5LJJA

Crystal structure of human mps1 (ttk) in complex with reversine
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
281
structure length
264
Chain Sequence
b'FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMEYGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTDSQVGTVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Structural basis of reversine selectivity in inhibiting Mps1 more potently than aurora B kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 264
sequence length 281
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ljjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ljjA01
2YCQA 2ZAZA 5AAEA 2EB2A 3Q6WA 1OKVA 3VBTA 3NLBA 2YIYA 4P2KA 3THBA 3VF9A 1ZOHA 3L1SA 4GJ2A 2B9JA 2YDJA 1ZYSA 2FYSA 3DK6A 4X3FA 4DYMA 2C6LA 4WRSA 5ANJA 2OW3A 1Z9XA 2C3KA 2BTRA 3W2OA 4C2VA 3L8PA 4W4WA 4WG4A 3GC0A 2C5YA 3W2QA 2QOQA 3OT3A 3QD2B 3QKLA 5E8VA 1U59A 2Z7SA 1ZZ2A 3RK5A 2GPHA 4QPAA 2HWPA 4UALA 3VS0A 4ZLZA 2XCKA 4C4HA 4R5SA 1IEPA 3ITZA 3A7FA 4GYGA 4RZVA 3R7OA 1W98A 3G6HA 1UVRA 1XQZA 3H10A 1W82A 3HNGA 5AP1A 5TR6A 3ULIA 3T9TA 4EUTA 4ZTMA 5K4JA 3G5DA 1Y6AA 4KB8A 5IDNA 3W16A 3CR0A 4EH5A 5L2SA 4ZJIA 2C4GA 4RA4A 1TVOA 2G15A 3VO3A 3HV7A 2P55A 4J99A 3UOJA 5IH5A 5KUPA 5JZJA 1YXXA 1O6LA 3ZRLA 2C6IA 3E5AA 1Q99A 4MYGA 4LV5A 2XNPA 2YCSA 1KOAA 2BFYA 3EQIA 3FZTA 4KD1A 5CNOA 5C03A 4W4XA 4UMPA 5CEQA 4EOJA 4FVQA 4UMRA 3DBCA 3EQHA 2ESMA 3MTFA 4G3GA 4RQVA 3VS1A 5LVLA 4A9UA 3P4KA 3SXFA 3UIMA 2JDSA 4L52A 2IW8A 5HX8A 4YZ9A 4AU8A 4AQCA 4C3RA 1XH9A 1WZYA 1QPDA 5CTPA 1SM2A 5T68A 4L46A 4IXPA 4QD6A 4HJOA 5JGDA 3RK7A 4CSVA 1ZAOA 4U80A 3ZM4A 4ZLOA 4R78A 1S9IA 4DTAA 3N4TA 3PWDA 4QMQA 3LFEA 2GNIA 3ZOSA 4OTGA 4DLIA 3I0QA 3UG1A 5AEPA 4C37A 4FT3A 4DH3A 4YURA 5KBQA 3H0ZA 5J1WA 4ZAUA 4RIYB 3PA5A 3ANRA 4O91A 4Y5QA 1YWNA 4YU2A 1APME 1SZMA 1Q8TA 1YI6A 2FH9A 3ERKA 5A4TA 3HECA 5CEMA 2SRCA 5FTQA 2QO7A 3F3VA 3O8UA 3OFMA 3DQWA 3OCSA 4PF4A 3QFVA 3D83A 5AR4A 4BY9E 5DA3A 1P14A 1XH7A 2C3IB 4F7NA 3LKMA 2CLXA 5ACKA 4FTJA 1GJOA 3ZCLA 3LM5A 4C34A 4DT8A 3BV2A 4J95A 2XM9A 4RIXB 4YTCA 3FI8A 5TOZA 1CSNA 1JSUA 1GIHA 4CLIA 3VBXA 4U41A 4CYJA 4AZTA 5TO8A 5I9XA 5HORA 1T45A 4RMZA 3NNWA 5CAQA 4LUEA 2XK8A 4IDVA 2P3GX 4DH7A 2OIDA 5IQHA 2B4SB 2F2UA 4U81A 4CMTA 3PLSA 3AG9A 4U7ZA 4UYNA 4XBUA 2R3HA 3SRVA 2PVMA 5CALA 3DAKA 2YAKA 2PUNA 5AM6A 2B9IA 4IJ9A 5JZNA 2HYYA 2RF9A 2P0CA 4G5PA 5IA4A 4DTKA 4M12A 3C0IA 2WPAA 4FTQA 2R3FA 3SA0A 3PY3A 5DNRA 4PNKA 1OIUA 4CKJA 2JITA 4KIPA 4E7WA 3RPRA 2PZIA 1BUHA 4FSUA 3RNYA 1KUTA 3OVVA 3OW4A 2B52A 2C6TA 3CTQA 4P90A 4BHZA 4M67A 4O27B 5LMKC 3ZUVA 4FOCA 1JSTA 2E9NA 3W10A 4FKRA 4W9WA 5CI7A 5EYDA 4FI1A 3ZEPA 1RW8A 5HKMA 1W84A 4IB3A 2HXLA 2Y4IB 1SNXA 2VNWA 3S1HA 1QMZA 4PPBA 4EQMA 2V7OA 3FUPA 4IVAA 5J95A 4OTFA 2R3IA 3PPJA 4C0TA 4C4EA 3OXZA 2J5FA 3FV8A 5FWKK 4X2JA 5GJFA 3FKLA 2F7EE 4IACA 3VF8A 4D55A 1K9AA 3NIZA 1OI9A 4S34A 1XBAA 5CSWA 2C69A 4MD8E 4C61A 1FGKA 1J1CA 5ETAA 3WYYA 4DTBA 1WBVA 2EB3A 4EOLA 5IQDA 2PSQA 3LFAA 1R39A 2YM5A 3UVPA 1EH4A 4H3QA 3MVLA 2F7ZE 3TNQB 5IA5A 4HVGA 3EN4A 2W17A 4GK2A 3UZRA 4ITJA 5GZAA 4BIBA 3VUIA 5KMKA 4BYJA 4N70A 4I0TA 4DH8A 2B0QA 1H1QA 4BGGA 2PK9A 1ZWSA 4TWNA 5ETFA 4ANBA 1TQMA 5LVOA 1XH6A 2CDZA 4I0RA 3MW1A 2UW3A 1LUFA 3O8PA 4LGHA 4O0TA 4ZS0A 3L9LA 5DT3A 1QPEA 3WARA 5J7HA 5C4KA 3OBGA 1BL7A 3HYHA 4EH7A 2BRMA 5E9EA 1QL6A 3SVVA 2ITYA 2E9OA 1GZNA 5A3XA 4IMYA 3QTQA 5IKWA 1CKJA 5E8SA 2BZHB 4ACDA 4D2VA 5CF4A 1Q8WA 4MVFA 4PY1A 4B99A 4R7IA 2X8EA 1M17A 4EH9A 1V1KA 3EL8A 3TJDA 2J4ZA 1GNGA 4O21A 2PE2A 4GH2A 1Q97A 5AFVA 1O6YA 1HCKA 4DGMA 3JR1A 3O7LB 3A7GA 2VTOA 3NVKI 3JVRA 3FBVA 5BVKA 2FO0A 4QMSA 4BTMA 3HUCA 1H1RA 5HO8A 4DLJA 3KU2A 4DFBA 4YTHA 3PJCA 3ORLA 5E7RA 3FEGA 3R83A 3UQFA 3KCKA 1FOTA 3HRCA 4HYIA 4MBJA 1BYGA 3IDPA 4ZSJA 3TV6A 4C2WA 1OIYA 2O5KA 2XKCA 3MY1A 3ZXTA 1H28A 3BX5A 2X81A 2Q0NA 2QO2A 4XUFA 1RJBA 1A48A 4NW6A 2WZJA 3LQ5A 4RX9A 5E8XA 5B0XA 1NXKA 2ZB0A 3BEAA 4KBCA 1PXPA 2VX3A 5CSHA 5GJDA 2FB8A 3L9PA 5KNJA 1W83A 2VD5A 4TTHB 1H25A 4X2NA 4QQCA 2ZVAA 1KE7A 3IDCA 5FBOA 4R7BA 3AC8A 3D94A 5AR5A 2WEVA 3AC2A 2JC6A 2VO0A 1H00A 3PZHA 5L2TA 3K3IA 1REKA 3C51A 3DBDA 5KMOA 4O81A 4D2WA 2OFVA 4LL5A 5BX0A 2GTNA 3MFUA 3PA4A 2QD9A 4WNPA 3HMOA 4I92A 5IQAA 4HVDA 3FPQA 2QOBA 3FC2A 4NWMA 1R3CA 4S33A 3UPXA 4Q9ZA 3FI2A 1OPLA 3FQSA 3A8XA 4GV1A 3AD5A 5KX8A 4WNKA 5LJJA 5KE0A 3E8DA 3V8WA 4F9BA 2WFYA 4NCTC 3D7TB 4QMVA 2B53A 3ZXZA 2WMQA 2JDRA 4YHTA 4LMUA 3B8RA 1ZLTA 4ZSEA 3IGGA 2RGPA 4BWPA 4NJ3A 2PHKA 3V5LA 2WTIA 3WBLA 2KULA 2ZB1A 3HDNA 4GVAA 3C0GA 3VVHA 4BCNA 2UZDA 4X21A 4EK4A 2J6MA 4YNEA 1FGIA 4G9CA 3C7QA 5KMJA 2BDWA 2OBJA 3HZTA 5DN3A 5E8YA 4G2FA 5ITAA 4PDPA 2GQSA 4DH1A 5ACBC 2JKMA 3NZ0A 2JKKA 4ID7A 4IB1A 4NZWB 4DT9A 4U3ZA 3C1XA 2RFSA 4KKGA 4LRMA 1YXSA 3FLZA 3UNJA 2C5XA 2UZUE 1MQBA 4F4PA 2OGVA 4C62A 1OBGA 2I0YA 2QKWB 4L7SA 4A9YA 4CFNA 4TWOA 2GSFA 1ZY4A 2BDJA 2ZDUA 3NNXA 3EN7A 1DI9A 2WKMA 2O0UA 2W1ZA 3BYUA 3K3JA 4KS8A 4YJOA 1XR1A 3MIAA 1MP8A 3LXNA 2GFCA 4HW7A 5A6OA 5IA1A 2OICA 3MBLA 3NIEA 4O1PA 3PDTA 3OCBA 3RMFA 1H1PA 3VC4A 3BQCA 4IADA 3GU7A 1YRPA 4XJ0A 4JBVA 4CT2A 2W05A 2J2IB 4BIEA 4B8LA 4PL4A 2H8HA 4ITHA 4ZTQA 4ZTHA 2W5HA 4F09A 5ANDA 2GMXA 5FLFA 5FTGA 2CGWA 3PRIA 3DY7A 3RCJA 3Q3BA 2BAJA 4MXAA 2XBJA 3KMUA 3PXYA 3S2PA 2PL0A 3NW6A 2ERZE 4EKKA 5IPJA 3I6WA 3MIYA 5KZ0A 3QCQA 3WE4A 4BCQA 3MPTA 2X7FA 4QMXA 2GU8A 2IZTA 3O23A 4EHGA 3PSCA 3ZFYA 5CT7A 4AOTA 1OIQA 2VGOA 3C4ZA 4TY1A 4F0FA 4M84A 4A9RA 5KMIA 4EONA 5HNBA 2O64A 3QQGA 5HBHA 4QPMA 3G2FA 5KO1A 4G5JA 1ZYDA 2P4IA 3C4EA 4A4LA 3QRJA 1JPAA 3GFWA 3BRBA 5J87A 1JVPP 1ZYJA 3IG7A 3UZPA 2HXQA 4IWDA 3V5TA 5C01A 5BMSA 3RPVA 3EZVA 5HVKA 2WMTA 3O51A 4HCUA 5CNNA 5DH3A 5H2UA 4HZRA 4LG4A 4FL2A 4BHNA 2XEYA 4IEBA 4JQEA 3AMYA 5AR3A 4O6EA 1L8TA 4CFMA 4QMYA 4CFUA 2V62A 3LJ1A 3M11A 3QRIA 1CTPE 3UIXA 3FC1X 3K54A 5ANOA 4TYHB 3DTWA 4UZHA 4CFXA 4CD0A 4Y8DA 2R3QA 4AFEA 2R0UA 1URWA 4LM5A 1SYKA 5EI8A 1J7IA 4YJVA 4FKUA 3R9DA 3UO4A 5J79A 4AFJA 3CY2A 4CT1A 3CS9A 1Y6BA 2C5NA 5ANKA 2YISA 1FBNA 4GIHA 3QWJA 4FV7A 2R3NA 2WMUA 4FTUA 4I5HA 4YJTA 4O38A 3QYWA 5AWMA 3DXPA 4AA4A 3RWQA 4XP0A 3IK3A 2YA9A 3LCTA 4BRXA 3UNZA 2A1AB 2R3JA 4G6LA 2YCRA 5AAGA 4XYFA 3C4FA 3OG7A 4JVGA 4XV1A 1SVHA 3QWKA 4IQ6A 3OWJA 3VBWA 2WTKB 5IUIA 4PRJA 1JQHA 4BWKA 4O0UA 1OPJA 3BWFA 4RIWB 5A54A 4UZDA 4OAUC 3H9OA 3V6RA 2F4JA 3DAEA 2QHNA 4KABA 3O8TA 4HOKA 2EUFB 4TYIA 2XP2A 4APCA 4V0GA 5JKGA 4A4XA 4BDDA 2F7XE 2G2FA 2C0OA 3AQVA 3ORNA 3TCPA 3UTOA 5BVDA 5HLPA 3VQHA 4ZOGA 5HLWA 4E20A 2CKOA 5BUEA 2R4BA 1Y91A 3AGLA 2PE1A 3NEWA 4M66A 3RK9A 3MN3A 3D14A 3QQLA 3TIYA 3TNHA 3VUGA 3ANQA 4TN6A 4IZ7A 3IW8A 4ZTRA 1R0EA 3ORKA 1W7HA 2X9FA 5H8EA 2GCDA 1WBTA 2YIRA 2FSMX 3CGFA 3P79A 2RIOA 3Q5ZA 4UXQA 4RVTA 5AV1A 1YWRA 3NNUA 3D5XA 2VTRA 5J9YA 1YOMA 3VUDA 2YM3A 3P86A 4XP2A 4I6QA 3TKUA 5LWNA 5EOLA 3C50A 4DCAA 2X8IA 2G01A 3O17A 2CN5A 2W0JA 3NRMA 4FUXA 1ZMWA 5AX9A 4Q2AA 4KRCA 4GU6A 2RKUA 5F20A 3QQJA 2YEXA 2CKPA 4I6FA 5M56A 2VTAA 3N9XA 1NT2A 4FK3A 4BZDA 3PSDA 4B7TA 3ZDUA 3E63A 2W1DA 3IW5A 3FQHA 4I6BA 5F1ZA 1IAJA 3RVGA 3KREA 4CQGA 2NNWB 2BAKA 2W96B 2CNUA 2GS2A 3VBYA 1GAGA 3R28A 4O7NA 3F5GA 4TZRA 5IQGA 2XIRA 4D1ZA 3QUEA 1LPUA 4MAOA 3ORXA 3TV4A 3ZZEA 5ANGA 4E6DA 5IQFA 4EYJA 2VWIA 5HIDA 2I0VA 3ID6C 3R04A 1WVYA 4FKGA 3OW3A 3PVGA 1KE6A 4ZIMA 5E8ZA 4U3YA 2UVYA 4FT9A 3PXKA 3VN9A 5JFSA 4L53A 3TZMA 4TYJA 5EW8A 3RPSA 5E8WA 4FTAA 4RLKA 1Q5KA 2PVLA 2VWVA 4FIGA 4L9IA 2X39A 3R9OA 3S3IA 5JQ8A 3DB6A 3ET7A 4QYHA 3DGKA 4WD5A 4ANLA 3OROA 3GEQA 3CXWA 3QTZA 5M09A 4QTAA 2UVZA 5TE0A 3S95A 3IO7A 3KA0A 3KMMA 4RIYA 3PSBA 1W0XC 3F7WA 5AUYA 2YIWA 3VHKA 4ZSAA 5DVRA 3ACKA 4E6AA 5L6OA 4YPDA 2R3OA 4RVKA 3R9NA 2ITUA 4YNOA 1FMOE 2GFSA 2ITXA 2XK9A 4TRLA 5AUZA 3ZEWA 3TNWA 1OMWA 4H05A 1VEBA 4RJ6A 3R01A 3AMAA 2QCSA 3PYYA 3B2WA 3ZBFA 3R8VA 4L00A 3U6IA 4ASDA 4IDTA 3E64A 3Q96A 2YCFA 3KY2A 4BFMA 1VYWA 4OTWA 5E90A 3EN6A 4Y95A 4RIXA 4RWJA 4BDEA 5DIAA 3ULZA 4YSJA 4JNWA 3ODYX 4K1BA 1YDSE 2CKEA 4EWQA 5HOAA 4QTDA 3ENMA 3A4OX 3R00A 4XRJA 3OTUA 3AMBA 5KMMA 3ENHA 3HV3A 3V6SA 1YOLA 3C5UA 4USEA 3Q2JA 2XS0A 4XEYA 3Q4ZA 3R63A 4UYAA 4WIHA 5IQIA 1DS5A 2RFNA 1GIIA 4GFOA 4JX3A 2C0IA 2GNJA 4U0IA 3TZ7A 3Q53A 4CZYB 4TL0A 5IH4A 3CSVA 4ZLYA 4ZMEA 5D7VA 2H9VA 3FKNA 4XV3A 1PMNA 4WNOA 2E2BA 3VIDA 3NMUF 3V51A 2JBOA 3NGAA 2V0DA 5EH0A 4FTCA 3GOKA 3HDMA 4FSRA 2FUMA 5GINE 3U9NA 4WA9A 2JAMA 3SW7A 5A46A 5IZFA 4WUNA 3BYVA 3M2WA 5KHXA 3BCEA 3QQHA 2PVHA 2XIKA 3QAME 3QC9A 4QPSA 2BHHA 1GIJA 3NS9A 4FG8A 4GSBA 3LAUA 4C33A 3QYZA 3OF0A 3H3CA 3Q4TA 2QLQA 4NM7A 1U54B 1OL1A 4CMOA 3QHWA 2X0GA 3LFDA 4QP8A 3FSFA 3TIZA 4BDKA 4RX5A 4HYHA 4FMQA 3LMIA 2UZBA 3AT2A 5M4FA 5HG7A 3O71A 1G8SA 5L3AA 4WSYA 3QUDA 4XCUA 3GB2A 4X2GA 3ZRMA 2IWIA 4XMOA 2PMOX 2BRNA 5L8JA 4YC8A 4AX8A 4RA5A 3PTGA 4R6VA 5HESA 3HMMA 1VZOA 5J5SA 3I81A 2PVFA 2C6EA 2GDOA 2GNHA 3F5UA 3DTCA 4CRSA 3FMJA 2XNOA 4U40A 2NPQA 1AD5A 2H6DA 2ZV7A 1YDTE 4I4EA 4Z9LA 3UVRA 3ZZWA 1Y57A 3CKXA 4E8AA 3LZBA 4FTOA 5I4NA 2VO3A 5KZIA 4L68A 4AGCA 4RZWA 4C4JA 2EVAA 1PKGA 1KE8A 2R5TA 2RG6A 4KIKB 5KKRC 4DA5A 2GHLA 3R1QA 4EC9A 4JAJA 3BELA 1SVGA 4G9RA 3PJ3A 4AZWA 4RLLA 3GCQA 4F65A 4FSMA 5BMMA 5L6PA 4BCHA 4IE9A 4Z3VA 5HX6A 4XG6A 2WEIA 5B2MA 4KBAA 4UWYA 3T9IA 2B9FA 4JIAA 5HD7A 2XRWA 5CAPA 4E5WA 4QQTA 3P1AA 4JBOA 5AP3A 4FEQA 1J7UA 3ZO1A 4I93A 4KBKA 2CGUA 3PJ8A 4FKTA 4A9SA 1AGWA 3TN8A 4YGAA 1UU9A 3OWLA 5FEEA 4AE6A 4IAAA 2LAVA 5JMSA 3KXXA 2PVJA 4OTDA 4ANNA 2J90A 4YPSA 2Y9QA 1Q41A 3FZSA 3NNVA 2W4JA 4IIRA 3RHXA 3DA6A 2WO6A 4BI1A 4JL9A 2QI8A 3CLYA 4K2RA 4Q9SA 4PTCA 3RHKA 5CF8A 4FSNA 4ZY5A 3VWAA 2WTWA 1U5QA 2BIKB 2C3JA 2XYNA 4RSSA 5G1XA 2J50A 3A61A 3OP5A 1PF8A 4YHJA 4G17A 4C58A 4PP7A 1X8BA 4HVIA 4NUSA 4RJ3A 3QTUA 3T3VA 3V04A 3U55A 1FVTA 4MXYA 4XH6A 5I3OA 4IZ5A 2YERA 4FTRA 4BVUA 2UW6A 4BR3A 2ETKA 4C59A 3F88A 2CLQA 4QOXA 3BI6A 2J0KA 4BTFA 2CCHA 4FEXA 4N57A 1DM2A 5IUGA 4GFGA 4PL5A 4HVSA 4NJDA 4AOJA 1LEZA 2OG8A 5AX3A 4AN3A 5L2IA 3AT3A 4NM5A 5DLSA 4CV9A 4TNDA 2VZ6A 2C5OA 3KXZA 4PL3A 3TTJA 1LEWA 2V5QA 1KWPA 2JDTA 4FOBA 4ONAA 3W2PA 5FBNC 4MNFA 3ZO4A 4DE4A 3QHRA 4IVDA 4FL1A 2IVSA 3CPBA 3B8QA 4I4FA 2C47A 3VRYA 2XEZA 2XNEA 1PXIA 2XNGA 3ZHPC 1NVSA 3NPCA 4JBPA 3W1FA 3CE3A 3LM0A 5CQWA 3L9NA 4YJSA 1KOBA 1MRYA 4Z16A 4GKIA 4QYFA 2PMLX 1QPJA 1QPCA 3D7TA 3F82A 5HVYA 2WMAA 3W32A 5CSPA 3FLNC 4DFYA 3F7ZA 3QKKA 5IF1A 2Y7JA 2HELA 3EB0A 4JG8A 2VTNA 3Q60A 3TV7A 2UW4A 2R64A 4IAKA 3CCNA 3OWPA 1YW2A 4FKQA 4YJUA 5JT2A 5AR8A 5EQPA 4LOPA 5A9UA 3AGMA 2OF4A 3LLAA 4K18A 5HI2A 5GZ9A 4YTIA 2XIYA 5HE0A 4ERWA 4NIFB 3TUCA 1OL2A 2RFEA 2C1AA 5HHWA 3EMGA 4FKPA 3P23A 3OC1A 3QRTA 3R8PA 5AV2A 4E4NA 2JKQA 3SW4A 5TF9A 3SXSA 2WAJA 3W8QA 3R2BA 3BGQA 4GK3A 4MEDA 5HICA 5BYLA 1GY3A 4KKHA 3VBVA 4F9YA 1XH4A 4JJRA 3LJ0A 2YAAA 4FBXA 5EKOA 2PULA 3ORTA 2PZYA 3ROYA 3KCFA 4C35A 3JS2A 2OJIA 4MK0A 4Z7GA 3ODZX 3I60A 3RGFA 2VTIA 4AGUA 4ANSA 3UQGA 2QC6A 3CTHA 3JUHA 4P5QA 2J7TA 3NAXA 2YABA 4CGAA 4YLKA 3ZRKA 4DFNA 2GNFA 4CTCA 2OLCA 4KA3A 4M8TA 4EK5A 5EW9A 5HO7A 2GHGA 5M53A 4EHZA 3UOKA 3VRZA 4EL9A 3VS7A 3EFJA 3FLQA 3UYSA 3Q9ZA 4LI5A 5HNGA 5L4QA 3U6HA 4L42A 2I1MA 3EKKA 3V8SA 5HTBA 4KNBA 1G5SA 4TXCA 4AW0A 1ZZLA 3QKMA 1J3HA 4R1VA 3KEXA 3RCDA 5L8KA 4PDYA 4RX7A 2F57A 1UNHA 4BF2A 3Q4UA 4EJNA 2PVRA 3TKIA 4J96A 2X2LA 1OL6A 4D4VA 2JGZA 1BLXA 2QOFA 3BZ3A 4L67A 4CXAA 5BVFA 1K2PA 1GZ8A 4M69B 4F1OA 1FMKA 2R2PA 2BRHA 4PNIA 4F6SA 3QZIA 5CASA 4LFIA 3EN5A 4F63A 1XBCA 4FKIA 1ZRZA 4V04A 3U87A 5HG5A 2ITPA 4L44A 4LMNA 2ZOQA 4NM3A 1H27A 4D5KA 5FRIA 3MFSA 3R73A 3OCTA 4S2ZA 5EKNA 4FTNA 3GCVA 4HVHA 3TM0A 5CVHA 3UC3A 3BV3A 4S32A 5M51A 4H3PA 2IVVA 4TYHA 2ZM3A 5DPVA 4QP7A 5AUWA 3WZKA 4I24A 3P0MA 4C36A 1CKPA 4RWKA 3IW4A 2GS7A 2C68A 5F95A 2J9MA 2J5EA 3KULB 3WI6A 5CEKA 4FTLA 4ENYA 4CG8A 3RAHA 3EQDA 3F66A 1VJYA 2EXMA 3BGPA 3GU8A 2OJGA 3DT1A 3PXZA 3DJ5A 4OBPA 4F0GA 2BHEA 1B38A 2O2UA 2IVTA 1JWHA 3VS4A 3DS6A 4ZJJA 4AOIA 4YTFA 5AA8A 2BAQA 3TWJA 1MQ4A 2HZNA 2QNJA 4O1OA 4ZSLA 2C6OA 2XK4A 2VTLA 3F61A 1WAKA 4JBQA 1YKRA 1ND4A 3FKOA 1MRUA 3HLLA 4JDJA 5LXMA 3I79A 1VYZA 3KC3A 3PFQA 4YP8A 4DINA 5CT0A 1M2RA 5C1QB 2R3LA 4X3FC 3S0OA 4FGBA 5C27A 3U54A 1DAYA 2ONLA 3FHIA 3R8UA 1WBOA 2YIXA 3KMWA 2IO6A 4AT5A 3QZGA 4AUAA 4BKYA 4W8DA 5D9HA 2WB8A 1XO2B 3RZBA 2Z7QA 3LQ8A 5JFVA 3QA0A 4FNYA 5IA0A 5JN2A 3EFLA 4RIWA 2GTMA 4L6QA 4BCMA 3LCDA 1JKLA 5CXHA 3VJNA 4E26A 4K77A 4BDGA 4QMNA 5BPYA 2Z2WA 2H34A 2A2AA 2R3MA 5K5NA 1UNLA 3VW6A 4LOOA 3F2NA 5EM8A 5EK7A 3ZYAA 2UZLA 3GCUA 2OXXA 3IKAA 3DXQA 4MXOA 4HPUE 5F94A 2WELA 4D4YA 5AR2A 2HCKA 3JVSA 4FR4A 4MD9E 3E88A 2YZLA 3QF9A 3R8ZA 3ZSGA 3TUBA 1KSWA 1PXNA 2OWBA 3EL7A 4YJPA 4MF0A 4DH5A 2WQBA 2WTVA 4NK9A 4XP3A 4B0GA 2UW0A 5EHYA 3ZC6A 5LVNA 3DKOA 3FL4A 1PXLA 4V05A 3EFWA 2VTMA 2YLFA 1OKYA 2ITZA 3KF4A 3FWQA 3WZDA 4HGTA 5AP7A 2GNLA 3VBQA 3I0OA 3G6GA 3W8LA 2PYWA 5HNIX 4MXZA 5AUXA 4CFFA 4C4GA 2W9FB 1JNKA 2Q0BA 4FSYA 4IFGA 4S30A 5CSXA 5FP6A 5EM6A 5H8GA 3TL8A 4ZEGA 4E4LA 5JFXA 4YJQA 4DBNA 1UA2A 5IH6A 3HP5A 1Q62A 2CPKE 2OF2A 3L8SA 3OS3A 5E1EA 2VO7A 5CAUA 3AD6A 3EIDA 1BX6A 1L3RE 1V0PA 5BYZA 4O7RA 5AADA 1V0OA 5DGZA 5J9ZA 4ZY4A 4BC6A 3GFEA 3C4XA 2YIQA 1OIRA 5EHOA 1TQIA 3PXFA 4DG2E 4F99A 4L43A 2AC5A 3MV5A 4NFNA 3BLRA 2JBPA 5D7AA 5IA3A 2YFXA 4OR5A 1NY3A 2RSVA 4QO9A 1SMHA 4AA0A 2UW9A 3OEFX 3N4UA 1H26A 4I5CA 3IONA 5KMNA 4NT4A 4ZJVA 2O65A 3FQEA 3KXHA 1PXOA 1IA9A 1IAHA 4DFZE 2C6DA 5AP0A 3BHUA 5DHJA 4F6WA 3ZO3A 4WBBB 1CM8A 1LP4A 5I9UA 4DEGA 4QMLA 3EQFA 3EJ1A 4A9TA 4CLJA 3COIA 5HU9A 3E7OA 3GP0A 3W55A 3MFTA 3U4UA 4HCVA 3PP1A 4IZAA 2F49A 1YDRE 4ZTNA 4CKRA 1WBSA 3HP2A 4O7SA 4IM0A 4RRVA 3T8OA 3OWKA 4HZSA 3D7ZA 2QG7A 4J53A 4ZY6A 4GCJA 3OY3A 2WU6A 3KFAA 3VUHA 3FZRA 4Y5HA 3IQ7A 3QCSA 4FIIA 3MESA 5M44A 4G6NA 5CU2A 4KINA 4TYGA 2ITVA 1DAWA 5A6NA 2CJMA 4YZBA 3A62A 2KTYA 5H9BA 2W4OA 1TKIA 5M55A 3GQLA 4UB7A 3QBNA 4NM0A 4PPCA 3LFQA 5EYCA 5ETIA 4PMTA 2Z60A 3OHTA 4RPVA 2FSTX 4PV0A 5DR2A 2XMYA 2X4ZA 5LQFA 3A8WA 4O82A 3QL8A 2DS1A 2VX1A 3E62A 4FIHA 5FM3A 2OIBA 3FLWA 1PXKA 3CP9A 1ATPE 3NW7A 3NX8A 5GIPE 4WO5A 3EZRA 1NVQA 3NYXA 3IGOA 4YLLA 2BVAA 2YN8A 3SRVB 4R3RA 4BCFA 2X9EA 3NWWA 4NTSA 4M3QA 1IASA 4U42A 4FEWA 3BU6A 3D5VA 5FG8A 2YM7A 5H3QA 4FODA 3NUYA 5CWZA 3AOXA 1OZ1A 3OMVA 1Q61A 3EHAA 2OIQA 5HG8A 3QQKA 3R1NA 3F9NA 2IW9A 4B9DA 5HQ0A 3KKVA 4O22A 3DLZA 3KVWA 3I4BA 4QYGA 5DT4A 4ANMA 4IFCA 4D1SA 4DG0E 2VV9A 1H24A 2YM8A 4ZMFA 3G9LX 2VAGA 4I5MA 4IX3A 5E8UA 4DG3E 4LGDA 4M0YA 5DG5A 5FEDA 2HIWA 4U5JA 3BYSA 4EI4A 3FMKA 3NYOA 1S9JA 3D2IA 2QU6A 2PUPA 4RJ5A 1H8FA 5HZNA 3CJGA 5L8LA 4EH4A 3V8TA 2EU9A 3PIZA 4LRKA 1OECA 3R02A 2ZJWA 4PDOA 5TT7A 3QD3A 4BDJA 5A4CA 5A4LA 1M14A 1H0VA 3SG8A 3ACJA 3R9HA 4RJ8A 4BI0A 4O7YA 2B1PA 3A7IA 3KRLA 5AJQA 3VUKA 4BBFA 3H9RA 4EBWA 2PE0A 3OT8A 4ACHA 4AACA 3I7BA 5L2QA 2VTSA 4YUQA 4OLIA 4BCGA 5EG3A 4X6RA 3ZUUA 3EOCA 4G3FA 4M14A 3KXNA 4D5HA 3MVHA 3LMGA 2C5VA 2XB7A 4II5A 4FIEA 2ITQA 2JEDA 3LFNA 3OD6X 4K0YA 4AZVA 4U44A 4TT7A 5BUIA 4E73A 3MDYA 3R21A 4OT5A 4EQUA 1PKDA 2XKEA 3B2TA 3D5UA 4P7EA 5HCZA 4OAVB 2HENA 4O7TA 2VU3A 2JFLA 4FSWA 5BVNA 1U46A 4BCOA 2H96A 4HGSA 1OKZA 4DEIA 1H4LA 4G16A 2W7XA 3WF8A 2WTJA 3PJ1A 4YC6A 4IZYA 2W4KA 3D2KA 5CLPA 4EC8A 2FVDA 4CKIA 3BHTA 4KWPA 3WZEA 5EOBA 2CGVA 4FE2A 4AE9A 4E4XA 4GYIA 3OY1A 4BCIA 2BTSA 2BZKB 5J1VA 5FEQA 3QCYA 3PA3A 5E91A 4ALUA 5GZ8A 1CDKA 1REJA 2ZYBA 3DV3A 4F9AA 4EH2A 4OTPA 2OO8X 3S4QA 2VNYA 4D1XA 3Q6UA 4MD7E 2X2KA 5K3YA 4AF3A 4D2RA 4KIKA 3LPBA 4GG7A 2VWZA 4JR7A 2PPQA 2OFUA 3MY5A 3JXWA 2P2HA 3HMIA 3ORPA 4F9CA 1E1XA 3AD4A 2W1CA 2QOKA 1YHVA 5DRBA 3FZPA 5GHVA 4XRLA 3FHRA 5GNKA 4EZ3A 5C26A 3EKNA 3PUPA 3EQBA 3R7UA 3DKGA 3U4WA 4IC7A 4CCUA 4FA2A 3GBZA 4R77A 4IAIA 3FSKA 3POZA 4QMWA 2QONA 4G3DA 4K33A 3JY9A 3P5KA 1NA7A 2NRYA 4K11A 3ZLYA 4BKZA 3UP7A 3TG1A 4DBXA 4FV1A 1OITA 4R3PA 1M52A 4ORKA 1NVRA 5LWMA 3Q4CA 3WIGA 4FNXA 4UWBA 4JXFA 4BICA 2O8YA 4C38A 3FJQE 1G3NA 2C6MA 1OL7A 1W8CA 3DK3A 3F3ZA 4IH8A 3VUTA 4L7FA 1JSVA 4D9UA 5AUUA 3CBLA 2BMCA 2CKQA 4AZSA 5DBXA 2VX0A 3NVMB 4QQJA 5CZIA 1Q8ZA 4FSTA 1YI4A 3KB7A 1ZYCA 1WBPA 2ETRA 2I0HA 3F6XA 4Y85A 5KCVA 3DAJA 4MQ2A 4Y83A 3RTPA 1KV1A 4FKWA 5JGBA 3A7HA 3H30A 4EHVA 4FTIA 4RIOA 4WSQA 3DJ7A 1WCCA 5CU4A 3GI3A 4BN1A 3NAYA 4O0YA 2UZEA 1I09A 2B54A 2QKRA 4EWHA 1P4OA 5H8BA 4MXXA 5LCKA 3TUDA 4QNYA 2VRXA 2E9PA 4JOAA 3UQCA 4IAZA 4ZZNA 4PMMA 4O6LA 5JRQA 2OJJA 3PIXA 4J71A 2PUUA 5LOHA 4JDKA 3FMNA 2VWWA 3BYMA 2WIPA 4OW8A 4X7QA 4K8AA 4TPTA 3KVXA 4XX9A 4IC8A 3UO6A 1OBDA 3REPA 4QT1A 4YO6A 3KQ7A 5KMLA 3R7IA 3FE3A 2B7AA 1AQ1A 3Q52A 3MJ2A 5CSVA 4D2SA 5BYYA 3PVBA 3SOCA 5FGKA 2XBAA 4U6RA 5IMEA 2IZUA 4QRCA 4F7LA 2FGIA 4J1RA 3SQQA 5D10A 4ASZA 2VTHA 4V01A 1J7LA 3MH1A 4D4RA 3DQXA 4D58A 3IOKA 5DEYA 4GG5A 2BIYA 2ZMDA 2YACA 5J7BA 3A60A 3R7EA 4B8MA 4IB5A 4DFLA 5JK3A 3QLFA 4NIFA 3GT8A 5LVMA 2X7GA 2JDOA 3IECA 2OH0E 3KRJA 2XUUA 3KXGA 3TI1A 4O84A 2CNVA 4QYYA 4MBLA 4BWXA 4LUDA 4BYIA 2ZMCA 2QG5A 1XKKA 3K2LA 3VAPA 2ITOA 3BYOA 3D4QA 4F7JA 3COHA 3V5WA 2CNQA 3ZLSA 4BB4A 4OTIA 1UWJA 4O2PA 3SDJA 2WMSA 4W4VA 5FXRA 1U4DA 4MBIA 1BI7A 2UW8A 3LFBA 2A4LA 2BPMA 1PYXA 2OKRA 2EXEA 2XCHA 3DPKA 4QYEA 5ANEA 4RVMA 2Z02A 5EDQA 3F5PA 3VS5A 3ZH8A 4NYEA 3ZM9A 1FQ1B 3DOGA 4TW9A 1H07A 3NUNA 4UMTA 5AA9A 5B7VA 2GQRA 4BI2A 1PMVA 1ZXEA 3F3WA 3G33A 4PWNA 4XV2A 5HE2A 4RQKA 3ATSA 4UXLA 4IWQA 3RI1A 5JEBA 2Q83A 4QP1A 4F6UA 2ETMA 1H1WA 3Q2MA 4FV0A 2PZPA 3MFRA 3UJGA 3FXWA 4P5ZA 3AXWA 1G8AA 1WVXA 3V5JA 1WMKA 3RAKA 3GGFA 4AT4A 5HLNA 5IEVA 4QTEA 4I94A 4EKLA 1UU7A 2UZOA 2VWYA 2VWXA 5CI6A 3VS3A 2HZ4A 2WOTA 3H9FA 2I6LA 4KIOA 3DBFA 3FYKX 3BU5A 2BROA 4RJ7A 3ZSHA 3NUAA 1IG1A 3OEZA 1UWHA 4JQ8A 3FAAA 1OM1A 3C4CA 4M69A 4CFVA 3DB8A 3PIYA 2HK5A 4IAFA 3UBDA 4TKSA 3WE8A 4DCEA 4DGNA 5AAFA 5IA2A 2JAVA 3MA3A 5CS6A 2PUIA 3Q9YA 4I23A 2OH4A 4Q5HA 3Q9WA 4BL1A 4BDIA 4EZ5A 3IW7A 4MH7A 4AG8A 5LMKA 4QMPA 4FEUA 3UZTA 2V55A 3FMDA 3UOHA 1JBPE 3K5UA 1MRVA 4JAIA 4GJ3A 4TYEA 4UY9A 4CVAA 1OUYA 3LOKA 4CCBA 3HMPA 4W4YA 3KF7A 2IJMA 5FUTA 3ZO2A 4DEAA 3KULA 5J8IA 3WOWA 4GRBA 5HU3A 3LVPA 2XYUA 3LLTA 3IDBA 5DE2A 3G15A 5HO6A 2QOOA 5I9WA 4R3CA 3CY3A 3I1AA 4O0WA 4D9TA 3NUPA 4AW2A 4DHFA 3OOGA 2GHMA 3CC6A 3ZFXA 2AC3A 4JDIA 2FSOX 1M7QA 3E8NA 2XNNA 5D1JA 1O9UA 3KK9A 2OU7A 4IJPA 4L3PA 3V3VA 3QGYA 4RBLA 4F1MA 5D11A 2RFDA 3EWHA 3PE2A 2P2IA 4G6OA 4WHZA 4X6QC 4MHAA 5D12A 3MH3A 4X0MA 1IA8A 2BILB 3Q04A 1PRYA 4I20A 4IVCA 4HCTA 1GOLA 4IANA 5CEOA 3Q9XA 4EORA 3FLSA 2RL5A 4BKJA 2R7BA 4RC2A 3R1YA 4PTEA 5KKRB 4WG3A 2I40A 5HIEA 4QMUA 1MUOA 2BCJA 4QP9A 4GT3A 4JR3A 4WT6A 4F0IA 3BPRA 2PU8A 2VTQA 4H58A 4GVJA 4BTKA 4IHPA 4C3PA 3KN6A 5BUJA 5JH6A 3EYGA 3TNIA 4QP3A 4CV8A 3U8WA 3UOLA 4AW1A 3DFCB 3AT4A 3O7LD 3QZFA 5FXQA 3KXMA 5CAOA 2XH5A 4DEDA 2C30A 3MH2A 4QTCA 4EH8A 5I9YA 5IEYA 1PMEA 4JRNA 1WVWA 2OZAB 3O0GA 4Q5EA 1UV5A 4E6CA 2YDIA 3GC8A 4E5AX 4J8NA 2PZRA 2ERKA 1FINA 4OT6A 4EOIA 4EOQA 4LYNA 4RT7A 3PRFA 4XG8A 2X6EA 1PYEA 2JIVA 2QOLA 4AP7A 4MTAA 5M06A 2PVYA 4XOZA 4F7SA 1JLUE 2PMNX 2RG5A 1UNGA 3NDMA 4JG7A 4LGGA 4IVBA 3ALNA 3OTVA 4WNMA 5HTCA 1P5EA 1PXMA 3ELJA 4FKOA 5C9CA 5HCYA 3UO5A 4CG9A 3DKCA 4F08A 1NW1A 2CN8A 3FMLA 4ERKA 4DFUA 3R2YA 3SKCA 4OGRA 3D0EA 5K0KA 4WRGA 3RM7A 3TACA 4O0XA 3CPCA 3QCXA 4UMUA 3TDWA 2JDVA 3EQCA 2QODA 4YBKA 2XA4A 5HTIA 2Y0AA 5CX9A 3DK7A 1OUKA 3QTXA 4JX7A 4QQ5A 4U45A 3RJCA 2J0JA 5K0XA 3RINA 3OUNB 2A27A 3F2AA 4PP9A 1Q24A 3GNIB 2VTTA 5B2KA 3OZ6A 2EWAA 2UZVA 1XHAA 4WUAA 2VTPA 2F9GA 5C8KA 4NCTA 1SNUA 2BZJA 3WF6A 4A7CA 4CTBA 3QTIA 5CEIA 2IPXA 3A7JA 4EOKA 2EXCX 1RE8A 3FMMA 1BMKA 2XJ0A 3C0HA 4R5YA 3SAYA 2PWLA 3DZOA 2XK7A 4MQ1A 1YHWA 3RAIA 3FDNA 2X1NA 4OTHA 2QR8A 3QQUA 5HVJA 3UYTA 4ALVA 4U8ZA 3DBQA 4R8QA 2XRUA 4FVRA 5AV3A 3ATTA 4FV6A 4YSMA 3DFAA 5FD2A 4E93A 4O7WA 2Y8OA 4I1ZA 5M57A 4TWCA 3DJ6A 4NFMA 2Y6OA 4FV8A 4EZ7A 3NSZA 1XBBA 4FT7A 4UWCA 4U43A 3V01A 5AV4A 4BZOA 1YXTA 3IS5A 4FV5A 1B39A 2QOHA 2IG7A 4ACCA 4JI9A 2WQMA 3CEKA 5KHWA 3ZSIA 4Z55A 2W9ZB 3EFKA 3GU5A 4O0VA 4I0SA 4BBEA 2V22A 3ZS5A 2QHMA 4U79A 4EOOA 3TZ8A 2IVUA 1OL5A 3I6UA 5IDPA 3A99A 2X7OA 4XG2A 4FV9A 4PDSA 4G3CA 4U97A 2JKOA 3RALA 5BVWA 3FL5A 3MVJA 4FEVA 3E92A 2DYLA 3LCOA 5C4LA 4BDCA 1KE9A 3LFSA 4FNWA 1M2QA 3N4VA 3BBWA 4MCVA 4M15A 3BWJA 4XHKB 4O0SA 4F1TA 5KBRA 5DR9A 1JAMA 1O6KA 3AC5A 5DMZA 2CGXA 4DITA 2R3PA 4QP2A 2AUHA 5M4UA 3BGZA 5CVGA 4BDAA 4D0WA 2Y4IC 1BI8A 1XH5A 4N6YA 5D41A 4KKEA 2XM8A 2PZ5A 5BVEA 2UVXA 3DDPA 3E87A 4EH3A 1RDQE 2OZOA 3VS2A 1UKHA 4DEBA 3K5VA 5CU0A 3LQ3A 1Y8YA 5IQEA 3WF7A 4M68A 4FV4A 4PPAA 5HCXA 4CZUA 3S00A 5CAVA 4C4FA 4FL3A 1URCA 1E1VA 4OTQA 4ZZMA 3SLSA 3UC4A 4D2PA 5BNJA 5JFWA 4BCJA 1Z5MA 4K6ZA 3PY0A 5M07A 3LCSA 4BGHA 3CGOA 5AP6A 3QZHA 4GT5A 3COMA 1ZMVA 2HZIA 2WHBA 3TEIA 3DKFA 2W1IA 1FPUA 3RAWA 3TZ9A 3P08A 1DI8A 3RZFA 3PE1A 3PVWA 4OBOA 4A06A 5CXZA 1E9HA 3HRFA 4CNHA 4Y72A 5IISA 3H0YA 4CZTA 3POOA 3L8XA 3R0TA 2E9VA 2UZWE 3SXRA 4X2FA 4ZZOA 4MNEB 2P33A 5G6VA 2VUWA 1PXJA 2E9UA 3KN5A 4M0ZA 3GU4A 3QX4A 4H1JA 4HYUA 4HGLA 2OJ9A 5CYIA 4I3ZA 4YMJA 2ZV2A 2W06A 3F69A 4EK8A 2OSCA 3QA8A 3ZMMA 4ARKA 4EBVA 1WBWA 3U9CA 4FNZA 4FTTA 2LGCA 1JKSA 2ZV8A 1Y8GA 3HKOA 4J52A 3ZC5A 4D28A 4DC2A 4YR8A 3M42A 4L45A 3MPMA 5AP5A 3NCGA 2HWOA 2WMXA 3O96A 3GCPA 5LMAA 3VQUA 3P7CA 4JQ7A 3PG1A 4X3FB 4EQCA 5L2WA 3MSSA 2X8DA 4IB0A 4ALWA 4ANOA 3JYAA 4PQNA 4NSTA 5HD4A 3OXIA 4CEGA 3HA8A 3NUUA 4Y73A 2IW6A 5E1SA 5HEZA 4R1YA 4J98A 3V5QA 3MH0A 3R7GA 4F70A 5TKDA 3VHEA 4AN2A 5AMNA 3F2RA 3HAVA 4ZS4A 5IG1A 4EH6A 3JPVA 3MB7A 4FKJA 2IZRA 1CKIA 2JIIA 4XLIA 5EM5A 4O0RA 3DZQA 4FG7A 4JDHA 4ZXTA 3TTIA 5JGAA 4ANQA 3F5XA 3JY0A 4FKVA 2HAKA 2HW7A 2HW6A 4ZP5A 4DFXE 3NUXA 4DAWA 3L9MA 3CQUA 3CD8A 1F5QA 2VWUA 3FI4A 3M1SA 4HGEA 2HY0A 1UKIA 3I7CA 1ZOGA 3NW5A 1PHKA 4AGDA 3FZ1A 3GENA 5HG9A 4IM2A 3LMHA 1F3MC 2BALA 4BIDA 1ZMUA 2W5AA 3FY2A 2HOGA 3HGKA 4XS2A 4EK3A 4GL9A 4BCPA 1XJDA 1IRKA 4LV8A 3UODA 4C7TA 3QTSA 4I6HA 3LCKA 4BDHA 4YZMA 4EOMA 3UPZA 4NW5A 3EYHA 2QLUA 4IX5A 2C1BA 2W1GA 3P7BA 1Z57A 2QVSE 1ZY5A 2QQ7A 2YJRA 4RFYA 3E8CA 2ZM1A 3OOMA 3IOPA 4ASXA 4FKLA 3UMWA 3HV6A 4H36A 4DEHA 4F64A 3C5IA 4ZTLA 1XWSA 3HA6A 2VN9A 4JLCA 2O3PA 4NU1A 3BLQA 3GC7A 4F9WA 4KSPA 3HV5A 4O2ZA 3TDVA 2WIHA 3AC1A 3WF5A 4TNBA 3ZDIA 4PMPA 2XK6A 2B9HA 4AZEA 5AP2A 4I5PA 5EHLA 2PMIA 3BIZA 4M13A 5F9EA 1RQQA 4FIJA 5HBJA 3G0FA 2ITNA 3MYGA 5AM7A 3DNEA 2ZV9A 3MS9A 4Y46A 3HAMA 4D2TA 5I9VA 2WD1A 4N6ZA 4UMQA 4KRDA 4YC3A 3R71A 2BFXA 2VWBA 4N4SA 5FDXA 3TNPC 4BGQA 4GK4A 3II5A 4MKCA 3FXZA 3MVMA 2WOUA 2C6KA 4B4LA 3MJ1A 3VJOA 3RKBA 3OXTA 3QRUA 4GW8A 2WGJA 4E1ZA 4GIIA 4QMZA 3TXOA 4FGRA 4AXAA 3GVUA 2YZAA 3C4WA 5LMBA 4GKHA 2WQOA 3BQRA 3R30A 5M08A 2CSNA 3I5NA 3NYNA 3UMXA 4YBJA 2QURA 5AIKA 5C8MA 4L01A 3LFFA 3LW0A 3O2MA 3QTRA 1SVEA 3RNIA 1H1SA 4FSQA 4YZCA 3PVUA 4WBOA 3EN9A 3VW8A 3QQFA 2HZ0A 2PVNA 3AC3A 4IW0A 4O96A 2JFMA 3FI3A 4GFMA 4N0SA 4K9YA 1IR3A 2WQEA 4EUUA 4EYMA 4XG7A 3SOAA 5I5ZA 4G34A 5BVOA 4XLVA 1PW2A 1YHSA 1M7NA 4IBMA 4RG0A 4W9XA 5T6KA 2BKKA 3CIKA 3FYJX 3ZLXA 3R8MA 5EQYA 4EOPA 5I3RA 2Y4PA 4J8MA 5J9LA 4PX6A 3U51A 5CU6A 2R3KA 4LRJA 3A2CA 4MWHA 3EQRA 3QX2A 5E92A 1YVJA 2CCIA 2IZSA 3SHEA 4A07A 2OI4X 4JT3A 4QNAA 1YXUA 4L8MA 4YHFA 4C57A 2XIZA 4FSZA 4RWLA 3W33A 3W2CA 2J0LA 1UU3A 3KGAA 3E3PA 2W1EA 1BL6A 5IQCA 2YWPA 4FV2A 4IX4A 3FMEA 3KK8A 3Q32A 3G9NA 3HRBA 2ZM4A 5FM2A 3PY1A 5EQEA 4EK6A 5EFQA 4CRLA 3NUSA 5AR7A 2B55A 2G2IA 5ANIA 2G9XA 5FP5A 1YQJA 2WXVA 5AUVA 2QO9A 4FV3A 4USFA 1OKWA 2CMWA 1STCE 1GZOA 4WKQA 1PMUA 3PJ2A 4RFMA 3LE6A 4DF3A 3ZBXA 4JRVA 2XJ1A 5B2LA 4AT3A 3QC4A 5FXSA 2G2HA 2UZTA 4YJRA 5AP4A 5HE3A 4UV0A 4FG9A 3E3BX 3BE2A 1ZARA 3PP0A 2A0CX 2WTCA 4ENXA 2FSLX 2BKZA 4GT4A 4ITIA 4L3LA 2WMVA 3R9RA 1FVVA 4HNIA 1OVEA 4IWOA 4AAAA 3EQPA 1U54A 3MPAA 5CF5A 2QU5A 2W1FA 3QRKA 4LOQA 5GJGA 3O50A 4KAOA 4PTGA 4AGWA 3QLGA 4O83A 2OK1A 2AYPA 2UW5A 3CJFA 3QALE 4Z7HA 3KRWA 3PZEA 4QMOA 4XG4A 5EI2A 4ZK5A 4O86A 2ONLC 3WILA 4DGGA 3UGCA 2UV2A 3DNDA 1H01A 4M97A 3RWPA 4AW5A 2GQGA 2WTKC 2YHVA 2Z8CA 2VGPA 2YDKA 3QXPA 4FICA 1XH8A 5IQBA 3BHYA 1OPKA 5DR6A 5FQDC 3E8EA 3N51A 4JG6A 3R7VA 3TKHA 3BU3A 1M2PA 2NO3A 3BBTB 4FTKA 4NEUA 3SX9A 5EYMA 2ITWA 2X6DA 5DEWA 4O7LA 4QMTA 3UVQA 1I44A 5EW3A 2JIUA 3G0EA 1H08A 1Q8UA 5K9IA 2F2CB 3BLHA 2R9SA 4CYIA 4NL0A 4UX9A 3IW6A 4I21A 4ASEA 4RFZA 3FMHA 3GQIA 5E4HA 3GCSA 2DUVA 3LXPA 4D4SA 5AUTA 1ZOEA 2XNBA 4X2KA 4DN5A 3TJCA 3R7YA 1A06A 2BRGA 4EHEA 2I7QA 5ICPA 5LVPA 3H4JA 3D5WA 3QTWA 4R7HA 5DT0A 5K4IA 2X4FA 1B6CB 4C3FA 5DI1A 4XG9A 5JQ5A 1A9UA 2XZSA 3D9VA 4NKAA 5DWRA 2G1TA 1KE5A 2Z7RA 4GU9A 4NTTA 1P4FA 4OTRA 1R0PA 2REIA 3R1SA 4AWIA 5I0BA 3LXKA 2YWVA 5DYJA 3P78A 4PMSA 3VS6A 4XBRA 3HX4A 4G3EA 2BDFA 4DGOA 4FZ6A 2ZDTA 4UN0C 2R7IA 2UZNA 5JRSA 1P2AA 4FC0A 4FIFA 5CY3A 4KS7A 3UIUA 4HPTE 2PTKA 3MY0A 4M7IA 1JOWB 2OJFE 3W2RA 1ZYLA 5CQUA 2C3LA 3Q5IA 4QP6A 4XNEA 3SG9A 5DFPA 2OZAA 3A4PA 2W1HA 3MTLA 4YJNA 4FF8A 5IUHA 1WFCA 2XNMA 3FLYA 2OXDA 5LCJA 3FPMA 3CQWA 4ZTSA 4WOVA 3RPYA 2QOIA 3ZUTA 3R22A 1R1WA 1R78A 4BCKA 1PJKA 3MB6A 1YI3A 2VO6A 2FA2A 4U9AA 3LHJA 4I41A 4FYOA 2XF0A 5DRDA 3MA6A 3V5PA 4OBQA 3P7AA 3SC1A 3BEGA 4S31A 3IPHA 1OB3A 3W2SA 3KL8A 3ZU7A 1HOWA 4B6LA 2PY3A 5IEXA 4C4IA 3HEGA 3PPKA 4AS0A 4AZFA 4IX6A 2DQ7X 1Q3DA 4GUEA 4IWPA 3KRXA 4JS8A 5IMXA 3C9WA 3HL7A 2J51A 4O7VA 3L8VA 4AN9A 3W18A 5BQ0A 4C8BA 4E3CA 5CENA 1OGUA 2Y6MA 4FX3A 3BE9A 4P4CA 4DEEA 1FVRA 3PPZA 4PUZA 5CZHA 3NCZA 4RGJA 1YWVA 3GXLA 1GZKA 4O7ZA 1K3AA 3PWYA 3PG3A 4J7BA 3LJ2A 1H0WA 4NKSA 3EQGA 1Q4LA 1J91A 4E6QA 3PLAE 4RWIA 4EEVA 4BZNA 1Q3WA 2HY81 4H1MA 2W5BA 2XK3A 2GNGA 4USDA 4DGLC 2XVDA 5HBEA 5HIBA 4MXCA 1VR2A 3C13A 3FXXA 5F4NA 2ITTA 1ERKA 3SV0A 2UUEA 2XKFA 2YM4A 3CD3A 4CFWA 5AV0A 5GIOE 1J1BA 4IM3A 4UBAA 2NP8A 2WMWA 5FTOA 3UNKA 3QUPA 5C8NA 5EM7A 4AA5A 3VULA 3HVCA 3LFCA 4YO4A 3WIKA 4FK6A 3AC4A 3ZFMA 4GS6A 3WZJA 4BDBA 2X2MA 2OXYA 2YITA 3UIBA 4BDFA 4BTJA 4HNFA 4CQEA 4E5BA 3GOPA 4E4MA 4TWPA 2A19B 2W99B 2WNTA 5CANA 3I5ZA 3UG2A 3DCVA 3ALOA 4RC4A 5EYKA 3E7VA 1YOJA 2XJ2A 4WG5A 2UW7A 3D15A 2QOCA 4APPA 3GUBA 2XKDA 4C02A 3U6JA 4XG3A 3RPOA 4UEUA 3ORMA 3E93A 4RJ4A 3DDQA 4A4OA 2YLEA 1HCLA 5A14A 4D0XA 3CQEA 4CMUA 1Q8YA 4FZAB 3DXNA 3NYVA 3UP2A 5M4IA 4GMYA 3ORIA 5CVFA 3R6XA 3DU8A 3F3UA 4FZDB 4J97A 3RM6A 4GUBA 5FDPA 3ETAA 4FT0A 4MF1A 5L6WL 3DBEA 1UU8A 1V0BA 5HGIA 1QCFA 3GC9A 2BZIB 4ZSGA 2PVKA 3WYXA 4H39A 3QD4A 2BUJA 2VTJA 3KRRA 3VUMA 3HMNA 4QMMA 4KIQA 5IU2A 3HV4A 2WMBA 3MI9A 3ORZA 2NRUA 2YM6A 3PXQA 4RX8A 4BBMA 1LR4A 4QTBA 3RBWA 3F3TA 3CTJA 3P9JA 3BKBA 3SGCA 4GEOA 3GU6A 4FT5A 4HYSA 5JSMA 3QD0A 2V7AA 4FZ7A 5A4QA 5CF6A 1YXVA 4EJ7A 5K5XA 3EH9A 1JKTA 2WMRA 4G1WA 4FZFB 4X3JA 5M4CA 3MWUA 5EI6A 3ZONA 3FY0A 3SD0A 4FKSA 3G51A 5DOSA 3WF9A 3TT0A 3VNTA 4KUJA 3UDBA 4QP4A 2XIXA 4YZNA 3PXRA 3LXLA 4I22A 3WZUA 3ZTXA 3FZOA 2WQNA 3R8LA 4FYNA 4JIKA 2QR7A 3NR9A 4XOYA 4L3JA 3RP9A 4EOSA 4FTMA 4MWIA 4RC3A 2R3GA 5ETCA 3OCGA 4ACMA 4FUYA 5T3QA 2C0TA 5I9ZA 3G90X 4YLJA 4YZDA 5E8TA 3ZLWA 2O63A 3HUBA 3MGYA 4LL0A 4LQMA 3OUKA 5A4EA 2GS6A 2J0MB 3BHVA 1TQPA 4KSQA 5CU3A 4RVLA 5HE1A 2JD5A 2WTDA 3T3UA 1KV2A 3DLSA 4MNEA 3BHHA 4G31A 1WBNA 3QXOA 4MX9A 5EDPA 5LARA 4V0GB 1PY5A 4XV9A 2R3RA 3COKA 4H3BA 2YJSA 4FVPA 2I0EA 2R0IA 5AIRA 1F0QA 1BKXA 2IN6A 4W8EA 4NH1A 3LIJA 3QU0A 3QGWA 4IAYA 2Z7LA 2JLDA 1JKKA 3OBJA 2DWBA 1CMKE 3UE4A 2WU7A 2CHLA 5J5TA 3ROCA 2ACXA 3CKWA 5EDRA 4ACGA 1T46A 5CEPA 2BR1A 4OUCA 2BRBA 1U5RA 2J0IA
chains in the Genus database with same CATH superfamily
2YCQA 2ZAZA 5AAEA 2EB2A 3Q6WA 1OKVA 3VBTA 3NLBA 4O4FA 2YIYA 4P2KA 3THBA 3VF9A 1ZOHA 3L1SA 4GJ2A 2B9JA 2YDJA 1ZYSA 2FYSA 3DK6A 4X3FA 4DYMA 2C6LA 4WRSA 5ANJA 2OW3A 1Z9XA 2C3KA 2BTRA 3W2OA 4C2VA 3L8PA 4W4WA 4WG4A 3GC0A 2C5YA 3W2QA 2QOQA 3OT3A 3QD2B 3QKLA 5E8VA 1U59A 2Z7SA 1ZZ2A 3RK5A 2GPHA 4QPAA 2HWPA 4UALA 3VS0A 4ZLZA 2XCKA 4C4HA 4R5SA 1IEPA 3ITZA 3A7FA 4GYGA 4RZVA 3R7OA 1W98A 3G6HA 1UVRA 1XQZA 3H10A 1W82A 3HNGA 5AP1A 5TR6A 3ULIA 3T9TA 4EUTA 4ZTMA 5K4JA 3G5DA 1Y6AA 4KB8A 5IDNA 3W16A 3CR0A 4EH5A 5L2SA 2IEWA 2C4GA 4ZJIA 4RA4A 1TVOA 2G15A 3VO3A 3HV7A 2P55A 4J99A 3UOJA 5IH5A 5KUPA 5JZJA 1YXXA 1O6LA 3ZRLA 2C6IA 3E5AA 1Q99A 4MYGA 4LV5A 2XNPA 2YCSA 1KOAA 2BFYA 3EQIA 3FZTA 4KD1A 5CNOA 5C03A 4W4XA 4UMPA 5CEQA 4EOJA 4FVQA 4UMRA 3DBCA 3EQHA 2ESMA 3MTFA 4G3GA 4RQVA 3VS1A 5LVLA 4A9UA 3P4KA 3SXFA 3UIMA 2JDSA 4L52A 2IW8A 5HX8A 4YZ9A 4AU8A 4AQCA 4C3RA 1XH9A 1WZYA 1QPDA 2AEGA 5CTPA 1SM2A 5T68A 4L46A 4IXPA 4QD6A 4HJOA 5JGDA 3RK7A 4CSVA 1ZAOA 4U80A 3ZM4A 4ZLOA 4R78A 1S9IA 3P5JC 4DTAA 3N4TA 3PWDA 4QMQA 3LFEA 2GNIA 3ZOSA 4OTGA 4DLIA 3I0QA 3UG1A 5AEPA 4C37A 4FT3A 4DH3A 4YURA 5KBQA 3H0ZA 5J1WA 4ZAUA 3W0MA 4RIYB 3PA5A 3ANRA 4O91A 4Y5QA 1YWNA 4YU2A 1APME 3KIOC 1SZMA 1Q8TA 1YI6A 2FH9A 3ERKA 5A4TA 3HECA 5CEMA 2SRCA 5FTQA 2QO7A 3F3VA 3O8UA 3OFMA 3DQWA 3OCSA 4PF4A 3QFVA 3D83A 5AR4A 4BY9E 5DA3A 1P14A 1XH7A 2C3IB 4F7NA 3LKMA 2CLXA 5ACKA 4FTJA 1GJOA 3ZCLA 3LM5A 4C34A 4DT8A 3BV2A 4J95A 2XM9A 4RIXB 4YTCA 3FI8A 5TOZA 1CSNA 1JSUA 1GIHA 4CLIA 3VBXA 4U41A 4CYJA 4AZTA 5TO8A 5I9XA 5HORA 1T45A 4RMZA 3NNWA 5CAQA 4LUEA 2XK8A 4IDVA 2P3GX 4DH7A 2OIDA 5IQHA 2B4SB 2F2UA 4U81A 4CMTA 3PLSA 3AG9A 4U7ZA 4UYNA 1ST4A 4XBUA 2R3HA 4FRFA 3SRVA 2PVMA 5CALA 3DAKA 2YAKA 2PUNA 5AM6A 2B9IA 4IJ9A 5JZNA 2HYYA 2RF9A 2P0CA 4G5PA 5IA4A 4DTKA 4M12A 3C0IA 2WPAA 4FTQA 2R3FA 3SA0A 3PY3A 5DNRA 4PNKA 1OIUA 4CKJA 2JITA 4KIPA 4E7WA 3RPRA 2PZIA 1BUHA 4FSUA 3RNYA 1KUTA 3OVVA 3OW4A 2B52A 2C6TA 3CTQA 4P90A 4BHZA 4M67A 4O27B 5LMKC 3ZUVA 4FOCA 1JSTA 2E9NA 3W10A 4FKRA 4W9WA 5CI7A 5EYDA 4FI1A 3ZEPA 1RW8A 5HKMA 1W84A 4IB3A 2HXLA 2Y4IB 1SNXA 2VNWA 3S1HA 1QMZA 4PPBA 4EQMA 2V7OA 3FUPA 4IVAA 5J95A 4OTFA 2R3IA 3PPJA 4C0TA 4C4EA 3OXZA 2J5FA 3FV8A 5FWKK 4X2JA 5GJFA 3FKLA 2F7EE 3UDTA 4IACA 3VF8A 4D55A 1K9AA 3NIZA 1OI9A 4S34A 1XBAA 5CSWA 2C69A 4MD8E 4C61A 1FGKA 1J1CA 5ETAA 3WYYA 4DTBA 1WBVA 2EB3A 4EOLA 5IQDA 2PSQA 3LFAA 4DHIB 1R39A 2YM5A 3UVPA 1EH4A 4H3QA 3MVLA 2F7ZE 3TNQB 5IA5A 4HVGA 3EN4A 2W17A 4GK2A 3UZRA 4ITJA 5GZAA 4BIBA 3VUIA 5KMKA 4BYJA 4N70A 4I0TA 4DH8A 2B0QA 1H1QA 4BGGA 2PK9A 1ZWSA 4TWNA 5ETFA 4ANBA 1TQMA 5LVOA 1XH6A 2CDZA 4I0RA 3MW1A 2UW3A 1LUFA 3O8PA 4LGHA 4O0TA 4ZS0A 3L9LA 5DT3A 1QPEA 3WARA 5J7HA 5C4KA 3OBGA 1BL7A 3HYHA 4EH7A 2BRMA 5E9EA 1QL6A 3SVVA 2ITYA 2E9OA 1GZNA 5A3XA 4IMYA 3QTQA 5IKWA 1CKJA 5E8SA 2BZHB 4ACDA 4D2VA 5CF4A 1Q8WA 4MVFA 4PY1A 4B99A 4R7IA 2X8EA 1M17A 4EH9A 1V1KA 3EL8A 3TJDA 2J4ZA 1GNGA 4O21A 2PE2A 4GH2A 1Q97A 5AFVA 1O6YA 1HCKA 4DGMA 3JR1A 3O7LB 3A7GA 2X0PA 2VTOA 3NVKI 3JVRA 3FBVA 5BVKA 2FO0A 4QMSA 4BTMA 3HUCA 1H1RA 5HO8A 4DLJA 3KU2A 4DFBA 4YTHA 3PJCA 3ORLA 5E7RA 3FEGA 3R83A 3UQFA 3KCKA 1FOTA 3HRCA 4HYIA 4MBJA 1BYGA 3IDPA 4ZSJA 3TV6A 4C2WA 1OIYA 2O5KA 2XKCA 3MY1A 3ZXTA 1H28A 3BX5A 2X81A 2Q0NA 2QO2A 4XUFA 1RJBA 1A48A 4NW6A 2WZJA 3LQ5A 4RX9A 5E8XA 5B0XA 1NXKA 2ZB0A 3BEAA 4KBCA 1PXPA 2VX3A 5CSHA 5GJDA 2FB8A 3L9PA 5KNJA 1W83A 2VD5A 4TTHB 1H25A 4X2NA 4QQCA 2ZVAA 1KE7A 3IDCA 5FBOA 4R7BA 3AC8A 3D94A 5AR5A 2WEVA 3AC2A 2JC6A 2VO0A 1H00A 3PZHA 5L2TA 3K3IA 1REKA 3C51A 3DBDA 5KMOA 4O81A 4D2WA 2OFVA 4LL5A 5BX0A 2GTNA 3MFUA 3PA4A 2QD9A 4WNPA 3HMOA 4I92A 5IQAA 4HVDA 3FPQA 2QOBA 3FC2A 4NWMA 1R3CA 4S33A 3UPXA 4Q9ZA 3FI2A 1OPLA 3FQSA 3A8XA 4GV1A 3AD5A 5KX8A 4WNKA 5LJJA 3TMOA 5KE0A 3AKKA 3E8DA 3V8WA 4F9BA 2WFYA 4NCTC 3D7TB 4QMVA 2B53A 3ZXZA 2WMQA 2JDRA 4YHTA 4LMUA 3B8RA 1ZLTA 4ZSEA 3IGGA 2RGPA 4BWPA 4NJ3A 2PHKA 3V5LA 2A98A 2WTIA 3WBLA 2KULA 2ZB1A 3HDNA 4GVAA 3C0GA 3VVHA 4BCNA 2UZDA 4X21A 4EK4A 2J6MA 4YNEA 1FGIA 4G9CA 3C7QA 5KMJA 2BDWA 2OBJA 3HZTA 5DN3A 5E8YA 4G2FA 5ITAA 4JMQA 4PDPA 2GQSA 4DH1A 5ACBC 2JKMA 3NZ0A 2JKKA 4ID7A 4IB1A 4NZWB 3BL7A 4U3ZA 3C1XA 4DT9A 2RFSA 4KKGA 4LRMA 1YXSA 3FLZA 3UNJA 2C5XA 2UZUE 1MQBA 4F4PA 2OGVA 4C62A 1OBGA 2I0YA 2QKWB 4L7SA 4A9YA 4CFNA 4TWOA 2GSFA 1ZY4A 2BDJA 2ZDUA 3NNXA 3EN7A 1DI9A 2WKMA 2O0UA 2W1ZA 3BYUA 3K3JA 4KS8A 4YJOA 1XR1A 4DHZA 3MIAA 1MP8A 3LXNA 2GFCA 4HW7A 5A6OA 5IA1A 2OICA 3MBLA 3NIEA 4O1PA 3PDTA 3OCBA 3RMFA 1H1PA 3VC4A 3BQCA 4IADA 3GU7A 1YRPA 4XJ0A 4JBVA 4CT2A 2W05A 2J2IB 4BIEA 4B8LA 4PL4A 2H8HA 4ITHA 4ZTQA 4ZTHA 2W5HA 4F09A 5ANDA 2GMXA 5FLFA 5FTGA 2CGWA 3PRIA 3DY7A 3RCJA 3Q3BA 2BAJA 4MXAA 2XBJA 3KMUA 3PXYA 3S2PA 2PL0A 3NW6A 2ERZE 4EKKA 5IPJA 3I6WA 3MIYA 5KZ0A 3QCQA 3WE4A 4BCQA 3MPTA 3W0OA 2X7FA 4QMXA 2GU8A 2IZTA 3O23A 4EHGA 3PSCA 3ZFYA 5CT7A 4AOTA 1OIQA 2VGOA 3C4ZA 4TY1A 4F0FA 4M84A 4A9RA 5KMIA 4EONA 1ST0A 5HNBA 2O64A 3QQGA 5HBHA 4QPMA 3G2FA 5KO1A 4G5JA 1ZYDA 2P4IA 3C4EA 4A4LA 3QRJA 1JPAA 3GFWA 3BRBA 5J87A 1JVPP 2AQXA 1ZYJA 3IG7A 3UZPA 2HXQA 4IWDA 3V5TA 5C01A 5BMSA 3RPVA 3EZVA 5HVKA 2WMTA 3O51A 4HCUA 5CNNA 5DH3A 5H2UA 4HZRA 4LG4A 4FL2A 4BHNA 2XEYA 4IEBA 4JQEA 3AMYA 5AR3A 4O6EA 1L8TA 4CFMA 4QMYA 3BLAA 4CFUA 2V62A 3LJ1A 3M11A 3QRIA 1CTPE 3UIXA 3FC1X 3K54A 5ANOA 4TYHB 3DTWA 4UZHA 4CFXA 4CD0A 4Y8DA 2R3QA 4AFEA 2R0UA 1URWA 4LM5A 1SYKA 5EI8A 1J7IA 4YJVA 4FKUA 3R9DA 3UO4A 5J79A 4AFJA 3CY2A 4CT1A 3CS9A 1Y6BA 2C5NA 5ANKA 2YISA 1FBNA 4GIHA 3QWJA 4FV7A 2R3NA 2WMUA 4FTUA 4I5HA 2NYAA 4YJTA 4O38A 3QYWA 5AWMA 3DXPA 4AA4A 3RWQA 4XP0A 3IK3A 2YA9A 3LCTA 4BRXA 3UNZA 2A1AB 2R3JA 4G6LA 2YCRA 5AAGA 4XYFA 2X0QA 3C4FA 3OG7A 4JVGA 4XV1A 1SVHA 3QWKA 4IQ6A 3OWJA 3VBWA 2WTKB 5IUIA 4PRJA 1JQHA 4BWKA 4O0UA 1OPJA 3BWFA 4RIWB 5A54A 4UZDA 4OAUC 3H9OA 3V6RA 4AXFA 2F4JA 3DAEA 2QHNA 4KABA 3O8TA 4HOKA 2EUFB 4TYIA 2XP2A 4APCA 4V0GA 5JKGA 4A4XA 4BDDA 2F7XE 2G2FA 2C0OA 3AQVA 3ORNA 3TCPA 3UTOA 5BVDA 5HLPA 3VQHA 4ZOGA 5HLWA 4E20A 2CKOA 5BUEA 2R4BA 1Y91A 3AGLA 2PE1A 3NEWA 4M66A 3RK9A 3MN3A 3D14A 3QQLA 3TIYA 3TNHA 3VUGA 3ANQA 4TN6A 4IZ7A 3IW8A 4ZTRA 1R0EA 3ORKA 1W7HA 2X9FA 5H8EA 2GCDA 1WBTA 2YIRA 2FSMX 3CGFA 3P79A 2RIOA 3Q5ZA 4UXQA 4RVTA 5AV1A 1YWRA 3NNUA 3D5XA 2VTRA 5J9YA 1YOMA 3VUDA 3W0QA 2YM3A 3P86A 4XP2A 4I6QA 3TKUA 5LWNA 5EOLA 3C50A 1OGYA 3W0NA 2X8IA 2G01A 3O17A 2CN5A 2W0JA 3NRMA 4FUXA 1ZMWA 5AX9A 4Q2AA 4KRCA 4GU6A 2RKUA 5F20A 3QQJA 2YEXA 2CKPA 4I6FA 5M56A 2VTAA 3N9XA 1NT2A 4FK3A 4BZDA 3PSDA 4B7TA 3ZDUA 3E63A 2W1DA 3IW5A 3FQHA 4I6BA 5F1ZA 1IAJA 3RVGA 3KREA 4CQGA 2NNWB 2BAKA 2W96B 2CNUA 2GS2A 3VBYA 1GAGA 3R28A 4O7NA 3F5GA 4TZRA 5IQGA 2XIRA 4D1ZA 3QUEA 1LPUA 4MAOA 3ORXA 3TV4A 3ZZEA 5ANGA 4E6DA 5IQFA 4EYJA 2VWIA 5HIDA 2I0VA 3ID6C 3R04A 1WVYA 4FKGA 3OW3A 3PVGA 1KE6A 4ZIMA 5E8ZA 4U3YA 2UVYA 4FT9A 3PXKA 3VN9A 5JFSA 4L53A 3TZMA 2XAMA 4TYJA 2IF8A 5EW8A 3RPSA 5E8WA 4FTAA 4RLKA 1Q5KA 2PVLA 2VWVA 4FIGA 4L9IA 2X39A 3R9OA 3S3IA 5JQ8A 3DB6A 3ET7A 4QYHA 3DGKA 4WD5A 4ANLA 3OROA 3GEQA 3CXWA 3QTZA 5M09A 4QTAA 2UVZA 5TE0A 3S95A 3IO7A 3KA0A 3KMMA 4RIYA 3PSBA 1W0XC 3F7WA 5AUYA 2YIWA 3VHKA 4ZSAA 5DVRA 3ACKA 4E6AA 5L6OA 4YPDA 2R3OA 4RVKA 3R9NA 2ITUA 4YNOA 1FMOE 2GFSA 2ITXA 2XK9A 4TRLA 5AUZA 3ZEWA 3TNWA 1OMWA 4H05A 1VEBA 4RJ6A 3R01A 3AMAA 2QCSA 3PYYA 3B2WA 3ZBFA 3R8VA 4L00A 3U6IA 4ASDA 4IDTA 3E64A 3Q96A 2YCFA 3KY2A 4BFMA 1VYWA 4OTWA 5E90A 3EN6A 4Y95A 4RIXA 4RWJA 4BDEA 5DIAA 3ULZA 4YSJA 4JNWA 3ODYX 4K1BA 1YDSE 2CKEA 4EWQA 5HOAA 4QTDA 3ENMA 3A4OX 3R00A 4XRJA 3OTUA 3AMBA 5KMMA 3ENHA 3HV3A 3V6SA 1YOLA 3C5UA 4USEA 3Q2JA 2XS0A 4XEYA 3Q4ZA 3R63A 4UYAA 4WIHA 5IQIA 1DS5A 2RFNA 1GIIA 4GFOA 4JX3A 2C0IA 2GNJA 4U0IA 3TZ7A 3Q53A 4CZYB 4TL0A 5IH4A 3CSVA 4ZLYA 4ZMEA 5D7VA 2H9VA 3FKNA 4XV3A 1PMNA 4WNOA 2E2BA 3VIDA 3NMUF 3V51A 2JBOA 3NGAA 1VLRA 2V0DA 5EH0A 4FTCA 3GOKA 3HDMA 4FSRA 2FUMA 5GINE 3U9NA 4WA9A 2JAMA 3SW7A 5A46A 5IZFA 4WUNA 3BYVA 3M2WA 5KHXA 3BCEA 3QQHA 2PVHA 2XIKA 3QAME 3QC9A 4QPSA 2BHHA 1GIJA 3NS9A 4FG8A 4GSBA 3LAUA 4C33A 3QYZA 3OF0A 3H3CA 3Q4TA 2QLQA 4NM7A 1U54B 1OL1A 4CMOA 3QHWA 2X0GA 3LFDA 4QP8A 3FSFA 3TIZA 4BDKA 4RX5A 4HYHA 4FMQA 3LMIA 2UZBA 3AT2A 5M4FA 5HG7A 3O71A 1G8SA 5L3AA 4WSYA 3QUDA 4XCUA 3GB2A 4X2GA 3BL9A 3ZRMA 2IWIA 4XMOA 2PMOX 2BRNA 5L8JA 4YC8A 4AX8A 4RA5A 3PTGA 4R6VA 5HESA 3HMMA 1VZOA 5J5SA 3I81A 2PVFA 2C6EA 2GDOA 2GNHA 3F5UA 3DTCA 4CRSA 3FMJA 2XNOA 4U40A 2NPQA 1AD5A 2H6DA 2ZV7A 1YDTE 4I4EA 4Z9LA 3UVRA 3ZZWA 1Y57A 3CKXA 4E8AA 3LZBA 4FTOA 5I4NA 2VO3A 5KZIA 4L68A 4AGCA 4RZWA 4C4JA 2EVAA 1PKGA 1KE8A 2R5TA 2RG6A 4KIKB 5KKRC 4DA5A 2GHLA 3R1QA 4EC9A 4JAJA 3BELA 1SVGA 4G9RA 3PJ3A 4AZWA 4RLLA 3GCQA 2XALA 4F65A 4FSMA 5BMMA 5L6PA 4BCHA 4IE9A 4Z3VA 5HX6A 4AAYA 4XG6A 2WEIA 5B2MA 4KBAA 4UWYA 3T9IA 2B9FA 4JIAA 5HD7A 2XRWA 5CAPA 4E5WA 4QQTA 3P1AA 4JBOA 5AP3A 4FEQA 1J7UA 3ZO1A 4I93A 4KBKA 2CGUA 3PJ8A 4FKTA 4A9SA 1AGWA 3TN8A 3O5AA 4YGAA 1UU9A 3OWLA 5FEEA 4AE6A 4IAAA 2LAVA 5JMSA 3KXXA 2PVJA 4OTDA 4ANNA 2J90A 4YPSA 2Y9QA 1Q41A 3FZSA 3NNVA 2W4JA 4IIRA 3RHXA 3DA6A 2WO6A 4BI1A 4JL9A 2QI8A 3CLYA 4K2RA 4Q9SA 4PTCA 3RHKA 5CF8A 4FSNA 4ZY5A 3VWAA 2WTWA 1U5QA 2BIKB 2C3JA 2XYNA 4RSSA 5G1XA 2J50A 3A61A 3OP5A 1PF8A 4YHJA 4G17A 4C58A 4PP7A 1X8BA 4HVIA 4NUSA 4RJ3A 3QTUA 3T3VA 3V04A 3U55A 1FVTA 4MXYA 4XH6A 5I3OA 4IZ5A 2YERA 4FTRA 4BVUA 2UW6A 4BR3A 2ETKA 4C59A 3F88A 2CLQA 4QOXA 3BI6A 2J0KA 4BTFA 2CCHA 4FEXA 4N57A 1DM2A 5IUGA 4GFGA 4PL5A 4HVSA 4NJDA 4AOJA 1LEZA 2OG8A 5AX3A 4AN3A 5L2IA 3AT3A 4NM5A 5DLSA 4CV9A 4TNDA 2VZ6A 2C5OA 3KXZA 4PL3A 3TTJA 4DDGA 1LEWA 2V5QA 1KWPA 2JDTA 4FOBA 4ONAA 3W2PA 5FBNC 4MNFA 3ZO4A 4DE4A 3QHRA 4IVDA 4FL1A 2IVSA 3CPBA 3B8QA 4I4FA 2C47A 3VRYA 2XEZA 2XNEA 1PXIA 2XNGA 3ZHPC 1NVSA 3NPCA 4JBPA 3W1FA 3CE3A 3LM0A 5CQWA 3L9NA 4YJSA 1KOBA 1MRYA 4Z16A 4GKIA 4QYFA 2PMLX 1QPJA 1QPCA 3D7TA 3F82A 5HVYA 2WMAA 3W32A 5CSPA 3FLNC 4DFYA 3F7ZA 3QKKA 5IF1A 2Y7JA 2HELA 3W0SA 3EB0A 4JG8A 2VTNA 3Q60A 3TV7A 2UW4A 2R64A 4IAKA 3CCNA 3OWPA 1YW2A 4FKQA 4YJUA 5JT2A 5AR8A 5EQPA 4LOPA 5A9UA 3AGMA 2OF4A 3LLAA 4K18A 5HI2A 5GZ9A 4YTIA 2XANA 2XIYA 5HE0A 4ERWA 4NIFB 3TUCA 1OL2A 2RFEA 2C1AA 5HHWA 3EMGA 4FKPA 3P23A 3OC1A 3QRTA 3R8PA 5AV2A 4E4NA 2JKQA 3SW4A 5TF9A 3SXSA 2WAJA 3W8QA 3R2BA 3BGQA 4GK3A 4MEDA 5HICA 5BYLA 1GY3A 4KKHA 3VBVA 4F9YA 1XH4A 4JJRA 3LJ0A 2YAAA 4FBXA 5EKOA 2PULA 3ORTA 2PZYA 3ROYA 3KCFA 4C35A 3JS2A 2OJIA 4MK0A 4Z7GA 3ODZX 3I60A 3RGFA 2VTIA 4AGUA 4ANSA 3UQGA 2QC6A 3CTHA 3JUHA 4P5QA 2J7TA 3NAXA 2YABA 4CGAA 4YLKA 3ZRKA 4DFNA 2GNFA 4CTCA 2OLCA 4KA3A 4M8TA 4EK5A 5EW9A 5HO7A 2GHGA 5M53A 4EHZA 3UOKA 4AXDA 3VRZA 4EL9A 3VS7A 3EFJA 3FLQA 3UYSA 3Q9ZA 4LI5A 5HNGA 5L4QA 3U6HA 4L42A 2I1MA 3EKKA 3V8SA 5HTBA 4KNBA 1G5SA 4TXCA 4AW0A 1ZZLA 3QKMA 1J3HA 4R1VA 3KEXA 3RCDA 5L8KA 4PDYA 4RX7A 2F57A 1UNHA 4BF2A 3Q4UA 4EJNA 2PVRA 3TKIA 4J96A 2X2LA 1OL6A 4D4VA 2JGZA 1BLXA 2QOFA 3BZ3A 4L67A 4CXAA 5BVFA 1K2PA 1GZ8A 4M69B 4F1OA 1FMKA 2R2PA 2BRHA 4PNIA 4F6SA 3QZIA 5CASA 4LFIA 3EN5A 4F63A 1G8JA 1XBCA 4FKIA 1ZRZA 4V04A 3U87A 5HG5A 2ITPA 4L44A 4LMNA 2ZOQA 4NM3A 1H27A 4D5KA 5FRIA 3MFSA 3R73A 3OCTA 4S2ZA 5EKNA 4FTNA 3GCVA 4HVHA 3TM0A 5CVHA 3UC3A 3BV3A 4S32A 5M51A 4H3PA 2IVVA 4TYHA 2ZM3A 5DPVA 4QP7A 5AUWA 3WZKA 4I24A 3P0MA 4C36A 1CKPA 4RWKA 3IW4A 2GS7A 2C68A 5F95A 2J9MA 2J5EA 3KULB 3WI6A 5CEKA 4FTLA 4ENYA 4CG8A 3RAHA 3EQDA 3F66A 1VJYA 2EXMA 3BGPA 3GU8A 2OJGA 3DT1A 3PXZA 3DJ5A 4OBPA 4F0GA 2BHEA 1B38A 2O2UA 2IVTA 1JWHA 3VS4A 3DS6A 4ZJJA 4AOIA 4YTFA 5AA8A 2BAQA 3TWJA 3PUFC 1MQ4A 2HZNA 2QNJA 4O1OA 4ZSLA 2C6OA 2XK4A 2VTLA 3F61A 1WAKA 4JBQA 1YKRA 1ND4A 3FKOA 1MRUA 3HLLA 4JDJA 5LXMA 3I79A 1VYZA 3KC3A 3PFQA 4YP8A 4DINA 5CT0A 1M2RA 5C1QB 2R3LA 4X3FC 3S0OA 4FGBA 5C27A 3U54A 1DAYA 2ONLA 3FHIA 3R8UA 1WBOA 2YIXA 3KMWA 2IO6A 4AT5A 3QZGA 4AUAA 4BKYA 4W8DA 3ML1A 5D9HA 2WB8A 1XO2B 3RZBA 2Z7QA 3LQ8A 5JFVA 3QA0A 4FNYA 5IA0A 5JN2A 3EFLA 4RIWA 2GTMA 4L6QA 4BCMA 3LCDA 1JKLA 5CXHA 3VJNA 4E26A 4K77A 4BDGA 4QMNA 5BPYA 2Z2WA 2H34A 2A2AA 2R3MA 5K5NA 1UNLA 3VW6A 4LOOA 3F2NA 5EM8A 5EK7A 3ZYAA 2UZLA 3GCUA 2OXXA 3IKAA 3DXQA 4MXOA 4HPUE 5F94A 2WELA 4D4YA 5AR2A 2HCKA 3JVSA 4FR4A 4MD9E 3E88A 2YZLA 3QF9A 3R8ZA 3ZSGA 3TUBA 1KSWA 1PXNA 1XMMA 2OWBA 3EL7A 4YJPA 4MF0A 4DH5A 2WQBA 2WTVA 4NK9A 4XP3A 4B0GA 2UW0A 5EHYA 3ZC6A 5LVNA 1TZDA 3DKOA 3FL4A 1PXLA 4V05A 3EFWA 2VTMA 2YLFA 1OKYA 2ITZA 3KF4A 3FWQA 3WZDA 4HGTA 5AP7A 2GNLA 3VBQA 3I0OA 3G6GA 3W8LA 2PYWA 5HNIX 4MXZA 5AUXA 4CFFA 4C4GA 2W9FB 1JNKA 2Q0BA 4FSYA 4IFGA 4S30A 5CSXA 5FP6A 5EM6A 5H8GA 3TL8A 4ZEGA 4E4LA 5JFXA 4YJQA 4DBNA 1UA2A 5IH6A 3HP5A 1Q62A 2CPKE 2OF2A 3L8SA 3OS3A 5E1EA 2VO7A 5CAUA 3AD6A 3EIDA 1BX6A 1L3RE 1V0PA 5BYZA 4O7RA 5BV3A 5AADA 1V0OA 5DGZA 5J9ZA 4ZY4A 4BC6A 3GFEA 3C4XA 2YIQA 1OIRA 5EHOA 1TQIA 3PXFA 4DG2E 4F99A 4L43A 2AC5A 3MV5A 4NFNA 3BLRA 2JBPA 5D7AA 5IA3A 2YFXA 4OR5A 1NY3A 2RSVA 4QO9A 1SMHA 4AA0A 2UW9A 3OEFX 3N4UA 1H26A 4I5CA 3IONA 5KMNA 4NT4A 4ZJVA 2O65A 3FQEA 3KXHA 1PXOA 1IA9A 1IAHA 4DFZE 2C6DA 5AP0A 3BHUA 5DHJA 4F6WA 3ZO3A 4WBBB 1CM8A 1LP4A 5I9UA 4DEGA 4QMLA 3EQFA 3EJ1A 4A9TA 4CLJA 3COIA 5HU9A 3E7OA 3GP0A 1XMLA 3W55A 3MFTA 3U4UA 4HCVA 3PP1A 4IZAA 2F49A 1YDRE 4ZTNA 4CKRA 1WBSA 3HP2A 4O7SA 4IM0A 4RRVA 3T8OA 1G8KA 3OWKA 4HZSA 3D7ZA 2QG7A 4J53A 4ZY6A 4GCJA 3OY3A 2WU6A 3KFAA 3VUHA 3FZRA 4Y5HA 3IQ7A 3QCSA 4FIIA 3MESA 5M44A 4G6NA 5CU2A 4KINA 4TYGA 2ITVA 1DAWA 5A6NA 2CJMA 4YZBA 3A62A 2KTYA 5H9BA 3VONA 2W4OA 1TKIA 5M55A 3GQLA 4UB7A 3QBNA 4NM0A 4PPCA 3LFQA 5EYCA 5ETIA 4PMTA 2Z60A 3OHTA 4RPVA 2FSTX 4PV0A 5DR2A 2XMYA 2X4ZA 5LQFA 3A8WA 4AXEA 4O82A 3QL8A 2DS1A 2VX1A 3E62A 4FIHA 5FM3A 2OIBA 3FLWA 1PXKA 3CP9A 1ATPE 3NW7A 3NX8A 5GIPE 4WO5A 3EZRA 1NVQA 3NYXA 3IGOA 4YLLA 2BVAA 2YN8A 3SRVB 4R3RA 4BCFA 2X9EA 3NWWA 4NTSA 4M3QA 1IASA 4U42A 4FEWA 3BU6A 3D5VA 5FG8A 2YM7A 5H3QA 4FODA 3NUYA 5CWZA 3AOXA 1OZ1A 3OMVA 1Q61A 3EHAA 2OIQA 5HG8A 3QQKA 3R1NA