKRB 4FEWA 3BX5A 3LMGA 2RIOA 2XIKA 2QOCA 1SVHA 2WMRA 3FXZA 2VTAA 5ANGA 4QMNA 2W1GA 4CV9A 3U9CA 4L42A 2LGCA 3IONA 3M42A 4L9IA 4FT3A 4K33A 3UPXA 1PHKA 4HW7A 4AUAA 2CN8A 2OXDA 2GNFA 3I5NA 3AT4A 1H00A 3JYAA 2IW8A 3R8MA 4EHEA 5LMKC 3G33A 3SGCA 4LMNA 4FV9A 4XLIA 2YIWA 3AT3A 3CXWA 2ZAZA 2RL5A 3D0EA 4Y5HA 5ANDA 3PVGA 4R3PA 3ZRKA 3AQVA 2WPAA 5EHYA 5CEOA 1XQZA 3QQLA 3VW8A 2VX3A 3BU5A 3ANRA 3TV4A 5CF8A 1JWHA 3F6XA 1YHWA 5GJDA 3P78A 1ZYJA 4PUZA 2PVKA 3ZO2A 5TR6A 3BLHA 5JT2A 5FEQA 3QLFA 1WCCA 2HY81 2XH5A 2GMXA 2A0CX 4DGOA 4IAIA 2PULA 4O86A 2X7GA 3QGYA 1Q8ZA 3R1YA 3SW4A 5I9WA 1JPAA 5C26A 4YZ9A 1GIHA 4YJRA 1L8TA 3A8XA 3C5IA 4XNEA 4BB4A 3Q3BA 4F65A 4FV2A 1B38A 1PMNA 3COKA 3ZC6A 4H36A 4RIYA 3TUCA 4ZEGA 3EN4A 2H8HA 3QZHA 4FKIA 4N6ZA 3QC9A 5LVNA 4PL3A 4ZLOA 3R02A 5HORA 1Q8UA 5HU3A 4JT3A 5ANKA 4KUJA 4CT2A 3UZRA 4L7SA 3UJGA 1OIUA 2GPHA 4FIFA 3R7YA 2C4GA 3HV4A 4GW8A 5DT4A 3SAYA 4MQ2A 5DPVA 2XA4A 2NRYA 4XV9A 3RKBA 4O7VA 1CTPE 3OC1A 1JBPE 3NUSA 3H10A 4MBJA 3BU3A 4OBPA 2XKFA 1K9AA 4Z7HA 5CAUA 5LJJA 5EHLA 2BDJA 2AC3A 2OJGA 1V0OA 2YM7A 4FTUA 4IC7A 2W1CA 1U5QA 2WTWA 3PDTA 1YXSA 2ITZA 4OTPA 1VZOA 4I21A 2OJJA 4I94A 3VF8A 2HELA 2HZIA 4NIFA 4QP2A 2VNWA 3TI1A 4PRJA 3ZYAA 4C7TA 3POZA 2Z7SA 4USFA 2EXEA 5J9ZA 3FZ1A 3KN6A 3VVHA 3W32A 5M56A 3MJ1A 3AXWA 2YIXA 3R9RA 5HD4A 2OG8A 4QP8A 4ANQA 1UKIA 4QQJA 5DWRA 3R7OA 4J8NA 4YURA 2I7QA 4Y85A 1UU7A 3RNYA 4BWXA 2I40A 3TNHA 3HVCA 4BDFA 5HBEA 3UQGA 2FSLX 1KE9A 3QYWA 3P7AA 4RJ5A 4BN1A 4C2VA 5A4EA 4FV6A 4FE2A 4RA4A 2XNGA 2JIIA 3HV3A 4FT0A 4KNBA 3BLQA 1CKIA 3IS5A 3HMOA 4F64A 4LUEA 5IZFA 3DKOA 3LIJA 2FYSA 5IQGA 4M8TA 4A7CA 2WMBA 2YA9A 4PNIA 4GUEA 3MB6A 4FZ6A 2XYNA 3PLAE 4UMQA 5DG5A 4MK0A 2H34A 4LOOA 2VWZA 4AGUA 4A06A 2R0UA 3OHTA 3O51A 4QD6A 4C4JA 1LPUA 4CNHA 1H8FA 5CU0A 2R9SA 3HMIA 3MS9A 1J7IA 1UU8A 3CKWA 3GCVA 4FTIA 1KOAA 4FTAA 4U43A 3W2SA 5BNJA 3UZPA 3DJ5A 1BLXA 2CGWA 4IXPA 3A7GA 5JFVA 4JBVA 3MIAA 3RTPA 3ZMMA 5HO6A 3ENHA 4FTRA 1CDKA 4E6AA 5FXRA 4MXAA 3TN8A 1KV2A 3DB8A 4IH8A 1RW8A 2YIQA 4RQKA 3QQHA 4ZZOA 2F2CB 3GBZA 4EK8A 5K5NA 5HTIA 5HQ0A 4FODA 4CZYB 2W1HA 5EI2A 1DI8A 3RPRA 2GNJA 3ZSGA 2C6TA 3RCJA 1WFCA 3LMIA 5LVMA 3CJFA 3FMJA 3Q6UA 2JBPA 3ZC5A 5EFQA 5C4KA 4CQGA 4F7LA 2R3HA 3BGQA 3PWYA 4AG8A 3HDMA 3DAEA 3ZM9A 3I60A 3D5XA 4GU6A 5HVJA 2BFYA 4UXLA 4WG4A 1YWNA 2GTNA 4WHZA 4NW6A 4BIEA 5HX8A 1PY5A 3PG1A 4B7TA 1OI9A 3NEWA 3ZBXA 4F6UA 4CQEA 4D9TA 4E4MA 1ZY4A 2WNTA 3QCYA 4FZAB 4FKTA 3HZTA 4U8ZA 1H26A 2BDFA 4JDHA 3QGWA 2VTTA 5EOBA 4A4XA 3PE1A 4NW5A 4PPBA 4FT9A 5EH0A 4D1ZA 2PPQA 2RSVA 3ZS5A 3F3WA 4F0FA 1OPKA 3EQPA 2BTRA 4BGGA 3SRVB 2OICA 3LFBA 2UZEA 3MDYA 4IWDA 1JLUE 4FUYA 3QC4A 4WRGA 3EN5A 3QTXA 3UO6A 5EKOA 2WFYA 3KY2A 4V01A 2WOTA 4XV2A 3AC8A 3DK7A 4C57A 1CKPA 3W18A 1KE6A 4XYFA 5HICA 5HCXA 3VHEA 4O0WA 2EB2A 3GCUA 3C4ZA 2R3OA 4M0ZA 4XV3A 3PA5A 3ORXA 4V0GB 3UIUA 3ZFMA 1H0WA 4RVLA 2I0YA 3NUUA 4FIGA 4JAIA 1FVVA 5A9UA 5E8VA 1H01A 3EB0A 2WTCA 4WD5A 2QO9A 1OIRA 2WIPA 3R2YA 3GVUA 4WUNA 4A9YA 4BL1A 2XM8A 4CFUA 4DEDA 3BBWA 4IJPA 4CFMA 5L2TA 2R4BA 3MWUA 4RX7A 4XX9A 2OIDA 3CTJA 3HKOA 2ETKA 4X6RA 3R01A 5DR2A 3FY2A 3K5UA 3OEFX 3VIDA 3SG8A 4EK3A 1R3CA 4O0XA 5EOLA 4EEVA 1PYEA 1ZY5A 5M09A 3F82A 2B55A 4IWOA 4BCMA 3UODA 2GHLA 3LQ8A 4MNEB 4EC8A 4EH7A 4R7IA 3TKHA 5A4TA 3JS2A 4TY1A 4F9CA 1GY3A 4BI1A 1Q3DA 2QVSE 1G5SA 5E8ZA 4C4GA 2H96A 5BMMA 1W0XC 2NPQA 2WELA 4ZSGA 3LXNA 2YABA 4GKIA 3HV7A 2VTLA 2C6LA 3OCTA 4L8MA 4D4RA 2OBJA 4LGHA 5CF4A 3UQFA 5AUTA 2GTMA 4S30A 2IVSA 5C8MA 3R9NA 3NW6A 2XRWA 4N70A 1FGKA 4X7QA 4YZNA 4Q9ZA 3DXQA 2C6DA 4S32A 4MD7E 5AR7A 5CF5A 4NJ3A 4LGGA 4YNOA 4O82A 4FZ7A 2UZUE 1S9IA 2XNEA 3TCPA 3KULB 1Q3WA 1YXVA 4XMOA 1GAGA 3ZLYA 4F9BA 1QCFA 2BHEA 4OTFA 2PMLX 2V5QA 3ZHPC 5CVFA 5GINE 5E1EA 1H25A 4E8AA 3W33A 3NCGA 3NCZA 4M14A 5HU9A 3Q32A 2OXYA 4ZLYA 2VTMA 2IWIA 3EN7A 4FNWA 3RPVA 3QD2B 4TN6A 5DE2A 3CLYA 3VUKA 4EOOA 1GJOA 2X7OA 3SOAA 3FMNA 4C0TA 1UU3A 5CYIA 5B2KA 4BWPA 4E6CA 1Q8YA 5GHVA 4BCQA 3QF9A 4K2RA 3D7TB 4QRCA 3UOKA 3CC6A 4QP7A 3F2RA 4IZYA 4PDPA 3E8NA 3WIKA 4YUQA 3F66A 4R1YA 2W17A 4XJ0A 4HCUA 1U4DA 1NY3A 5L6OA 3AOXA 4MBLA 3PXQA 3UOJA 3N4UA 4YZMA 1OPJA 2J0KA 3MVMA 5JGBA 3QX4A 4KWPA 5IQCA 4RFMA 3QBNA 3KREA 3MFTA 3P5KA 3ROYA 3P9JA 1IR3A 2WOUA 4C62A 1PXLA 3EIDA 3RHKA 1CSNA 4L3JA 4RX8A 4U44A 3RK7A 4BCJA 3MN3A 5HOAA 4BBEA 4IBMA 4YU2A 4ZTSA 2OIBA 3MY5A 4NUSA 4BZDA 4FKLA 3NYNA 3BHHA 4H1MA 3TXOA 3DKFA 4EKKA 4DBXA 3JVRA 5CWZA 3DS6A 3WF7A 3G6HA 4YP8A 3UVPA 5L6PA 3FI2A 4WSYA 1OECA 1AD5A 3JY0A 4F7NA 3B8QA 3GCSA 4K9YA 3IKAA 4YLKA 3EN6A 4AA5A 4ZTLA 4CKIA 4EWHA 4LRMA 5AP5A 3MFRA 4ZSLA 3TEIA 4EH5A 3LCDA 3W2PA 4P4CA 4J99A 4PDSA 3HLLA 1KE8A 3LFQA 3Q4CA 1TKIA 3VS3A 5BUJA 5J79A 3HRCA 4I92A 1XH7A 2ERZE 3ZLSA 2XBAA 4DHFA 2IJMA 3P7BA 4QQCA 3OTUA 3UOLA 3FI8A 3BGPA 4FSWA 4HGEA 3VJNA 4F6SA 1T45A 4EK4A 2HXLA 4ASZA 4DH7A 5IH6A 1W84A 4IM2A 4NYEA 1JNKA 1J1BA 1FQ1B 2C1BA 2QI8A 4KABA 4P7EA 3ZRLA 5M51A 3I79A 4AS0A 3H9FA 4L67A 3PIYA 3U9NA 4KAOA 4XG4A 4EQCA 5HI2A 3A7HA 4M12A 3F5PA 2PE1A 4XH6A 3RGFA 4ALVA 4PDYA 2VTSA 1E9HA 1ZOEA 2PMNX 1FINA 4JAJA 2WHBA 2EWAA 4K0YA 3FMHA 4A9RA 4II5A 1XKKA 4RIWB 3WZDA 2J50A 5L8LA 4G1WA 5L2SA 3PLSA 3UC3A 4PPCA 5J95A 2CCHA 2PVHA 3HMNA 3Q2MA 3UPZA 5CSXA 2JKKA 4ACHA 5IDPA 4G3GA 1PMUA 2WEVA 4BYJA 2VO6A 3PA3A 3PYYA 4JR7A 4P2KA 2WGJA 3R83A 3HDNA 2W06A 4HGTA 5BYLA 3SRVA 3OWKA 4JX3A 3S3IA 3R8PA 4RC4A 3TWJA 2DQ7X 5AIKA 3FQEA 3MB7A 1KE5A 3F88A 3ZDIA 4K1BA 4QTAA 1Q8WA 2RFNA 3DT1A 4RWJA 2E9OA 2BZJA 5M4IA 4F6WA 4QPMA 4BCIA 2BROA 1QPCA 4DH1A 1VR2A 5AEPA 4Y46A 4BKYA 2OWBA 2UZVA 1ZLTA 4BDAA 2JDOA 3FC1X 4V0GA 2PY3A 4BDGA 4P5ZA 2QO2A 2ONLA 4U40A 2CDZA 3BHYA 4DE4A 3AD4A 3GFWA 1K3AA 3GNIB 3P08A 2R3KA 4EC9A 3UIBA 3BQRA 2WTJA 4Z55A 4DCEA 3ZXZA 3PP1A 2WQMA 4FTOA 3RWQA 4K18A 3MPAA 3KF4A 3R8UA 1GZNA 4DH5A 5JEBA 5EW8A 4O81A 1S9JA 4IWPA 4PL4A 3ORKA 4OGRA 1E1XA 3DJ6A 3RI1A 4O7SA 4KKHA 4M69B 5LWMA 4HVHA 2ZM1A 2FUMA 3PIZA 2PZ5A 3Q96A 4CXAA 2X39A 4GFMA 4TYJA 2VNYA 4O7LA 3EL8A 3R04A 5TKDA 2V55A 4JQEA 4E20A 4RX5A 1J7UA 2YDKA 3LJ1A 4MNFA 4AP7A 3DNDA 2XEZA 4BI0A 2OJ9A 4EQUA 3AD5A 3NX8A 5JQ5A 3EZRA 4RBLA 4W9XA 2XKEA 4LL5A 4B4LA 3PSCA 5IQIA 5JRQA 3ZSHA 1LEWA 2GFCA 5H9BA 3E8DA 3ORPA 3LFNA 1JQHA 4ERWA 5GIOE 2IW9A 1UVRA 3R7EA 2FO0A 2ITQA 2ZMCA 1OKVA 4S34A 3O0GA 4KA3A 3NNWA 4P90A 2FSOX 5H8BA 3FPMA 3TJDA 4AX8A 2BRHA 3LXPA 2X1NA 4J95A 4Q5HA 4AA4A 4R3RA 4AT5A 2CLQA 3SA0A 5HE3A 2PTKA 5K0KA 3GFEA 3CE3A 3LQ5A 4N0SA 4CFWA 3EOCA 3DB6A 5E8SA 3OTVA 1YHVA 2E9VA 2WTKC 3DY7A 2JDSA 3KULA 1UNHA 3UBDA 3V8SA 4BZNA 2IW6A 4Z16A 4U6RA 5AA8A 2OZAB 2C6MA 2YM3A 4XV1A 5EI6A 3VUHA 3C4WA 3R8VA 4ZJJA 3VS0A 5IA4A 5AR3A 2KULA 4FV8A 3KU2A 2VD5A 2ZOQA 2C0OA 1YOJA 2P3GX 4HPUE 5A4LA 1H28A 4AOIA 4EOMA 5I4NA 3KXNA 4APPA 2R3JA 3FMKA 3FSFA 5F94A 2XCKA 3P86A 1UV5A 1PJKA 4L43A 5AX3A 4C37A 5E8WA 3CS9A 4LOPA 2VO0A 4CG8A 1ATPE 2F57A 5I9YA 2BRNA 5BUIA 3TUBA 2F2UA 5I3OA 5FQDC 4D2PA 2OLCA 3VHKA 5ETFA 1PMVA 1YKRA 3GOPA 4FKSA 1QPJA 3PZHA 4D1SA 3QU0A 4GK3A 2HZ4A 3IECA 4FG7A 1REJA 3SXFA 4AAAA 4CD0A 4YBKA 4QO9A 3RVGA 3SV0A 4UV0A 4DC2A 4CEGA 3GCPA 1W98A 3NUNA 3C4CA 5HESA 4LQMA 2PU8A 4FSNA 5AA9A 4RGJA 2VO3A 3FKNA 2Z2WA 2XB7A 3TKUA 3H9RA 3N4VA 2QOIA 4WRSA 2O65A 1YI3A 2O63A 3MPTA 3R1QA 4IVBA 3E64A 4BZOA 2W9FB 1IAJA 1UU9A 1XH5A 4GIHA 2P55A 3PWDA 3GGFA 2ITVA 4NIFB 3N9XA 5ANOA 1BUHA 1TQPA 3L9LA 1Z57A 2QKWB 3FJQE 3OCSA 4MF0A 5J1WA 3MYGA 1ZYDA 4MBIA 4RZWA 2ZVAA 3R63A 5IA1A 5J5TA 1SYKA 2Z7RA 1MP8A 4FV4A 5FLFA 4IB3A 4RC2A 5HG8A 3VAPA 4DH8A 5IF1A 3WYYA 3AMAA 4BBFA 4QP1A 4I5CA 1Q24A 2X7FA 4D5KA 2B9IA 2CNUA 5ANIA 4DFBA 3GQIA 1FBNA 4YHTA 3UYSA 1QPEA 4AA0A 2I6LA 4ANSA 4JBPA 4QMVA 4EOLA 3NGAA 5IKWA 5CASA 5CSPA 3BWJA 5LVPA 2ETRA 3KK8A 4XG7A 1XBCA 3C0HA 3KMWA 4EZ7A 5JZJA 2ONLC 1OL6A 5H8EA 4I93A 3LM0A 2R7IA 1CMKE 2EXMA 3FQHA 3POOA 5HG9A 2YACA 3L9MA 3AMBA 3GU7A 3V6RA 3WIGA 4WOVA 4CCBA 4NTSA 4O1OA 4K77A 2VX0A 4ZTQA 3RAIA 2RFEA 3FWQA 4O21A 5J5SA 1H07A 4EH6A 3EN9A 4BTMA 3UO4A 3VBYA 3UOHA 4BIDA 3FI4A 4F1TA 3EQCA 3UC4A 5HO7A 1H08A 5E8YA 4O7RA 2Y9QA 3KRWA 2Z7LA 4XOYA 4JR3A 4C2WA 2BILB 3PVUA 4IFCA 4RPVA 2JDVA 2X2LA 5AR2A 4JNWA 5BVNA 4H3BA 3RAWA 5KMNA 1A9UA 4WKQA 3L8VA 2QG7A 2Y4PA 3FMMA 3ZZWA 4GT4A 2HZ0A 1WBNA 2I0EA 3E92A 3LKMA 4EJNA 2A27A 3ZEWA 1G3NA 2O0UA 4J98A 3EQHA 1FMOE 5TO8A 3U4UA 4FNZA 3V5JA 4AW2A 5A4QA 2X6EA 2G9XA 3ACJA 2ITTA 4OTQA 5AP7A 3UNZA 4EWQA 3GXLA 5GIPE 4YTIA 3EZVA 1J7LA 5JK3A 3MVLA 3PVWA 4KS8A 3EQRA 3L8XA 4NKSA 5AV1A 2XNNA 3T9IA 5I5ZA 1OITA 2HY0A 3RCDA 3W8QA 4A9UA 4ZTRA 4APCA 2BIKB 4K6ZA 3VBVA 2XNBA 2VN9A 3DXNA 2YM5A 4U97A 3C1XA 4R5YA 3VQUA 5ANEA 4GKHA 4M69A 3A4OX 4EK5A 3GQLA 4YNEA 4QPAA 5JRSA 3UMWA 4CKJA 3AC4A 5CVGA 2J2IB 2W4KA 4QMXA 4YHFA 2VRXA 3AGLA 4J53A 4O7ZA 4UY9A 5AX9A 4QMOA 3KXGA 4YTFA 5AV0A 2C47A 5G6VA 2JKQA 2DS1A 2VZ6A 1RDQE 2OO8X 5M55A 3COMA 3I0QA 1EH4A 4YSMA 3TNWA 4D2TA 1JSTA 4AOJA 2PK9A 5HBJA 3AC2A 3ZFXA 3K3IA 4O22A 3AD6A 4ACGA 4AU8A 3KXHA 3GENA 4FICA 1JKLA 2GQGA 4GEOA 4AGDA 5CEQA 5IMEA 2CGXA 3QTIA 2C3JA 3E5AA 3M2WA 3UP2A 4C33A 3BEAA 4I24A 4ACDA 4B8LA 4AT3A 3PXYA 5T68A 4U80A 3ZO4A 5LARA 2IVVA 2W4JA 5AP3A 4AFJA 4IDVA 5EDRA 5IUGA 2EB3A 4PMPA 2X9FA 4YC3A 3GI3A 2QU6A 5AAEA 4J8MA 2WQOA 3EQIA 2OH4A 3OOMA 2ZDTA 4BDCA 5A14A 5AFVA 3QRIA 1O6LA 2E9PA 2YDJA 3K3JA 5CX9A 5KE0A 2OZAA 4UZDA 2QOBA 4X0MA 1U46A 2UUEA 3SOCA 3KF7A 3DDQA 2V22A 5EW9A 5IISA 4W9WA 1OB3A 4XP0A 2WTVA 3JVSA 5CAVA 4A9SA 3LPBA 1MQ4A 3BHUA 4TXCA 3KK9A 4FKRA 1AGWA 4L3PA 3OS3A 2JDTA 4YBJA 3VUIA 1YXTA 4U79A 2AUHA 3R7UA 3QLGA 3IW4A 1YDRE 3NUAA 5EQYA 3O50A 4RVKA 2ITXA 4QYGA 4IIRA 4EOPA 4J52A 3BYOA 3MGYA 4FIEA 3IDPA 4X2JA 5IQBA 4QP6A 4GK4A 3QQGA 4QTBA 1UWHA 3DBFA 3DTWA 4J97A 4YJSA 5EM8A 2XUUA 3LAUA 4Z3VA 4ITHA 4GG7A 5AV2A 4EI4A 4YO6A 2GDOA 2V0DA 2QD9A 4G3DA 3K54A 1Q61A 1CKJA 2UW5A 3BYSA 5F4NA 1XBBA 4E93A 4EOSA 5HLWA 4JBQA 4CRSA 4R78A 3D15A 4OW8A 4C35A 2VWIA 5BVFA 2XK6A 3A7FA 1M17A 1Y6BA 4G6OA 2J5EA 4DA5A 2W5BA 5CS6A 1SMHA 2GHGA 3E3BX 3DLZA 3LOKA 4HVIA 2HZNA 2QOHA 4YHJA 3WYXA 3FC2A 2OJIA 3R9DA 4IDTA 2WMXA 2GHMA 3PXFA 4YLLA 1SNUA 4ZSJA 5HKMA 2XP2A 3TTJA 4USEA 3LCKA 4JQ8A 3L1SA 2FB8A 5FGKA 3ORNA 2IPXA 3LFFA 3VRZA 4HPTE 3THBA 2UW9A 3ULZA 5DHJA 2WEIA 3ZH8A 4AE9A 4BDJA 4ORKA 1LEZA 1ZOHA 4LRJA 3VUGA 4GS6A 4S33A 3UZTA 4ITIA 4ZSEA 3NNVA 5A3XA 2CKEA 4IAYA 5LVOA 1JVPP 2VWWA 2A4LA 3DAJA 4FKWA 3R0TA 4FTLA 4M0YA 4Y73A 4D4YA 2IO6A 3EQBA 4ZK5A 2YISA 4FV7A 4UEUA 4AZVA 3RINA 2B0QA 3TT0A 3V04A 1ZMUA 1YHSA 4BICA 5B2MA 4G9RA 2PUPA 3VF9A 5JZNA 2C69A 2NO3A 1Q8TA 3MVJA 2PZRA 3KA0A 3NS9A 5C1QB 4ASXA 3G51A 5LVLA 3BBTB 3BHTA 5FEEA 3QCXA 4RLKA 2FVDA 2XNMA 4IX3A 4MYGA 4PX6A 3FKOA 4V04A 4YJQA 2WMAA 3ZLXA 2WTKB 5IUHA 4BKJA 4JJRA 4BGHA 4F0GA 4KKGA 3NYXA 2VUWA 3OBGA 3CCNA 4RC3A 4GV1A 4C34A 3G15A 3QQFA 4E3CA 2HYYA 3OEZA 1YW2A 4FSZA 5CNOA 1ZMVA 4U42A 5CENA 3TTIA 3ZO1A 5E8XA 3RHXA 5FTGA 4HYUA 4O91A 3WZEA 2PZIA 2ZYBA 2F9GA 4FKJA 4AE6A 5LXMA 3MH1A 4X2NA 5IQFA 3SXRA 4PMSA 3C4XA 4BCOA 1W82A 2CN5A 1M52A 4JXFA 4QMTA 3SQQA 4DT8A 4MHAA 4FSYA 5M06A 3KRXA 3NW5A 3H30A 3LLAA 1YVJA 4FC0A 5CEKA 5EQPA 3PRIA 4IB5A 5EM7A 2VAGA 1WMKA 2XIRA 3ZONA 4ZY6A 5LMAA 4HVDA 2XM9A 3QX2A 4E4XA 5C8KA 4L6QA 3WF8A 2CLXA 3FL4A 4O84A 2Y0AA 1BI7A 5F9EA 4O7WA 4LFIA 3IDCA 4B0GA 1CM8A 2YWVA 4C02A 3RPSA 3KXMA 4J1RA 3QQJA 4Q2AA 3NUXA 4FTKA 1O9UA 5HD7A 5KUPA 2QLQA 2W9ZB 3PJ2A 4HZRA 3QA0A 2VU3A 4X2FA 4FVPA 3D7ZA 4QNYA 2I0VA 4TYIA 2BRMA 4JDJA 4MEDA 4QMLA 4UB7A 3DA6A 3ORZA 5GNKA 1LUFA 1OM1A 5CU6A 1FVTA 3E3PA 4TTHB 1HCLA 1Y6AA 4NH1A 4L68A 2VX1A 4DFNA 4KSQA 3AC3A 4BDBA 3HUCA 3MESA 2PVJA 3F7WA 4ZMEA 4C3PA 4KIPA 5E4HA 3EL7A 5HG7A 2A1AB 5AUVA 2F7XE 2XK8A 4DFYA 3MTLA 3SKCA 5I0BA 4DF3A 3A99A 2XYUA 2X4ZA 3ET7A 3ZEPA 2ZM4A 2Y6OA 5EYCA 3UP7A 2NNWB 2REIA 3REPA 4TWNA 3VBTA 1QPDA 5LCKA 2CCIA 2UZDA 3PPJA 3OXTA 3QZIA 1ZYCA 4TRLA 4MQ1A 4L53A 2O64A 1IAHA 5KBQA 4W4YA 3PA4A 3QTQA 3R9HA 4Y8DA 4X21A 4OBQA 4OTIA 3UVRA 1YI6A 2UW3A 4DAWA 1B6CB 1UA2A 3FKLA 4IZ7A 3BKBA 5ITAA 4RMZA 3U87A 4XHKB 3LXLA 4LI5A 3WZUA 3SG9A 3KRLA 4CFVA 2B9HA 3QKMA 3AGMA 1OL2A 2RFDA 3PP0A 4NTTA 4ITJA 2VWUA 4FNYA 4NCTA 4F7JA 4L46A 4YPSA 3MW1A 4H58A 2J9MA 1WVXA 4GVAA 3RM7A 1OGUA 4D28A 4I20A 5D10A 4D2WA 5BUEA 2UZBA 2YIRA 2HXQA 4ENXA 4RQVA 3EYGA 4D4VA 4TNBA 3HP5A 2UW6A 5E8UA 1X8BA 3O7LB 4I6FA 5HE1A 3TIYA 4LUDA 5CAQA 2F4JA 4GRBA 2BHHA 3WE8A 3O2MA 3P7CA 4UBAA 3SDJA 2HWPA 3UYTA 3E63A 1DAYA 1JSUA 1OPLA 4FL2A 4GUBA 4JVGA 2C6KA 2H9VA 4EOKA 1A48A 3TNIA 1MUOA 5HCZA 5AR5A 1V1KA 3V5TA 4I6BA 4LOQA 4HNFA 4C36A 5AUUA 3H0YA 3SLSA 3W16A 1DAWA 2WZJA 3IQ7A 3ZM4A 5DRBA 4I4FA 2PZYA 3DK6A 1YDTE 1ZYLA 3MFUA 3NPCA 4QP9A 5DN3A 1UKHA 3MV5A 4W8EA 3QD4A 2VWYA 4ACMA 2JBOA 4I6HA 4XG6A 5CU4A 3W10A 4O7NA 4EK6A 4FVQA 3G0EA 4TWCA 1XHAA 1O6YA 3AG9A 5AP0A 3WF6A 5EDPA 3FZTA 4DFUA 4IM3A 1MRVA 3G6GA 3OWPA 1MQBA 1P5EA 4Q5EA 3UGCA 2O3PA 4XBRA 2BTSA 4CVAA 1OBGA 4AW0A 2RF9A 5CXHA 4E26A 5FM2A 1SVGA 1U5RA 2X9EA 3S2PA 4OAUC 3MY0A 4IQ6A 2QCSA 5IQHA 3KGAA 2XMYA 2G2IA 4GMYA 4UYAA 3TL8A 3H3CA 4FZFB 1YI4A 2ZV8A 4BHZA 4YJNA 2JKMA 5CNNA 3F3ZA 2JAMA 4JOAA 2R0IA 3FDNA 2W5AA 2JKOA 4FL1A 5A4CA 3H4JA 2R5TA 3PTGA 3QL8A 4HYIA 3EQFA 3BV2A 5D41A 3OP5A 4LGDA 4EHZA 2O8YA 2J51A 3VRYA 3II5A 4BCPA 2VV9A 5DGZA 4CYJA 1M14A 3DKCA 3ETAA 3BI6A 1FPUA 4ZOGA 5CTPA 5HBHA 3PE2A 4O2PA 3LLTA 2WU6A 2UW4A 3C4FA 4IC8A 3WBLA 4W4WA 2QKRA 4BDEA 2GS6A 2WTIA 1HCKA 5B2LA 3CGFA 2R64A 5JH6A 3U6JA 4E7WA 1ZRZA 2YLEA 1NA7A 4ZY5A 3DAKA 1M7NA 3KFAA 1BL6A 5EK7A 4FTNA 1YOMA 4AOTA 4I3ZA 4TYGA 4B9DA 4FYNA 5KHXA 3RJCA 3L8SA 3HX4A 3DGKA 3GOKA 3EFWA 2OFVA 5HCYA 3CR0A 4RRVA 4QMYA 4IZAA 5LQFA 5HGIA 4PTCA 3NR9A 3UIXA 4C8BA 4BHNA 4DEBA 4BTFA 4QQ5A 3ALOA 3JR1A 3WF9A 4O7TA 1WAKA 4GYIA 4KBCA 1J3HA 5DOSA 2ITYA 4FKPA 3ZUUA 1Y91A 3QTUA 3EMGA 1WBWA 5AWMA 2B54A 3MH3A 4RZVA 4MXCA 3PXKA 2BR1A 4QPSA 3AMYA 4XRJA 3OXIA 4WBBB 4AZSA 4BTKA 3NAXA 4FSMA 3R71A 4DLJA 3PVBA 5CSHA 3LFAA 5IH5A 2XK9A 2R3GA 3MFSA 4RWLA 3FEGA 4DH3A 2CNQA 1OBDA 3EKNA 5KMOA 1F0QA 3D5VA 3S95A 5KO1A 5E92A 4MF1A 3HRBA 1YOLA 4DGMA 1SZMA 4DEEA 5DRDA 5J7HA 4CTCA 4CLJA 3U54A 4ARKA 2J0MB 3BWFA 4LMUA 3C7QA 3FLWA 3L9PA 4QT1A 4ASEA 2PVRA 5CZIA 5JFSA 3ACKA 3K2LA 4E6DA 3H9OA 4W4XA 1OL1A 5LCJA 4FL3A 5ACBC 4NCTC 5IEVA 4XOZA 1PYXA 1GZKA 2YJRA 4WNMA 4RT7A 3VBXA 5AR4A 4NWMA 5HNIX 3VULA 2FGIA 3HAMA 2PYWA 3P23A 4DGLC 5IU2A 1SNXA 1OKWA 4EUTA 4MKCA 3HMMA 3Q5IA 2CGVA 4HZSA 4I41A 4ZS4A 3UO5A 4CMTA 1E1VA 3A61A 4M84A 5JN2A 4QMQA 2YJSA 3TG1A 5CAOA 4AGCA 4EYJA 5J7BA 1V0PA 2XKCA 5HTCA 4KIKB 2J0LA 4OT5A 4HYSA 5EG3A 3RZFA 1OUKA 1GNGA 3IG7A 4YO4A 4RIXA 3LZBA 3PY0A 4FV3A 2WXVA 2DYLA 1PXIA 4LL0A 5DNRA 1XBAA 3U6IA 5FD2A 4E1ZA 1W7HA 2JFLA 3Q4ZA 1W83A 3F3UA 1RJBA 2BPMA 5HIBA 1OMWA 3NDMA 3PPZA 3T3UA 3NZ0A 2OJFE 4UMRA 3QYZA 5H2UA 2QG5A 3G5DA 4AQCA 4FIIA 2XIXA 4DG3E 5EI8A 3CQWA 5F1ZA 4FSUA 4EOIA 4RJ4A 4ANBA 3BYVA 4O0SA 1OUYA 4HYHA 4FSRA 5AAFA 1BI8A 3CPBA 3G9LX 2ZV2A 4MXXA
chains in the Genus database with same CATH superfamily
1XH4A 2BDWA 3COHA 3EHAA 2XJ1A 4CV8A 3OW3A 4X2KA 5HTBA 4ZJVA 3MJ2A 3QTRA 2IZSA 3BU6A 1HOWA 3ORIA 3R2BA 5AV3A 4EH8A 3HAVA 4CFNA 2W1IA 5AUWA 2V7AA 2G01A 2BUJA 5EHOA 3MY1A 4N6YA 3LJ0A 4BDHA 2OZOA 4ANMA 4HCVA 3RBWA 5HNBA 3R73A 3W2QA 2BMCA 1M2PA 3D5UA 1R0EA 3TZ9A 2UVZA 3ERKA 2WMSA 4BBMA 4F1MA 3L8PA 4XEYA 5CLPA 4G17A 1H1SA 5DT3A 2BAQA 2EU9A 3TV6A 2C3KA 1PKDA 4XG2A 1OKYA 5GZ8A 5GJFA 3RWPA 2W1EA 4FR4A 4O27B 5M08A 2VTPA 4C59A 5AP1A 5DIAA 3RMFA 4MTAA 3IPHA 4XG9A 3EKKA 2QURA 4A4LA 5FBOA 3HECA 3I4BA 4NFMA 5TT7A 2YCSA 3OROA 3V5LA 5F95A 4ERKA 5K0XA 1IEPA 2EVAA 4CTBA 4EUUA 5DR9A 3R28A 1OKZA 4XP3A 4NFNA 5B0XA 4DLIA 4LRKA 5D12A 4KS7A 1IRKA 4YLJA 3WZJA 1PXMA 2GQRA 2J0JA 2VTQA 3UDBA 5CALA 3W0SA 3AC5A 3NWWA 4ZMFA 1XWSA 4HNIA 4M67A 4U3YA 4AAYA 2R7BA 4PWNA 3HA8A 1PXJA 5EDQA 3UNKA 4YZBA 3UVQA 3W0OA 2IEWA 4O0TA 4QMUA 3D94A 1BKXA 4FSTA 5CSVA 1DM2A 3HL7A 3U51A 3KQ7A 2BKKA 4IMYA 4NU1A 4O96A 4EH2A 4D2SA 5CEMA 2VTIA 3OMVA 5M4CA 1OGYA 3ORTA 4IVAA 2XK4A 5KHWA 4IE9A 4MVFA 1BL7A 4FIJA 3OCBA 4FT5A 4IX4A 2ZB0A 2YHVA 1XJDA 4FT7A 4RJ8A 5KZ0A 5HX6A 3FXWA 4QP3A 2UZTA 5D11A 4GYGA 2UW0A 4NM5A 4E6QA 3QRJA 2QHNA 5L4QA 4YJPA 4I0RA 4J71A 1JKKA 2WO6A 3PZEA 4FV1A 5E8TA 3KC3A 4WUAA 2E9UA 3KEXA 4AQKA 4BKZA 5FXSA 5EYDA 4PMMA 3KRJA 1OL5A 5CSWA 3A8WA 1L3RE 1TZDA 4RG0A 1DS5A 1SVEA 3QRUA 1XH9A 3MA6A 3MA3A 3FYJX 2VWBA 4GFGA 4KB8A 5TOZA 4AZWA 4F63A 3UMXA 1B39A 4YC8A 2BFXA 3ZTXA 4I4EA 3NUPA 4TZRA 4G3FA 4XRLA 4DTAA 4V05A 3FLZA 2UZWE 4PPAA 3DBDA 4GCJA 3A60A 3B2TA 2OF4A 2UW8A 1A06A 4IW0A 4MXYA 2XNPA 2C5YA 4O0VA 2R3LA 1Q41A 2XZSA 4O38A 3DDPA 4ANOA 2BZIB 3O17A 3DBQA 1NVSA 4EYMA 1H1RA 2JLDA 2Y4IC 3QQKA 1YRPA 1WBVA 4C38A 4FI1A 3ZZEA 3G2FA 5K9IA 1H27A 3DFAA 2WKMA 3O71A 3UQCA 2HOGA 4TKSA 3N4TA 2WB8A 3DCVA 4QYEA 4ALUA 3R6XA 3DZQA 3D2IA 3VS5A 5CEIA 3MSSA 4WBOA 5K4JA 2O2UA 5EKNA 2QHMA 4O6LA 2DUVA 5FM3A 2EXCX 2O5KA 2R3FA 2LAVA 4U5JA 3CTHA 3KMMA 3NSZA 2B53A 2J4ZA 4FUXA 4RA5A 3VS1A 4D55A 4ZS0A 4HVGA 3IK3A 3COIA 2RGPA 3LJ2A 3TACA 5A46A 5KBRA 3PJ3A 3V5QA 4X3JA 4MX9A 4D0WA 3CGOA 4WO5A 3E62A 3HMPA 2Q0BA 4DDIA 2YAKA 4GFOA 3MTFA 5EQEA 3OY1A 4EJ7A 4HVSA 5E91A 4M3QA 2BCJA 1J1CA 2CJMA 3C13A 4IAKA 4KIKA 5AIRA 3TZ8A 3WF5A 3GC9A 3F2NA 3OWJA 5L2IA 4KD1A 2HW7A 3KVWA 3TIZA 4ZTNA 3VW6A 4F99A 4FG8A 5L6WL 1J91A 4I0SA 3E7OA 2QU5A 3ORMA 2QOKA 3P0MA 2GQSA 5M07A 1REKA 3F5XA 1KOBA 3HUBA 3HEGA 3KCFA 4ZXTA 3C4EA 3VO3A 4EHVA 3MIYA 5IQEA 4K11A 2R3QA 2XAOA 3ZFYA 3QHWA 4CSVA 2C6IA 3V6SA 3ID6C 3RPYA 2CHLA 4XLVA 1JAMA 2QO7A 4BI2A 1OZ1A 3B2WA 4JI9A 2UZLA 2G15A 3I6WA 2PZPA 3OZ6A 2CKQA 2YZLA 3I7BA 4FMQA 3D9VA 2ZMDA 2WIHA 1PXKA 4MXOA 5D7VA 1NVRA 4A4OA 5AP4A 5TE0A 2X0QA 4U0IA 3W0NA 3R1NA 1UWJA 3VBWA 4FKQA 3QD3A 3OD6X 5AADA 5L2WA 2PUNA 3CBLA 1PXNA 3DFCB 1H24A 4FTMA 2VTNA 2XJ0A 2QOOA 4LV8A 1LR4A 1P2AA 3R8LA 3FMEA 3R7IA 2GSFA 3A62A 4PTGA 4QNAA 5J8IA 1GZOA 3B8RA 5IA2A 3AT2A 2Q0NA 4W4VA 2WMQA 3OW4A 3WOWA 4CYIA 4DCAA 4G6LA 3OUKA 3NVKI 5C03A 4Y72A 1KSWA 4FSQA 3IO7A 3OT3A 5IDNA 2BVAA 4F09A 1PF8A 3KXXA 2C5OA 4IANA 5AUYA 4BTJA 2JGZA 2Z60A 3FUPA 3V8WA 4PL5A 4YR8A 4QYHA 4FEVA 3LQ3A 3BEGA 1YWRA 3E87A 4ALWA 2FA2A 4JRNA 3CSVA 3CPCA 3IOPA 4BWKA 5DYJA 4PNKA 5I9ZA 1BYGA 2WMUA 3VQHA 1STCE 4EH9A 3P1AA 4L52A 4AXFA 1Q5KA 4DG0E 2WMTA 2ZV9A 3SVVA 3KB7A 4F9WA 3F2AA 2E2BA 4JRVA 2YLFA 1APME 2GS2A 2P2HA 4TWOA 3LCTA 3QZFA 1ZARA 2X8DA 4RJ3A 1LP4A 5BVKA 5KMLA 3FHIA 5IMXA 3OOGA 3FLYA 4XUFA 2ITUA 5T6KA 4FA2A 3F69A 4BVUA 2WQEA 4FEQA 4FBXA 4RVMA 3W1FA 4CCUA 4DITA 2FSTX 2QC6A 2VGPA 2X6DA 3Q52A 2ZJWA 2FSMX 4RFYA 5CF6A 3R22A 3TKIA 4EQMA 5K4IA 2QNJA 4ANLA 4MWHA 3RPOA 2C5XA 4BDKA 4C3RA 4RVTA 3W2OA 3DV3A 3FQSA 1JKTA 3ZUTA 5GJGA 4WSQA 4U41A 5CAPA 4G3CA 4BFMA 5AAGA 5M53A 4IB1A 1UNLA 1WBOA 3RP9A 3DBEA 2QLUA 3ULIA 4AN9A 4OR5A 1U54B 2W4OA 5DT0A 3QQUA 4FV5A 2W99B 2PE0A 5D1JA 2X0GA 4ZY4A 4C58A 3CQUA 5EYMA 5DI1A 5HLNA 3I7CA 1NVQA 2PE2A 4BY9E 4BF2A 2PHKA 4BCKA 5A54A 3DU8A 4G31A 3Q9YA 4G9CA 5AUZA 4C4HA 4CFFA 4NK9A 4UMUA 1Q99A 2I0HA 5FP6A 4FIHA 3PY1A 1RQQA 3SHEA 4O2ZA 2G2HA 4QMWA 5L8KA 2VTOA 2PMIA 5A6OA 4MUQA 1W8CA 2HAKA 4DEAA 3ZDUA 3K5VA 5C01A 3RK9A 3U8WA 3LCSA 5EYKA 3BQCA 4JG6A 4EONA 2OGVA 5CY3A 3VS7A 1KUTA 4LG4A 5BYZA 2CPKE 4F0IA 3I81A 5HNGA 3QXOA 2J90A 2OSCA 4IFGA 4RWIA 5C4LA 2R2PA 3BPRA 4ACCA 4S2ZA 2XJ2A 4IX6A 1FOTA 4DGGA 3BGZA 1PXOA 1BMKA 2AC5A 3QCQA 3WILA 2JEDA 4AW5A 3TJCA 4EORA 3I5ZA 4YC6A 3S4QA 3QA8A 3FY0A 4WG3A 4A9TA 1KE7A 1VJYA 3QUEA 4DEHA 4NL0A 4QMZA 3G9NA 4O0YA 5CI6A 3IGGA 3LHJA 1ZZLA 4RWKA 4QP4A 3NAYA 2X81A 5HVYA 3T3VA 3LM5A 5IA0A 3A4PA 3R7GA 4YJUA 5FEDA 4IJ9A 3DXPA 3EFJA 2C6OA 3FI3A 4M13A 3F9NA 3MBLA 4PF4A 2OK1A 4B99A 2W1DA 3Q6WA 3I1AA 1Z5MA 3NNUA 5IA5A 2YWPA 4FX3A 5D9HA 4KBAA 4XBUA 5FDPA 1Y8YA 5KMJA 5DEYA 2HIWA 3Q60A 1M2RA 5AM6A 3KVXA 3SC1A 4L01A 4Y83A 4K8AA 5FWKK 4TT7A 5JGAA 3E8EA 3LFSA 5JSMA 5I9UA 2JIVA 3BZ3A 4UX9A 2YERA 3GU6A 2P33A 4U9AA 3PPKA 5DLSA 3ZU7A 4F1OA 3DQXA 5JMSA 2C1AA 2C0IA 4O0UA 4TL0A 3TM0A 3T9TA 2YCFA 3D5WA 3KL8A 3EYHA 3DOGA 4DYMA 2V62A 4WIHA 5FUTA 2HK5A 4MCVA 2C5NA 3LXKA 4NEUA 4J96A 3V5WA 5L2QA 4AN3A 3OY3A 2OFUA 4ZZMA 5I9VA 4TPTA 1Y8GA 4FRFA 5DEWA 2OU7A 1YQJA 2RFSA 4G5JA 4AZTA 5LWNA 3F3VA 2GFSA 3ANQA 4H3PA 2B9JA 5FTOA 3I0OA 4UALA 3C0IA 3ZSIA 4H3QA 3I6UA 1MRUA 3MVHA 2PUUA 4YZDA 2ZDUA 4GJ2A 4E5WA 3DZOA 4UXQA 3VC4A 4CMUA 4QYFA 3R9OA 1W2DA 5IEYA 3O8UA 3R7VA 3GU8A 5GZAA 4MH7A 2Y4IB 4BDIA 2I1MA 1JOWB 1QMZA 2BKZA 2W1ZA 1ERKA 4RIXB 4IACA 4BYIA 3R1SA 4D58A 5CANA 4NZWB 3FXXA 5JKGA 5FG8A 5F20A 2UZOA 4OTWA 3GT8A 5H3QA 4FJVA 4CGAA 3A7JA 3OUNB 3MI9A 1R78A 2P0CA 5E9EA 3ZO3A 2BIYA 2NP8A 3EWHA 3GB2A 2RG6A 4JG8A 4Y95A 2PVLA 2PL0A 4QTDA 3FV8A 2YM4A 4O0RA 4YSJA 5KMKA 4IM0A 2E9NA 1PXPA 3WI6A 1URCA 3BIZA 3D83A 4KBKA 4EH4A 3NRMA 3U55A 2IZUA 2WD1A 2JC6A 3QWJA 4IEBA 4GK2A 4BCGA 4O83A 2V7OA 2X8IA 5LOHA 2R3IA 3PG3A 2ERKA 3TV7A 5I9XA 5T3QA 5E90A 3VNTA 4FK6A 4CG9A 1ZMWA 4IWQA 1Q4LA 4QMPA 2C30A 1IA8A 3MH0A 2J6MA 3D4QA 2A2AA 3NIZA 3ATTA 1URWA 3LW0A 4X6QC 3EH9A 4E73A 5K5XA 4UMPA 2R3PA 2NRUA 3BLRA 1FMKA 3QCSA 2YIYA 4JBOA 4M7IA 4U81A 5EM5A 5CT0A 5KNJA 3F3TA 3IW6A 2YN8A 3FHRA 3R21A 5FBNC 2UVYA 2OXXA 3VUDA 4ENYA 3QTZA 1H1WA 2BAKA 3O96A 3S00A 4HGLA 5L8JA 4L45A 4O4FA 5BX0A 3Q9ZA 1AQ1A 5M57A 2X0PA 1VYWA 4TYHB 1I44A 1M7QA 2RKUA 1NT2A 1JKSA 1H4LA 2BZHB 2Y8OA 2UVXA 4U45A 1H1PA 4WNOA 3VBQA 5HZNA 3CQEA 4DGNA 4QYYA 3PJ8A 3TDVA 3QUDA 1M2QA 2YCQA 3DK3A 4BDDA 2W96B 4MD9E 3D14A 4FZDB 4JDIA 3KN5A 3TMOA 2WQBA 3FZPA 3UIMA 5BVEA 5GZ9A 2JIUA 1U54A 4DEIA 3PRFA 4IHPA 3GP0A 1ZXEA 2CNVA 4WG5A 3DLSA 5IQDA 3TNPC 2CSNA 3FBVA 4D0XA 3O8PA 4U3ZA 2VWXA 4FEUA 4QTCA 3MH2A 3FLSA 5EW3A 2OKRA 1GIJA 4IADA 5EM6A 4FNXA 4M97A 3TZMA 3UG1A 2ITPA 4R3CA 3NVMB 4GSBA 3FMLA 3FLNC 5ANJA 4FKVA 3Q53A 4AZFA 2KTYA 3BE9A 5IG1A 4R5SA 1WVYA 2F49A 3PJCA 2XKDA 4C3FA 3PIXA 4NM3A 3JPVA 3E8CA 3GC7A 3Q4TA 4R7BA 4IB0A 2AYPA 3O8TA 4N57A 2GNIA 4EOJA 3QRKA 2QR7A 2UW7A 2GCDA 2ACXA 3M11A 3V5PA 2X2KA 4E5AX 3TNQB 1NXKA 2XS0A 3FSKA 5DH3A 4I6LA 4O4EA 4JIKA 3UNJA 1XR1A 3CY3A 4X3FB 3VJOA 4YJOA 4PDOA 3SD0A 2C3IB 5JFWA 2J7TA 1RE8A 4R8QA 5AP6A 3ATSA 4GIIA 2YAAA 3RAHA 4EOQA 4XCUA 2IVTA 3ZLWA 1PW2A 4IAFA 4I5PA 4O7YA 2OW3A 2QONA 2R3MA 3QTWA 4RSSA 2XNOA 5BMSA 3CY2A 2C68A 5C9CA 4FEXA 5FRIA 3IOKA 4RJ7A 3C51A 2QOLA 2VO7A 3IW5A 3GU5A 3O23A 4HJOA 2W5HA 3LVPA 4AN2A 1ZYSA 2UZNA 4RIOA 3E88A 3PFQA 2J5FA 4PTEA 3RNIA 1YWVA 2PVMA 1ZOGA 3VUTA 4NSTA 3CIKA 5BPYA 4OTRA 1IASA 5J87A 3BELA 3H0ZA 2R3NA 4G6NA 2YEXA 3ZRMA 4B6LA 4FTTA 4DFLA 5IH4A 3GC0A 1WBSA 4QTEA 4OUCA 5JFXA 4GJ3A 3VWAA 4KIOA 4AACA 4F70A 2XIZA 2YCRA 4G3EA 4BCNA 4C4IA 3RALA 4NJDA 4PP7A 2C0TA 4NM7A 4U7ZA 4O6EA 4LM5A 5CQUA 3BCEA 2PWLA 4FKUA 4CFXA 4F08A 4UWBA 3PUPA 3VS2A 5AV4A 2X8EA 3W0QA 4L00A 1DI9A 3FL5A 4FF8A 3SXSA 4C61A 3T8OA 4EH3A 2GNGA 4G34A 4I5HA 1YXUA 3M1SA 5C27A 3G0FA 3UDSA 4A07A 3IGOA 3NUYA 3ITZA 3QKKA 3NYOA 4JL9A 3FMDA 4FV0A 2IZTA 4N4SA 4PQNA 4D9UA 3O7LD 5BVDA 2VGOA 3BE2A 3ZCLA 2PVFA 1IA9A 4IZ5A 4C4FA 1OIQA 4D1XA 5KX8A 2XEYA 4TWPA 1ZAOA 5KKRC 3PSDA 3NLBA 2ZM3A 2CMWA 5FXQA 3VN9A 2B4SB 4UN0C 3PY3A 4F7SA 3CEKA 5DA3A 4AXAA 5CU3A 2YZAA 4IAAA 2PMOX 3DPKA 4D2RA 5IEXA 5ACKA 4F9AA 3QUPA 2QOFA 3HV6A 3QALE 4UWYA 4EBVA 5M44A 5IQAA 3ORLA 4G16A 2JD5A 3TDWA 4DDGA 3PJ1A 4YPDA 4D4SA 1YXXA 1F3MC 3F5UA 4FGBA 3R00A 2WTDA 4IX5A 4CLIA 1ND4A 4NKAA 4S31A 4UMTA 2A19B 2J0IA 3IW8A 4MWIA 2C3LA 2XVDA 3FAAA 4WT6A 3Q4UA 5AJQA 5ETCA 4G2FA 3GC8A 3ZUVA 4H05A 1XH6A 3QZGA 3F7ZA 2ESMA 2WMVA 5FP5A 2W05A 3R8ZA 3CD3A 4USDA 3DNEA 4XS2A 2Y7JA 4IVCA 3EFKA 2G1TA 4L3LA 4KSPA 4M66A 1WVWA 5IA3A 3UE4A 2DWBA 3W0MA 2F7ZE 4EL9A 4TW9A 4ZLZA 1ZZ2A 4PP9A 4PV0A 5M4FA 3KCKA 5DFPA 3V01A 2YITA 1PMEA 1I09A 3PXRA 2PSQA 4D2VA 4DT9A 4CKRA 3TZ7A 2BRBA 4FYOA 4GT3A 4EBWA 5CEPA 4CZUA 5KCVA 3OG7A 2XANA 3LFCA 1KV1A 4F4PA 2XBJA 4I22A 4CMOA 2W1FA 2H6DA 1F5QA 3Q9WA 3QKLA 2YFXA 4FTJA 2Q83A 2IF8A 3G90X 4R7HA 4XP2A 4ZZNA 3BV3A 2HCKA 5JGDA 4M15A 3NYVA 4GH2A 3OCGA 3GCQA 3PSBA 4ASDA 4JG7A 5CQWA 4BC6A 2WQNA 1JSVA 1O6KA 2ZV7A 3ZBFA 4AT4A 2P2IA 3Q04A 3VUMA 1P4FA 3QAME 4CZTA 1WBPA 2B52A 1OIYA 2JFMA 2X2MA 3GUBA 2OH0E 3QHRA 4FK3A 4BCFA 3U6HA 4NM0A 4TYHA 1MRYA 4I1ZA 1TVOA 5KMMA 3Q2JA 5ETAA 4DFZE 4R1VA 5ICPA 3L9NA 2W7XA 3DJ7A 3CP9A 4EHGA 5DR6A 4UWCA 3ENMA 4YTHA 2Y6MA 3OT8A 4W8DA 3E7VA 4QMMA 3QXPA 4E4NA 2XRUA 3EQDA 3BYUA 1VEBA 4MNEA 4P5QA 1FVRA 4TYEA 5IPJA 3HNGA 3Q9XA 1V0BA 4FVRA 3BYMA 3HYHA 4KIQA 3E93A 4AGWA 2HWOA 3FPQA 4NT4A 3ODZX 4AWIA 4BIBA 4KKEA 3S0OA 4OTHA 4DG2E 3GEQA 4J7BA 3QRTA 5BQ0A 3F5GA 5HVKA 4GL9A 4BR3A 3KKVA 1P4OA 1TQMA 4ZIMA 3VS4A 2SRCA 3Q5ZA 1VYZA 3SX9A 3LMHA 1P14A 3OF0A 5DBXA 2NYAA 4YGAA 3R30A 3IW7A 3CD8A 3HA6A 4Q9SA 2QQ7A 3KRRA 3LFEA 4I23A 4ANNA 3FZOA 1G8AA 1NW1A 3U4WA 3RAKA 2IG7A 1Q97A 4DEGA 2ETMA 4YZCA 5J9YA 4MD8E 4QOXA 1GZ8A 2BAJA 2OI4X 1OL7A 1TQIA 5HIEA 1U59A 3OXZA 4WNPA 3QD0A 4EZ5A 4DFXE 4RLLA 2CKOA 3ROCA 1W2CA 3JXWA 5HE0A 4YMJA 5TF9A 3WE4A 3EJ1A 4X3FA 3LFDA 4JX7A 5CU2A 4I6QA 5AM7A 5AUXA 4DN5A 1H0VA 2QOQA 4H1JA 5HG5A 3S1HA 4OTGA 4UZHA 3HGKA 4OT6A 4RJ6A 5CVHA 4R77A 5BVOA 4BRXA 4KRCA 4F9YA 3DQWA 4C4EA 5H8GA 4RIYB 2VTRA 3D7TA 2GS7A 3V3VA 5CXZA 3HV5A 5M4UA 5FTQA 3NW7A 4ZJIA 4RX9A 3ZXTA 3SW7A 1T46A 4Y5QA 5LMKA 3W0RA 3UG2A 4QQTA 2GNLA 4I0TA 4L44A 4GVJA 2VTJA 4HGSA 2WU7A 3FZSA 4I5MA 4PY1A 4DTBA 1R1WA 1GIIA 2B1PA 2YM8A 4HCTA 5DVRA 4KRDA 2WAJA 3WARA 3GU4A 5AP2A 3QWKA 4JDKA 4YJVA 2CGUA 2QODA 5HO8A 3NMUF 2C6EA 4G5PA 2B9FA 1UNGA 5I3RA 4FGRA 2ZB1A 3ODYX 5KMIA 2RG5A 1OVEA 3FZRA 5HE2A 1R0PA 3QFVA 5D7AA 3N51A 4QMSA 3RZBA 3JUHA 2XIYA 5IUIA 3MPMA 3ZOSA 4ZTMA 1Q62A 2F7EE 5CZHA 3ALNA 5AR8A 4EKLA 2Z02A 1IG1A 2VWVA 4KINA 5HIDA 2JDRA 2XK7A 3C9WA 1G8KA 4MXZA 4E4LA 2BALA 2OIQA 2Z7QA 2ITNA 4CRLA 2XF0A 1PKGA 2C5VA 2ITWA 2R3RA 4ZSAA 5DMZA 3A7IA 3QTSA 5J1VA 1QL6A 2W0JA 2PUIA 2IN6A 3JY9A 3C0GA 4WNKA 4JLCA 2UV2A 2OF2A 3NNXA 3P4KA 5E1SA 3V51A 3BRBA 1R39A 1FGIA 2YDIA 3A2CA 4LYNA 4TNDA 4XG8A 4E5BA 4YTCA 2PVYA 4FTQA 1YDSE 2VTHA 3HP2A 1SM2A 4OAVB 3OWLA 1WBTA 2XK3A 4B8MA 2Z8CA 4L7FA 5G1XA 3V8TA 4IVDA 3PXZA 2CKPA 2G2FA 4FKOA 4ZAUA 4X2GA 4MAOA 3ELJA 2WMWA 3EQGA 3CJGA 2ITOA 4PMTA 2B7AA 3LE6A 1GOLA 4FG9A 3C5UA 3DTCA 5ETIA 5C8NA 4RIWA 4JQ7A 4ONAA 4R6VA 3BHVA 4OTDA 2XCHA 4WA9A 4OBOA 5HEZA 5KZIA 4BCHA 5BYYA 3DBCA 1Z9XA 4FTCA 1G8SA 3HRFA 4ID7A 3NIEA 5B7VA 3NFFB 1ZWSA 2JAVA 5HHWA 4RFZA 4DBNA 1WZYA 3RK5A 4UYNA 4D5HA 5BVWA 5J9LA 1K2PA 4IAZA 2YM6A 3FYKX 3W8LA 4AZEA 4JS8A 5AMNA 4GU9A 3WZKA 3P79A 2GU8A 4EZ3A 4LV5A 2HW6A 4O1PA 4GT5A 4HOKA 4Z7GA 4OLIA 4YJTA 4XG3A 3FLQA 3CKXA 1XH8A 2GNHA 2HENA 4H39A 3W2RA 4M68A 5HLPA 3C50A 4DINA 4CT1A 4ZP5A 5CI7A 3TUDA 5JQ8A 1KWPA 3UTOA 5E7RA 3KXZA 1H1QA 4JIAA 3IDBA 2QR8A 2P4IA 5K3YA 5LMBA 3FE3A 1Y57A 4AF3A 2IVUA 2IZRA 4AFEA 2BZKB 3W55A 2FH9A 5A6NA 4FOBA 3OBJA 2EUFB 3DKGA 1BX6A 2JITA 3AC1A 3OFMA 3CTQA 4GG5A 5FDXA 2X4FA 4DTKA 4BGQA 4O4DA 4X3FC 4Z9LA 3EFLA 4AW1A 1XO2B 4FKGA 3VS6A 3D2KA 3F61A 2BRGA 2PVNA 4FOCA 1PRYA 3OVVA 4ZTHA 5L3AA 3KMUA 3W2CA 3RM6A 5CT7A 3LCOA 5KKRB 4FEWA 3BX5A 3LMGA 2RIOA 2XIKA 2QOCA 1SVHA 2WMRA 3FXZA 2VTAA 5ANGA 4QMNA 2W1GA 4CV9A 3U9CA 4L42A 2LGCA 3IONA 3M42A 4L9IA 4FT3A 4K33A 3UPXA 1PHKA 4HW7A 4AUAA 2CN8A 2OXDA 2GNFA 3I5NA 3AT4A 1H00A 3JYAA 2IW8A 3R8MA 4EHEA 5LMKC 3G33A 3SGCA 4LMNA 4FV9A 4XLIA 2YIWA 3AT3A 3CXWA 2ZAZA 2RL5A 3D0EA 4Y5HA 5ANDA 3PVGA 4R3PA 3ZRKA 3AQVA 2WPAA 5EHYA 5CEOA 1XQZA 3QQLA 3VW8A 2VX3A 3BU5A 3ANRA 3TV4A 5CF8A 1JWHA 3F6XA 1YHWA 5GJDA 3P78A 1ZYJA 4PUZA 2PVKA 3ZO2A 5TR6A 3BLHA 5JT2A 5FEQA 3QLFA 1WCCA 2HY81 2XH5A 2GMXA 2A0CX 4DGOA 4IAIA 2PULA 4O86A 2X7GA 3QGYA 1Q8ZA 3R1YA 3SW4A 5I9WA 1JPAA 5C26A 4YZ9A 1GIHA 4YJRA 1L8TA 3A8XA 3C5IA 4XNEA 4BB4A 3Q3BA 4F65A 4FV2A 1B38A 1PMNA 3COKA 3ZC6A 4H36A 4RIYA 3TUCA 4ZEGA 3EN4A 2H8HA 3QZHA 4FKIA 4N6ZA 3QC9A 5LVNA 4PL3A 4ZLOA 3R02A 5HORA 1Q8UA 5HU3A 4JT3A 5ANKA 4KUJA 4CT2A 3UZRA 4L7SA 3UJGA 1OIUA 2GPHA 4FIFA 3R7YA 2C4GA 3HV4A 4GW8A 4QDEA 5DT4A 3SAYA 4MQ2A 5DPVA 2XA4A 2NRYA 4XV9A 3RKBA 4O7VA 1CTPE 3OC1A 1JBPE 3NUSA 3H10A 4MBJA 3BU3A 4OBPA 2XKFA 1K9AA 4Z7HA 5CAUA 5LJJA 5EHLA 2BDJA 2AC3A 2OJGA 1V0OA 2YM7A 4FTUA 4IC7A 2W1CA 1U5QA 2WTWA 3PDTA 1YXSA 2ITZA 4OTPA 1VZOA 4I21A 2OJJA 4I94A 3VF8A 2HELA 2HZIA 4NIFA 4QP2A 2VNWA 3TI1A 4PRJA 3ZYAA 4C7TA 3POZA 2Z7SA 4USFA 2EXEA 5J9ZA 3FZ1A 3KN6A 3VVHA 3W32A 5M56A 3MJ1A 3AXWA 2YIXA 3R9RA 5HD4A 2OG8A 4QP8A 4ANQA 1UKIA 4QQJA 5DWRA 3R7OA 4J8NA 4YURA 2I7QA 4Y85A 1UU7A 3RNYA 4BWXA 2I40A 3TNHA 3HVCA 4BDFA 5HBEA 3UQGA 2FSLX 1KE9A 3QYWA 3P7AA 4RJ5A 4BN1A 4C2VA 5A4EA 4FV6A 2ZFYA 4FE2A 4RA4A 2XNGA 2JIIA 3HV3A 4FT0A 4KNBA 3BLQA 1CKIA 3IS5A 3HMOA 4F64A 4LUEA 5IZFA 3DKOA 3LIJA 2FYSA 1ST0A 4M8TA 4A7CA 5IQGA 2WMBA 2YA9A 4PNIA 4GUEA 3MB6A 4FZ6A 2XYNA 3PLAE 4UMQA 5DG5A 4MK0A 2H34A 4LOOA 2VWZA 4AGUA 4A06A 2R0UA 3OHTA 3O51A 4QD6A 4C4JA 1LPUA 4CNHA 1H8FA 5CU0A 2R9SA 3HMIA 3MS9A 1J7IA 1UU8A 3CKWA 3GCVA 4FTIA 1KOAA