4LRJA

Bacterial effector nleh1 kinase domain with amppnp and mg2+
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
163
structure length
160
Chain Sequence
RLSVPGNVIGKGGNAVVYEDAEDATKVLKMFTTSQSNEEVTSEVRCFNQYYGAGSAEKIYGNNGDIIGIRMDKINGESLLNISSLPAQAEHAIYDMFDRLEQKGILFVDTTETNVLYDRAKNEFNPIDISSYNVSWSESQIMQSYHGGKQDLISVVLSKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NleH defines a new family of bacterial effector kinases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Effector NleH1
total genus 51
structure length 160
sequence length 163
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4lrjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4lrjA01
1BYGA 1Q8TA 5DRBA 4EHVA 4FV7A 3TT0A 3U9CA 5L8KA 3FUPA 4MXAA 1OGUA 1TVOA 4K77A 4K8AA 4HPUE 1U46A 4MNEA 3NNWA 2GS6A 3WILA 2JIIA 4UZDA 5HD4A 4QMWA 4UXLA 3V5JA 4QTCA 4FICA 2UZTA 4N6YA 4EONA 2FSOX 1XH9A 3G6GA 4ZMEA 4RIXA 3FQSA 5C8MA 5AR7A 5KHWA 5ANDA 2FVDA 2B7AA 5CAUA 1P2AA 1UNHA 4O1PA 1OL7A 4DCAA 3G0FA 3WF7A 4AGWA 2KULA 2VWUA 2ZOQA 3NUYA 2JBOA 4KD1A 4HYIA 4BKYA 4DEBA 5BNJA 3IDPA 5KNJA 4FVRA 3L9MA 2P2HA 4BDBA 3LHJA 4BB4A 4OAVB 3OCSA 3DTCA 4BKZA 1GIJA 3C13A 2XS0A 3HEGA 2JEDA 3RINA 4PPCA 3ORKA 5EK7A 5LARA 3O7LB 4O2PA 5HE0A 3KL8A 5IMEA 2LGCA 4YHTA 2EB3A 4Z7HA 3QD3A 4JT3A 2BAJA 4D2RA 1Q4LA 3TM0A 2SRCA 1UVRA 3PUPA 3DB8A 3HV7A 3IG7A 3D2IA 1XBCA 2GHGA 4C4GA 3ANQA 4HVDA 5AAEA 3BQRA 3C50A 1WBNA 3VUTA 5HNBA 4QQJA 4FSQA 4ZJJA 4ORKA 3A4PA 2JC6A 4YLKA 5DT4A 5EM6A 4O0TA 3EQFA 2ITXA 3ZBFA 3LXLA 1J91A 4YO6A 4ZLYA 4ZEGA 4CG8A 2VWIA 2BHEA 2P0CA 1NA7A 3LVPA 4M7IA 5E8UA 3RK5A 5CEKA 3PLAE 3GI3A 3ZH8A 3MIAA 5IA5A 5F9EA 4IC7A 1BUHA 4G3FA 3I7BA 1MRUA 5B0XA 5E9EA 4KKHA 4ZOGA 3UMXA 2XCHA 5CSVA 2NRUA 4L68A 3EFJA 5H2UA 4J99A 3I60A 2EXEA 3HZTA 4C4FA 1QPJA 4FKOA 1Q8ZA 4BI1A 3GCUA 5KMKA 2C3IB 4M0ZA 5JFXA 2PMLX 3QQKA 4RJ5A 1Q3WA 4ZSLA 4DH5A 4D5HA 3PP1A 4PMPA 5EI2A 3EYHA 1IG1A 2WXVA 2OICA 4L3JA 3VS5A 4EHEA 5IEYA 4Z9LA 2VTSA 5G6VA 3VS2A 3C0IA 2CKQA 4GCJA 2ETKA 5KMJA 4Q2AA 5CANA 3QZGA 3VS4A 4J95A 3FYJX 4UMPA 5IA1A 4AN9A 5JGBA 1E1VA 3TIZA 4JDIA 3P7AA 3U8WA 4G3CA 3ZFYA 4DFYA 4O0WA 5D12A 2BAQA 5FEEA 3K5VA 2HZNA 4F1OA 2W4OA 4BDEA 1AQ1A 3HAMA 3IOPA 5FQDC 3CCNA 2BTRA 3QXPA 4RVLA 4ZSAA 5HX6A 5IH6A 3JYAA 1SYKA 4NTTA 5CVHA 3Q9ZA 3E7OA 3PWYA 2Y9QA 1WBVA 4G5PA 2UZBA 4QYYA 3BYOA 2OJJA 4G9CA 4V04A 4XMOA 4BDFA 2VNYA 2HK5A 4U7ZA 2YA9A 4ENXA 5M56A 3EN6A 5HCXA 2HXQA 4U0IA 1DS5A 1UU7A 2X7GA 3LJ2A 3C5IA 4OTHA 4L53A 4JNWA 2UVZA 4H1MA 4GS6A 3MTLA 5ACKA 2F49A 3NUXA 5L4QA 2QO9A 2ZB0A 3LKMA 2BRGA 3QQJA 2VTTA 3FI3A 4TWOA 3FLSA 4IVAA 3OY1A 4RX8A 3WZEA 4F0FA 4ZSGA 2X81A 4M68A 5IG1A 3UVRA 4RJ3A 5IA2A 1K2PA 2C6IA 4K33A 2PVJA 1Y8GA 5FXRA 3EH9A 4ZLOA 3DJ6A 3SVVA 5CEOA 3WZUA 3LIJA 2JKQA 5BVFA 1IA9A 4CGAA 2OH0E 1Q5KA 3R2BA 4DH1A 3I0QA 4E4LA 4E93A 4PDSA 4DFUA 3R02A 1KOAA 2YCSA 3NWWA 3QD2B 3AT2A 2R3FA 3HMIA 4FSMA 5J95A 4IWPA 3RK7A 2BZIB 5GZAA 1WBSA 4O7RA 5CAPA 3QZHA 4YNEA 5CU6A 2XM9A 1R0EA 1PXLA 5GIOE 2GPHA 5DT3A 4BDJA 4KIKA 4LOQA 4GT3A 4BFMA 4BCOA 5JEBA 4IW0A 2FSTX 3W10A 3NIZA 2XBAA 1PJKA 5HLPA 5CSXA 3F5PA 3LOKA 3OZ6A 4KKEA 2XEYA 4WG4A 4NT4A 4QTDA 1G8AA 3DZQA 4Q9SA 2R64A 3UNZA 4WRGA 3PY0A 1OKVA 4DT9A 4FL3A 5AP7A 2JAVA 1GAGA 3ALOA 2UW8A 3IPHA 2WD1A 4O82A 2ITWA 4MXZA 2Y7JA 2R7BA 4GFMA 4X3FC 4P2KA 3I1AA 3OCGA 3HGKA 3ROYA 4AA0A 4JOAA 3VAPA 4AP7A 4U6RA 4CT2A 4ZTHA 4HVGA 2RIOA 4DGLC 4D5KA 2F57A 3U87A 3KKVA 2CJMA 5BYZA 4WNOA 5IKWA 4BI0A 1JOWB 3LM5A 4GK4A 4F0GA 2XEZA 4IANA 3A61A 3CY3A 3Q9WA 5IQBA 4FODA 4B9DA 1OZ1A 2RG5A 1A9UA 2OKRA 4JIKA 3A7GA 3H0ZA 3SOCA 1HCKA 4KSPA 5CAVA 1YI4A 5HZNA 5L2TA 2BKKA 2GQSA 3FMMA 4UWYA 5AR8A 4DN5A 3NS9A 4O6EA 2JDRA 1Q8YA 2B9HA 4RIYA 4Z55A 3MBLA 4UEUA 4RVTA 1U5QA 2QOCA 1CDKA 3UNKA 3NLBA 1PMNA 3PVUA 3C1XA 3CPCA 3V5PA 4BCMA 5HI2A 4RX5A 3EKKA 5L2QA 3KEXA 1YWRA 4FL2A 3R8VA 4GKHA 5D41A 4BCJA 3MPTA 3KMUA 3FL5A 5DWRA 4ARKA 4I5HA 4BBMA 5M06A 3MVJA 3R9DA 3BGZA 1VYWA 3C0GA 2GNIA 4IVCA 1Q61A 3C4CA 2XA4A 4FMQA 3DK3A 3OCBA 4MQ2A 4O0UA 5AV2A 2VX3A 4FKLA 4CLIA 3PJCA 2AYPA 4LUEA 3T9IA 3IKAA 5BVDA 1XH7A 4OGRA 4S30A 4NJDA 5HU3A 5IH5A 1XH8A 4CZTA 4M3QA 3FMKA 5A9UA 3Q4ZA 5KMLA 4U42A 2GFCA 4MF0A 3O17A 3ORNA 1VYZA 4BDDA 3EJ1A 1WBPA 5L6OA 3ZO4A 4YURA 3HDMA 3O7LD 3TNWA 2VX1A 4RC3A 2BALA 3R73A 4TWNA 4Y5HA 4UMRA 5KZ0A 4XRLA 5GIPE 3RKBA 2O8YA 3OEFX 4M67A 5IQCA 2CCHA 4EC9A 1KE6A 2Y6OA 2WELA 3GCSA 3F3ZA 3NUPA 4IX3A 4BKJA 4HVHA 3BU5A 4O84A 4YJOA 3MA3A 5IF1A 3HVCA 2YDIA 3ORTA 5LVLA 3S00A 3LCKA 2IWIA 3AG9A 3VRYA 4BCGA 4CFUA 4CCUA 4A4XA 2XNNA 2IVTA 3NGAA 3PZHA 1XQZA 2W05A 3FKOA 3UODA 3NAXA 4IEBA 1OL1A 3MB6A 5E8XA 2NRYA 3QYZA 2RF9A 3ZUTA 5A14A 3F3UA 2ZV7A 1BI7A 4RLLA 1MRYA 2HENA 1H1PA 2XKCA 3LXNA 4DYMA 2X8IA 3SA0A 4NWMA 2PULA 3PE1A 1M17A 1O6YA 4XX9A 4CCBA 2X8DA 1UWHA 4M66A 4LM5A 4M14A 5HEZA 4X2KA 3BHTA 1SZMA 4PQNA 4RLKA 1M7NA 1GZKA 1YXXA 3Q9XA 3GNIB 1TQMA 4ZY4A 4AXAA 4RIXB 2ZVAA 1PXKA 3R63A 3IW5A 3UP2A 2YITA 5AUZA 4JXFA 3NVKI 3KULB 3PSDA 2X4FA 3MTFA 1H28A 3BLHA 4R78A 2OZAA 2RSVA 5FXSA 4EH8A 3QKKA 1JQHA 4L52A 4RSSA 5AA8A 2OH4A 4WIHA 1S9JA 3D83A 5D7AA 4MD7E 4BWXA 2PZYA 1B39A 3WARA 2CNVA 1H1SA 3BE2A 3CIKA 3MVLA 2X2KA 2XYNA 3KMMA 2UZWE 5C8KA 2OF4A 2ITVA 2QOBA 5FWKK 2PMOX 2QKRA 4IAKA 4S2ZA 5ANKA 3MFTA 4IDTA 5HQ0A 4D2PA 4EOOA 5I4NA 4G31A 3SG9A 2JKKA 4F7SA 4UN0C 5AAGA 3ZC5A 1BLXA 2ITUA 3GCQA 3SC1A 2ZMDA 4W4VA 2XIXA 4BYJA 4EQUA 2CGUA 2WHBA 5AR2A 4FKPA 3LFNA 4UX9A 4CTBA 4O96A 3HECA 4AW2A 3U4WA 3VUHA 4H58A 2P2IA 3ORIA 4TWCA 2OXYA 4QYFA 3OS3A 4BVUA 2W0JA 3UJGA 4FA2A 2WMVA 1OBDA 5C03A 5AUUA 3UO5A 4KA3A 3ORZA 4HGEA 2UZLA 4Y5QA 5ACBC 4QMMA 3KN6A 3UBDA 1J3HA 4EK6A 5J7HA 3NCZA 3Q4CA 2RKUA 1NVSA 2W1HA 3RI1A 3AQVA 3C4WA 4I41A 5K9IA 3HLLA 4I22A 4RX9A 3WZJA 2OZOA 2VO6A 3FQHA 2GNLA 5HVJA 4B0GA 1K9AA 2RFSA 4E5AX 2OJGA 3I7CA 2X39A 2OLCA 4N57A 2OU7A 3VHKA 3IW8A 3ODYX 3B2TA 3W2RA 3D5WA 4YSJA 5AP3A 1ZOGA 3L9LA 5EH0A 4EH2A 4FNYA 4L3PA 3RM6A 3DK7A 3PVWA 4X3FB 3QUPA 3OC1A 5AUVA 4QQTA 2FA2A 5ICPA 4FC0A 3R8MA 3LFBA 3UG2A 3DOGA 4G5JA 4IAAA 3OEZA 1NXKA 1XO2B 2BVAA 2Q0NA 2CMWA 4FIGA 3MY0A 4K2RA 2R3KA 2UUEA 4I24A 2FB8A 2R3RA 4WSYA 4EHGA 4ZY6A 5JH6A 3DLZA 3F61A 4PMSA 3ZEPA 2C1AA 4GH2A 4NIFB 4YNOA 2VRXA 4GJ2A 4L44A 5E8YA 2CKPA 4G3EA 3MGYA 4GV1A 5DPVA 2PSQA 2GSFA 4LV8A 5E90A 5IUGA 3GQIA 2QOFA 2BRNA 5A6NA 1ZXEA 2BKZA 4YZBA 4ANBA 1ZY4A 4ZSEA 3DV3A 4FV8A 5AP0A 2Z7LA 4W4WA 5J1VA 2WIHA 4LOOA 5I9YA 3IW6A 3EIDA 3FC1X 4B8LA 4J96A 4CLJA 4O22A 4YJSA 4MBLA 4ZZNA 5IUHA 4YR8A 1PMUA 4E1ZA 3ZZEA 3FSKA 3KXMA 5LWMA 4RMZA 4M69B 4JBVA 2ZV2A 2VO3A 5HCZA 4ACHA 4RFZA 4LMUA 3BPRA 4BDKA 2H34A 3ZLWA 4TYEA 3LAUA 2WQBA 2BPMA 3GCVA 3R30A 5DA3A 2Z02A 2WMUA 2J50A 3QQGA 4NJ3A 4RWKA 5CVGA 4KB8A 4B7TA 3CSVA 4HPTE 1XH6A 4K9YA 4CTCA 5C9CA 3ZEWA 4DGMA 3QLGA 4R3RA 3F9NA 3NAYA 4I4FA 4GG5A 1YXVA 4P7EA 3LZBA 5HKMA 2XJ2A 4X2NA 2Z2WA 2BFYA 1DM2A 4IB0A 3BX5A 4O0XA 3N4VA 5EOBA 3U51A 4LGGA 2EU9A 3HP2A 3EL7A 5DYJA 4QPMA 4JQEA 5EYDA 4AW1A 1R78A 2ZDTA 2CDZA 3P9JA 3R1QA 5E7RA 3EOCA 1LP4A 2IVVA 2OW3A 3QLFA 3MJ1A 5H9BA 3VF8A 4FV9A 2R2PA 5FRIA 2YLFA 4AZVA 1LEWA 3CJGA 2VU3A 3UO6A 4MD9E 3HMMA 3R7IA 3MH3A 4UMUA 5I9XA 5BVNA 5IUIA 4DITA 3F7WA 3C7QA 4FIIA 1IRKA 3N9XA 3DGKA 2HZ4A 1TQPA 3DB6A 4FZ7A 4M15A 4O7YA 4UY9A 3QRJA 2UZOA 3QUEA 4BCHA 3D5XA 2YERA 3EKNA 5DEWA 3H10A 4HGSA 4WBBB 5AUXA 4RG0A 3RBWA 2BCJA 3Q6UA 4QP9A 3ZRKA 4YTFA 2WMXA 4NKSA 4BIEA 1B6CB 4MWHA 5L8JA 2YAKA 4BBEA 3ANRA 3FZSA 3MPMA 2VNWA 4NFNA 4XNEA 4G17A 3OROA 2ITZA 3FXZA 3UP7A 1U54A 4GMYA 4B99A 4LQMA 4ZAUA 4ZTLA 4EYMA 1U59A 4DFXE 4YUQA 3DU8A 5CX9A 4DA5A 2R0UA 4R1YA 3ORXA 3DA6A 3LCDA 1YOJA 5CF8A 3R01A 5IQFA 2IZUA 3DBQA 3S3IA 3DBFA 4FKSA 4H3QA 3U55A 4IZYA 2ZB1A 3Q2JA 3FZTA 1W98A 3GC8A 3HV4A 4IACA 3AD6A 3E62A 4WBOA 3LFCA 5EHOA 2BR1A 4F9CA 2I0VA 2QG7A 1H00A 3ZHPC 4WNMA 1H1RA 4TPTA 4BZOA 3DT1A 3F69A 2PUNA 3AC1A 4EORA 4F7JA 4WT6A 1H1QA 4BTFA 3EQPA 3ORLA 5EYCA 4D2VA 4BI2A 3WF6A 1UU3A 4RFMA 4AX8A 3NW5A 1ZYDA 4JQ8A 2C6EA 5KUPA 4I0RA 1ZYCA 4II5A 4GYIA 4W8DA 1JNKA 5KKRC 5DR6A 4NYEA 4ANMA 1PXOA 1PXPA 2YJRA 3DXNA 1PXMA 3ZCLA 2WQMA 1Q99A 5AUYA 3TIYA 4YTCA 2PVHA 4XBUA 2IZSA 3BYMA 4JDJA 3PG1A 1LEZA 3IW7A 3DBCA 3LFAA 3WOWA 3E7VA 3R9HA 4AU8A 3GOPA 3ZM4A 3EQIA 3W8LA 1KOBA 3PJ2A 5J8IA 4RC4A 3BI6A 3FPMA 3CY2A 2BTSA 3I79A 3QTXA 5T3QA 4I1ZA 2CGVA 1FPUA 2C3KA 3ORPA 4ASXA 1ZY5A 4UBAA 3NW7A 4BRXA 1W84A 1L3RE 2YZAA 4JG8A 5CNNA 5BVEA 4QTEA 2XF0A 4FEUA 4AFJA 1Q8WA 2WTJA 4HJOA 2H96A 4G6NA 4FKGA 4RIWA 1M2RA 4WUNA 4O86A 5IISA 5JSMA 2Y8OA 2VD5A 3EN9A 1ZLTA 1H27A 2O0UA 2XIZA 3MFRA 4LUDA 4Y95A 5H8EA 2YZLA 2F2UA 1ZYSA 4OBQA 4C4IA 4AT4A 4E4MA 3OVVA 3PJ3A 3CBLA 3EHAA 3UIMA 3V6SA 4MTAA 1FGIA 1GZOA 1YI3A 2OXDA 3FPQA 2YCQA 2YM3A 2QHNA 4EKLA 3ZDIA 3FLWA 2XMYA 4I6BA 2X9FA 5CU2A 4LGDA 3P4KA 3PG3A 3ITZA 4I21A 5IH4A 4DG0E 4ZP5A 4EH3A 3AOXA 5CNOA 5HBEA 3A7FA 2V7AA 4KIQA 5DIAA 3BU3A 1O6KA 3RGFA 3RNYA 1KE5A 4ACGA 4KIKB 4YP8A 1IAHA 3GEQA 5K3YA 2XJ0A 4MX9A 4ANQA 4M97A 3SXSA 2QNJA 2WMSA 5DR2A 4A06A 3GXLA 3CQEA 4PTGA 2C6MA 3EFKA 3HUCA 3EQBA 2GTNA 3VUIA 5HLWA 4BR3A 4R8QA 3FL4A 4FV6A 2GMXA 4HZRA 4KBAA 4N70A 3QCQA 3V8TA 1FOTA 4NH1A 1OPJA 5KKRB 1CKJA 1OKZA 3DAKA 4FEQA 2YM8A 2VTHA 4DEAA 5KMNA 3CKWA 2FH9A 4CYJA 4LG4A 4GL9A 3TDVA 5JQ8A 2UW4A 3Q60A 1V1KA 3KXGA 5AR4A 3BWFA 5BVKA 4U41A 2PY3A 5I9UA 3DZOA 4UALA 1OIRA 3KRLA 4ASEA 4C38A 1NVRA 2R3QA 2F4JA 4C37A 4CKRA 5JMSA 1KE8A 4Q9ZA 4V05A 3FI8A 3NSZA 5F95A 2YWPA 4H3BA 4EOKA 1GJOA 1UKIA 2GU8A 3IO7A 3ZO3A 5ITAA 4FIHA 4Z7GA 2V55A 5KO1A 4DLJA 4F64A 3KCFA 3DBEA 3DFCB 4NEUA 4DTBA 3HA8A 4YTHA 5A54A 3HV6A 1M2PA 2B9JA 2WMTA 2RFNA 2JDVA 3QU0A 3SG8A 3GT8A 3R7EA 1QCFA 3C51A 4QMYA 3V5QA 4TYHA 4FEXA 3QQUA 2EUFB 4KABA 3A7JA 4M84A 5FLFA 3FV8A 3LFQA 1OM1A 1KWPA 4FTLA 5KCVA 4BGQA 4J8MA 4HCTA 5HU9A 4U5JA 4FTAA 3UZRA 5M55A 5K5XA 3GOKA 4E20A 1U5RA 2WMWA 2J2IB 3R1YA 4PWNA 2DYLA 5IEVA 2Y4IB 3Q52A 1MUOA 2QVSE 5HHWA 4CXAA 2JKOA 4AWIA 4F7LA 5CZIA 3SV0A 2OZAB 4G1WA 2YIXA 2O64A 1H01A 1H4LA 5M4FA 3AXWA 3PPZA 4KBKA 4WD5A 4GFOA 3RHKA 3VRZA 3LQ3A 4AZTA 3DCVA 5E8VA 3G15A 3G2FA 4RIWB 5M07A 4FTNA 2YM6A 3EQGA 4TYJA 4EZ3A 5IPJA 3ZXTA 3G33A 3TDWA 5C26A 5M4IA 5ANIA 3FZRA 2HY81 2WAJA 2WTIA 4G9RA 4I4EA 4NIFA 1E1XA 2VAGA 5F94A 4C02A 2JKMA 3CTQA 3W2SA 4AE6A 3LJ1A 4AN3A 5DEYA 4BZNA 4HNFA 3W32A 3WIGA 3BHHA 2GHMA 2R3GA 5EYMA 3RPVA 4G3DA 5CTPA 4QYGA 2VTMA 2UV2A 4KIPA 3CS9A 1QL6A 3GU7A 2WPAA 4QPSA 2HWOA 4FGBA 1J1CA 2J5FA 4M12A 4OR5A 4C62A 3FSFA 4XEYA 4UZHA 4RJ4A 3PXRA 4YSMA 3MDYA 3PTGA 5E1EA 3CKXA 3VN9A 3G9NA 3WZKA 2ETMA 4FZAB 5A4LA 4EK8A 5CU4A 3UC4A 2EXMA 4MNFA 5E8WA 3C4ZA 3W2PA 4JQ7A 2BILB 2O65A 2JDTA 4M69A 1RW8A 2PVMA 3FYKX 3G90X 3H0YA 2W06A 1PYXA 3HV3A 3KU2A 4FKVA 2OG8A 1X8BA 3O8PA 3TWJA 4IX6A 3C4XA 4IXPA 2LAVA 4GT5A 4ITJA 4U97A 2FUMA 1PRYA 1OI9A 1GIHA 3O51A 3OT3A 4RWJA 4JDHA 4CKJA 1F5QA 3HMOA 4IMYA 4F9AA 3DJ5A 2PZPA 3H3CA 3K5UA 3PXFA 4UWCA 5CZHA 3VBYA 2GNJA 2YJSA 2ACXA 4RWIA 4UV0A 4MXYA 1NT2A 1Z57A 3NYNA 4FX3A 3V5LA 1STCE 3PSBA 1JPAA 3F5XA 3MY5A 2R9SA 2PVYA 3IGGA 3OY3A 4N4SA 4EH9A 4IB3A 4IX5A 4CFVA 2IO6A 1FVTA 3NNXA 4C3PA 5IA3A 5M53A 5D9HA 3FY2A 5CU0A 3QGWA 2J6MA 2ETRA 2XK6A 3M1SA 3ZFXA 4GU9A 3U6IA 3D7ZA 5AP6A 1H24A 4JI9A 2ITYA 4FTJA 4CMUA 4EK4A 1P4FA 2VN9A 4BCIA 4AFEA 1WAKA 2G01A 4JJRA 3L1SA 4D1SA 3S1HA 2W9ZB 2C6LA 4AOTA 4CFXA 1CMKE 3ZLYA 4R5YA 4XP2A 5C4LA 4BICA 3A4OX 1H25A 1RDQE 2FO0A 2PUUA 4KINA 4RVKA 3UTOA 4IBMA 4AOJA 3ETAA 5BVOA 4BBFA 3W33A 3CTHA 3QX2A 3OF0A 1NVQA 3HNGA 4HZSA 2E9OA 4LL5A 3O96A 1IR3A 4QRCA 2P3GX 3Q5IA 4TNDA 4L6QA 4W9WA 4CFMA 2WTKC 4IVBA 4QNYA 3V5WA 3QBNA 4D9UA 5IDPA 5CT0A 3GCPA 1G5SA 4KS8A 3RZFA 2PK9A 3VBQA 5LMBA 4PDYA 4D55A 5JZJA 2HW7A 2WO6A 1XHAA 3FKLA 4FT9A 3ODZX 1YW2A 4O7NA 2C3JA 2X2MA 4ZS4A 4XOYA 2OSCA 3R22A 5CAQA 2J51A 4OUCA 4HYHA 4ACCA 2C5YA 3R9OA 4RC2A 2BFXA 3GUBA 4GW8A 3COMA 3COKA 1JKKA 2UW5A 5HTIA 4XG2A 2GQGA 3QTIA 3OW4A 3P08A 4R7HA 3AC2A 2V0DA 5FBOA 3CTJA 2IN6A 3QUDA 5T68A 3E8DA 3LFSA 3Q6WA 4NSTA 3K3JA 4X21A 5ETAA 1R0PA 3KXHA 3UO4A 5KHXA 2C5NA 5GINE 2WTCA 5HCYA 4DFNA 4BTJA 3ZO2A 4D4YA 4DHFA 3LMIA 4U79A 3IK3A 1ZAOA 4CQEA 4EBVA 3CXWA 4G6LA 3R8UA 4QMVA 4U40A 2HIWA 2G2IA 5GNKA 5HO7A 5L8LA 3NYOA 4X3FA 2YDKA 3AMYA 4S32A 2WOUA 3IDBA 4FT5A 5HNIX 4G3GA 4C2WA 4FSTA 5IDNA 1YHVA 2RFEA 1A48A 5ETIA 2VTNA 3RALA 2IPXA 2CPKE 1S9IA 3HMNA 3CQUA 3WE4A 1WZYA 3R6XA 2QOIA 3GGFA 5E1SA 5FBNC 2W99B 3FI2A 3QA8A 3E3BX 2HOGA 2YN8A 3HV5A 2E9VA 4FTOA 2X6DA 4DC2A 5B2LA 4AT5A 4O21A 4ZJIA 3VJOA 2XB7A 3SRVA 1V0OA 5KMOA 3MWUA 4CV8A 2HCKA 5CY3A 4FIJA 4E4NA 3M2WA 4UMQA 4L42A 2CCIA 2WEVA 2WZJA 3CQWA 3L8XA 4XV1A 4FZFB 5AP4A 3F88A 4CEGA 4C7TA 4E5WA 2V22A 1KV2A 2WB8A 3BBWA 5F20A 5GJDA 2IG7A 5DBXA 3FLQA 3GC9A 3QRUA 3F3WA 1KE9A 4ACDA 1W0XC 1YDTE 4FVQA 4LGHA 4HGTA 3HMPA 3E88A 3ZONA 5CF5A 4FKWA 2VTOA 2QOLA 4DFBA 2X4ZA 2JIVA 4H36A 4NW6A 2CN5A 3PXYA 4QMOA 2XIYA 4PTEA 4D2SA 2IVUA 4IC8A 2BHHA 3EZRA 5I9WA 3KB7A 4FKUA 4KNBA 3RWPA 4CKIA 2JITA 3TV6A 4IM2A 2IZTA 3VS7A 4D4VA 5CYIA 4F63A 3R7VA 4S31A 2C30A 2Z7SA 3HDNA 3BV2A 4U9AA 4W9XA 4YPSA 1J7LA 5DRDA 5IQGA 4NZWB 4RVMA 4O7ZA 3SGCA 2O63A 4E26A 3FJQE 4P5QA 2WTDA 3KVXA 4QMTA 4CFNA 5JRSA 1H08A 4BIDA 2BAKA 3MVHA 5F4NA 3CGOA 4GFGA 2UW3A 2WMRA 4F7NA 3F2RA 3FBVA 3CJFA 1ND4A 1FMOE 3MA6A 5LMKA 3JXWA 1WCCA 3DDPA 4RJ6A 3LMGA 4USDA 2C0TA 3LLTA 4YLJA 1V0BA 4PNIA 4R3CA 2XK9A 3R2YA 5EDRA 4DE4A 2B55A 3AMBA 3EL8A 3VS0A 4HYSA 3ACKA 2OFUA 4FTKA 4MXCA 3MN3A 4PL4A 1JBPE 4EHZA 1YI6A 5FD2A 2BUJA 3OBJA 3POZA 3KREA 3IOKA 3CD8A 3QQFA 4RA4A 4HYUA 5DNRA 3W2CA 3TACA 2I1MA 3DS6A 1Q24A 2J0KA 3ZO1A 4I5PA 5EKNA 4IWDA 3AC4A 1UU9A 3FXXA 3EFLA 3O0GA 4H3PA 4GJ3A 1JAMA 2GFSA 3IECA 1URWA 4I93A 3D9VA 3TKIA 3QTUA 4A9RA 4F6UA 3WF9A 3G51A 3F2NA 3R00A 4I23A 4BGHA 4FSNA 3QWJA 4FK3A 5LVPA 2XCKA 2XRUA 4EJNA 4O81A 1UKHA 2ZV8A 4ASZA 4BIBA 3QWKA 5AIKA 4I5MA 3WE8A 4EI4A 1U54B 4YBJA 4CFFA 4YC8A 2XKFA 2CN8A 4OT5A 4EH7A 3D5UA 3QXOA 5T6KA 3UGCA 2WFYA 1GOLA 3E92A 3P7CA 4WO5A 3ZRMA 4E7WA 2CLQA 2I40A 2PWLA 4ERWA 5CSPA 3K54A 3MS9A 5LCKA 2C5XA 1H07A 4YZDA 4CVAA 2F2CB 3VC4A 4M0YA 1PKDA 3RZBA 4D4RA 3KVWA 4O0VA 4PMMA 3ATTA 2HZ0A 2W1FA 3LQ5A 4RIOA 3TZ7A 3RPYA 3QF9A 2YM5A 2UZVA 2GTMA 3DTWA 3GU4A 4FV0A 3RVGA 3U9NA 4AZFA 4U80A 4BZDA 3I5ZA 2OK1A 4QMUA 5I3RA 3QD4A 4K11A 4ALWA 4NL0A 4X2GA 3RAKA 3KRWA 5K0KA 4YLLA 1VJYA 2W5HA 1GNGA 2EXCX 3LMHA 5C27A 4L01A 4IZ7A 3CEKA 2OIDA 4L00A 1WBOA 4EUUA 2C1BA 1YQJA 2CNQA 5HX8A 3BGQA 2O3PA 2WGJA 3U4UA 3ZRLA 4BDAA 1MQBA 4IE9A 3QALE 4TY1A 1XBBA 2C6DA 1OVEA 4S33A 4D58A 4FE2A 4IM3A 1MQ4A 2R4BA 3QHRA 3COIA 2BMCA 2J5EA 4FTIA 4MNEB 2YEXA 3GC0A 2PVFA 4JRNA 2F7XE 4FIEA 1ZMVA 4IDVA 2GS2A 1OMWA 4AG8A 3BYUA 4M13A 5HO8A 1OITA 3EQRA 3OHTA 4IZAA 1OB3A 4WRSA 2YISA 3N4TA 1YVJA 3M42A 2EVAA 3FMDA 3BV3A 4I5CA 2ESMA 4IJPA 3VQUA 4JL9A 3GBZA 2UW9A 4CFWA 3Q3BA 2W1DA 4AW5A 3BQCA 4OTRA 5D11A 1OL6A 3UZPA 5ANGA 3ZYAA 3FXWA 3TUBA 4JX3A 3B2WA 3DY7A 3HRFA 5AX9A 5EQEA 2DS1A 4ONAA 4DTAA 2DWBA 2Y4PA 4BDCA 2JDOA 2X2LA 5I0BA 3QCSA 3PSCA 4OW8A 4GKIA 3PRFA 4ALUA 1G3NA 3Q96A 4JAJA 4MBJA 1FBNA 2XIRA 3QYWA 3NEWA 5JK3A 5EQYA 3BRBA 3MH2A 4TYHB 4XV9A 4GVAA 4BWKA 4EOLA 3O2MA 1DI9A 1PF8A 3KK9A 3E64A 4GUEA 4Q5HA 5AP1A 4RIYB 3ZSIA 4F1TA 5J1WA 5FM2A 2J0JA 4C57A 5AR3A 3N51A 4ACMA 3K2LA 3PLSA 3QC9A 3P23A 1P5EA 4D0XA 1YWVA 3PPKA 4L67A 2ONLC 4QOXA 4FIFA 4Z16A 5JGDA 2DUVA 1FVVA 3E8EA 4JBQA 4F99A 5LCJA 3OWKA 3PA5A 3BU6A 4A9TA 2B4SB 4EYJA 3II5A 2W5BA 3V3VA 5GZ8A 4P4CA 4IHPA 4Y73A 5HE3A 4OBPA 2W4JA 4RZWA 3VUGA 4DEHA 4G6OA 4X0MA 4BYIA 5IQEA 4D2TA 3LE6A 3VULA 3QTWA 2NO3A 3H9OA 1FINA 2P55A 3SXRA 5HG8A 3IONA 4ITIA 2P4IA 3TZ8A 4FTTA 5AV0A 4YZMA 2RFDA 3ZUUA 3FZPA 5JFVA 2PUPA 2W5AA 3ATSA 3UIXA 3TNIA 4FV1A 4BTKA 3P5KA 4C3RA 3AC8A 4YJQA 5CU3A 3SQQA 3MW1A 4O0RA 3BYSA 4QMSA 4E73A 3HKOA 4NU1A 4L9IA 3QTRA 4WUAA 5AADA 1BL7A 3CC6A 4CNHA 3BLRA 4X3JA 4GIHA 5C8NA 1SVEA 2R3JA 4FSRA 4MEDA 3ZU7A 3DDQA 4D1XA 5I9VA 2X9EA 4BN1A 2ERZE 3KGAA 3DAJA 5K5NA 3LXPA 5L6PA 2VZ6A 2X1NA 3ERKA 4IAZA 4JAIA 5DN3A 3W2QA 1UU8A 3V51A 3F82A 3DFAA 4JX7A 2W1ZA 1PW2A 3E8NA 2VO7A 4A4LA 4ZLZA 1XH5A 2B9IA 5IA0A 2QOHA 4NK9A 3QTSA 4FT3A 5CS6A 4XLVA 1Z9XA 2VWZA 3HUBA 3L9PA 4NCTC 3RPRA 5E8ZA 4PV0A 4ZXTA 5HGIA 5EOLA 3P86A 3FC2A 2J7TA 5FUTA 4CZYB 2YFXA 2XM8A 3AT3A 4V01A 3ZBXA 5JGAA 4EEVA 1OIQA 5HG5A 3MJ2A 1JKLA 2W1CA 2PL0A 3LM0A 2NP8A 3SLSA 3H30A 5CVFA 3KFAA 4EQMA 3EYGA 2RL5A 4FBXA 4AF3A 4YHJA 5J79A 3KK8A 4L46A 5D7VA 4FKRA 1M52A 2XKEA 5CI7A 5DMZA 3V01A 5AM6A 4YZ9A 3IGOA 5GJFA 3W16A 3LPBA 2BDFA 4YC6A 4PPBA 4YBKA 4NM3A 4LRKA 5FTOA 4XRJA 2C4GA 4AN2A 3U6HA 2UZNA 5AAFA 4D28A 4PDPA 5AM7A 2W17A 4CSVA 1KUTA 2R3HA 2PVRA 3DNEA 4YJUA 3MB7A 3Q04A 3ZXZA 3MYGA 3FMJA 2QU5A 2W7XA 4D1ZA 1XJDA 5CEQA 4YO4A 3W2OA 1ZOEA 3SKCA 1QMZA 4O7LA 1ZWSA 4QPAA 4HOKA 5AA9A 2BDJA 3EZVA 5DH3A 4FV5A 4EH6A 1WVWA 4FYOA 3DLSA 3REPA 2YIWA 3F5UA 4FSUA 3VBXA 1YOLA 2YABA 2XNBA 3SX9A 2A0CX 4OTGA 4TZRA 4GEOA 4TT7A 1OIUA 5K4IA 3LLAA 4BF2A 2WMBA 1V0PA 1ZRZA 3EB0A 5E92A 4G16A 2Z8CA 3BHYA 4EZ5A 3QAME 4GG7A 1XR1A 1I44A 5EI8A 4EOMA 5IU2A 3NUAA 2W4KA 3UIUA 4AT3A 1CTPE 3PY3A 3W55A 5AJQA 4FNXA 4AZSA 4CD0A 1IAJA 1URCA 1YXSA 5AP5A 2FYSA 3TNHA 4USEA 2VUWA 1O6LA 5CQWA 2OJ9A 4AOIA 4EK5A 3OXTA 3ELJA 5A4CA 4FKQA 4FUYA 2PMNX 5LMKC 1WMKA 4EH5A 3EMGA 2G2HA 3QZIA 1Q41A 2KTYA 5M4CA 4FTUA 3SDJA 5J5SA 3B8QA 4C33A 3AGLA 5LVMA 5CF4A 4FOBA 3GU6A 1YHWA 5DOSA 2PYWA 4AUAA 4IFGA 1FGKA 4PDOA 4QP8A 2QKWB 3KC3A 3VVHA 4E5BA 2A27A 2IZRA 2OJFE 2XJ1A 3COHA 3ALNA 4QT1A 3I5NA 3PXQA 4RA5A 3H9RA 2AC3A 4JG6A 4XV3A 3UE4A 5DG5A 4ANLA 4IM0A 4ANOA 5B2MA 3ZZWA 3RPSA 3OWJA 2ERKA 3CD3A 4H05A 3UPZA 3UQCA 5CF6A 3A99A 4GK3A 4BC6A 4L3LA 4C35A 5EW3A 2VWYA 4JLCA 4IWQA 2WKMA 5FDXA 4PNKA 4IIRA 1RQQA 3OW3A 3QHWA 4I0SA 3QRIA 5EI6A 3ZDUA 4C3FA 4CMTA 4EQCA 5KX8A 5L3AA 4E4XA 4ZMFA 1CKPA 2VTAA 5HTBA 4GIIA 1ZYLA 4ZZOA 3FZOA 4O38A 1OECA 5DHJA 4IAFA 4A4OA 1YDSE 3D15A 4QP2A 3HAVA 4FNWA 3T3UA 2YIYA 1RE8A 5CENA 3RJCA 4CT1A 2FSMX 3AD5A 2G1TA 3RPOA 3ZM9A 5HESA 3PDTA 3LJ0A 2F7ZE 1WFCA 3KA0A 4YJNA 5EDPA 1OL2A 5CALA 2IW6A 5BMMA 2PHKA 4A9UA 3ACJA 2OIBA 4J71A 2IW9A 2B0QA 2V62A 3NUSA 2B9FA 4RRVA 1VR2A 4ALVA 3PVGA 4EZ7A 3FHIA 4DFZE 5FG8A 2WMAA 3C5UA 4KAOA 1FVRA 2B53A 3QL8A 5GJGA 2C47A 5CEIA 4JRVA 2C6TA 4EL9A 3K3IA 2C69A 5JZNA 5E8TA 4XV2A 3FE3A 1LR4A 2JDSA 3Q4UA 4FT0A 3RP9A 4KS7A 4QMQA 2QOQA 3NW6A 2V5QA 4R3PA 4UXQA 4V0GA 5EW9A 4ZK5A 4E6DA 1NW1A 5TOZA 5EHLA 1W7HA 4FKTA 3ROCA 5DGZA 2I0EA 2VTIA 3LCSA 3BCEA 1DAWA 4XYFA 4KIOA 2QLQA 4S34A 4ZTSA 3R8LA 5LVOA 3TUCA 1E9HA 3R9NA 3OWPA 3ZS5A 2BDWA 1YXTA 4PMTA 1G8SA 3JY0A 2H6DA 2VWVA 4U44A 3H9FA 3UG1A 3L8PA 3QCYA 3EN4A 4LRMA 3WYXA 2QR7A 5BYLA 3OUKA 2Y6MA 1J1BA 4U8ZA 3BE9A 3R7OA 4DINA 4IWOA 3BLQA 4RJ8A 5A4QA 5C4KA 3GFWA 1F3MC 5AFVA 3G0EA 4FYNA 3SAYA 1BMKA 1REKA 2BZHB 2PE1A 5K4JA 1SMHA 3PJ8A 5HG7A 4MXOA 3DKCA 4J98A 2OO8X 2VO0A 2UVXA 3VUKA 3EN5A 3A62A 4PL3A 3SRVB 1T45A 3TJCA 5JKGA 3HA6A 5J9ZA 4C34A 4JVGA 1HOWA 3OTUA 4X2JA 4XUFA 4ZTRA 4JR3A 2E9UA 4ZTQA 3S0OA 1YRPA 3A2CA 3HRBA 2AC5A 2ONLA 4UYAA 4K0YA 4TTHB 2A4LA 1ERKA 3DNDA 5KE0A 2NNWB 3ZFMA 4AA4A 2OJIA 2ZMCA 2XZSA 5AX3A 3TCPA 4EOPA 2R3OA 2J9MA 1PY5A 3QFVA 3RTPA 2QURA 3RAWA 4F09A 4MKCA 3LFDA 4YJVA 4DGNA 3TKHA 4ZS0A 4A9YA 5CEMA 2VGPA 5TF9A 5I3OA 3SOAA 5M57A 3BIZA 1Y6BA 3RM7A 3UOHA 3QX4A 2PZRA 2JAMA 4HW7A 3WYYA 5A4EA 3WBLA 4U45A 2A2AA 5J9YA 4GRBA 4P5ZA 4PY1A 4DG3E 1IA8A 4DH3A 4PPAA 3QQHA 5AEPA 5BUIA 3GU8A 3S95A 4XG9A 4DEEA 4DT8A 4QO9A 4JBPA 3R71A 3QZFA 1KE7A 1WVYA 3NUNA 4FKIA 4H39A 4IB1A 5EYKA 5J87A 3OXIA 1QPEA 2XNGA 4RZVA 4XP0A 4YPDA 4C58A 2AUHA 2GDOA 4YTIA 4XH6A 3MPAA 3QTZA 3GENA 4MD8E 3R0TA 3VQHA 3DQXA 4E6CA 5IQDA 4C61A 3WF8A 4L43A 4TXCA 4ENYA 4NFMA 1R1WA 4RWLA 3B8RA 4OAUC 3UVPA 2ZM4A 1KSWA 2QODA 4XG8A 1TQIA 4FVPA 3V8SA 1Y57A 5LQFA 5J9LA 1Y91A 3BYVA 4IVDA 4D0WA 4ANSA 5AUWA 3ZLXA 4XLIA 3E5AA 4QP7A 4DTKA 3ZSHA 1NY3A 4QYEA 5LJJA 3R1NA 1UA2A 3KXZA 3NX8A 4FG7A 3R83A 3KF4A 1OKWA 3WZDA 4R7BA 3V04A 3EN7A 3BBTB 4EH4A 3H4JA 4U3ZA 4FI1A 2ZAZA 4EOIA 4KUJA 5FEQA 3MY1A 3UPXA 4YC3A 3A60A 4C0TA 2PVLA 4TKSA 4G2FA 4NKAA 4F6SA 3UOJA 4F9BA 5HOAA 1H8FA 2C5OA 4XHKB 4CYIA 4CG9A 1SNUA 4KRDA 4EK3A 2IJMA 4GVJA 3PIYA 4X6QC 5JQ5A 4X2FA 5C01A 3HRCA 2YIRA 4I20A 3JY9A 2REIA 3TNQB 4F65A 2QO7A 2Q0BA 1JSTA 3VW8A 1W8CA 2WMQA 3GP0A 4RQVA 4WNKA 4FUXA 3SW4A 4DEIA 2G15A 3DKGA 4OTQA 5EQPA 2YM7A 3NMUF 3O8TA 4B8MA 4PX6A 5DFPA 2YDJA 3C9WA 1JWHA 3GFEA 2GNGA 4AZEA 1KV1A 2HY0A 1CKIA 3FHRA 2VGOA 2VV9A 4WSQA 4ZSJA 4KKGA 1ZZ2A 3TJDA 5TKDA 3TEIA 1MRVA 1WVXA 3BHVA 1PXNA 4L8MA 4C8BA 2WTWA 4D4SA 3FMHA 4GYGA 4RJ7A 5FP6A 3QTQA 3UVQA 1H0WA 4WG3A 3ZSGA 4O7SA 3F2AA 1ZOHA 3AD4A 4ZJVA 3E63A 5M51A 3ZOSA 3NVMB 3F7ZA 4K18A 4ZIMA 3Q5ZA 5AV4A 4XJ0A 4K1BA 5A3XA 2J0LA 3POOA 3D0EA 2CKEA 3M11A 3C4FA 3O8UA 1JSUA 2Z7RA 4QMPA 5HIBA 3ULIA 3D2KA 4BWPA 2WEIA 3SXFA 1Y8YA 5GHVA 1VZOA 5AUTA 3PYYA 1U4DA 3F66A 2R3LA 5HE1A 3QA0A 5JN2A 3IQ7A 3TV4A 3JS2A 4IZ5A 4BTMA 4TN6A 5EW8A 5M09A 2O2UA 4FEWA 2YAAA 3ULZA 2J0MB 3R7GA 3DK6A 4PL5A 4L7FA 4LMNA 4EWHA 4DF3A 5LWNA 4DEDA 4Z3VA 4QP6A 2CKOA 3P78A 4OBOA 5H8BA 1M7QA 3FAAA 3GVUA 4EOQA 5KBQA 2OIQA 2PE0A 5L2IA 4HCVA 3KXNA 1H26A 5CLPA 2OBJA 3VS6A 5FGKA 4R5SA 5DE2A 2E9NA 3TZMA 4I6HA 4TYIA 3BKBA 4BCFA 3QCXA 4E6QA 1WBTA 3OP5A 5H8GA 3I6UA 2WQEA 3GU5A 4MWIA 2VTLA 5G1XA 2F7EE 2JBPA 3S2PA 3D94A 1JKTA 4QP3A 3LXKA 2XK7A 1PHKA 2JFMA 3CR0A 3P79A 4KSQA 5E91A 5FTQA 3SD0A 4QYHA 5LOHA 3NNVA 3PFQA 4BHZA 4I6FA 4YZNA 2XNOA 3CE3A 1W83A 4NM0A 4DAWA 2A19B 3GQLA 5FP5A 4NTSA 2R3MA 1OBGA 2OFVA 2QCSA 3Q4TA 4GSBA 3DAEA 3UMWA 4BCKA 4F9WA 2PUIA 2PU8A 4Y8DA 2CGWA 5HO6A 2H8HA 3JVSA 4APPA 3W18A 3VS1A 4IH8A 4JBOA 2QONA 2WU7A 3G6HA 2G2FA 3ET7A 3LW0A 3VBTA 2UVYA 4C36A 5HTCA 1GIIA 1JLUE 4TNBA 3RMFA 2P33A 4CV9A 4EOJA 4F4PA 3IW4A 3WI6A 3FKNA 3R28A 1H0VA 4LI5A 4LOPA 2GHLA 2XIKA 3MIYA 2C6OA 5D10A 5ANJA 2R7IA 4CRLA 3VS3A 3W1FA 4QMZA 3F3VA 4E6AA 5BUEA 5M4UA 2GNHA 1EH4A 3F5GA 3NZ0A 5LMAA 2XKDA 4IX4A 5D1JA 3FY0A 4DEGA 3RWQA 4TW9A 2ZJWA 2J4ZA 4O83A 5DI1A 3VHEA 1SVHA 2G9XA 1YOMA 2GNFA 2IVSA 2QOKA 2X0GA 2ZYBA 5CQUA 3VUDA 3OD6X 5HD7A 2H9VA 3VJNA 3ZTXA 2YACA 4AQCA 2C0OA 1B38A 5TR6A 3TL8A 4Y83A 2Z60A 4LRJA 2VTJA 1H1WA 2HELA 1GY3A 1IEPA 3PA3A 3EQCA 4NCTA 4OLIA 5ANEA 3THBA 3V8WA 2XRWA 2B1PA 5AIRA 4E3CA 3AT4A 3JUHA 4QTBA 5ETCA 2Z7QA 4WG5A 4PTCA 2PMIA 3EFWA 1SM2A 2VTRA 3LFEA 1OKYA 3D7TB 4LV5A 4MVFA 5M44A 3LCOA 4FF8A 4WKQA 4QMNA 3UYTA 3KN5A 4AGCA 3LQ8A 5KBRA 2WIPA 4WOVA 5AR5A 4DH8A 2QR8A 4FTMA 3AC5A 4UMTA 5AWMA 2QQ7A 3KRXA 3JR1A 2I7QA 4DBNA 1PKGA 4NM7A 3R21A 4BCPA 4EKKA 2BIYA 3FZ1A 4WNPA 4QP1A 2I0YA 4TYGA 3VF9A 3EQDA 2R3PA 5IEXA 4ANNA 4DLIA 3Q32A 2V7OA 2HWPA 1WBWA 1YWNA 4NM5A 3ZC6A 3KQ7A 1HCLA 2YLEA 5CT7A 1R39A 5HIDA 4U43A 2XH5A 5L6WL 2HZIA 3QRKA 1OIYA 4PUZA 3TTIA 3PPJA 4C4JA 3N4UA 4FSYA 1R3CA 4XP3A 5CXHA 2BRMA 4EBWA 4F70A 5BPYA 2BZJA 4Q5EA 1OUYA 3Q9YA 4AGUA 1YHSA 3FLZA 2X7OA 3GC7A 1BI8A 3C0HA 3BEGA 3TV7A 4BDHA 3C4EA 4CQGA 4R77A 3KCKA 3OUNB 2C3LA 3S4QA 4A9SA 1XWSA 3SHEA 5EKOA 5CEPA 2B54A 4DBXA 4IAYA 3OG7A 3TTJA 1AD5A 4O7WA 1OL5A 3E3PA 3TNPC 2XNEA 4RFYA 5HIEA 5LXMA 1Z5MA 3R7UA 4O1OA 4QNAA 1I09A 1GZ8A 4FZDB 5HBHA 3VIDA 3PZEA 3RAHA 3VWAA 4DCEA 3P7BA 4DG2E 3PXZA 2ZM3A 4FNZA 3OOGA 4ZZMA 3A7IA 3MH1A 4QMXA 4UB7A 3E8CA 2E9PA 4C59A 3OTVA 3CLYA 2VTPA 3VNTA 4D9TA 4HNIA 2UZDA 3AC3A 4OTPA 5B7VA 2R3NA 2C6KA 4YMJA 3HL7A 4FT7A 3OWLA 4OTWA 4XG3A 1XKKA 2BZKB 4YJTA 3MFSA 2RG6A 3KRRA 4FV2A 4MQ1A 4ERKA 3FQEA 1AGWA 4N6ZA 4AZWA 3UC3A 4V0GB 4AAAA 4RPVA 2UW0A 3A7HA 3TXOA 2GS7A 4J8NA 5JFSA 4NW5A 4EOSA 4FGRA 4MH7A 3FLYA 4OTDA 2W9FB 3E93A 4AS0A 4R7IA 2XYUA 3FWQA 5FM3A 1CSNA 3MVMA 3JVRA 1QPDA 3IDCA 4KWPA 5J7BA 1SVGA 2VX0A 3MFUA 3NIEA 4A07A 2O5KA 1SNXA 2J0IA 2UW7A 3UDBA 5I5ZA 5FDPA 3NDMA 4FKJA 1F0QA 4OTIA 2R3IA 2XNPA 4O2ZA 1FQ1B 1OPLA 4O0SA 2ZM1A 4O6LA 5J5TA 4I92A 3I6WA 4WHZA 3F6XA 4BY9E 5IA4A 4RBLA 3UIBA 4FG9A 1FMKA 2XUUA 3R8PA 5AP2A 1DAYA 5BMSA 4PRJA 2QLUA 1REJA 4CZUA 1YXUA 3PA4A 4OT6A 5HE2A 3PP0A 3DJ7A 2CHLA 3D7TA 2JGZA 4U81A 4Y46A 5CSHA 2GCDA 1PXJA 3FDNA 2JFLA 5EG3A 4LFIA 4N0SA 2CNUA 4MAOA 3O23A 3T9TA 2I0HA 1OUKA 2B52A 2A1AB 3MV5A 5TO8A 2YM4A 3FEGA 4FTQA 4FSZA 2JIUA 2XVDA 4KBCA 4RQKA 5CXZA 5E4HA 3MESA 2ZV9A 5F1ZA 4AA5A 3OT8A 4C4HA 2WNTA 4MBIA 3TZ9A 3FMNA 2PVKA 1GZNA 4FR4A 2WTVA 3RCDA 3ENMA 4L7SA 4NUSA 4XOZA 5EHYA 4JDKA 4TRLA 3RNIA 3QRTA 5E8SA 2QHMA 1QPCA 4JS8A 3QC4A 4FZ6A 3BWJA 4FTRA 4CRSA 3ZMMA 4QP4A 2RGPA 3R1SA 3QD0A 3O50A 3P1AA 4J52A 3ZUVA 1Q3DA 3RCJA 3NRMA 2XNMA 3L8SA 4O7VA 4IB5A 3FI4A 4RX7A 3EWHA 5AMNA 3VW6A 3VUMA 4EUTA 4ZTMA 3R9RA 2R0IA 4Y85A 2PVNA 5EM7A 3JPVA 3OMVA 5FXQA 3DKFA 4IJ9A 3T3VA 3UYSA 1XH4A 2CSNA 4IFCA 4X6RA 3VBVA 4I94A 1JSVA 2EB2A 3NYVA 1BX6A 4GUBA 1YKRA 3DBDA 4MYGA 4KRCA 4XG4A 4YZCA 1P4OA 3R8ZA 3RAIA 3BEAA 2HAKA 3HX4A 2QD9A 4BGGA 5DLSA 3WF5A 3TN8A 3P0MA 2XK4A 3PRIA 3V6RA 4X7QA 4O27B 3VBWA 3O71A 4W4YA 3MH0A 3LCTA 1LUFA 4FK6A 4DGGA 1UWJA 2PZIA 5HVKA 1JKSA 4IQ6A 4RT7A 2OWBA 3KMWA 4YHFA 2Q83A 1T46A 2PPQA 5BX0A 5I9ZA 4J97A 2W96B 3CPBA 3OFMA 2UW6A 1K3AA 4W4XA 5HNGA 1UNLA 3TKUA 1ZYJA 4AW0A 3TUDA 4B6LA 4LL0A 5IZFA 4YGAA 4FSWA 5KZIA 4XBRA 2WQOA 3WIKA 1ZMUA 4WA9A 1BL6A 2HXLA 1Q97A 2XBJA 5ETFA 3NYXA 5CAOA 2UZUE 4O0YA 4H1JA 4JG7A 4M8TA 2PE2A 5DT0A 4BL1A 1PXIA 3PWDA 4ASDA 3A8WA 2C68A 2VTQA 4PF4A 5CASA 2WOTA 2XK3A 5CSWA 5DVRA 5HICA 3QKLA 4QMLA 4QQCA 4IAIA 4U3YA 2CLXA 5HVYA 3UQGA 2W1EA 4J1RA 3EQHA 2QI8A 2OGVA 2YCRA 4O7TA 3PJ1A 2WQNA 3KRJA 1Y6AA 4G34A 4FOCA 4FEVA 5CI6A 5ANOA 2W1GA 5TT7A 3AMAA 3E87A 5AV1A 4DH7A 1L8TA 2X8EA 2VWBA 3D14A 1M14A 1YDRE 4HVIA 3MI9A 2BRBA 2ITQA 3I4BA 4APCA 3PY1A 3QKMA 2E2BA 1OPKA 2HYYA 3V5TA 4I0TA 3OBGA 4ITHA 3KF7A 2VWXA 3GB2A 5KMIA 3DKOA 4ZTNA 2BRHA 3OCTA 5FEDA 3VO3A 5LVNA 3D5VA 3PIXA 2OF2A 4YJPA 3RHXA 4F9YA 4ID7A 1Q62A 2J90A 2QU6A 5EDQA 3QQLA 5HLNA 1APME 1M2QA 1PMVA 2ZDUA 4BDGA 4AE9A 2NPQA 4UWBA 5IMXA 1UNGA 3OXZA 2X7FA 1XBAA 5KMMA 5K0XA 1RJBA 4JIAA 4XCUA 4XG6A 5HORA 5B2KA 4HVSA 2OXXA 3NCGA 2QG5A 3NR9A 3T8OA 4O91A 3G5DA 4XS2A 3PVBA 5IQAA 5HG9A 3KXXA 1VEBA 4BHNA 3MSSA 5JFWA 1BKXA 2YCFA 4E8AA 4HGLA 4UYNA 4CMOA 2JLDA 4FG8A 1PMEA 4RGJA 5L2SA 4OTFA 4IADA 3F3TA 1J7UA 2F9GA 2C5VA 1JVPP 3W8QA 2BIKB 5H3QA 4B4LA 4F0IA 2YWVA 3ZLSA 4MF1A 1Q8UA 1UV5A 2GQRA 4FV4A 4MCVA 4YU2A 3ENHA 2IW8A 3L8VA 4GK2A 5L2WA 4I3ZA 4F08A 1J7IA 5JT2A 4EJ7A 1W82A 1MP8A 4R1VA 5GZ9A 4GU6A 2FSLX 5A46A 4ZY5A 3ORMA 4BDIA 5IQIA 3NUUA 2C0IA 4QTAA 1PYEA 2PTKA 4QD6A 4J53A 4BCNA 1CM8A 3I81A 1ZZLA 2CGXA 3Q53A 3IS5A 3TG1A 4AACA 4HCUA 2WTKB 2YHVA 5DR9A 1ATPE 3FMEA 4MHAA 1P14A 3ID6C 3PIZA 5IQHA 5A6OA 5AV3A 3FMLA 5JRQA 3TI1A 4TL0A 3R04A 1LPUA 4DFLA 3UOKA 4A7CA 3U6JA 3DXQA 2PZ5A 3CP9A 4YJRA 3UNJA 5BQ0A 2R5TA 2X6EA 3HP5A 5A4TA 5CWZA 2YIQA 3BELA 3DPKA 3AGMA 3L9NA 2W1IA 3OOMA 4I6QA 4C4EA 3Q2MA 3KULA 2ITNA 2ITOA 1ZMWA 4K6ZA 4C2VA 3HYHA 1IASA 4USFA 3PE2A 4F6WA 4EC8A 3QGYA 2QC6A 2ITTA 2UZEA 3NNUA 2QO2A 4F1MA 3I0OA 3FLNC 3KY2A 2XK8A 5M08A 4W8EA 4QQ5A 4PP7A 3UOLA 4EWQA 5EM5A 5BUJA 3A8XA 3BGPA 4L45A 3R7YA 4FV3A 3CGFA 3D4QA 3LFFA 1ZARA 2QOOA 4XG7A 2FGIA 4MXXA 2Y0AA 3NPCA 2OI4X 4JR7A 4D2WA 5EM8A 5FTGA 4MK0A 4PP9A 3DQWA 2I6LA 3UZTA 3G9LX 3U54A 4R6VA 3BHUA 4FL1A 4P90A 4J7BA 3UQFA 2EWAA 2HW6A 4DGOA 2XP2A 1TKIA 5HBJA 5C1QB 3SW7A 5EFQA 4GT4A 3BZ3A 4TWPA 1DI8A 2WU6A 4LYNA 4BCQA 4FTCA 2VWWA 1O9UA 5BYYA 2ITPA 2DQ7X 3RK9A 4Y72A 1A06A 3PXKA 2JD5A 5TE0A 2Y4IC 4AGDA 3DXPA 2BROA 5BVWA
chains in the Genus database with same CATH superfamily
1BYGA 1Q8TA 5DRBA 4EHVA 4FV7A 3TT0A 3U9CA 5L8KA 3FUPA 4MXAA 1OGUA 1TVOA 4K77A 4K8AA 4HPUE 1U46A 4MNEA 3NNWA 2GS6A 3WILA 2JIIA 4UZDA 5HD4A 4QMWA 4UXLA 3V5JA 4QTCA 4FICA 2UZTA 4N6YA 4EONA 2FSOX 1XH9A 3G6GA 4ZMEA 4RIXA 3FQSA 5C8MA 5AR7A 5KHWA 5ANDA 2FVDA 2B7AA 5CAUA 1P2AA 1UNHA 4O1PA 1OL7A 4DCAA 3G0FA 3WF7A 4AGWA 2KULA 2VWUA 2ZOQA 3NUYA 2JBOA 4KD1A 4HYIA 4BKYA 4DEBA 5BNJA 3IDPA 5KNJA 4FVRA 3L9MA 2P2HA 4BDBA 3LHJA 4BB4A 4OAVB 3OCSA 3DTCA 4BKZA 1GIJA 3C13A 2XS0A 3HEGA 2JEDA 3RINA 4PPCA 3ORKA 5EK7A 5LARA 3O7LB 4O2PA 5HE0A 3KL8A 5IMEA 2LGCA 4YHTA 2EB3A 4Z7HA 4AQKA 3QD3A 4JT3A 2BAJA 4D2RA 1Q4LA 3TM0A 2SRCA 1UVRA 3PUPA 3DB8A 3HV7A 3IG7A 3D2IA 1XBCA 2GHGA 4C4GA 3ANQA 4HVDA 5AAEA 3BQRA 3C50A 1WBNA 3VUTA 5HNBA 4QQJA 4FSQA 4ZJJA 4ORKA 3A4PA 2JC6A 4YLKA 5DT4A 5EM6A 4O0TA 3EQFA 2ITXA 3P5JC 3ZBFA 3LXLA 1J91A 4YO6A 4ZLYA 4ZEGA 3BL9A 4CG8A 2VWIA 2BHEA 2P0CA 1NA7A 3LVPA 4M7IA 5E8UA 3RK5A 5CEKA 3PLAE 3GI3A 3ZH8A 3MIAA 5IA5A 5F9EA 4IC7A 1BUHA 4G3FA 3I7BA 1MRUA 5B0XA 5E9EA 4KKHA 4ZOGA 3UMXA 2XCHA 5CSVA 2NRUA 4L68A 3EFJA 5H2UA 2ZFYA 4J99A 3I60A 2EXEA 3HZTA 4C4FA 1QPJA 4FKOA 1Q8ZA 4BI1A 3GCUA 5KMKA 2C3IB 4M0ZA 5JFXA 2PMLX 3QQKA 4RJ5A 1Q3WA 4ZSLA 4DH5A 4D5HA 3PP1A 4PMPA 5EI2A 3EYHA 1IG1A 2WXVA 2OICA 4L3JA 3VS5A 4EHEA 5IEYA 4Z9LA 2VTSA 5G6VA 3VS2A 3C0IA 2CKQA 4GCJA 2ETKA 5KMJA 4Q2AA 5CANA 3QZGA 3VS4A 4J95A 3AKKA 3FYJX 4UMPA 5IA1A 4AN9A 5JGBA 1E1VA 3TIZA 4JDIA 3P7AA 3U8WA 4G3CA 3ZFYA 4DFYA 4O0WA 5D12A 2BAQA 5FEEA 3K5VA 2HZNA 4F1OA 2W4OA 4BDEA 1AQ1A 3HAMA 3IOPA 5FQDC 3CCNA 2BTRA 3QXPA 4RVLA 4ZSAA 5HX6A 5IH6A 3JYAA 1SYKA 4NTTA 5CVHA 3Q9ZA 3E7OA 3PWYA 2Y9QA 1WBVA 4G5PA 2UZBA 4QYYA 3BYOA 2OJJA 4G9CA 4V04A 4XMOA 4BDFA 2VNYA 2HK5A 4U7ZA 2YA9A 4ENXA 5M56A 3EN6A 5HCXA 2HXQA 4U0IA 1DS5A 1UU7A 2X7GA 3LJ2A 3C5IA 4OTHA 4L53A 4JNWA 2UVZA 4H1MA 4GS6A 3MTLA 5ACKA 2F49A 3NUXA 5L4QA 2QO9A 2ZB0A 3LKMA 2BRGA 3QQJA 2VTTA 3FI3A 4TWOA 3FLSA 4IVAA 3OY1A 4RX8A 3WZEA 4F0FA 4ZSGA 2X81A 4M68A 5IG1A 3UVRA 4RJ3A 5IA2A 1K2PA 2C6IA 4K33A 2PVJA 1Y8GA 5FXRA 3EH9A 4ZLOA 3DJ6A 3SVVA 4O4FA 5CEOA 3WZUA 3LIJA 2JKQA 5BVFA 1IA9A 4CGAA 2OH0E 1Q5KA 3R2BA 4DH1A 3I0QA 4E4LA 4E93A 4PDSA 4DFUA 3R02A 1KOAA 2YCSA 3NWWA 3QD2B 3AT2A 2R3FA 3HMIA 4FSMA 5J95A 4IWPA 3RK7A 2BZIB 5GZAA 1WBSA 4O7RA 5CAPA 3QZHA 4YNEA 5CU6A 2XM9A 1R0EA 1PXLA 1XMLA 2GPHA 5GIOE 5DT3A 4BDJA 4KIKA 4LOQA 4GT3A 4BFMA 4BCOA 5JEBA 4IW0A 2FSTX 3W10A 3NIZA 2XBAA 1PJKA 5HLPA 5CSXA 3F5PA 3LOKA 3OZ6A 4KKEA 2XEYA 4WG4A 4NT4A 4QTDA 1G8AA 3DZQA 4Q9SA 2R64A 3UNZA 4WRGA 3PY0A 4O4CA 1OKVA 4DT9A 4FL3A 5AP7A 2JAVA 1GAGA 3ALOA 2XAOA 2UW8A 3IPHA 2WD1A 4O82A 2ITWA 4MXZA 2Y7JA 2R7BA 4GFMA 4X3FC 4P2KA 3I1AA 3OCGA 3HGKA 3ROYA 4AA0A 4JOAA 3VAPA 4AP7A 4U6RA 4CT2A 4ZTHA 4HVGA 2RIOA 4DGLC 4D5KA 2F57A 3U87A 3KKVA 2CJMA 5BYZA 4WNOA 5IKWA 4BI0A 1JOWB 3LM5A 4GK4A 4F0GA 2XEZA 4IANA 3A61A 3CY3A 3Q9WA 5IQBA 4FODA 4B9DA 1OZ1A 2RG5A 1A9UA 2OKRA 4JIKA 3A7GA 3H0ZA 3SOCA 1HCKA 4KSPA 5CAVA 1YI4A 5HZNA 5L2TA 2BKKA 2GQSA 3FMMA 4UWYA 5AR8A 4DN5A 3NS9A 4O6EA 2JDRA 1Q8YA 2B9HA 4BJJB 4RIYA 4Z55A 3MBLA 4UEUA 4RVTA 1U5QA 2QOCA 1CDKA 3UNKA 3NLBA 1PMNA 3PVUA 3C1XA 3CPCA 3V5PA 4BCMA 5HI2A 4RX5A 3EKKA 5L2QA 3KEXA 1YWRA 4FL2A 3R8VA 4GKHA 5D41A 4BCJA 3MPTA 2A98A 3KMUA 3FL5A 5DWRA 4ARKA 4I5HA 4BBMA 5M06A 3MVJA 3R9DA 3BGZA 1VYWA 3C0GA 2GNIA 4IVCA 1Q61A 3C4CA 2XA4A 4FMQA 3DK3A 3OCBA 4MQ2A 4O0UA 5AV2A 2VX3A 4FKLA 4CLIA 3PJCA 2AYPA 4LUEA 3T9IA 3IKAA 5BVDA 1XH7A 4OGRA 4S30A 4NJDA 5HU3A 5IH5A 1XH8A 4CZTA 4M3QA 3FMKA 5A9UA 3Q4ZA 5KMLA 4U42A 2GFCA 4MF0A 3O17A 3ORNA 1VYZA 4BDDA 3EJ1A 1WBPA 5L6OA 3ZO4A 4YURA 3HDMA 3O7LD 3TNWA 2VX1A 4RC3A 2BALA 3R73A 4O4BB 4TWNA 3W0SA 4Y5HA 4UMRA 5KZ0A 4XRLA 5GIPE 3RKBA 2XAMA 2O8YA 3OEFX 4M67A 5IQCA 2CCHA 4EC9A 1KE6A 2Y6OA 2WELA 3GCSA 3F3ZA 3NUPA 4IX3A 4BKJA 4HVHA 3BU5A 4O84A 4YJOA 3MA3A 5IF1A 3HVCA 2YDIA 3ORTA 5LVLA 3S00A 3LCKA 2IWIA 3AG9A 3VRYA 4BCGA 4CFUA 4CCUA 4A4XA 2XNNA 2IVTA 3NGAA 3PZHA 1XQZA 2W05A 3FKOA 3UODA 3NAXA 4IEBA 1OL1A 3MB6A 5E8XA 2NRYA 3QYZA 2RF9A 3ZUTA 5A14A 3F3UA 2ZV7A 1BI7A 4RLLA 1MRYA 2HENA 1H1PA 2XKCA 3LXNA 4DYMA 2X8IA 3SA0A 4NWMA 2PULA 3PE1A 1M17A 1O6YA 4XX9A 4CCBA 2X8DA 1UWHA 4M66A 4LM5A 4M14A 5HEZA 4X2KA 3BHTA 1SZMA 4PQNA 4RLKA 1M7NA 1GZKA 1YXXA 3Q9XA 3GNIB 1TQMA 4ZY4A 4AXAA 4RIXB 2ZVAA 1W2CA 1PXKA 3R63A 3IW5A 3UP2A 2YITA 5AUZA 4JXFA 3NVKI 3KULB 3PSDA 2X4FA 3MTFA 1H28A 3BLHA 4R78A 2OZAA 2RSVA 5FXSA 4EH8A 4AXFA 3QKKA 1JQHA 4L52A 4RSSA 5AA8A 2OH4A 4WIHA 1S9JA 3D83A 5D7AA 4MD7E 4BWXA 2PZYA 1B39A 3WARA 2CNVA 1H1SA 3BE2A 3CIKA 3MVLA 2X2KA 2XYNA 3KMMA 2UZWE 5C8KA 2OF4A 2ITVA 2QOBA 5FWKK 2PMOX 2QKRA 4IAKA 4S2ZA 5ANKA 3MFTA 4IDTA 5HQ0A 4D2PA 4EOOA 5I4NA 4G31A 3SG9A 2JKKA 4F7SA 4UN0C 5AAGA 3ZC5A 1BLXA 2ITUA 3GCQA 3SC1A 2ZMDA 4W4VA 2XIXA 4BYJA 4EQUA 2CGUA 2WHBA 5AR2A 4FKPA 3LFNA 4UX9A 4CTBA 4O96A 3HECA 4AW2A 3PFYA 3U4WA 3VUHA 4H58A 2P2IA 3ORIA 4TWCA 2OXYA 4QYFA 3OS3A 4BVUA 2W0JA 3UJGA 4FA2A 2WMVA 1OBDA 5C03A 5AUUA 3UO5A 4KA3A 3ORZA 4HGEA 2UZLA 4Y5QA 5ACBC 4QMMA 3KN6A 3UBDA 1J3HA 4EK6A 5J7HA 3NCZA 3Q4CA 2RKUA 1NVSA 2W1HA 3RI1A 3AQVA 3C4WA 4I41A 5K9IA 3HLLA 4I22A 4RX9A 3WZJA 2OZOA 2VO6A 3FQHA 2GNLA 5HVJA 4B0GA 1K9AA 2RFSA 4E5AX 2OJGA 3I7CA 2X39A 2OLCA 4N57A 2OU7A 3VHKA 3IW8A 3ODYX 3B2TA 3W2RA 3D5WA 4YSJA 5AP3A 1ZOGA 3L9LA 5EH0A 4EH2A 4FNYA 4L3PA 3W0OA 3RM6A 3DK7A 3PVWA 4X3FB 3QUPA 3OC1A 5AUVA 4QQTA 2FA2A 5ICPA 4FC0A 3R8MA 4AXCA 3LFBA 3W0PA 3UG2A 3DOGA 4G5JA 4IAAA 3OEZA 1NXKA 1XO2B 2BVAA 2Q0NA 2CMWA 4FIGA 3MY0A 1XMMA 4K2RA 2R3KA 2UUEA 4I24A 2FB8A 2R3RA 4WSYA 4EHGA 4ZY6A 5JH6A 3DLZA 3F61A 4PMSA 3ZEPA 2C1AA 4GH2A 4NIFB 4YNOA 2VRXA 4GJ2A 4L44A 4O4DA 5E8YA 2CKPA 4G3EA 3MGYA 4GV1A 5DPVA 2PSQA 2GSFA 4LV8A 5E90A 5IUGA 3GQIA 2QOFA 2BRNA 5A6NA 1ZXEA 2BKZA 4YZBA 4ANBA 1ZY4A 4ZSEA 3DV3A 4FV8A 5AP0A 2Z7LA 4W4WA 5J1VA 2WIHA 4LOOA 5I9YA 3IW6A 3EIDA 3FC1X 4B8LA 4J96A 4CLJA 4O22A 4YJSA 4MBLA 4ZZNA 5IUHA 4YR8A 1PMUA 4E1ZA 3ZZEA 3FSKA 3KXMA 5LWMA 4RMZA 4M69B 4JBVA 2ZV2A 2VO3A 5HCZA 4ACHA 4RFZA 4LMUA 3BPRA 4BDKA 2H34A 3ZLWA 4TYEA 3LAUA 2WQBA 2BPMA 3GCVA 3R30A 5DA3A 2Z02A 2WMUA 2J50A 3QQGA 4NJ3A 4RWKA 5CVGA 4KB8A 4B7TA 3CSVA 4HPTE 1XH6A 4K9YA 4CTCA 5C9CA 3UDZA 3ZEWA 4DGMA 3QLGA 4R3RA 3F9NA 3NAYA 4I4FA 4AXEA 4GG5A 1YXVA 4P7EA 3LZBA 5HKMA 2XJ2A 4X2NA 2Z2WA 2AEGA 2BFYA 1DM2A 4IB0A 3BX5A 4O0XA 3N4VA 5EOBA 3U51A 4LGGA 2EU9A 1G8JA 3HP2A 3EL7A 5DYJA 4QPMA 4JQEA 5EYDA 4AW1A 1R78A 2ZDTA 3W0NA 1W2FA 2CDZA 3P9JA 3R1QA 5E7RA 3EOCA 1LP4A 2IVVA 2OW3A 3QLFA 3MJ1A 5H9BA 3VF8A 4FV9A 2R2PA 5FRIA 2YLFA 4AZVA 1LEWA 3CJGA 2VU3A 3UO6A 4MD9E 3HMMA 3R7IA 3MH3A 4UMUA 5I9XA 5BVNA 5IUIA 4DITA 3F7WA 3C7QA 4FIIA 4MUQA 1IRKA 3N9XA 3DGKA 2HZ4A 1TQPA 3DB6A 4FZ7A 4M15A 4O7YA 4UY9A 3QRJA 2UZOA 3QUEA 4BCHA 3D5XA 2YERA 3EKNA 5DEWA 3H10A 4HGSA 4WBBB 5AUXA 4RG0A 3RBWA 2XARA 2BCJA 3Q6UA 4QP9A 3ZRKA 4YTFA 2WMXA 4NKSA 4BIEA 1B6CB 4MWHA 5L8JA 2YAKA 4BBEA 3ANRA 3FZSA 3MPMA 2VNWA 4NFNA 4XNEA 4G17A 3OROA 2ITZA 3FXZA 3UP7A 1U54A 4GMYA 4B99A 4LQMA 4ZAUA 4ZTLA 4EYMA 1U59A 4DFXE 4YUQA 3DU8A 5CX9A 4DA5A 2R0UA 4R1YA 3ORXA 3DA6A 3LCDA 1YOJA 5CF8A 4BJJA 3R01A 5IQFA 2IZUA 3DBQA 3S3IA 3DBFA 4FKSA 4H3QA 3AKJA 3U55A 4IZYA 2ZB1A 3Q2JA 3FZTA 1W98A 3GC8A 3HV4A 4IACA 3AD6A 3E62A 4WBOA 3LFCA 5EHOA 2BR1A 4F9CA 2I0VA 2QG7A 1H00A 3ZHPC 4WNMA 1H1RA 4TPTA 4BZOA 3DT1A 3F69A 2PUNA 3AC1A 4EORA 4F7JA 4WT6A 1H1QA 4BTFA 3EQPA 3ORLA 3NFFB 5EYCA 4D2VA 4BI2A 3WF6A 1UU3A 4RFMA 4AX8A 3NW5A 1ZYDA 4JQ8A 2C6EA 5KUPA 4I0RA 1ZYCA 4II5A 4GYIA 4W8DA 1JNKA 5KKRC 5DR6A 4NYEA 4ANMA 1PXOA 1PXPA 2YJRA 3DXNA 1PXMA 3ZCLA 2WQMA 1Q99A 5AUYA 3TIYA 4YTCA 2PVHA 4XBUA 2IZSA 3BYMA 4JDJA 3PG1A 1LEZA 3IW7A 3DBCA 3LFAA 3WOWA 3E7VA 3R9HA 4AU8A 3GOPA 3ZM4A 3EQIA 3W8LA 1KOBA 3PJ2A 5J8IA 4RC4A 3BI6A 3FPMA 3CY2A 2BTSA 3I79A 3QTXA 5T3QA 3BLAA 4I1ZA 2CGVA 1FPUA 2C3KA 3ORPA 4ASXA 1ZY5A 4UBAA 3NW7A 4BRXA 1W84A 1L3RE 2YZAA 4JG8A 5CNNA 5BVEA 4QTEA 2XF0A 4FEUA 4AFJA 1Q8WA 2WTJA 4HJOA 2H96A 4G6NA 4FKGA 4RIWA 1M2RA 4WUNA 4O86A 5IISA 5JSMA 2Y8OA 2VD5A 3EN9A 1ZLTA 1H27A 2O0UA 2XIZA 3MFRA 4LUDA 4Y95A 5H8EA 2YZLA 2F2UA 1ZYSA 4OBQA 4C4IA 4AT4A 4E4MA 3OVVA 3PJ3A 3CBLA 3EHAA 2AQXA 3UIMA 3V6SA 4MTAA 1FGIA 1GZOA 1YI3A 2OXDA 3FPQA 2YCQA 2YM3A 2QHNA 4EKLA 3ZDIA 3FLWA 2XMYA 4I6BA 2X9FA 5CU2A 4LGDA 3P4KA 3PG3A 3ITZA 4I21A 5IH4A 4DG0E 4ZP5A 4EH3A 3AOXA 5CNOA 5HBEA 3A7FA 2V7AA 4KIQA 5DIAA 4DHJA 3BU3A 1O6KA 3RGFA 3RNYA 1KE5A 4ACGA 4KIKB 4YP8A 1IAHA 3GEQA 5K3YA 2XJ0A 4MX9A 4ANQA 4M97A 3SXSA 2QNJA 2WMSA 5DR2A 4A06A 3GXLA 3CQEA 4PTGA 2C6MA 3EFKA 3HUCA 3EQBA 2GTNA 3VUIA 5HLWA 4BR3A 4R8QA 3FL4A 4FV6A 2GMXA 4HZRA 4KBAA 4N70A 3QCQA 3V8TA 1FOTA 4NH1A 1OPJA 5KKRB 1CKJA 1OKZA 3DAKA 4FEQA 2YM8A 2VTHA 4DEAA 5KMNA 3CKWA 2FH9A 4CYJA 4LG4A 4GL9A 3TDVA 5JQ8A 2UW4A 3Q60A 1V1KA 3KXGA 5AR4A 3BWFA 4DHZA 5BVKA 4U41A 2PY3A 5I9UA 3DZOA 4UALA 1OIRA 3KRLA 4ASEA 4C38A 1NVRA 2R3QA 2F4JA 4C37A 4CKRA 5JMSA 1KE8A 4Q9ZA 4V05A 3FI8A 3NSZA 5F95A 2YWPA 4H3BA 4EOKA 1GJOA 1UKIA 2GU8A 3IO7A 3ZO3A 5ITAA 4FIHA 4Z7GA 2V55A 5KO1A 4DLJA 4F64A 3KCFA 3DBEA 3DFCB 4NEUA 4DTBA 3HA8A 4YTHA 5A54A 3HV6A 1M2PA 2B9JA 2WMTA 2RFNA 2JDVA 3QU0A 3SG8A 3GT8A 3R7EA 1QCFA 3C51A 4QMYA 3V5QA 4TYHA 4FEXA 3QQUA 2EUFB 4KABA 3A7JA 4M84A 5FLFA 3FV8A 3LFQA 1OM1A 1KWPA 4FTLA 5KCVA 4BGQA 4J8MA 4HCTA 5HU9A 4U5JA 4FTAA 3UZRA 5M55A 5K5XA 3GOKA 4E20A 1U5RA 2WMWA 2J2IB 3R1YA 4PWNA 3AKLA 2DYLA 5IEVA 2Y4IB 3Q52A 1MUOA 2QVSE 5HHWA 4CXAA 2JKOA 4AWIA 4F7LA 5CZIA 3SV0A 2OZAB 4G1WA 2YIXA 2O64A 1H01A 1H4LA 5M4FA 3AXWA 3PPZA 4KBKA 4WD5A 4GFOA 3RHKA 3VRZA 3LQ3A 4AZTA 3DCVA 5E8VA 3G15A 3G2FA 4RIWB 5M07A 4FTNA 2YM6A 3EQGA 4TYJA 4EZ3A 5IPJA 3ZXTA 3G33A 3TDWA 5C26A 5M4IA 5ANIA 3FZRA 2HY81 2WAJA 2WTIA 4G9RA 4I4EA 4NIFA 1E1XA 2VAGA 5F94A 4C02A 2JKMA 4LDTA 3CTQA 3W2SA 4AE6A 3LJ1A 4AN3A 5DEYA 4BZNA 4HNFA 3W32A 3WIGA 3BHHA 2GHMA 2R3GA 5EYMA 3RPVA 4G3DA 5CTPA 4QYGA 2VTMA 4JMQA 2UV2A 4KIPA 3CS9A 1QL6A 3GU7A 2WPAA 4QPSA 2HWOA 4FGBA 1J1CA 2J5FA 4M12A 4OR5A 4C62A 3FSFA 4XEYA 4UZHA 4RJ4A 3PXRA 4YSMA 3MDYA 3PTGA 5E1EA 3CKXA 3VN9A 3G9NA 3WZKA 2ETMA 4FZAB 5A4LA 4EK8A 5CU4A 3UC4A 2EXMA 4MNFA 5E8WA 3C4ZA 3W2PA 4JQ7A 2BILB 2O65A 2JDTA 4M69A 1RW8A 2PVMA 3FYKX 3G90X 3H0YA 2W06A 1PYXA 3HV3A 3KU2A 4FKVA 2OG8A 1X8BA 3O8PA 3TWJA 4IX6A 3C4XA 4IXPA 2LAVA 4GT5A 4ITJA 4U97A 2FUMA 1PRYA 1OI9A 1GIHA 3O51A 3OT3A 4RWJA 4JDHA 4CKJA 1F5QA 3HMOA 4IMYA 4F9AA 3DJ5A 2PZPA 3H3CA 3K5UA 3PXFA 4UWCA 5CZHA 3VBYA 2GNJA 2YJSA 2ACXA 4RWIA 4UV0A 4MXYA 1NT2A 1Z57A 3NYNA 4FX3A 3V5LA 1STCE 3PSBA 1JPAA 3F5XA 3MY5A 2R9SA 2PVYA 3IGGA 3OY3A 4N4SA 4EH9A 2X0OA 4IB3A 4IX5A 2IO6A 1FVTA 3NNXA 4C3PA 4CFVA 5IA3A 5D9HA 5M53A 3FY2A 5CU0A 3QGWA 2J6MA 2ETRA 2XK6A 3M1SA 3ZFXA 4GU9A 3U6IA 3D7ZA 5AP6A 1H24A 4JI9A 2ITYA 4FTJA 4CMUA 4EK4A 1P4FA 2VN9A 4BCIA 4AFEA 1WAKA 2G01A 4JJRA 3L1SA 4D1SA 3S1HA 2W9ZB 2C6LA 4AOTA 4CFXA 1CMKE 3ZLYA 4R5YA 4XP2A 5C4LA 4BICA 3A4OX 1H25A 1RDQE 2FO0A 2PUUA 4KINA 4RVKA 3UTOA 4IBMA 4AOJA 3ETAA 5BVOA 4BBFA 3W33A 3CTHA 3QX2A 3OF0A 1NVQA 3HNGA 4HZSA 2E9OA 4LL5A 3O96A 4QDVA 1IR3A 4QRCA 2P3GX 3Q5IA 4TNDA 3O5AA 4L6QA 4W9WA 4CFMA 2WTKC 4IVBA 4QNYA 3V5WA 3QBNA 4D9UA 5IDPA 5CT0A 3GCPA 1G5SA 4KS8A 3RZFA 2PK9A 3VBQA 5LMBA 4PDYA 4D55A 5JZJA 2HW7A 2WO6A 1XHAA 3FKLA 4FT9A 3ODZX 1YW2A 4O7NA 2C3JA 2X2MA 4ZS4A 4XOYA 2OSCA 3R22A 4AXDA 5CAQA 2J51A 4OUCA 4HYHA 4ACCA 2C5YA 3R9OA 4RC2A 2BFXA 3GUBA 4GW8A 3COMA 3COKA 1JKKA 2UW5A 5HTIA 4XG2A 2GQGA 3QTIA 3OW4A 3P08A 4R7HA 3AC2A 2V0DA 5FBOA 3CTJA 2IN6A 3QUDA 5T68A 3E8DA 3LFSA 3Q6WA 4NSTA 3K3JA 4X21A 5ETAA 1R0PA 3KXHA 3UO4A 5KHXA 2C5NA 5GINE 2WTCA 5HCYA 4DFNA 4BTJA 3ZO2A 4D4YA 4DHFA 3LMIA 4U79A 3IK3A 1ZAOA 4CQEA 4EBVA 3CXWA 4DDIA 4G6LA 3R8UA 4QMVA 4U40A 2HIWA 2G2IA 5GNKA 5HO7A 5L8LA 3NYOA 4X3FA 2YDKA 3AMYA 4S32A 2WOUA 3IDBA 4FT5A 5HNIX 4G3GA 4C2WA 4FSTA 5IDNA 1YHVA 2RFEA 1A48A 5ETIA 2VTNA 3RALA 2IPXA 2CPKE 1S9IA 3HMNA 3CQUA 3WE4A 1WZYA 3R6XA 2QOIA 3GGFA 5E1SA 5FBNC 2W99B 3FI2A 3QA8A 3E3BX 2HOGA 2YN8A 3HV5A 2E9VA 4FTOA 2X6DA 4DC2A 5B2LA 4AT5A 4O21A 4ZJIA 3VJOA 2XB7A 3SRVA 1V0OA 5KMOA 3MWUA 4CV8A 2HCKA 5CY3A 4FIJA 4E4NA 3M2WA 4UMQA 4L42A 2CCIA 2WEVA 2WZJA 3CQWA 3L8XA 4XV1A 4FZFB 5AP4A 3F88A 4CEGA 4C7TA 4E5WA 2V22A 1KV2A 2WB8A 3BBWA 5F20A 5GJDA 2IG7A 5DBXA 3FLQA 3GC9A 3QRUA 3F3WA 1KE9A 4ACDA 1W0XC 1YDTE 4FVQA 4LGHA 3KIOC 4HGTA 3HMPA 3E88A 3ZONA 5CF5A 4FKWA 2VTOA 2QOLA 4DFBA 2X4ZA 2JIVA 4H36A 4NW6A 2CN5A 3PXYA 4QMOA 2XIYA 4PTEA 4D2SA 2IVUA 4IC8A 2BHHA 3EZRA 5I9WA 3KB7A 4FKUA 4KNBA 3RWPA 4CKIA 2JITA 3TV6A 4IM2A 2IZTA 3VS7A 4D4VA 5CYIA 4F63A 3R7VA 4S31A 2C30A 2Z7SA 3HDNA 3BV2A 4U9AA 4W9XA 4YPSA 1J7LA 5DRDA 3VONA 5IQGA 4NZWB 4RVMA 4O7ZA 3SGCA 2O63A 4E26A 3FJQE 4P5QA 2WTDA 3KVXA 4QMTA 4CFNA 5JRSA 1H08A 4BIDA 2BAKA 3MVHA 5F4NA 3CGOA 4GFGA 2UW3A 2WMRA 4F7NA 3F2RA 3FBVA 3CJFA 1ND4A 1FMOE 3MA6A 5LMKA 3JXWA 1WCCA 3DDPA 4RJ6A 3LMGA 4USDA 2C0TA 3LLTA 4YLJA 1V0BA 4PNIA 4R3CA 2XK9A 3R2YA 5EDRA 4DE4A 2B55A 1VLRA 3AMBA 3EL8A 3VS0A 4HYSA 3ACKA 2OFUA 4FTKA 4MXCA 3MN3A 4PL4A 1JBPE 4EHZA 1YI6A 5FD2A 2BUJA 3OBJA 3POZA 3KREA 3IOKA 3CD8A 3QQFA 4RA4A 4HYUA 5DNRA 3W2CA 3TACA 2I1MA 3DS6A 1Q24A 2J0KA 3ZO1A 4I5PA 5EKNA 4IWDA 3AC4A 1UU9A 3FXXA 3EFLA 3O0GA 4H3PA 4GJ3A 1JAMA 2GFSA 3IECA 1URWA 4I93A 3D9VA 3TKIA 3QTUA 4A9RA 4F6UA 3WF9A 3G51A 3F2NA 3R00A 4I23A 4BGHA 4FSNA 3QWJA 4FK3A 5LVPA 2XCKA 2XRUA 4EJNA 4O81A 1UKHA 2ZV8A 4ASZA 4BIBA 3QWKA 5AIKA 4I5MA 3WE8A 4EI4A 1U54B 4YBJA 4CFFA 4YC8A 2XKFA 2CN8A 4OT5A 4EH7A 3D5UA 3QXOA 5T6KA 3UGCA 2WFYA 1GOLA 3E92A 3P7CA 4WO5A 3ZRMA 4E7WA 2CLQA 2I40A 2PWLA 4ERWA 5CSPA 3K54A 3MS9A 5LCKA 2C5XA 1H07A 4YZDA 4CVAA 2F2CB 3VC4A 4M0YA 1PKDA 3RZBA 4D4RA 3KVWA 4O0VA 4PMMA 3ATTA 2HZ0A 2W1FA 3LQ5A 4RIOA 3TZ7A 3RPYA 3QF9A 2YM5A 2UZVA 2GTMA 3DTWA 3GU4A 4FV0A 3RVGA 3U9NA 4AZFA 4U80A 4BZDA 3I5ZA 2OK1A 4QMUA 5I3RA 3QD4A