5LJJA

Crystal structure of human mps1 (ttk) in complex with reversine
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
281
structure length
264
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMEYGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTDSQVGTVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of reversine selectivity in inhibiting Mps1 more potently than aurora B kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dual specificity protein kinase TTK
total genus 67
structure length 264
sequence length 281
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ljjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ljjA01
2JFMA 4O38A 1WVWA 1Q3WA 3LQ8A 4MEDA 3R7YA 3UJGA 5EKNA 5HD4A 3EN6A 4O7RA 5IMEA 3NX8A 4A9RA 4C34A 2QO7A 1WBOA 2G2IA 4FV8A 4KSQA 3E64A 2X9EA 3ORZA 4NK9A 2OWBA 3UG2A 4AGCA 1PJKA 4TN6A 5C9CA 4C4FA 5J7HA 4IVCA 2BILB 3LFBA 4AN9A 1KV2A 1OL7A 5AR3A 3GXLA 1WBPA 4FV2A 4G3GA 3UIBA 5CANA 2CNUA 4KIKB 2GTNA 3BX5A 4U6RA 5GNKA 3V3VA 4XOYA 2ETMA 3FZSA 3ZLWA 5LCJA 4PP7A 1JBPE 5D12A 3RK9A 3OWJA 3AD4A 2QOIA 2CKQA 1MUOA 2QD9A 4YHTA 1NY3A 3KMUA 1DAYA 1UU8A 4FV9A 3DXNA 4RLLA 4RX9A 5ETCA 1I44A 1APME 5E8TA 3MB7A 2OI4X 2RGPA 4IZYA 1PMUA 2C6IA 2UUEA 1L3RE 3DDQA 4QTAA 4RX5A 5C4KA 2GFSA 3AC3A 2OZAB 4E3CA 3DFCB 1IR3A 4HCUA 3A62A 3KRJA 1PY5A 4I20A 3ZZEA 4F99A 4FVRA 3W55A 1H0WA 5M4FA 5A4QA 2PZPA 3D4QA 3QQUA 4HVGA 4IVDA 3TDWA 4I5MA 3BHUA 1OBDA 5HCZA 2WKMA 4FV6A 3FJQE 4YZCA 4D0XA 5JKGA 3ZFMA 4BN1A 4XG8A 4DGGA 4FEWA 1LR4A 3BU5A 4NUSA 4X3FC 5E8SA 1FGIA 4FT9A 4DT8A 2QU6A 4FSRA 2C1AA 3P23A 3ITZA 4D58A 5JGBA 1YWRA 3LMGA 2UW5A 4GUEA 4L8MA 5AP0A 5EW8A 2P2IA 4FODA 1VZOA 3QQGA 4QPAA 1OPKA 2IVTA 5DA3A 4IADA 4WT6A 5FP6A 5HTCA 4TYGA 5IISA 5DLSA 3Q4ZA 5AP4A 3KEXA 5GZ9A 1URWA 1JQHA 3EMGA 5HESA 2BDFA 5IF1A 3OUKA 5CVHA 2GQGA 2YIWA 1OPJA 5CF8A 3JR1A 5HBHA 3DQXA 3EFKA 2WMBA 4E1ZA 1P2AA 2YCRA 1H1WA 3QRUA 4NFNA 4AGWA 4EBWA 3PDTA 2FSLX 3VBTA 4I22A 4LQMA 3FYJX 4BHNA 3RAKA 3NCGA 3MA3A 1Z5MA 2IZRA 1ZAOA 2JFLA 3VW8A 4O0TA 3IECA 4Y95A 5J87A 2CPKE 1WBTA 2X7OA 2YZLA 2ZV2A 4LGGA 2BRNA 2VTHA 3FZTA 2XF0A 4CQEA 5KHXA 4C2WA 2V7AA 3OOMA 1KUTA 3DB6A 1VEBA 4KUJA 2IG7A 2F2CB 4J7BA 5AP1A 3HUBA 3KRLA 4HVIA 3Q3BA 2OFUA 2R3OA 3GFWA 1KV1A 4FEUA 4G5PA 4X6QC 3QWKA 3R9RA 2OICA 2G01A 4CFXA 4DFYA 3V04A 5TT7A 4BZDA 4QO9A 3TZ8A 4BDBA 4I93A 1YI6A 4BKJA 4LMUA 4FSZA 3LFAA 3PRIA 2QONA 4RRVA 3ZFYA 3DV3A 1UNHA 2B1PA 5AAFA 3TI1A 3Q9XA 4NU1A 5KMIA 2EXEA 4G1WA 4MCVA 3C4XA 3R04A 3M2WA 4FL1A 5BUJA 3E92A 3QUEA 2C0OA 4HCTA 3MVJA 3RCJA 4PF4A 2XZSA 5CYIA 4MBIA 3GBZA 1OL6A 4ENYA 1NA7A 4IVBA 1U5RA 4EHEA 3MFTA 4K2RA 1GAGA 2O2UA 2Y0AA 3CCNA 4G9RA 2C68A 5EHOA 4EH4A 4USEA 3AG9A 4LV5A 3RINA 4BDEA 3ID6C 2KULA 3Q5IA 2UZVA 3CC6A 2X6DA 4RT7A 4RIWB 3V5QA 2WTDA 1MRUA 4DTBA 2IVSA 3UO5A 2C3KA 3WARA 3V8SA 5IH4A 3O17A 4A4XA 5JFVA 3IO7A 2E9PA 2ZDUA 5LMKA 4BDFA 4G3CA 3SOAA 4CXAA 2WOUA 4QMNA 4GIIA 3UO6A 5C1QB 2DQ7X 5AM6A 4G16A 4EOKA 3LCDA 4AA0A 4ZMFA 2YHVA 3U4UA 4WNMA 4MXOA 4EL9A 2VWYA 1Q8TA 3Q9YA 4M8TA 4EC8A 4NWMA 4C61A 2JIVA 4XP3A 5ICPA 4NM5A 4FIJA 4L45A 2ACXA 3NS9A 5GJFA 4ZEGA 2OBJA 3QHWA 4KAOA 4YTIA 2G2FA 3FWQA 5B0XA 3ROCA 3E93A 5HKMA 5CX9A 5KO1A 3L8PA 2HZ4A 1JKKA 3HV4A 3DKCA 4BDJA 4RWLA 3IOKA 3PA4A 3AMYA 2PVJA 5L2TA 3D5UA 2I0VA 2ZVAA 3GCSA 1V0PA 3NYNA 3QGYA 4F6UA 3O8UA 3EB0A 1XH8A 2C47A 2JBPA 4YPDA 3ORIA 3DBQA 4KWPA 3PY0A 3KXGA 3D7ZA 1SM2A 5CZIA 3PUPA 3PXFA 4BCIA 4YURA 4A4OA 3KXZA 4R3CA 4BKYA 1Z9XA 5JQ5A 3SVVA 4AOTA 3TV6A 3Q2JA 2ITUA 3NSZA 1Q24A 3SC1A 4AA4A 2UV2A 3F5XA 4KIPA 2PVFA 2A0CX 3DLZA 5HTBA 3NNXA 5IG1A 3DKGA 4DYMA 3ZXZA 2IZUA 1TQIA 4S2ZA 3DDPA 3OW3A 4ZTHA 5HD7A 5LVPA 4K9YA 3QX2A 3E62A 2BAKA 2BAJA 2CCIA 4I6BA 1LUFA 2VO6A 4FUXA 4L46A 2QLUA 4F7SA 4LUEA 4Z7HA 1ZWSA 2EWAA 4MNFA 4V0GA 2IVUA 3ZLYA 4TXCA 3DK7A 2X7FA 2CLXA 4CMUA 5L2IA 3PTGA 5EFQA 4L3JA 4HJOA 4M66A 4I4FA 4OTDA 5D7AA 2SRCA 3VBQA 2IZTA 4IAAA 4B9DA 3ZSIA 3CPBA 4EOJA 4Y5QA 4OTWA 3DNEA 2ZOQA 2QG7A 2Z02A 2E9VA 2QVSE 2QKWB 3QBNA 3BV3A 4GW8A 4D1SA 4HVHA 4G3FA 3TZMA 1IAJA 4LOOA 3AC8A 3E7VA 4M7IA 4S30A 2BDWA 1XR1A 5EM7A 4EH8A 3HV7A 2EUFB 3Q2MA 4H3BA 3NIZA 4YC6A 5K0XA 3W32A 3KREA 4BF2A 4DGLC 3DTCA 4DEAA 5CF6A 1Y91A 4YBKA 1K9AA 5FEDA 3VHKA 3WF6A 5IMXA 3QD2B 1YWVA 3V8WA 1G5SA 5L8JA 1F0QA 5B2MA 3P0MA 4FV0A 1PHKA 4U42A 4BDDA 4WBBB 1ZRZA 3SW7A 4RWIA 3LKMA 3FZ1A 4PDPA 4GFGA 4UZDA 1Y8GA 5TE0A 4S34A 3UOHA 3HAMA 2GNJA 3ACKA 5CSVA 3R9DA 5M51A 4HNIA 1FPUA 3QTXA 3JYAA 3RPSA 4BI2A 3ZM4A 2VTQA 4IVAA 4FT0A 3FMMA 3JY9A 4I6FA 4FEQA 3CJFA 4FC0A 4I0SA 3OCBA 4MD9E 5K0KA 3MIAA 4MYGA 4OTIA 5DIAA 3QWJA 2BRBA 5ETAA 2CKOA 3UOLA 3DAKA 4JR3A 5KMOA 3MW1A 4X2NA 2J0LA 4ZLOA 5EYDA 5JFXA 1SNUA 2ETRA 4FZFB 4JDIA 5HIBA 4MNEB 4FTJA 3UPXA 5JEBA 2HZNA 3CKXA 3E3BX 4PTCA 5EYCA 3RGFA 4JR7A 4PTGA 3TN8A 5JRQA 1JVPP 4IWOA 5J79A 5IH5A 4YPSA 1Q61A 2FB8A 4PL4A 3ROYA 4U81A 4YNEA 3KA0A 4ZAUA 3KFAA 4AAAA 3SRVA 4UWCA 2GNHA 4U80A 3LFSA 5KBRA 5AM7A 3OP5A 1STCE 2BUJA 1ZXEA 2AC5A 3H4JA 5DT4A 3F88A 2VX0A 3OW4A 3Q4CA 3VUGA 3W2SA 1Q8WA 3PSBA 4YTCA 4IAFA 5L2WA 2F49A 3H3CA 3C0HA 3KKVA 5CVGA 2BZHB 2XEYA 3DJ7A 4GKIA 5BQ0A 4ID7A 3HNGA 5HBEA 3VQUA 2VWBA 3MI9A 5FG8A 3ZBXA 4BCJA 5JK3A 1SZMA 4KKEA 4HYUA 3EKNA 4E5WA 4M3QA 5JFSA 2PE1A 3ZUTA 4G3DA 1CM8A 5AX3A 2Z7RA 2JDTA 1NVRA 3AC5A 4DFZE 1IA8A 4TW9A 2WTWA 4ZZNA 4U3ZA 2PVNA 4QMTA 4D9TA 4YMJA 4OAVB 2G15A 4ZSJA 4NYEA 4O0SA 1W7HA 3B2TA 5I9WA 5JZJA 1PF8A 2WTKC 3I0OA 3UNKA 4KBAA 4A4LA 3G90X 2Y8OA 3BI6A 3R7IA 2P2HA 2C69A 4UWBA 2XA4A 5CWZA 2JDVA 5EK7A 2OIDA 4AZFA 2HIWA 2UZEA 4F1TA 4IBMA 4LOPA 3UVQA 5K5XA 1VJYA 4O6LA 4WHZA 4D4RA 4U8ZA 1IAHA 3OG7A 4EQUA 4RVKA 4UMPA 1RDQE 1BLXA 2X8DA 3FMEA 4GK2A 5BVFA 2YACA 2YLEA 4OT5A 3VBYA 5FM3A 3VULA 4C7TA 4ANQA 3DA6A 4XG2A 4I94A 5BVWA 5BUEA 4X2FA 4E4XA 3OY1A 3PPZA 4G9CA 3UDBA 4PMSA 3KMMA 3QCXA 5A6OA 5KCVA 3VF8A 3G5DA 2I0YA 5HVKA 3AC2A 2GHGA 2XCKA 4FNZA 4ASXA 4X0MA 4PV0A 4N6YA 2VWUA 4RIYA 4BVUA 4O7LA 2O3PA 4PDYA 4CG8A 1W98A 3PXQA 5HI2A 3IQ7A 4BDGA 2BTSA 4IXPA 3Q60A 3ZBFA 1RE8A 2H96A 4LGHA 3HKOA 5AMNA 2UW7A 5AR7A 4O7VA 3OUNB 4A7CA 3Q96A 2WTIA 1IRKA 3WF9A 2OH4A 5KMLA 4JIAA 4L68A 4DGNA 3OCGA 5CY3A 5H8BA 2P55A 3QZFA 4BI0A 5BNJA 3CS9A 3R2BA 4YJSA 4A9UA 1MQ4A 3KCKA 4GG5A 5J1VA 5I9XA 3S2PA 4BCNA 3DOGA 4Z3VA 1NVSA 2Z8CA 3MFRA 4JXFA 1KE5A 4Q9ZA 2R3PA 4J8MA 4YTFA 5BVDA 4TWPA 3U4WA 5IQBA 5H8GA 2UVYA 1REJA 2OIQA 2FH9A 5IZFA 5H9BA 4YR8A 2XK9A 3SG8A 1JSUA 1V0OA 2IJMA 2R7IA 3FY0A 1O9UA 2J9MA 2JKMA 3HL7A 3U8WA 2X1NA 2BTRA 3OC1A 3O7LD 1WFCA 3LLTA 1BUHA 5GZ8A 3QC4A 3F82A 3AD5A 1XQZA 2Z60A 4I5PA 4ERKA 4JDJA 2WMRA 3HMNA 4J97A 4O83A 5ANKA 5B2KA 2RL5A 1XBBA 4BBEA 5CEOA 3T8OA 5HNBA 5A46A 3MPAA 5FXQA 5DNRA 5I9ZA 3COHA 3KMWA 4C62A 4FT7A 5CU6A 3UVPA 5HNIX 3PXRA 2GPHA 4HYHA 4JG6A 4O22A 3G51A 4GT5A 5BMSA 4KB8A 4GT4A 2VV9A 4DA5A 3TIYA 1T46A 4XG6A 2QNJA 4YSJA 1SYKA 4IM2A 5J95A 4XBUA 4F4PA 3QFVA 2XYUA 3FLWA 3DT1A 2XNPA 3DS6A 3NYXA 4FSUA 3UGCA 2J0MB 2V0DA 4C3RA 3FXZA 3HRCA 2YZAA 2ZM4A 3LAUA 4BCPA 3COIA 4M69A 3MGYA 1OBGA 4FTIA 2QI8A 3FSFA 3F3UA 3IKAA 4QYGA 2ITNA 1KE9A 2C6OA 4MKCA 1WVXA 4DFXE 3P86A 3SA0A 4HCVA 2PUPA 3MESA 3GCUA 1Q5KA 2X2KA 2B55A 4H39A 4AT4A 3ZM9A 3PA5A 3NNWA 4F9WA 5KKRB 4WIHA 2VWZA 4QP9A 2ONLC 4FIEA 4D4SA 4XNEA 4I23A 4RC2A 1QL6A 3A7HA 3DBDA 3CSVA 3R8PA 2BDJA 1JWHA 3FQEA 2Y4IB 2NPQA 3MY0A 3DBCA 2YDJA 3OXIA 4BDKA 3BU3A 4QMQA 2JDSA 3TEIA 2W06A 2WQMA 3QZHA 2BHHA 3Q6WA 1WMKA 4EOOA 4CKJA 2W5HA 4OUCA 3LFFA 4N0SA 2X6EA 3FI8A 2QLQA 3U51A 5ANOA 3TTJA 2W1HA 3TXOA 3VS3A 3FQSA 4AUAA 3H9FA 5M53A 3OWPA 4QMUA 3UC4A 4L43A 3VUMA 4GL9A 4JX3A 3HAVA 4FICA 4EHVA 2YIXA 3UO4A 4F09A 4E5AX 4IMYA 3BYMA 3ET7A 3ZC5A 4K6ZA 3GOPA 5IA5A 5GIPE 3CGFA 4JBVA 4C38A 4E4NA 2PZRA 5KMKA 5BUIA 4GFOA 2WTCA 1BI7A 4U44A 4GH2A 3SHEA 3EH9A 4NEUA 3FPMA 4RJ3A 4E6QA 5AV1A 5IDPA 5HZNA 4XRJA 1R0EA 4O7TA 3NIEA 2GS7A 2OH0E 5HNGA 5CEQA 4HVDA 4IJPA 1PMVA 1YDTE 3PG3A 5L6WL 4FTLA 5E1SA 5H3QA 2PULA 1H8FA 4AU8A 1YHSA 4EK3A 2UVXA 3PPKA 5LARA 4CFMA 1U59A 5EYMA 4WNPA 4JQEA 3ZSHA 4G6OA 3KK9A 1YVJA 3F7WA 2AUHA 3FI3A 4GRBA 4QP3A 4BCQA 4CTBA 2C4GA 5HX8A 4DHFA 5DR6A 3PJ3A 2XYNA 3BYOA 4RLKA 1OIYA 2HWOA 5HLNA 1OECA 3PWDA 5D9HA 5I0BA 1WAKA 2GS6A 2IVVA 3KN5A 4ANLA 5I5ZA 3DAJA 2ZM3A 4R8QA 3WYYA 2Y9QA 3E8EA 3H30A 4XP2A 3NPCA 4WSYA 3OD6X 5AUYA 4L6QA 4IWDA 4NJ3A 5AIRA 3ZO1A 2O64A 2XJ2A 3HECA 3R02A 3FMDA 3ALOA 4L67A 3UIUA 1M2RA 1YI4A 4D55A 2BRGA 3W8QA 1PXJA 4PPAA 3HMOA 3CEKA 2XNNA 1K3AA 4RJ6A 4Y46A 4QOXA 3GC8A 4WUNA 4ZZOA 2UW6A 3K5UA 2BRMA 5EW3A 1DI9A 4HPTE 3SXFA 3W2OA 4D4VA 2UZBA 1Y8YA 4F65A 1U5QA 4F9CA 1Y6BA 2C3LA 3I7BA 3PLSA 5JZNA 3WILA 1Y57A 2WIPA 2VGOA 5C8NA 3SV0A 5JQ8A 3KXXA 2RKUA 3EQFA 1Q99A 2ITYA 5ANGA 5AP7A 3FEGA 2XIXA 1H24A 2YABA 2CCHA 2PUUA 4JLCA 4XV2A 3VAPA 2VTSA 4RIXB 3ZSGA 5KMNA 4BTMA 4MNEA 3Q52A 4OBOA 5IA4A 2FVDA 4TWCA 3AGMA 1J91A 2GTMA 5A54A 2J5EA 2QCSA 2VTTA 4WG5A 4X7QA 4F0IA 2XNGA 2DS1A 4BDIA 4F08A 3NGAA 1YWNA 2R64A 3TNHA 4MQ1A 2RG5A 1IG1A 3FLZA 5EOBA 3MY1A 1ZZ2A 3V5PA 4XV1A 4FKRA 5EI6A 5J5SA 4CRSA 1WBWA 4TWOA 2HY0A 4XHKB 3HV6A 4H36A 2PE0A 3IPHA 3WI6A 5TF9A 2O5KA 3AXWA 3VQHA 3BRBA 2V55A 3GU4A 3P79A 4DTAA 5M44A 3TKHA 3PE2A 4FTOA 4ZJIA 4DF3A 4RZWA 4BDCA 5I3RA 3R1SA 3P9JA 3TKUA 3G9LX 3DXPA 4QTDA 3PIZA 1P14A 4WG4A 3ZS5A 3R28A 4P2KA 1JAMA 4IX6A 2XB7A 2YITA 5JH6A 3D83A 3L9LA 2YIQA 2OG8A 4R3RA 2UW8A 3IOPA 3JVRA 4QT1A 3HEGA 3I81A 2PVMA 3IONA 4FV3A 4YJRA 4O0RA 3LJ1A 3MH2A 2BKZA 4L42A 4GEOA 3O8TA 4O2ZA 3SQQA 4D2PA 2WTKB 5KUPA 2O8YA 4LI5A 4YZDA 3W2PA 1O6LA 3MFUA 4E6AA 3UIXA 2YISA 3MPTA 4ACMA 4FE2A 4ZZMA 4D9UA 3FMLA 5CXZA 5KNJA 2X4ZA 2C5VA 3BGQA 4AOIA 4MBLA 2ZAZA 3GVUA 5L4QA 4YJPA 3Q32A 4BDHA 5AAEA 3KF4A 4EOQA 1UU9A 3VHEA 3QLFA 3RM6A 4I21A 4OLIA 1J7UA 3PSCA 4WNOA 3UOKA 3K2LA 4FSMA 3MS9A 4EZ5A 3BYVA 3ORXA 4DG3E 1YXXA 3N9XA 1XH5A 2YCFA 2ITWA 3F69A 3O2MA 2QR8A 4YGAA 4FNWA 4DFUA 3ORPA 1LP4A 4ASZA 4EK6A 1G8AA 2I6LA 2QQ7A 2YDKA 3QD3A 4RJ5A 3QTIA 2WAJA 1QPEA 3RHKA 1BMKA 3MJ2A 2CGVA 2C6TA 2QOBA 3VS7A 3ZHPC 4IZAA 5HIDA 2CNVA 5DR2A 4B8LA 4YSMA 5AFVA 4R6VA 2VGPA 2PU8A 3CJGA 4RSSA 4FTQA 4K11A 4KRCA 2QODA 3RP9A 3IW7A 3C5IA 3LOKA 4G31A 4UY9A 4CFWA 2LAVA 4B7TA 3WZEA 1GZKA 2C0IA 4RPVA 4GU6A 3C9WA 3C4ZA 3POZA 4GYGA 4GVJA 4PPCA 1NT2A 5IA0A 2BIYA 4WUAA 4PTEA 1J7IA 4WA9A 3BHHA 1YOJA 4IACA 3R6XA 3M42A 4C4IA 2VWXA 1YXSA 3KGAA 4NSTA 5CT7A 5J9YA 5EHLA 4YU2A 2B0QA 4XH6A 3CD3A 4Y5HA 4GS6A 4C4GA 2O0UA 3PIXA 2XNEA 4EK5A 4FKTA 4TNBA 2A27A 2XJ0A 2UW3A 5FBOA 5M56A 5HLPA 1M7NA 3DNDA 2CGUA 4FKVA 4BY9E 1DS5A 3GU6A 1XH4A 4EUUA 5K4IA 3KULB 4NKSA 1U54A 1YHVA 3ELJA 1VYWA 1XBCA 4JS8A 4DGMA 4UB7A 2UZOA 3GFEA 2XVDA 4TY1A 2OKRA 4GG7A 4NM7A 4QP6A 3PP0A 3UQFA 4ZJVA 2ITPA 2ITTA 3LFCA 4IAYA 1H27A 1X8BA 2GNFA 3FMJA 3PJ1A 4MTAA 4YJOA 3SXRA 4QTCA 3ORMA 4K1BA 5BYZA 5EM6A 3I79A 3GC9A 5L2SA 5E92A 3QGWA 5C8MA 1ZYDA 2CMWA 4DBNA 2RSVA 3CXWA 3Q5ZA 5EYKA 3OXTA 3L9MA 2Y6OA 3D14A 4O1OA 3EHAA 4TYHA 5FLFA 3BZ3A 3W18A 3FLQA 4PL5A 4CZTA 4EH3A 3L9PA 2OJFE 4E4MA 5CAUA 4KIKA 1PW2A 5CU2A 2R3LA 3BHVA 1FMOE 2ITZA 5ACBC 4Q5EA 4Z7GA 5AWMA 4XMOA 2PZ5A 2X81A 3UNZA 2VX1A 1W0XC 3AOXA 2IW6A 5FD2A 3VRZA 3RMFA 5A9UA 1YOMA 5FQDC 4GT3A 4X3FA 4CT2A 3GQIA 2BROA 4E5BA 3NYVA 4YLKA 4G6LA 3SGCA 3BLRA 4RVTA 4NCTC 3GP0A 3NLBA 5IQHA 4IM0A 2YM7A 2F2UA 5HQ0A 3DCVA 5AP2A 4FYOA 4AA5A 4UZHA 2XIRA 2ITOA 5AP5A 5FM2A 1G3NA 3PLAE 2VO7A 2RFDA 1XJDA 4P7EA 4O2PA 3WZUA 3NUPA 4FTMA 5T6KA 2ETKA 4A06A 2X2MA 4XG4A 3O51A 3UBDA 5KHWA 4ERWA 4J99A 4F0GA 3FDNA 3CKWA 4D2RA 4DCEA 4D0WA 1ZY4A 3NW6A 4BIDA 2VWIA 5E4HA 4QYHA 4FYNA 1UVRA 2CGXA 4QMOA 4BIBA 4DEEA 3I5ZA 2ZMCA 5LVNA 5CZHA 2J0IA 1OM1A 3RJCA 4E6DA 2A2AA 1J7LA 4TYJA 2XP2A 3VBXA 3LCKA 4XP0A 4O0XA 2R3QA 3CY2A 4GJ2A 4ASDA 5CI7A 4RC3A 3TL8A 4DFNA 4Z16A 3SLSA 1ZOEA 3HP2A 4FIHA 3MSSA 4WG3A 5KZ0A 2PL0A 3IGGA 4JOAA 4B99A 2WMSA 5AIKA 4H3PA 5HO8A 1AQ1A 2EVAA 4QTBA 2WMWA 3R1QA 4L7SA 4Q2AA 4M13A 3EQPA 4ACHA 4DFLA 5LVMA 5M06A 5H8EA 4BKZA 3E8DA 3VC4A 4FBXA 2B53A 4RJ8A 2RFNA 1ZYLA 2QOKA 2PVHA 1Q8ZA 3E8NA 4J53A 4J8NA 3SW4A 3UPZA 3QYZA 4EOLA 3OMVA 3FL5A 3PJCA 2W4JA 2PHKA 3C1XA 4IAIA 2Y7JA 4DAWA 5FWKK 2W9FB 3TV7A 1A06A 3G6HA 3TG1A 3PZHA 2VTRA 3ORLA 4ZTMA 1BI8A 2OJGA 3B8RA 3BCEA 3D2KA 4FT5A 5H2UA 4PL3A 4AACA 3DK3A 3OT3A 3AGLA 4IEBA 1YXVA 2XNBA 3O0GA 4UXLA 3MA6A 2X2LA 2WNTA 3ZLSA 1KWPA 2W1ZA 4J95A 5EQEA 4BYJA 3RZBA 3LM5A 2CHLA 4IB0A 3QZGA 2BKKA 4C8BA 4DLIA 2CGWA 5DMZA 2W1IA 4S32A 1ZARA 2VN9A 4FZAB 2E9NA 4QMXA 3FZPA 4IAKA 4ZY6A 2PYWA 4NW5A 2VNYA 4BB4A 1T45A 2WELA 1CKJA 2B9IA 5IKWA 2W5BA 2OF4A 3L8VA 4CFVA 4QP7A 5ANIA 3PFQA 3R1YA 3UNJA 5AA8A 4PDSA 3QXOA 2R5TA 4DH5A 3IW4A 3OF0A 1PYEA 4MBJA 2DUVA 1SMHA 4F7NA 2VNWA 4KD1A 3R8ZA 1K2PA 1PKDA 2C5YA 3G0FA 3QD4A 2WMXA 3GUBA 2HOGA 4EWHA 2WXVA 3IW5A 1LPUA 5AV0A 4QP2A 4C2VA 4APPA 3ENMA 1MP8A 3RK5A 5DT0A 1OKZA 3ZEPA 4O7SA 1Q41A 1UNGA 2I0HA 4PX6A 4BR3A 4IC8A 3E3PA 4OBPA 4FG8A 3N4VA 4KS7A 2P4IA 2XBJA 3R22A 1W82A 3TT0A 4D2VA 3FC2A 2VTMA 2Z7SA 3TV4A 4PDOA 3ZYAA 3W2RA 2BFYA 3BEAA 2WZJA 3R8VA 3F61A 3COKA 2OXYA 3R9OA 1ND4A 2PY3A 3LFDA 4GIHA 4AF3A 1R3CA 2G2HA 3GU5A 4EONA 4KRDA 2B52A 4J52A 5TR6A 4L9IA 2XM8A 3AMAA 1OKYA 3SRVB 1ZLTA 3F2NA 4KINA 5F20A 5JMSA 1L8TA 4O7YA 3BE2A 3BGPA 1GY3A 4CV8A 1UNLA 3A8WA 3NW5A 4FGBA 5HBJA 2E2BA 4UX9A 2J90A 3A4OX 3IDCA 3QCYA 4XX9A 4NL0A 3SKCA 4FSNA 3VS5A 3Q4UA 3U9CA 4BYIA 4KS8A 2HXLA 2F9GA 1H1QA 2C6KA 1BX6A 3ZRMA 4RX7A 1SVEA 3A60A 4D5KA 3MDYA 4F9YA 4TWNA 2ITVA 4EQCA 3SXSA 3PXYA 1YXUA 3LCOA 4GK3A 4R77A 4OTGA 2OZAA 3HVCA 4QTEA 4E20A 5M08A 4GMYA 4F6WA 2ZV9A 3DKFA 3U87A 2WQBA 3NUAA 4DBXA 4AGDA 4D5HA 5CEMA 3KVXA 3HZTA 4OT6A 3RKBA 3LFQA 3DZQA 2ITQA 4G17A 3ZUUA 4ANOA 4DITA 5AA9A 4D2SA 3RPOA 2R2PA 4R3PA 3CPCA 1WBVA 5EDRA 3D7TB 3BELA 4BTJA 2HWPA 2VTNA 4N70A 2OU7A 2GS2A 4U7ZA 3UZTA 1ZYJA 2YM8A 4CFFA 3I4BA 4I4EA 5DR9A 5M57A 4DT9A 1LEZA 3LE6A 4CV9A 4OR5A 4ENXA 3CTJA 4BGHA 3NNUA 1R39A 4CZYB 5EOLA 3MPMA 4BICA 2ERZE 3ERKA 1OIRA 2EU9A 1E1XA 2W05A 3QYWA 3WE4A 4CEGA 5JFWA 1SVHA 4CMTA 2EXMA 4UYNA 1ZMUA 3V5JA 4MQ2A 1WZYA 1GZOA 4FK6A 4CMOA 4IB5A 4LV8A 3W16A 1UKIA 5EM8A 4QMSA 3WF5A 4IX3A 4BCHA 3OT8A 4KIOA 5TOZA 2BMCA 4FL2A 2CDZA 2AC3A 3C0GA 4EKKA 4PY1A 4MD7E 4ACGA 3GCVA 4EEVA 1WVYA 4U79A 3PJ8A 2J5FA 3ZONA 4KSPA 4ZJJA 3EFLA 4A9SA 4EQMA 4FEVA 4RMZA 4D4YA 1XHAA 3GEQA 4RVMA 1PKGA 1YXTA 1W83A 4U0IA 4CKRA 2J50A 3MBLA 1QMZA 4UMRA 3ATSA 4KIQA 3KXNA 2UW0A 1S9IA 2IO6A 3EQHA 3I5NA 2JC6A 4C3FA 3OBJA 4EOIA 3U6IA 1GJOA 4U45A 3VBVA 4DGOA 5FDXA 1FBNA 2V7OA 3BKBA 3F2AA 4NTTA 1VR2A 3K3JA 4H58A 3LFEA 4S33A 2IW8A 3WBLA 5L6PA 4FMQA 5BPYA 3FLYA 2Q0BA 2HW7A 4FSWA 4F64A 3OS3A 4O0WA 4QMZA 2WO6A 4RA5A 2WEVA 2VWWA 3EJ1A 5ANEA 1YRPA 4HZSA 5BX0A 3U9NA 3FY2A 4AOJA 4XEYA 4YZ9A 5DH3A 4YZMA 5HE2A 4M84A 3V5TA 3R7UA 3TTIA 3TUDA 3T9IA 2UZWE 3OEZA 4M12A 5EDPA 1J1CA 5EW9A 3RNYA 3W33A 2HK5A 1V0BA 4PNKA 2C30A 3GNIB 5DT3A 2ERKA 5D7VA 5AP3A 4O21A 5I9UA 4OTRA 3ANQA 4EH2A 4IH8A 4PWNA 4ALVA 2R3MA 2JAMA 3QUPA 2JAVA 4B0GA 2RFEA 1MQBA 3L8SA 3TIZA 3MIYA 3EFJA 4DLJA 3U6JA 4QP8A 3TJDA 5C01A 4C33A 4W4VA 1KOAA 2W4KA 5KMJA 1NW1A 5DRBA 3MY5A 3S4QA 4O96A 3EIDA 5EM5A 2OIBA 1KSWA 5EH0A 1PMEA 4AX8A 2W1DA 4L44A 4EJNA 2WMAA 3LPBA 4KABA 3DAEA 3SAYA 3FC1X 3IDBA 4LGDA 4FV4A 2XS0A 1XH9A 3FE3A 4MXCA 1Q8UA 3ATTA 1KOBA 4MXXA 5TO8A 5F4NA 4IM3A 4K8AA 1Q97A 1XH6A 5IUIA 3A7GA 5HIEA 1XH7A 3DPKA 3ENHA 2OLCA 3A99A 4J71A 3Q9ZA 4UV0A 4YZBA 4DH1A 1YQJA 4G3EA 3WF8A 5K4JA 3TJCA 2QC6A 1UU3A 2X39A 2WIHA 3PZEA 2HZIA 4RFZA 2XK4A 4BIEA 5CAQA 4CG9A 4QNAA 4X3FB 5AUWA 4QMPA 4LFIA 3RVGA 3V8TA 3CIKA 2WOTA 2RG6A 4X3JA 2WQEA 5IA3A 3NDMA 3O71A 4ALWA 5I9VA 3HRFA 3G0EA 4YJUA 4Y8DA 3EL8A 4XV3A 5JSMA 2C6EA 2I0EA 3CQUA 4JNWA 4QD6A 3MVHA 4XYFA 3E88A 4R7BA 3WZKA 2W1CA 5CXHA 3PIYA 3JVSA 3F3ZA 3FAAA 2PWLA 2V5QA 3AC4A 4GUBA 4JQ7A 4ZSEA 4FKQA 2WMQA 3E63A 4YUQA 2XBAA 4NIFB 4D2WA 4YO6A 4R5YA 4AZSA 5EDQA 4ZTSA 3HP5A 1Q62A 2OXXA 2R0UA 1H08A 4IJ9A 2GNLA 2YIRA 5M4IA 5CU0A 2B9HA 3A7IA 3DFAA 1OMWA 4NCTA 3ETAA 1O6YA 2Z7QA 2ZDTA 4BCOA 1ZYSA 4FKWA 5GIOE 3NUUA 2J2IB 1H0VA 3VWAA 3I6WA 3NW7A 3SX9A 3UE4A 1F5QA 3O7LB 4YP8A 2W0JA 1ZY5A 2Z2WA 3DBFA 2H34A 4FOBA 4M68A 1GOLA 4U3YA 4HOKA 4TTHB 2XIKA 4U40A 3CTQA 4L01A 3LJ0A 3BU6A 4N57A 1PXIA 4O82A 3THBA 1ZMWA 3LXPA 3LXKA 5AV2A 3ZOSA 4CZUA 2AYPA 3SOCA 1OKVA 1DAWA 2V22A 4JT3A 3Q9WA 4M14A 2F7EE 1H1RA 5E8YA 5FTOA 4I5CA 1H1SA 5LWNA 5IQDA 4PUZA 4BGQA 4YZNA 5HO7A 5IUGA 5IA1A 2UZTA 3VS6A 5AUUA 2CLQA 5HG9A 3VRYA 5C26A 2WPAA 2R3JA 3DU8A 2R3GA 3BEGA 3NZ0A 5EG3A 4BDAA 1WBNA 5G1XA 5K3YA 1LEWA 2G9XA 1TQPA 3KVWA 3BLHA 2J6MA 4QMMA 1OZ1A 4M0ZA 4IB3A 3V51A 4XS2A 5LVOA 4G34A 1ZOGA 3RWQA 1B39A 3R63A 3ALNA 3QC9A 3ZZWA 4NKAA 4C3PA 4GKHA 3R1NA 3N4TA 3QQHA 5AUZA 2C6MA 3GGFA 3LXNA 4IE9A 4AQCA 1M52A 4USDA 3NUNA 1JKTA 4PMMA 3VNTA 1CMKE 2WU7A 5E8WA 4ZS4A 1J1BA 4OTPA 5FTGA 4MXZA 4C59A 3FMHA 4JBQA 3F9NA 3G2FA 2WU6A 5GINE 3QTWA 1XWSA 2F7XE 4AG8A 2HYYA 4JQ8A 5EKOA 4AZEA 4W9WA 5IA2A 2ZV7A 3MJ1A 1G8SA 4NW6A 5DRDA 4IX4A 3MH0A 4XG9A 3BHYA 5CVFA 1ATPE 3IG7A 2IN6A 4JIKA 4IANA 4RIXA 4TKSA 3LXLA 4MF1A 3P08A 4H1JA 4GJ3A 3V5LA 3BWJA 4RIWA 4FTRA 3FKLA 3CLYA 3NRMA 3NR9A 2V62A 4QMVA 3FSKA 5IQGA 5T68A 2VAGA 3D2IA 1GIIA 2A4LA 3H0ZA 4DINA 3L8XA 3POOA 1PXMA 4ZTNA 3QRTA 4KA3A 5DVRA 2FSMX 2WTJA 4ITJA 3HMIA 4OTQA 4ZSAA 4MAOA 1JSTA 1Q3DA 1H00A 1OIUA 3K5VA 3RAWA 1GIHA 2VTLA 3RNIA 2VD5A 3CGOA 2UVZA 4CTCA 5IQFA 4GYIA 4EOMA 4FI1A 2R7BA 4C02A 1UWJA 2XIZA 2UZLA 3AT3A 3F5PA 2QR7A 3FV8A 5D11A 2FSTX 4F0FA 5A14A 4EJ7A 5IU2A 4AFEA 3QXPA 1I09A 3I60A 3QQJA 4I6HA 1JSVA 2Y6MA 5AADA 1VYZA 1YDSE 4USFA 3WIKA 5CF4A 3FPQA 3NUXA 4ZP5A 5DEYA 4O7ZA 3ZUVA 3COMA 4U43A 4NM3A 1HCLA 3CQEA 4M97A 4GSBA 4MX9A 4X2GA 2PMOX 3FUPA 2LGCA 4M67A 1RW8A 5DN3A 2WFYA 3S3IA 4M15A 2XNMA 4WNKA 2PVYA 5JRSA 3OOGA 3AT2A 5HTIA 5EQPA 4FIGA 3HRBA 4BFMA 5C8KA 3C51A 5HU9A 5CEPA 4W4XA 2C3IB 3ZU7A 4DEDA 2I7QA 1OITA 2WGJA 2YJSA 4MF0A 4C35A 5LXMA 1Q8YA 3ZFXA 4LRMA 4O1PA 3FHIA 5HCXA 2JEDA 4QNYA 3P7BA 3R01A 3IW6A 3RM7A 4BRXA 4CVAA 2FO0A 3NAYA 1NXKA 2XKEA 3BBWA 3F66A 4CNHA 4TZRA 5E8ZA 5A4CA 4I6QA 2EXCX 3NUYA 3HYHA 5E91A 2ONLA 1OIQA 1UA2A 3MV5A 1OL2A 4FKLA 5E1EA 4NH1A 5C03A 3QTSA 2NRYA 3PY1A 4BCMA 2CKPA 3S95A 4ZY4A 4TRLA 2H6DA 2YAKA 2QOCA 1U46A 3VN9A 4FNXA 3TKIA 3ZLXA 5AAGA 3AD6A 5CS6A 4FKGA 5LQFA 3F2RA 1GZNA 4JBPA 1XO2B 4LM5A 3WE8A 2JBOA 5ETIA 5LVLA 4UEUA 1RQQA 3BLQA 3D5WA 4FSQA 4RIYB 4BCFA 1JNKA 4Y83A 4EH9A 2YERA 3QZIA 4ZLYA 4V05A 1IASA 2OSCA 1EH4A 3R73A 5E8UA 4H3QA 3VJNA 5IQEA 3LQ5A 4ORKA 4E6CA 4K0YA 3LVPA 4EUTA 1A9UA 2BHEA 2BVAA 2J0KA 5CAOA 4ZSGA 1M7QA 3C13A 3OBGA 2XM9A 4EYJA 1CDKA 4R7IA 5HE3A 4AS0A 3JPVA 4ACCA 2HZ0A 5FP5A 2BAQA 1UU7A 4DH3A 4O27B 4AT3A 4YHJA 5FRIA 4R5SA 1PMNA 3VF9A 3QKMA 3PVWA 3UQGA 5HVJA 4YLJA 1FVVA 3BQRA 3GU8A 4I5HA 5LMAA 4YO4A 5IDNA 3S0OA 3VS4A 4Y73A 4LRKA 5IH6A 3KU2A 1FVRA 4Q9SA 4QRCA 5DGZA 3GENA 4P90A 3FKNA 5KX8A 3KN6A 3QTQA 4C58A 5JGDA 1CSNA 2J7TA 1OI9A 2YM4A 3PVBA 3KY2A 4E73A 4JVGA 4DG0E 5AR4A 3WIGA 3VBWA 3WOWA 3EZVA 4NM0A 1F3MC 1FGKA 3QTZA 3ZRKA 4HGEA 5CASA 4RX8A 4LUDA 3FLSA 4ANSA 2VWVA 4R1VA 4V01A 4XUFA 5M4CA 3R7EA 5HOAA 4I0RA 4U9AA 3VUIA 3PVUA 2B54A 5IEYA 1NVQA 4P5QA 3TM0A 2BALA 1JLUE 1B6CB 3R7OA 4FG9A 1BKXA 2XK8A 3D5VA 1YW2A 4CT1A 2QG5A 3EYGA 3GOKA 4IX5A 4J1RA 5EI2A 3HGKA 5IQAA 4L52A 5J7BA 2XKFA 3QU0A 1O6KA 4NFMA 4WRSA 3Q04A 4NT4A 5CAVA 2X8IA 3HV3A 3KL8A 5HG5A 2IW9A 3PY3A 3KRRA 4H1MA 5ETFA 4LG4A 4I0TA 3RBWA 1REKA 4EHZA 4HVSA 4LL0A 4QQJA 2F57A 4YC8A 2F4JA 3DK6A 5AUTA 4FKOA 2ZJWA 1AGWA 4I24A 4PNIA 4K33A 2R3NA 4II5A 2CN8A 3G33A 4HPUE 4UBAA 4UMQA 1PXOA 4IDVA 4EK4A 5E8VA 4P4CA 3GQLA 4UWYA 3FL4A 2R3FA 4PMPA 3PRFA 4RC4A 1WCCA 3R71A 5AP6A 3ORKA 2JIIA 3IS5A 3R7VA 3N4UA 2QHNA 4FZDB 3UP7A 4CGAA 2QO9A 3Q4TA 3FZRA 3KCFA 4ANMA 4QPSA 4WO5A 3JS2A 2QOHA 4XV9A 2ZB1A 4ZOGA 4X6RA 2B9JA 2YA9A 3DBEA 5CEKA 1OUKA 4UMTA 4X2JA 5KBQA 3QCSA 2GQSA 4RBLA 3GU7A 5ITAA 3RCDA 4LMNA 5F95A 3GT8A 2W96B 4J98A 4NIFA 3TCPA 4DC2A 5AEPA 4EBVA 2R0IA 2OJ9A 3KXMA 3QF9A 3QKKA 2YAAA 3K3IA 4B4LA 4CFNA 3EQRA 5EHYA 2RF9A 2VRXA 4C37A 5CQUA 3NVKI 4ANNA 5JGAA 4CKIA 2HW6A 3EOCA 5HE1A 5IEVA 3EYHA 4Y72A 5GJDA 4EHGA 1CKIA 1BL6A 1UKHA 3JXWA 2FUMA 4I92A 4FK3A 2QOQA 3Q6UA 1TKIA 3R8LA 2XEZA 5DE2A 5J8IA 3F7ZA 3QTRA 3A7JA 3QCQA 4C57A 4D2TA 3ZRLA 5DI1A 4TL0A 4DFBA 4YLLA 4CFUA 4O0UA 2Z7LA 4XLVA 4HGSA 3JY0A 5EI8A 3UOJA 5CF5A 5L8LA 3VUDA 5DBXA 3MTFA 3OTUA 4YNOA 2XJ1A 4FTCA 4WD5A 5K5NA 5AUXA 4RIOA 5FUTA 5GJGA 2X7GA 2RIOA 2PVKA 1FMKA 3VJOA 3ZDIA 4JDHA 3F5GA 3EQDA 4Z55A 3FLNC 4YBJA 4LL5A 5LOHA 4IHPA 4O86A 2W99B 1FVTA 2JKQA 4YC3A 5FEEA 5HICA 4QP1A 3B8QA 1S9JA 4IB1A 3ZC6A 3L9NA 1HCKA 3OCSA 4AGUA 3PA3A 4FV7A 3RPYA 3N51A 2W17A 5M07A 3LMIA 4TNDA 3G9NA 3IDPA 4RWJA 4FF8A 4IFCA 3UG1A 3UMXA 2REIA 4HGTA 5A3XA 2IWIA 1H26A 3IGOA 1P4FA 2VTIA 4BTKA 3P5KA 2BPMA 4MHAA 4GU9A 1U54B 3P7AA 4MXYA 4NZWB 3BWFA 4EH7A 2PMNX 3CQWA 3QRJA 4XRLA 3CP9A 3F3VA 5CU3A 5HE0A 3F6XA 1YOLA 5BVOA 4RFYA 1H07A 4JI9A 4KKGA 2NO3A 3V6RA 1OPLA 2BFXA 2PMLX 3F3WA 2XRWA 2J0JA 2PMIA 3ZO3A 3ZTXA 4E4LA 3D0EA 5LWMA 3UQCA 3MWUA 3CTHA 5D10A 4QMYA 4GV1A 1GIJA 2WQNA 3RPVA 3QAME 3UMWA 2BZJA 4I3ZA 1GZ8A 4F7JA 4AT5A 4W8EA 1KE8A 4RVLA 4KBKA 4XG7A 5CI6A 3QA8A 4CRLA 4YTHA 3R0TA 4I41A 2XNOA 2HELA 2VTJA 4EZ3A 2QKRA 4IIRA 4LYNA 1JOWB 5GZAA 2C5NA 4YHFA 5D41A 1JKLA 3U6HA 2GDOA 2WTVA 4IDTA 3O50A 4HYIA 4AE9A 3GCPA 4C4EA 1QPJA 2OO8X 3RAHA 2EB2A 3TNQB 2C6DA 3V6SA 3OFMA 4FIIA 3ORNA 3QQLA 5CSXA 3RWPA 4W4YA 3W2CA 1YHWA 4QYFA 3NVMB 3FI4A 4D28A 2Q0NA 5FBNC 1B38A 5CU4A 3ODYX 3OZ6A 2O63A 2PSQA 1H01A 3BV2A 3HDNA 4LRJA 4FR4A 2P33A 3DGKA 4DEBA 3R2YA 2WHBA 4PPBA 1IA9A 3UODA 2KTYA 4OGRA 1PYXA 4MVFA 2Y4PA 1PRYA 2WQOA 3QKLA 3FKOA 4W9XA 4DN5A 4FTUA 3I0QA 4X2KA 5CENA 4EC9A 3EN9A 3C7QA 4A9TA 3LW0A 5FDPA 4BHZA 3PWYA 2GNIA 5AUVA 1R0PA 5D1JA 2IPXA 2I40A 1AD5A 4JBOA 2H8HA 4EK8A 4MK0A 4GCJA 3ZDUA 3RTPA 4BBFA 3C5UA 3LCSA 3UYTA 4O0VA 1UV5A 4QQTA 2NNWB 2WEIA 3HA8A 4WRGA 3MYGA 4P5ZA 3R8MA 2P3GX 2W4OA 4O6EA 2E9UA 3REPA 2GHMA 2DYLA 4EI4A 4FTTA 2DWBA 3R8UA 3VS0A 2OW3A 2W1FA 4RGJA 3I6UA 1ERKA 1OL1A 1M2QA 2BIKB 4FKUA 4F7LA 4Y85A 2YIYA 2QOFA 4C36A 2XIYA 3LIJA 2FYSA 4U97A 4V0GB 3EKKA 4FEXA 2XKDA 4EH5A 4J96A 3AQVA 3V01A 1A48A 3QA0A 3OEFX 5AX9A 1ZYCA 1YI3A 1ZZLA 3VUTA 2YJRA 5JN2A 5CNOA 4QYYA 3ULZA 3QUDA 4B6LA 2X0GA 3EN4A 4FG7A 3SG9A 2YCQA 2QOLA 4TT7A 3LQ3A 2YFXA 5DHJA 4ZXTA 3BIZA 3O8PA 1PXNA 1IEPA 5CALA 2GU8A 5KZIA 5HLWA 3G15A 3HV5A 4GVAA 1E1VA 2GHLA 2ITXA 3R30A 4FV1A 5CEIA 5KMMA 4AN2A 5KKRC 5I3OA 4Q5HA 5HCYA 3KRXA 4WKQA 2OXDA 5AV4A 4M0YA 2PZYA 2YCSA 2FSOX 5C4LA 5E7RA 4C4JA 3MVLA 5CSWA 4O91A 4S31A 5IPJA 3DXQA 2HXQA 4ZIMA 2R3KA 4BWPA 4WBOA 3T9TA 5LMKC 2W5AA 3I1AA 3ZO2A 3MB6A 2YLFA 4E93A 1JKSA 2C1BA 4TYIA 4XOZA 5AV3A 2H9VA 4QMWA 4L7FA 2W9ZB 4L3LA 4F1MA 3M1SA 2ZMDA 4FTNA 5E9EA 4JDKA 4JRNA 3FZOA 1OVEA 4UYAA 3UC3A 2R3HA 4BCGA 1SNXA 3FMKA 4K18A 4AP7A 4QMLA 3H10A 2YM5A 3FQHA 4AXAA 3PSDA 2PZIA 2JDOA 5CT0A 3TACA 3EFWA 2QURA 3GC7A 2XK3A 3KXHA 4DG2E 4GK4A 2QOOA 3PG1A 3KULA 3H9OA 3DTWA 4JX7A 4ZTLA 2GSFA 2NRUA 3RPRA 4FKIA 3OROA 3TZ9A 3NMUF 4ZMEA 4L53A 1PXKA 2PUIA 2OZOA 4F1OA 2J4ZA 3R21A 5AJQA 4FTAA 4AW0A 5M09A 4QQCA 4KKHA 2CJMA 5CAPA 4UN0C 4BZOA 3BPRA 3NUSA 5FEQA 3W1FA 3R9HA 3DZOA 4FKSA 2BCJA 2CN5A 4HNFA 5BVEA 5IUHA 5ANDA 4G5JA 5IQIA 1UWHA 4FZ6A 3PPJA 3TWJA 3TNWA 3SDJA 1WBSA 4FA2A 3QD0A 3LFNA 3DKOA 3E7OA 2YM6A 1Y6AA 5J1WA 4DH8A 2A19B 3NAXA 3MFSA 1M14A 1W84A 3C4CA 4TYHB 5A4TA 3VVHA 3MH3A 4IFGA 3OWKA 3LCTA 5ANJA 4EH6A 3ORTA 4FSTA 2XKCA 4MXAA 5CSHA 4DEIA 4BBMA 2IZSA 2OGVA 3A8XA 1ZOHA 3CD8A 2E9OA 3HMPA 3M11A 4FGRA 2GNGA 3C4WA 3F5UA 3Q53A 3ZEWA 4HYSA 4JRVA 2HAKA 3AMBA 3GCQA 5AR8A 5IEXA 3A61A 4HW7A 4AFJA 4CYIA 2QHMA 5HEZA 3RAIA 4FIFA 4FUYA 4K77A 4AW1A 1YKRA 4BI1A 3EN7A 5A6NA 3KRWA 2PK9A 5A4LA 4DCAA 4FNYA 5DG5A 4YJVA 2UW4A 3BYSA 4IZ5A 4ITHA 1Q4LA 2W1GA 2WMUA 5DFPA 3LMHA 4ZY5A 2VU3A 4DEHA 2WB8A 2A1AB 3FBVA 2GCDA 3H9RA 3LHJA 4C4HA 4IWQA 4MD8E 1P5EA 2VUWA 1FOTA 4MWHA 3D7TA 4Z9LA 5DYJA 2JGZA 3RK7A 4RQVA 4ARKA 2OFVA 4IW0A 4JG8A 3PJ2A 2JITA 4UALA 5KE0A 5HG8A 3QLGA 3R83A 4QQ5A 3UVRA 4H05A 5F9EA 1BYGA 4IWPA 4MWIA 3QRIA 5FXSA 3QRKA 4I1ZA 2B7AA 4IAZA 4U41A 4AWIA 5J9ZA 5BVKA 4JAIA 4WSQA 3NNVA 2PPQA 4O84A 4RJ4A 5HORA 3KC3A 4IQ6A 3PP1A 3U55A 3VW6A 2B9FA 4AW5A 3P7CA 2XCHA 2C0TA 4ITIA 2J51A 4PQNA 3WZJA 3UP2A 3DLSA 1J3HA 2Y4IC 3BBTB 5DOSA 2OK1A 2XMYA 5GHVA 3UTOA 4BWXA 3CE3A 2JIUA 3C0IA 3DJ6A 3HDMA 5EQYA 2XRUA 5HX6A 5IQCA 2GMXA 2R4BA 4D1XA 4FX3A 2VTAA 2G1TA 3E5AA 2C5XA 4OTHA 4TPTA 1URCA 4AN3A 3TUBA 5TKDA 3RHXA 3ULIA 3HUCA 4XBRA 3CR0A 3LJ2A 3ODZX 5FGKA 2OJJA 5L2QA 4KBCA 5ACKA 1OUYA 4BL1A 3T3VA 3KK8A 1H28A 3QL8A 4BCKA 4BWKA 4BGGA 5J9LA 3ANRA 3GB2A 5CNNA 3E8CA 4F6SA 3O23A 2Q83A 3TDVA 3R7GA 4RA4A 1QPCA 3NYOA 1OKWA 4A07A 4O7WA 2W1EA 1OL5A 2P0CA 3L1SA 4D1ZA 3O96A 4WOVA 5HO6A 4RJ7A 4PRJA 4U5JA 1XKKA 5AR5A 5FTQA 1JPAA 2XK6A 4FTKA 4OAUC 4LOQA 1FINA 3HMMA 1H25A 4ONAA 3VIDA 2UZNA 3KF7A 4AE6A 5CQWA 3OWLA 3PXZA 4PMTA 3QHRA 1H4LA 4FKJA 3FXWA 2W7XA 3NCZA 4W4WA 4G2FA 4E26A 3D5XA 1TQMA 3BE9A 4AZWA 2GQRA 5M55A 4FL3A 4QYEA 5DEWA 5DWRA 3ZH8A 4NJDA 3GI3A 4QP4A 4E8AA 1Z57A 2R3IA 3MVMA 3A7FA 4G6NA 4XG3A 1QCFA 4ZK5A 4E7WA 3D9VA 4YJNA 4B8MA 1M2PA 2YEXA 5AR2A 4R1YA 4V04A 5HU3A 3TZ7A 4DEGA 1OB3A 4FKPA 4AZTA 4UMUA 1YDRE 4GFMA 3D94A 4N4SA 3UIMA 2PUNA 3AC1A 2X8EA 1MRYA 4JJRA 3ZCLA 3EN5A 4JG7A 2VO3A 5B2LA 3LLAA 4XJ0A 4CLJA 5JT2A 2JD5A 2ZM1A 2QU5A 2HENA 5DPVA 1ZMVA 1W8CA 4OTFA 2F7ZE 2VTPA 1SVGA 3CY3A 5T3QA 2VTOA 1MRVA 5M4UA 4M69B 4C0TA 3FHRA 3EZRA 4CCBA 1CKPA 5CSPA 2UW9A 4N6ZA 4O7NA 3ZO4A 4APCA 4BTFA 5J5TA 3TUCA 3UYSA 2PTKA 2X9FA 3FXXA 4OBQA 2JDRA 5HHWA 2XUUA 5FXRA 4KNBA 2HY81 3P78A 4RFMA 4HGLA 4BC6A 2PVRA 4XCUA 3EQBA 3PVGA 2ZYBA 2FA2A 3F3TA 3B2WA 4OW8A 3HA6A 4FVQA 2ESMA 4EYMA 3FYKX 2BR1A 2PE2A 2NP8A 3S00A 4FSYA 2R3RA 3D15A 3ZMMA 3S1HA 3LM0A 2C5OA 3W10A 4AZVA 2XH5A 2ZB0A 4FZ7A 3VUKA 3WYXA 4CLIA 3C4EA 3FI2A 4YJQA 4EWQA 3LZBA 1R1WA 4CCUA 3RZFA 4XLIA 2QO2A 2CSNA 4EZ7A 3PE1A 4ANBA 4ZS0A 4F9BA 1P4OA 1TVOA 4W8DA 4O0YA 3II5A 1V1KA 1OGUA 3MTLA 5F1ZA 5L3AA 1PXPA 2OF2A 1KE7A 2BZKB 2RFSA 3H0YA 3NEWA 1U4DA 3OVVA 4DTKA 4F9AA 3MH1A 4F70A 3OY3A 5BYYA 3IW8A 4AW2A 4HZRA 5E90A 2I1MA 4F63A 4DE4A 3K54A 3NWWA 4EOSA 3QALE 2O65A 2ZV8A 2OJIA 4ZSLA 3T3UA 4ALUA 3BGZA 4JAJA 3VO3A 4PP9A 2JKKA 4ACDA 3BQCA 3HX4A 3G6GA 3A2CA 4MH7A 4L00A 2HCKA 2YN8A 3I7CA 3SD0A 5CLPA 2VX3A 3DB8A 3DJ5A 2YDIA 3R9NA 5I4NA 1XBAA 3C4FA 4EORA 4L3PA 4BZNA 2BRHA 2VO0A 3VS2A 3FMNA 4RQKA 4UXQA 3IK3A 3VUHA 4CQGA 1CTPE 2JLDA 4TYEA 2GFCA 3VS1A 3P4KA 3EWHA 3W2QA 4RWKA 5LCKA 3A4PA 3RI1A 2YWVA 3QTUA 3P1AA 3QQFA 2CKEA 3PYYA 3UZPA 3WF7A 2C3JA 2YWPA 5HVYA 1M17A 4ZLZA 2C6LA 3BHTA 3EQIA 2EB3A 4EKLA 3ZXTA 3R00A 4DH7A 5E8XA 1H1PA 4IZ7A 3GC0A 4FT3A 4ZTRA 3UZRA 2FGIA 3JUHA 2PVLA 2B4SB 3RALA 3TNPC 3EQCA 2CNQA 2WD1A 3HLLA 4CYJA 5BYLA 5I9YA 3E87A 5A4EA 3DQWA 1E9HA 2R9SA 3MN3A 2VZ6A 5CTPA 5G6VA 1RJBA 2X4FA 4A9YA 5BMMA 1PXLA 2WMTA 4CSVA 5K9IA 3OCTA 3WZDA 4NTSA 3CBLA 3QQKA 4YJTA 2UZDA 1GNGA 4QPMA 4EOPA 4R78A 3KB7A 3U54A 1DM2A 3OTVA 1DI8A 3PXKA 1HOWA 4RZVA 1FQ1B 4ASEA 2XK7A 4R7HA 1KE6A 2UZUE 5C27A 5L6OA 1R78A 1QPDA 4IC7A 3TNIA 3BYUA 3KQ7A 5B7VA 5BVNA 4FOCA 4X21A 3W8LA 3AT4A 5LJJA 3EL7A 5L8KA 3C50A 3EQGA 3OHTA 3QX4A 4FVPA 3V5WA 2BZIB 5HG7A 1BL7A 2YM3A 4O81A 4CD0A 5LMBA 3ACJA 2JKOA 5F94A 4JL9A 3OXZA 5HGIA 3DY7A 2WMVA 4ZTQA 4FV5A 4RG0A
chains in the Genus database with same CATH superfamily
2JFMA 4O38A 1WVWA 1Q3WA 3LQ8A 4MEDA 3R7YA 3UJGA 5EKNA 5HD4A 3EN6A 4O7RA 5IMEA 3NX8A 4A9RA 4C34A 2QO7A 1WBOA 2G2IA 4FV8A 4KSQA 3E64A 2X9EA 3ORZA 4NK9A 2OWBA 3UG2A 4AGCA 1PJKA 4TN6A 5C9CA 4C4FA 5J7HA 4IVCA 2BILB 3LFBA 4AN9A 1KV2A 1OL7A 5AR3A 3GXLA 1WBPA 4FV2A 4G3GA 3UIBA 5CANA 1ST4A 2CNUA 4KIKB 2GTNA 3BX5A 4U6RA 5GNKA 3V3VA 4XOYA 2ETMA 3FZSA 3ZLWA 5LCJA 4PP7A 1JBPE 5D12A 3RK9A 3OWJA 3AD4A 2QOIA 2CKQA 1MUOA 2QD9A 4YHTA 1NY3A 3KMUA 1DAYA 1UU8A 4FV9A 3DXNA 4RLLA 4RX9A 5ETCA 1I44A 1APME 5E8TA 3MB7A 2OI4X 2RGPA 4IZYA 1PMUA 2C6IA 2UUEA 1L3RE 3DDQA 4QTAA 4RX5A 5C4KA 2GFSA 3AC3A 2OZAB 4E3CA 3DFCB 1IR3A 4HCUA 3A62A 3KRJA 1PY5A 4I20A 3ZZEA 4F99A 4FVRA 3W55A 1H0WA 5M4FA 5A4QA 2PZPA 3D4QA 3QQUA 4HVGA 4IVDA 3TDWA 4I5MA 3BHUA 1OBDA 5HCZA 2WKMA 4FV6A 3FJQE 4YZCA 4D0XA 5JKGA 3ZFMA 4BN1A 4XG8A 4DGGA 4FEWA 1LR4A 3BU5A 4NUSA 4X3FC 5E8SA 1FGIA 4FT9A 4I6LA 4DT8A 2QU6A 4FSRA 2C1AA 3P23A 3ITZA 4D58A 5JGBA 1YWRA 3LMGA 2UW5A 4GUEA 4L8MA 5AP0A 5EW8A 2P2IA 4FODA 1VZOA 3QQGA 4QPAA 3W0PA 1OPKA 2IVTA 5DA3A 4IADA 4WT6A 5FP6A 5HTCA 4TYGA 5IISA 5DLSA 3Q4ZA 5AP4A 3KEXA 5GZ9A 1URWA 1JQHA 3EMGA 5HESA 2BDFA 5IF1A 3OUKA 5CVHA 2GQGA 2YIWA 1OPJA 5CF8A 3JR1A 5HBHA 3DQXA 3EFKA 2WMBA 4E1ZA 1P2AA 2YCRA 1H1WA 3QRUA 4NFNA 4AGWA 4EBWA 3PDTA 2FSLX 3VBTA 4I22A 4LQMA 3FYJX 4BHNA 3RAKA 3NCGA 3MA3A 1Z5MA 2IZRA 1ZAOA 2JFLA 3VW8A 4O0TA 3IECA 4Y95A 5J87A 2CPKE 1WBTA 2X7OA 2YZLA 2ZV2A 4LGGA 2BRNA 2VTHA 3FZTA 2XF0A 4CQEA 5KHXA 4C2WA 2V7AA 3OOMA 1KUTA 3DB6A 1VEBA 4KUJA 2IG7A 2F2CB 4J7BA 5AP1A 3HUBA 3KRLA 3P5JC 4HVIA 3Q3BA 2OFUA 2R3OA 3GFWA 1KV1A 4FEUA 4G5PA 4X6QC 3QWKA 3R9RA 2OICA 2G01A 4CFXA 4DFYA 3V04A 5TT7A 4BZDA 4QO9A 3TZ8A 4BDBA 4I93A 1YI6A 3UDSA 4BKJA 2IF8A 4LMUA 4FSZA 3LFAA 3PRIA 2QONA 4RRVA 3ZFYA 3DV3A 1UNHA 2B1PA 5AAFA 3TI1A 3Q9XA 4NU1A 5KMIA 2EXEA 4G1WA 4MCVA 3C4XA 3R04A 3M2WA 4FL1A 5BUJA 3E92A 3QUEA 2C0OA 4HCTA 3MVJA 3RCJA 4PF4A 2XZSA 5CYIA 4MBIA 3GBZA 1OL6A 4ENYA 1NA7A 4IVBA 1U5RA 4EHEA 3MFTA 4K2RA 1GAGA 2O2UA 2Y0AA 3CCNA 4G9RA 2C68A 5EHOA 4EH4A 4USEA 3AG9A 4LV5A 3RINA 4BDEA 3ID6C 2KULA 3Q5IA 2UZVA 3CC6A 3BL9A 2X6DA 4RT7A 4RIWB 3V5QA 2WTDA 1MRUA 4DTBA 2IVSA 3UO5A 2C3KA 3WARA 3V8SA 5IH4A 3O17A 4A4XA 5JFVA 3IO7A 2E9PA 2ZDUA 5LMKA 4BDFA 4G3CA 3SOAA 4CXAA 2WOUA 4QMNA 4GIIA 3UO6A 5C1QB 2DQ7X 5AM6A 4G16A 4EOKA 3LCDA 4AA0A 4ZMFA 2YHVA 3U4UA 4WNMA 4MXOA 4EL9A 2VWYA 1Q8TA 3Q9YA 4M8TA 4EC8A 4NWMA 4C61A 2JIVA 4XP3A 5ICPA 4NM5A 4FIJA 4L45A 2ACXA 3NS9A 5GJFA 4ZEGA 2OBJA 3QHWA 4KAOA 4YTIA 2G2FA 3FWQA 5B0XA 3ROCA 3E93A 5HKMA 5CX9A 2AQXA 5KO1A 4O4CA 3L8PA 2HZ4A 1JKKA 3HV4A 3DKCA 4BDJA 4RWLA 3IOKA 3PA4A 3AMYA 2PVJA 5L2TA 3D5UA 2I0VA 2ZVAA 3GCSA 1V0PA 3NYNA 3QGYA 4F6UA 3O8UA 3EB0A 1XH8A 2C47A 2JBPA 4YPDA 3ORIA 3DBQA 4KWPA 3PY0A 3KXGA 3D7ZA 1SM2A 5CZIA 3PUPA 3PXFA 4BCIA 4YURA 4A4OA 3KXZA 4R3CA 4BKYA 1Z9XA 5JQ5A 3SVVA 4AOTA 3TV6A 3Q2JA 2ITUA 3NSZA 1Q24A 3SC1A 4AA4A 2UV2A 3F5XA 4KIPA 1W2DA 2A0CX 2PVFA 3DLZA 5HTBA 3NNXA 5IG1A 3DKGA 4DYMA 3ZXZA 2XARA 2IZUA 1TQIA 4S2ZA 3DDPA 3OW3A 4ZTHA 5HD7A 5LVPA 4K9YA 3QX2A 3E62A 2BAKA 2BAJA 2CCIA 4I6BA 1LUFA 2VO6A 4FUXA 4L46A 2QLUA 4F7SA 4LUEA 4Z7HA 1ZWSA 2EWAA 4MNFA 4V0GA 2IVUA 3ZLYA 4TXCA 3DK7A 2X7FA 2CLXA 4CMUA 5L2IA 3PTGA 5EFQA 4L3JA 4HJOA 4M66A 4I4FA 4OTDA 5D7AA 2SRCA 3VBQA 2IZTA 4IAAA 4B9DA 3ZSIA 3CPBA 4EOJA 4Y5QA 4OTWA 3DNEA 2ZOQA 2QG7A 2Z02A 3AKLA 2E9VA 2QVSE 2QKWB 3QBNA 3BV3A 4GW8A 4D1SA 4HVHA 4G3FA 3TZMA 1IAJA 4LOOA 3AC8A 3E7VA 4M7IA 4S30A 2BDWA 1XR1A 5EM7A 4EH8A 3HV7A 2EUFB 3Q2MA 4H3BA 3NIZA 4YC6A 5K0XA 3W32A 3KREA 4BF2A 4DGLC 3DTCA 4DEAA 5CF6A 1Y91A 4YBKA 1K9AA 5FEDA 3VHKA 3WF6A 5IMXA 3QD2B 1YWVA 3V8WA 1G5SA 5L8JA 1F0QA 5B2MA 3P0MA 4FV0A 1PHKA 4U42A 4BDDA 4WBBB 1ZRZA 3SW7A 4RWIA 3LKMA 3FZ1A 4PDPA 4GFGA 4UZDA 1Y8GA 5TE0A 4S34A 3UOHA 3HAMA 2GNJA 3ACKA 5CSVA 3R9DA 5M51A 4AXDA 4HNIA 1FPUA 3QTXA 3JYAA 3RPSA 4BI2A 3ZM4A 2VTQA 4IVAA 4FT0A 3FMMA 3JY9A 4I6FA 4FEQA 3CJFA 4FC0A 4I0SA 3OCBA 4MD9E 5K0KA 3MIAA 4MYGA 4OTIA 5DIAA 3QWJA 2BRBA 5ETAA 2CKOA 3UOLA 3DAKA 4JR3A 5KMOA 3MW1A 4X2NA 2J0LA 4ZLOA 5EYDA 5JFXA 1SNUA 2ETRA 2A98A 4FZFB 4JDIA 5HIBA 4MNEB 4FTJA 3UPXA 5JEBA 2HZNA 3CKXA 3E3BX 4PTCA 5EYCA 3RGFA 4JR7A 4PTGA 3TN8A 5JRQA 1JVPP 4QDVA 4IWOA 5J79A 5IH5A 4YPSA 1Q61A 2FB8A 4PL4A 3ROYA 4U81A 4YNEA 3KA0A 4ZAUA 3KFAA 4AAAA 3SRVA 4UWCA 2GNHA 4U80A 3LFSA 5KBRA 5AM7A 3OP5A 1STCE 2BUJA 1ZXEA 2AC5A 4DHJA 3H4JA 5DT4A 3F88A 2VX0A 3OW4A 3Q4CA 3VUGA 3W2SA 1Q8WA 3PSBA 4YTCA 4IAFA 5L2WA 2F49A 3H3CA 3C0HA 3KKVA 5CVGA 2BZHB 2XEYA 3DJ7A 4GKIA 5BQ0A 4ID7A 3HNGA 5HBEA 3VQUA 2VWBA 3MI9A 5FG8A 3ZBXA 4BCJA 5JK3A 1OGYA 1SZMA 4KKEA 4HYUA 3EKNA 4E5WA 4M3QA 5JFSA 2PE1A 3ZUTA 4G3DA 1CM8A 5AX3A 2Z7RA 2JDTA 1NVRA 3AC5A 4DFZE 1IA8A 4TW9A 2WTWA 4ZZNA 4U3ZA 2PVNA 4QMTA 4D9TA 4YMJA 4OAVB 2G15A 4ZSJA 4NYEA 4O0SA 1W7HA 3B2TA 5I9WA 5JZJA 1PF8A 2WTKC 3I0OA 3UNKA 4KBAA 4A4LA 3G90X 2Y8OA 3BI6A 3R7IA 2P2HA 2C69A 4UWBA 2XA4A 5CWZA 2JDVA 5EK7A 2OIDA 4AZFA 2HIWA 2UZEA 4F1TA 4IBMA 4LOPA 3UVQA 5K5XA 1VJYA 4O6LA 4WHZA 4D4RA 4U8ZA 1IAHA 3OG7A 4EQUA 4RVKA 4UMPA 1RDQE 1BLXA 2X8DA 3FMEA 4GK2A 5BVFA 2YACA 2YLEA 4OT5A 3VBYA 5FM3A 3VULA 4C7TA 4ANQA 3DA6A 4XG2A 4I94A 5BVWA 5BUEA 4X2FA 4E4XA 3OY1A 3PPZA 4G9CA 3UDBA 4PMSA 3KMMA 4LV7A 3QCXA 5A6OA 5KCVA 3VF8A 3G5DA 2I0YA 5HVKA 3AC2A 2GHGA 2XCKA 4FNZA 4ASXA 4X0MA 4PV0A 4N6YA 2VWUA 4RIYA 4BVUA 4O7LA 2O3PA 4PDYA 4AQKA 1W98A 3PXQA 5HI2A 4CG8A 3IQ7A 4BDGA 2BTSA 4IXPA 3Q60A 3ZBFA 1RE8A 2H96A 4LGHA 3HKOA 5AMNA 2UW7A 5AR7A 4O7VA 3OUNB 4A7CA 3Q96A 2WTIA 1IRKA 3WF9A 2OH4A 5KMLA 4JIAA 4L68A 4DGNA 3OCGA 5CY3A 5H8BA 2P55A 3QZFA 4BI0A 5BNJA 3CS9A 3R2BA 4YJSA 4A9UA 1MQ4A 3KCKA 4GG5A 5J1VA 5I9XA 3S2PA 4BCNA 3DOGA 4Z3VA 1NVSA 2Z8CA 3MFRA 4JXFA 1KE5A 4Q9ZA 2R3PA 4J8MA 4YTFA 5BVDA 4TWPA 3U4WA 5IQBA 5H8GA 2UVYA 1REJA 2OIQA 2FH9A 5IZFA 3BL7A 5H9BA 4YR8A 2XK9A 3SG8A 1JSUA 1V0OA 2IJMA 2R7IA 3FY0A 1O9UA 2J9MA 2JKMA 3HL7A 3U8WA 2X1NA 4QDEA 2BTRA 3OC1A 3O7LD 1WFCA 3LLTA 1BUHA 5GZ8A 3QC4A 3F82A 3AD5A 1XQZA 2Z60A 4I5PA 4ERKA 4JDJA 2WMRA 3HMNA 4J97A 4O83A 5ANKA 5B2KA 2RL5A 1XBBA 4BBEA 5CEOA 3T8OA 5HNBA 5A46A 3MPAA 5FXQA 5DNRA 5I9ZA 3COHA 3KMWA 4C62A 4FT7A 5CU6A 3UVPA 5HNIX 3PXRA 2GPHA 4HYHA 4JG6A 4O22A 3G51A 4GT5A 5BMSA 4KB8A 4GT4A 2VV9A 4DA5A 3TIYA 1T46A 4XG6A 2QNJA 4YSJA 1SYKA 4IM2A 5J95A 4XBUA 4F4PA 3QFVA 2XYUA 3FLWA 3DT1A 2XNPA 3DS6A 3NYXA 4FSUA 3UGCA 2J0MB 2V0DA 4C3RA 3FXZA 3HRCA 2YZAA 2ZM4A 3LAUA 4BCPA 3COIA 4M69A 3MGYA 1OBGA 4MUQA 4FTIA 2QI8A 3FSFA 3F3UA 3IKAA 4QYGA 2ITNA 1KE9A 2C6OA 4MKCA 1WVXA 4DFXE 3P86A 3SA0A 4HCVA 2PUPA 3MESA 3GCUA 1Q5KA 2X2KA 2B55A 4H39A 4AT4A 3ZM9A 3PA5A 3NNWA 4F9WA 5KKRB 4WIHA 2VWZA 4QP9A 2ONLC 4FIEA 4D4SA 4XNEA 4I23A 4RC2A 1QL6A 3A7HA 3DBDA 3CSVA 3R8PA 2BDJA 1JWHA 3FQEA 2Y4IB 2NPQA 3MY0A 3DBCA 2YDJA 3OXIA 4BDKA 3BU3A 4QMQA 2JDSA 3TEIA 2W06A 2WQMA 3QZHA 2BHHA 3Q6WA 1WMKA 4EOOA 4CKJA 2W5HA 4OUCA 3LFFA 4N0SA 2X6EA 3FI8A 2QLQA 3U51A 5ANOA 3TTJA 2W1HA 3TXOA 3VS3A 3FQSA 4AUAA 3H9FA 5M53A 3OWPA 4QMUA 3UC4A 4L43A 3VUMA 4GL9A 4JX3A 3HAVA 4FICA 4EHVA 2YIXA 3UO4A 4F09A 4E5AX 4IMYA 3BYMA 3ET7A 3ZC5A 4K6ZA 3GOPA 5IA5A 5GIPE 3CGFA 4JBVA 4C38A 4E4NA 2PZRA 5KMKA 3W0SA 5BUIA 4GFOA 2WTCA 1BI7A 4U44A 4GH2A 3SHEA 3EH9A 4NEUA 3FPMA 4RJ3A 4E6QA 5AV1A 5IDPA 5HZNA 4XRJA 1R0EA 4O7TA 3NIEA 2GS7A 2OH0E 5HNGA 5CEQA 4HVDA 4IJPA 1PMVA 1YDTE 3PG3A 5L6WL 4FTLA 5E1SA 5H3QA 2PULA 1H8FA 4AU8A 1YHSA 4EK3A 2UVXA 3PPKA 5LARA 4CFMA 1U59A 5EYMA 4WNPA 4JQEA 3ZSHA 4G6OA 3KK9A 1YVJA 3F7WA 2AUHA 3FI3A 4GRBA 4QP3A 4BCQA 4CTBA 2C4GA 5HX8A 4DHFA 5DR6A 3PJ3A 2XYNA 3BYOA 4RLKA 1OIYA 2HWOA 5HLNA 1OECA 3PWDA 5D9HA 5I0BA 1WAKA 2GS6A 2IVVA 3KN5A 4ANLA 5I5ZA 3DAJA 2ZM3A 4R8QA 3WYYA 2Y9QA 3E8EA 3H30A 4XP2A 3NPCA 4WSYA 3OD6X 5AUYA 4L6QA 4IWDA 4NJ3A 5AIRA 3ZO1A 2O64A 2XJ2A 3HECA 3R02A 3FMDA 3ALOA 4L67A 3UIUA 1M2RA 1YI4A 4D55A 2BRGA 3W8QA 3NFGB 1PXJA 4PPAA 3HMOA 3CEKA 2XNNA 1K3AA 4RJ6A 4Y46A 4QOXA 3GC8A 1G8JA 4WUNA 4ZZOA 2UW6A 3K5UA 2BRMA 5EW3A 1DI9A 4HPTE 3SXFA 3W2OA 4D4VA 2UZBA 1Y8YA 4F65A 1U5QA 4F9CA 1Y6BA 2C3LA 3I7BA 3PLSA 5JZNA 3WILA 1Y57A 2WIPA 2VGOA 5C8NA 3SV0A 5JQ8A 3KXXA 2RKUA 3EQFA 1Q99A 2ITYA 5ANGA 5AP7A 3FEGA 2XIXA 1H24A 2YABA 2CCHA 2PUUA 4JLCA 4XV2A 3VAPA 2VTSA 4RIXB 3ZSGA 5KMNA 4BTMA 4MNEA 3Q52A 4OBOA 5IA4A 2FVDA 4TWCA 3AGMA 1J91A 2GTMA 5A54A 2J5EA 2QCSA 2VTTA 4WG5A 4X7QA 4F0IA 2XNGA 2DS1A 4BDIA 4F08A 3NGAA 1YWNA 2R64A 4AXFA 3TNHA 4MQ1A 2RG5A 1IG1A 3FLZA 5EOBA 3MY1A 1ZZ2A 3V5PA 4XV1A 4FKRA 5EI6A 5J5SA 4CRSA 1WBWA 4TWOA 2HY0A 4XHKB 3HV6A 4H36A 2PE0A 3IPHA 3WI6A 5TF9A 2O5KA 3AXWA 3VQHA 3BRBA 2V55A 3GU4A 3P79A 4DTAA 5M44A 3TKHA 3PE2A 4FTOA 4ZJIA 4DF3A 4RZWA 4BDCA 5I3RA 3R1SA 3P9JA 3TKUA 3G9LX 4AXEA 3DXPA 4QTDA 3PIZA 1P14A 4WG4A 3ZS5A 3R28A 4P2KA 1JAMA 4IX6A 2XB7A 2YITA 5JH6A 3D83A 3L9LA 2YIQA 2OG8A 4R3RA 2UW8A 3IOPA 3JVRA 4QT1A 3HEGA 3I81A 2PVMA 3IONA 4FV3A 4YJRA 4O0RA 3LJ1A 3MH2A 2BKZA 4L42A 4GEOA 3O8TA 4O2ZA 3SQQA 4D2PA 2WTKB 5KUPA 2O8YA 4LI5A 4YZDA 3W2PA 1O6LA 3MFUA 4E6AA 3UIXA 2YISA 3MPTA 4ACMA 4FE2A 4ZZMA 4D9UA 3FMLA 5CXZA 5KNJA 2X4ZA 2C5VA 3BGQA 4AOIA 4MBLA 2ZAZA 3GVUA 5L4QA 4YJPA 3Q32A 4BDHA 5AAEA 3KF4A 4EOQA 1UU9A 3VHEA 3QLFA 3RM6A 4I21A 4OLIA 1J7UA 3PSCA 4WNOA 3UOKA 3K2LA 4FSMA 3MS9A 4EZ5A 3BYVA 3ORXA 4DG3E 1YXXA 3N9XA 1XH5A 2YCFA 2ITWA 3F69A 3O2MA 2QR8A 4YGAA 4FNWA 4DFUA 3ORPA 1LP4A 4ASZA 4EK6A 1G8AA 2I6LA 2QQ7A 4O4BB 2YDKA 3QD3A 4RJ5A 3QTIA 2WAJA 1QPEA 3RHKA 1BMKA 3MJ2A 4F78A 2CGVA 2C6TA 2QOBA 3VS7A 3ZHPC 4IZAA 5HIDA 2CNVA 5DR2A 4B8LA 4YSMA 5AFVA 4R6VA 2VGPA 2PU8A 3CJGA 4RSSA 4FTQA 4K11A 4KRCA 2QODA 3RP9A 3IW7A 3C5IA 3LOKA 4G31A 4UY9A 4CFWA 2LAVA 4B7TA 3WZEA 1GZKA 2C0IA 4RPVA 4GU6A 3C9WA 3C4ZA 3POZA 4GYGA 4GVJA 4PPCA 1NT2A 5IA0A 2BIYA 4WUAA 4PTEA 1J7IA 4WA9A 3W0MA 3BHHA 1YOJA 4IACA 3R6XA 3M42A 4C4IA 2VWXA 1YXSA 3KGAA 4NSTA 5CT7A 5J9YA 5EHLA 4YU2A 2B0QA 4XH6A 3CD3A 4Y5HA 4GS6A 4C4GA 2O0UA 3PIXA 2XNEA 4EK5A 4FKTA 4TNBA 2A27A 2XJ0A 2UW3A 5FBOA 5M56A 5HLPA 1M7NA 3DNDA 2CGUA 4FKVA 4BY9E 1DS5A 3GU6A 1XH4A 4EUUA 5K4IA 3KULB 4NKSA 1U54A 1YHVA 3ELJA 1VYWA 1XBCA 4JS8A 4DGMA 4UB7A 2UZOA 3GFEA 2XVDA 4TY1A 2OKRA 4GG7A 4NM7A 4QP6A 3PP0A 3UQFA 4ZJVA 2ITPA 2ITTA 3LFCA 4IAYA 1H27A 1X8BA 2GNFA 3FMJA 3PJ1A 4MTAA 4YJOA 3SXRA 4QTCA 3ORMA 4K1BA 5BYZA 5EM6A 3I79A 3GC9A 5L2SA 5E92A 3QGWA 5C8MA 1ZYDA 2CMWA 4DBNA 2RSVA 3CXWA 3Q5ZA 5EYKA 3OXTA 3L9MA 2Y6OA 3D14A 4O1OA 3EHAA 4TYHA 5FLFA 3BZ3A 3W18A 3FLQA 4PL5A 4CZTA 4EH3A 3L9PA 2OJFE 4E4MA 5CAUA 4KIKA 1PW2A 5CU2A 2R3LA 3BHVA 1FMOE 2ITZA 5ACBC 4Q5EA 4Z7GA 5AWMA 4XMOA 2PZ5A 2X81A 3UNZA 2VX1A 1W0XC 3AOXA 2IW6A 5FD2A 3VRZA 3RMFA 5A9UA 1YOMA 5FQDC 4GT3A 4X3FA 4CT2A 3GQIA 2BROA 4E5BA 3NYVA 4YLKA 4G6LA 4FJVA 3BLRA 4RVTA 4NCTC 3GP0A 3SGCA 3NLBA 5IQHA 4IM0A 2YM7A 2F2UA 5HQ0A 3DCVA 5AP2A 4FYOA 4AA5A 4UZHA 2XIRA 2ITOA 5AP5A 5FM2A 1G3NA 3PLAE 2VO7A 2RFDA 1XJDA 4P7EA 4O2PA 3WZUA 3NUPA 4FTMA 5T6KA 2ETKA 4A06A 2X2MA 2ZFYA 4XG4A 3O51A 3UBDA 5KHWA 4ERWA 4J99A 4F0GA 3FDNA 3CKWA 4D2RA 4DCEA 4D0WA 1ZY4A 3NW6A 4BIDA 2VWIA 5E4HA 4QYHA 4FYNA 1UVRA 2CGXA 4QMOA 4BIBA 4DEEA 3I5ZA 2ZMCA 5LVNA 5CZHA 2J0IA 1OM1A 3RJCA 4E6DA 2A2AA 1J7LA 4TYJA 2XP2A 3VBXA 3LCKA 4XP0A 4O0XA 2R3QA 3CY2A 4GJ2A 4ASDA 5CI7A 4RC3A 3TL8A 4DFNA 4Z16A 3SLSA 1ZOEA 3HP2A 4FIHA 3MSSA 4WG3A 5KZ0A 2PL0A 3IGGA 4JOAA 4B99A 2WMSA 5AIKA 4H3PA 5HO8A 1AQ1A 2EVAA 4QTBA 2WMWA 3R1QA 4L7SA 4Q2AA 4M13A 3EQPA 4ACHA 4DFLA 5LVMA 5M06A 5H8EA 4BKZA 3E8DA 3VC4A 4FBXA 2B53A 4RJ8A 2RFNA 1ZYLA 2QOKA 2PVHA 1Q8ZA 3E8NA 4J53A 4J8NA 3SW4A 3UPZA 3QYZA 4EOLA 3OMVA 3BLAA 3FL5A 3PJCA 2W4JA 2PHKA 3C1XA 4IAIA 2Y7JA 4DAWA 5FWKK 2W9FB 3TV7A 1A06A 3G6HA 3TG1A 3PZHA 2VTRA 3ORLA 4ZTMA 1BI8A 2OJGA 3B8RA 3BCEA 3D2KA 4FT5A 5H2UA 4PL3A 4AACA 3DK3A 3OT3A 3AGLA 4IEBA 1YXVA 2XNBA 3O0GA 4UXLA 3MA6A 2X2LA 2WNTA 3ZLSA 1KWPA 2W1ZA 4J95A 5EQEA 4BYJA 3RZBA 3LM5A 2CHLA 4IB0A 3QZGA 2BKKA 4C8BA 4DLIA 2CGWA 5DMZA 2W1IA 4S32A 1ZARA 2VN9A 4FZAB 2E9NA 4QMXA 3FZPA 4IAKA 4ZY6A 2PYWA 4NW5A 2VNYA 4BB4A 1T45A 2WELA 1CKJA 2B9IA 5IKWA 2W5BA 2OF4A 3L8VA 4CFVA 4QP7A 5ANIA 3PFQA 3R1YA 3UNJA 5AA8A 4PDSA 3QXOA 2R5TA 4DH5A 3IW4A 3OF0A 1PYEA 4MBJA 2DUVA 1SMHA 4F7NA 2VNWA 4KD1A 3R8ZA 1K2PA 1PKDA 2C5YA 3G0FA 3QD4A 2WMXA 3GUBA 2HOGA 4EWHA 2WXVA 3IW5A 1LPUA 5AV0A 4QP2A 4C2VA 4APPA 3ENMA 1MP8A 3RK5A 5DT0A 1OKZA 3ZEPA 4O7SA 1Q41A 1UNGA 2I0HA 4PX6A 4BR3A 4IC8A 3E3PA 4OBPA 4FG8A 3N4VA 4KS7A 2P4IA 4DHZA 2XBJA 3R22A 1W82A 3TT0A 4D2VA 3FC2A 2VTMA 2Z7SA 3TV4A 4PDOA 3ZYAA 3W2RA 2BFYA 3BEAA 2WZJA 3R8VA 3F61A 3COKA 2OXYA 3R9OA 1ND4A 2PY3A 3LFDA 4GIHA 4AF3A 1R3CA 2G2HA 3GU5A 4EONA 4KRDA 2B52A 4J52A 5TR6A 4L9IA 2XM8A 3AMAA 1OKYA 3SRVB 1ZLTA 3F2NA 4KINA 5F20A 5JMSA 1L8TA 4O7YA 3BE2A 3BGPA 1GY3A 4CV8A 1UNLA 3A8WA 3NW5A 4FGBA 5HBJA 2E2BA 4UX9A 3PUFC 2J90A 3A4OX 3IDCA 3QCYA 4XX9A 4NL0A 3SKCA 4FSNA 3VS5A 3Q4UA 3U9CA 4BYIA 4KS8A 2HXLA 2F9GA 1H1QA 2C6KA 1BX6A 3ZRMA 4RX7A 1SVEA 3A60A 4D5KA 3MDYA 4F9YA 4TWNA 2ITVA 4EQCA 4QEBA 3SXSA 3PXYA 1YXUA 3LCOA 4GK3A 4R77A 4OTGA 2OZAA 3HVCA 4QTEA 4E20A 5M08A 4GMYA 4F6WA 2ZV9A 3DKFA 3U87A 2WQBA 3NUAA 4DBXA 4AGDA 4D5HA 5CEMA 3KVXA 3HZTA 4OT6A 3RKBA 3LFQA 3DZQA 2ITQA 4G17A 3ZUUA 4ANOA 4DITA 5AA9A 4D2SA 3RPOA 2R2PA 4R3PA 3CPCA 1WBVA 5EDRA 3D7TB 3BELA 4BTJA 2HWPA 2VTNA 4N70A 2OU7A 2GS2A 4U7ZA 3UZTA 1ZYJA 2YM8A 4CFFA 3I4BA 4I4EA 5DR9A 5M57A 4DT9A 1LEZA 3LE6A 4CV9A 4OR5A 4ENXA 3CTJA 4BGHA 3NNUA 1R39A 4CZYB 5EOLA 3MPMA 4BICA 2ERZE 3ERKA 1OIRA 2EU9A 1E1XA 2W05A 3QYWA 4O4EA 3WE4A 4CEGA 1SVHA 5JFWA 4CMTA 2EXMA 4UYNA 1ZMUA 3V5JA 4MQ2A 1WZYA 1GZOA 4FK6A 4CMOA 4IB5A 4LV8A 3W16A 1UKIA 5EM8A 4QMSA 3WF5A 4IX3A 4BCHA 3OT8A 4KIOA 5TOZA 2BMCA 4FL2A 2CDZA 2AC3A 3C0GA 4EKKA 4PY1A 4MD7E 4ACGA 3GCVA 4EEVA 1WVYA 4U79A 3PJ8A 2J5FA 3ZONA 4KSPA 4ZJJA 3EFLA 4A9SA 4EQMA 2XALA 4BJJB 4FEVA 4RMZA 4D4YA 1XHAA 3GEQA 4RVMA 1PKGA 1YXTA 1W83A 4U0IA 4CKRA 2J50A 3MBLA 1QMZA 4UMRA 2IEWA 3ATSA 4KIQ