5LJJA

Crystal structure of human mps1 (ttk) in complex with reversine
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
281
structure length
264
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMEYGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTDSQVGTVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Structural basis of reversine selectivity in inhibiting Mps1 more potently than aurora B kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 264
sequence length 281
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ljjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ljjA01
3IONA 1H07A 2KTYA 2QOHA 3FY2A 4O6EA 2R3MA 2IVUA 4PUZA 4RWLA 1IRKA 4G5JA 3E93A 3ZLWA 1KWPA 4BDAA 4G17A 3R8LA 3UZTA 4QP9A 3TCPA 4C59A 5HTIA 3NPCA 4AXAA 2NRUA 3KRWA 3Q9WA 3ZONA 2J5FA 4IX5A 5J95A 1H01A 5JFSA 5E8UA 3NVKI 3CE3A 4JBVA 3TN8A 5ETIA 3ZSGA 4EOIA 4FV7A 4RT7A 3BWJA 4HPUE 4QTBA 1UU8A 3MI9A 5IH4A 3TNHA 4DFBA 4QTAA 4QMNA 4XBRA 1QMZA 4LQMA 2UW3A 3QUDA 3QX4A 3ZMMA 4O83A 2FB8A 1JWHA 2FA2A 4L42A 3BLHA 4IZAA 4LI5A 3P7BA 5CSXA 1QL6A 5H8GA 3WZKA 4BDHA 1TQPA 2C6IA 2CLQA 4FSWA 2HENA 5H8BA 4F4PA 4R7BA 2PWLA 4RJ5A 2WMRA 2YJRA 2C0TA 2YM6A 3DCVA 5KCVA 4FT9A 3FQEA 1E1XA 2C6EA 2ZDUA 2QOBA 3GCVA 3AD6A 4M67A 3R7OA 3PIXA 4RFMA 1UU9A 4WSYA 2QURA 1ZYSA 2UVXA 1YXUA 4EBWA 1Y6AA 2WAJA 1KOBA 3KMWA 4I24A 4XEYA 4CFUA 2WMAA 3F2RA 4XLIA 4DEGA 5L3AA 2EWAA 1KE7A 2WZJA 4XRJA 2WQEA 3PXQA 4G3GA 4GYGA 1OKZA 5FM3A 4BIBA 1B38A 4GL9A 1ZMUA 4GRBA 4BCGA 1ZOEA 3C4XA 4RGJA 3A4PA 1AQ1A 4D2RA 2UW7A 5IA4A 3LCSA 4APCA 3NW6A 4AQCA 1LPUA 4IACA 4U5JA 3UVRA 3RKBA 3MV5A 4QPAA 3T9IA 3EQCA 2OI4X 2XEYA 1CTPE 1ZRZA 2X9FA 2YA9A 3PA5A 4HYSA 2IO6A 3NAXA 4BC6A 4GFMA 4AGWA 4UMTA 4W8DA 3SD0A 3H30A 2X8DA 4UYNA 2C6TA 3W2OA 4O82A 2VX0A 2YDKA 2RFNA 1Q41A 4FVQA 5L8JA 3ZRLA 5HBJA 3FMEA 1LEZA 3CTHA 2V7AA 3HA8A 2IJMA 2HZ4A 3TZ9A 4RIWB 3EN9A 2HXLA 5LVLA 5CQUA 3G15A 1JKSA 4MWIA 5AUXA 4JT3A 5CI6A 4UMPA 5FUTA 4YTCA 1JAMA 3TKUA 2CGUA 2FSLX 1X8BA 4XLVA 3PJCA 2IZUA 4JL9A 3GU5A 3VS7A 1P4OA 4M14A 3Q5IA 4RQKA 4FZDB 2HYYA 1KSWA 4I3ZA 3EL8A 5IUHA 4AOJA 4RZWA 1PMNA 3A8XA 5HD4A 4BCKA 4CFWA 4ANMA 4BI0A 5DR6A 2YLFA 3F88A 3QGWA 4E5AX 4FT5A 2PVLA 5IQBA 4USFA 2XIZA 3KKVA 3PVBA 3DKFA 3FHRA 3LXKA 3BBTB 4QTDA 2JIVA 3FL4A 3KXMA 3WF5A 2C5NA 4DGNA 3QZHA 4G9CA 4EI4A 4O21A 4ZEGA 5DEYA 5LWNA 5ACBC 1PXNA 2FH9A 3R7IA 3PYYA 3PRIA 2QG7A 3QTIA 3IG7A 2SRCA 3PXFA 5C8MA 5DVRA 4R1YA 3V3VA 4MK0A 3RTPA 4P2KA 2EB3A 3H0YA 4CKRA 5JN2A 2XJ0A 4HVSA 4AGCA 3KRXA 3QTRA 3GC0A 3U4UA 3GEQA 1O9UA 3RAWA 4RFZA 4XBUA 3SAYA 2OIBA 3LFCA 4GJ3A 2ETMA 3A8WA 3HMNA 4J8NA 3S3IA 2ZYBA 1T45A 3MDYA 1A06A 1OI9A 5EHOA 4ZSEA 4EOOA 1U5RA 5I9XA 2QR8A 4XV2A 4EKLA 5FTQA 3AD5A 4IHPA 3L9MA 4QYHA 1YOLA 2OJJA 5HX6A 3ZDIA 2NO3A 2F49A 2W1CA 5JFXA 4DBXA 4BCPA 4FK6A 5EFQA 2PZRA 4QMXA 3BYSA 3IGGA 3OHTA 4FZ6A 5EI8A 3NIZA 5J87A 3W10A 3WIGA 5DFPA 4AN2A 5CF8A 3I81A 5C8NA 2BMCA 2BR1A 1M2PA 3KEXA 4MD9E 4O0WA 5I9VA 3DXPA 4R1VA 2QOFA 4WG5A 3W18A 2WELA 3I60A 1JSTA 4JNWA 5B2KA 5CEKA 2XBAA 4K33A 3BQRA 4TRLA 3RCDA 3UZPA 5L8LA 3ORLA 2X9EA 3OUNB 3PJ1A 4O22A 3E92A 2OJFE 4E6DA 2J90A 4RLLA 2P3GX 1UNHA 5J1VA 3PFQA 2E9PA 4YZDA 4QMMA 3TDWA 3B2TA 3C9WA 5HVKA 2FO0A 3K3IA 4NYEA 5CNOA 1P4FA 2PL0A 3II5A 5E9EA 3WYXA 2DWBA 3AGMA 2YAKA 3LMGA 4QPSA 2HY81 4LV8A 4J71A 4NZWB 4A4LA 2XNGA 1H1WA 5LWMA 4IVDA 4HGLA 3D2KA 4O2PA 3R83A 2XKCA 3GENA 4NUSA 1ERKA 1PXIA 3PLSA 3EQIA 4ASXA 1FINA 1PKDA 1PMEA 1SNUA 2PTKA 3NUYA 4YBJA 4BRXA 5IH5A 1DI9A 3PZEA 5TKDA 4HVIA 2W1GA 4FG7A 2PUPA 2B54A 2E9OA 3IGOA 4CRLA 4FSNA 3MA3A 3EL7A 5LCJA 5ANEA 4MEDA 1GOLA 1YWNA 3MVMA 3QTQA 3DK6A 3GU7A 3OP5A 3K2LA 3HRFA 4KIKA 3WOWA 1YXTA 4K1BA 3D7TA 3R1SA 2Q0BA 4B8LA 5HNIX 4BDBA 2F7EE 3DU8A 1VZOA 3OY3A 5D11A 3PZHA 3QBNA 2VTTA 2X7FA 4I0TA 2GHLA 3F61A 4M0ZA 2WGJA 4QMZA 4XP3A 4PNKA 4DEIA 5JZJA 1XH7A 3TTJA 5F9EA 2Y4IC 1ZOGA 3EQGA 4D9TA 3I4BA 4FTMA 3C4FA 4FTJA 4JQ7A 4L3LA 4NIFB 3TZ8A 3VAPA 2E2BA 3VUGA 5HG7A 4C35A 4XG7A 4G5PA 5A4LA 2OK1A 5AA9A 3ZBXA 4TN6A 3UQFA 4JI9A 3F66A 4F9AA 5FBOA 2AC5A 3FLYA 1JSVA 3KQ7A 4EK8A 5KBRA 2YWVA 4KBCA 3OWPA 4D2VA 4GKIA 1MUOA 4YZBA 4E93A 4XCUA 5BYZA 3PG1A 3LM0A 2QR7A 3I7CA 3BHVA 4RIYB 4BB4A 5EW9A 3T8OA 3KK8A 1PXOA 2QOLA 4U42A 3TV4A 5J79A 2C3KA 2WMXA 3O8UA 2QU6A 4DITA 1XH8A 2QOKA 1R3CA 4ZY5A 2GNIA 3CS9A 5HNGA 3WZJA 5IQDA 5I9ZA 4BDGA 3LQ8A 2BFXA 2GNJA 4NM7A 3UP7A 3ERKA 3ZFMA 3MTFA 3BU3A 3LFFA 3QCYA 2G1TA 4WUNA 3DAKA 3KXGA 4FSYA 1YKRA 3QC9A 4QQCA 3E8NA 4DLIA 3QD4A 2BPMA 3UODA 3PVWA 4FEWA 4MNEA 4E4MA 5CSWA 2J2IB 3MVJA 5LCKA 1NT2A 5KBQA 3V5JA 2BKZA 4E4XA 1OKVA 1V0PA 2J9MA 3R63A 3CPBA 3IW5A 2GFCA 2OF4A 5LVMA 5CU4A 2YISA 4KSQA 3UVQA 1XH6A 2GHGA 3NUPA 1OBDA 5AR5A 3R9NA 4JLCA 5IQIA 5EM8A 3DJ7A 2OFVA 3FZTA 4FTCA 3VBTA 1BL7A 3HRBA 3WE4A 3UNZA 4DBNA 3LZBA 4U6RA 3BRBA 5AV0A 4HCUA 3R8VA 2J50A 2XM9A 4AT3A 2JKOA 1VR2A 4GG5A 2FSMX 5C01A 3CQEA 4EHZA 1NXKA 4KBKA 4UN0C 4FIIA 2VWVA 4TYIA 3ZUVA 3AGLA 1U59A 2JDSA 5HE2A 3AMAA 4IMYA 2XIXA 3SOCA 1E9HA 4E1ZA 5GNKA 4X3FC 4CFXA 5IF1A 3DLZA 2FYSA 4YTIA 5ANIA 2YM4A 4JBPA 4CG9A 2BFYA 2H6DA 3DZQA 4LMUA 3VBQA 2CGVA 2ITNA 3COKA 3O8PA 4C33A 3R1YA 4EC9A 4EQCA 2F2CB 1YDTE 1H28A 5KZIA 2WQNA 3DAEA 3ZXZA 4M68A 4M13A 5JEBA 4I5CA 4MD7E 3EQBA 5JZNA 4ZJVA 4XNEA 1DAYA 2IVVA 4O27B 1YDRE 4C3FA 4E6AA 2J7TA 4PNIA 1G3NA 2VAGA 5HU3A 2QODA 3R9HA 4FTTA 3OTUA 3DV3A 4PF4A 1OIQA 4BDDA 1S9IA 2Z7SA 4I92A 3RHKA 2PZPA 4QP7A 4BCFA 3R21A 2VTLA 4FKUA 1AGWA 3MYGA 2PUUA 3QKMA 5ACKA 3WARA 2YDJA 4B7TA 4RA5A 1IAJA 2BRGA 4XP2A 2C6LA 4UALA 2YACA 2XK9A 2C30A 2QONA 4WBBB 4ZZMA 4FVPA 4U81A 4KS7A 3BGQA 1VYZA 3DXNA 3P7CA 3LXLA 4GT5A 4L53A 1UKIA 2ITZA 3A7IA 4XH6A 5BUJA 4I1ZA 1YI3A 2W5AA 2XNEA 3IDCA 3OBJA 3I5ZA 4V0GA 5IDNA 3FLQA 4DGLC 1B39A 5DHJA 3QXPA 4KD1A 3EYGA 3B8RA 3PSBA 1UV5A 5E8YA 3VHKA 3UOHA 4U45A 5CEPA 5J5TA 3KRLA 4MBLA 4C34A 2IVSA 5LOHA 1FGKA 4EUUA 5KE0A 4ZSGA 4I41A 5I3RA 5CASA 5CZIA 1YHVA 1H0VA 4IIRA 4MXYA 3ORPA 4MX9A 4FTKA 4D2SA 3TIYA 3H9OA 3UQGA 4GU9A 2R3QA 3P0MA 4TXCA 2WMBA 2IW9A 3LCTA 2Z7QA 4EORA 5HO7A 3SHEA 5KKRC 2YABA 4GG7A 2CPKE 4TYHA 4ACGA 4IX4A 2QKRA 3ACJA 4AA5A 3SC1A 2BTSA 4FKJA 4EC8A 1KV2A 3FMKA 3MIYA 3EQPA 1Y8YA 1JKTA 1WVXA 3CGOA 2QLUA 3D5VA 4FYNA 4NM5A 3IOKA 5AV4A 4LV5A 4QMVA 3PP0A 1PXJA 3UOLA 4FV1A 4AU8A 2VWYA 4O81A 3VJNA 4BWPA 4FC0A 2XCKA 3V51A 4R8QA 2OKRA 2NPQA 4FR4A 4N70A 1CKJA 3P86A 3FYJX 5HLPA 1SM2A 4TPTA 2W1IA 4F7LA 3VS1A 5HNBA 2VN9A 3O8TA 3F3WA 1PHKA 3OT8A 2R3HA 4F9WA 1OGUA 4FTNA 3MVHA 3A61A 4MBJA 4YHJA 3TEIA 1J1BA 4NTSA 4ANQA 4GFOA 3FLSA 3FMNA 4J8MA 4FKWA 2X81A 4RC3A 4BI1A 5I9YA 1IR3A 3PPKA 3HV4A 4OTFA 3C51A 1FMOE 3F2AA 3ZZEA 4P4CA 3ALNA 1BI7A 3R2YA 3FLZA 3TKHA 4EOLA 4L67A 5BVOA 3LKMA 5IQAA 4WRSA 2DQ7X 2WXVA 1VEBA 5DA3A 4DGOA 4IEBA 3WF6A 2R9SA 3QHRA 5DWRA 5CEQA 4FT3A 2FGIA 1JVPP 4CEGA 4AS0A 4D4RA 5M4UA 1I09A 3JUHA 4C0TA 4MQ1A 5DH3A 5D10A 4KSPA 5L8KA 5EI6A 2VGPA 5L6PA 3E8CA 3FUPA 4ALUA 3KCKA 2EU9A 3NVMB 4DH7A 3NUAA 3I6WA 4P7EA 3FHIA 3FZ1A 3DZOA 4RWKA 4U79A 5HKMA 2HAKA 5A4QA 2PUIA 3TDVA 3W33A 1OIUA 3QRIA 3FMLA 5LJJA 4DH1A 4LMNA 4LOQA 5E4HA 3RALA 4IB1A 2BAKA 1YHSA 3S95A 4UWYA 4EK6A 4AA0A 3SW4A 1KUTA 3TNIA 2QOCA 4GT4A 5A4CA 4WD5A 3IO7A 3QLFA 2RFEA 5AM7A 5BPYA 2EUFB 5HIDA 5JT2A 3MVLA 3HP2A 3R73A 1MRYA 2JLDA 4UZDA 2I0EA 4V01A 5EM6A 3CSVA 3GBZA 4HYIA 1PJKA 5LVOA 4EWQA 4ANLA 4GU6A 2XUUA 4TWNA 1SVGA 1NVRA 3FI8A 5TO8A 4DFZE 4LRMA 4C36A 2PHKA 3UOJA 4BHZA 1SNXA 4K9YA 3KCFA 1F3MC 3A99A 5TOZA 3HX4A 4F08A 1H26A 3CJFA 2B4SB 3PWDA 2BILB 5H3QA 2JFMA 4ZLOA 5EKNA 5KMOA 1LUFA 2YLEA 1GJOA 4UZHA 4FYOA 3Q4ZA 5BUIA 3GGFA 2WQMA 1PYXA 3GCPA 3WZUA 2QD9A 1FQ1B 3CD8A 2GU8A 4DC2A 3IKAA 3LQ3A 4I5HA 2PMIA 2YCQA 4H1JA 4PY1A 4BGGA 4DF3A 4XV1A 2JDOA 3WZDA 3R8PA 4NFNA 2O8YA 2ZM3A 3COMA 4ZTQA 4IADA 2OGVA 2UW6A 2QQ7A 3DA6A 4RIXA 5IISA 3VF9A 3DK3A 3I1AA 2CN5A 3AC3A 2AC3A 5L2TA 2ACXA 3QTSA 5I4NA 4A4XA 1UU3A 4A9TA 4QPMA 3BQCA 5BUEA 5DEWA 4AT5A 3BE2A 3LQ5A 3MFRA 1H0WA 4PMMA 4J99A 3FLNC 3KC3A 2C47A 3CEKA 3PY3A 4JBOA 5DRBA 5GJGA 5C27A 2RSVA 3DTWA 3G33A 3D94A 4X21A 4XX9A 4YZMA 2WTWA 4BTMA 5CENA 2VX3A 3MFUA 1ZLTA 3GP0A 3CC6A 5CSPA 3OOMA 1VJYA 4DHFA 5A14A 4H3BA 2UZNA 4DEBA 4A7CA 3QYZA 3CKXA 3NAYA 4ZJIA 1ZZLA 3QD0A 5BVKA 4FG9A 5BVNA 2C5OA 4QMWA 3UMWA 3R01A 5DT3A 3UO6A 3CY2A 4O0RA 5HVYA 3BYOA 3W16A 1V1KA 1JLUE 2W5BA 3P4KA 3EQRA 3CKWA 3MPAA 2XK3A 4YLLA 4E4NA 5A46A 5AV1A 3NZ0A 4MXOA 3IS5A 4BZOA 4BY9E 2R4BA 3NYXA 5HZNA 3DNDA 1FBNA 3P1AA 4EJNA 3PDTA 3SRVB 3R7EA 2X1NA 1YOMA 5KHXA 3RPVA 5LVPA 5A54A 2PYWA 3KRRA 4RIOA 2Y6OA 3MB6A 5K4IA 1Y6BA 3DQWA 2CNVA 4IVCA 3C50A 5HE3A 3VBVA 2ZMDA 2GQSA 2CHLA 2GNFA 4U0IA 5E91A 3I79A 3MW1A 2GMXA 4MD8E 4DG2E 2B55A 4RX7A 2C3IB 2OG8A 2C0IA 5J5SA 4TYGA 2Y0AA 3L8XA 2CDZA 4EZ3A 2ZDTA 2UZBA 3FI3A 3JYAA 2HWPA 5EYDA 3EZRA 3UG1A 3LFNA 2UW8A 3D5WA 5CVFA 3NUNA 4YURA 4MXAA 4K2RA 4FEXA 3PE2A 4A06A 1REJA 3HV6A 3HEGA 4WNPA 3PJ3A 3FAAA 5EOBA 3SXSA 2XA4A 3ZUUA 3QZIA 4PTEA 4EK3A 2OBJA 5AP1A 3DBEA 3O23A 2A1AB 2HCKA 4PTCA 5FEDA 3EN6A 4F1TA 2ONLA 2W17A 2W96B 4D2WA 4L9IA 3EMGA 1P2AA 4KAOA 4BYJA 1JKLA 4ZTLA 3F3TA 4IJ9A 2XYNA 3BHHA 4JDJA 1H8FA 4UEUA 3MY5A 4ALVA 4CFNA 4YU2A 1OL5A 4FUXA 4NT4A 3SG9A 3NNVA 2RG6A 4LM5A 5LXMA 1ZY5A 3HP5A 4DINA 5AA8A 3F3ZA 4A07A 2GNLA 4W4WA 4U43A 5CLPA 4J98A 4OW8A 2R3GA 1GIIA 4L00A 2YITA 5JSMA 3OD6X 3QCQA 4J96A 4GMYA 4K8AA 1LR4A 2A19B 3A7JA 4M69B 3C1XA 4FKSA 5M4CA 4DA5A 5AX9A 3LMIA 3R1NA 4FEQA 2C4GA 1DM2A 4KWPA 4L52A 5HBHA 5HHWA 2XRWA 1WBTA 4L45A 4U80A 5M07A 3GQIA 3DY7A 3UIMA 1XO2B 2ONLC 1OITA 1LP4A 1APME 4YZ9A 3V04A 3L9PA 4ONAA 2FSOX 5AIKA 4O0VA 5FXQA 5DLSA 3EFLA 4D28A 3ZZWA 1G5SA 2GQGA 4FV2A 2XMYA 4FV4A 1W82A 5KNJA 4YUQA 4N6YA 4GFGA 3F3UA 5CEIA 3VS3A 5KUPA 3SA0A 5F1ZA 1BLXA 2JDRA 5A9UA 4Q5EA 2VU3A 4PRJA 5HX8A 2F2UA 4RJ7A 1Q61A 4JXFA 4QP8A 2Y4IB 2BCJA 4UXLA 3LOKA 4O91A 2XIYA 5F4NA 4ENXA 5JQ5A 2WKMA 1M7NA 3DQXA 5KMIA 2WTKB 2JAMA 3G2FA 4GIIA 2OICA 3VS0A 4YMJA 4ZY6A 1ZYCA 2JIIA 2WTJA 5HE1A 3Q4CA 5FWKK 2IN6A 4YHFA 5T6KA 3RVGA 4LRKA 1PXKA 5AUUA 4IB0A 1H1RA 4EZ5A 1H1PA 3KY2A 2HW6A 4YJSA 5KMKA 5LMKA 3GXLA 4J52A 2RKUA 2VWIA 3CY3A 3GFEA 3KF4A 3RINA 3L1SA 4BCOA 4KIKB 3KGAA 1R78A 3MFTA 4GIHA 3D7TB 4RFYA 4X0MA 4HOKA 5IKWA 3GU6A 3S1HA 3GQLA 4DG3E 5AAEA 4TWCA 4ZTNA 4JBQA 2BALA 4ASEA 5F20A 1PMVA 3AMYA 2QI8A 2UUEA 4OLIA 1T46A 4HZRA 2OW3A 4K77A 2YIYA 4BCNA 3O7LD 4HZSA 3DDPA 4LOPA 5G6VA 2PZ5A 1CM8A 2X6EA 2BAJA 3PIZA 3V5TA 3VO3A 4NEUA 4EH3A 5KMLA 3Q2MA 4TNDA 3V5PA 1UVRA 2BRMA 5CS6A 2OWBA 3AC4A 3E3BX 3FPMA 2C6DA 2P4IA 2I0YA 5BNJA 2PULA 3SXRA 3MESA 2C5VA 3ORTA 3Q3BA 3BHTA 3E8EA 3R2BA 3KF7A 3GCSA 4JDKA 5HU9A 5LMKC 4WKQA 4PDPA 2OZOA 3OMVA 3POZA 5F95A 2IPXA 4G3FA 4DFUA 1ZAOA 3LXPA 2BRBA 1OKYA 3FY0A 3M11A 4FKOA 4F0FA 3G0FA 4OTRA 4EH9A 2G9XA 5C26A 3FMMA 3JPVA 2GNHA 4W4VA 4WNOA 4LUEA 3T9TA 3ORXA 3BYUA 3QHWA 1OIYA 4U40A 3S0OA 4FTUA 5G1XA 3P23A 4LGHA 2KULA 2IZRA 3E87A 1TQIA 1Q8YA 2QKWB 4LUDA 3TL8A 1FGIA 5J7BA 5CAPA 2OXXA 1XKKA 4MBIA 4QOXA 5DI1A 1DAWA 4ANSA 3LLTA 3BZ3A 4I0SA 4BKYA 4CCUA 4QTCA 5CALA 2R3RA 2I7QA 2CGXA 2HK5A 5EDPA 5EHLA 2BKKA 3LFQA 2I1MA 2QO2A 4GW8A 2UVZA 4FSTA 4MNEB 4OUCA 1H1QA 2P0CA 4APPA 3GOPA 2XP2A 3CTQA 2A2AA 2GTMA 4CYJA 3E63A 4EWHA 4RVLA 4QO9A 2OXDA 2VWUA 4WNMA 2OJGA 3E7OA 2LGCA 5K4JA 2G01A 4FICA 3VS5A 4ASZA 4K0YA 4B4LA 4BIDA 2UW5A 3IW7A 3QQKA 3OBGA 2VTSA 5KZ0A 2QC6A 2VTOA 3U9NA 1Q24A 4QMSA 3D7ZA 4WUAA 2C1AA 2UW4A 4CZYB 1GZNA 3D5XA 5ETAA 3BV3A 2ZVAA 3SX9A 4E26A 3H4JA 3ZC5A 2WFYA 5CEOA 5JMSA 3GCQA 3VW6A 3BHYA 4XG8A 4E8AA 4AW1A 4W9WA 1MQ4A 2J0MB 3R04A 4ZSAA 4GK4A 4FTAA 2WMSA 4QMYA 5TF9A 4LGGA 3QU0A 4BCIA 3G5DA 2W0JA 3VS4A 3ZDUA 3QQUA 2G2IA 3I5NA 4RMZA 4AUAA 1FOTA 3EKKA 3HKOA 2VD5A 3HLLA 3TZ7A 2WOTA 1F5QA 4ARKA 1SYKA 4TY1A 3FSFA 3RHXA 4AZEA 5B7VA 3AG9A 2I0VA 2PVMA 4RJ4A 3KVXA 4D55A 2J51A 3HUCA 4X2FA 3EZVA 5EDQA 3ZO3A 1O6KA 4DT8A 4O0TA 3ZH8A 3FE3A 5AR3A 2HY0A 5EYCA 4EBVA 1XBBA 3LXNA 5HCXA 2VO7A 4OAVB 2O64A 4YJOA 3RNIA 2Z7LA 3KFAA 4PTGA 2VWZA 4RVKA 3P9JA 2R3KA 4KABA 3DBCA 2PE2A 4FE2A 4CVAA 3QUPA 4F09A 4O7NA 2W1HA 4FIHA 2X0GA 3KMMA 4L3JA 2ITWA 4EH2A 1ZOHA 4FOCA 2XNPA 3BGPA 3PVUA 3OTVA 3FC2A 2GFSA 4NH1A 1OL2A 4M7IA 3R9OA 1R0EA 4JIKA 2QVSE 3Q04A 3R7GA 5CWZA 3R8MA 5DGZA 5C4KA 2IVTA 2GCDA 4Z3VA 4O7VA 2PVYA 3C13A 4BCJA 3ORNA 5IA0A 1WFCA 3HYHA 5B0XA 3JS2A 5CF6A 2CJMA 1IASA 4Q9ZA 2PY3A 3SV0A 4AE9A 4IB5A 4IDVA 3FEGA 2B9JA 4YZNA 3H9FA 3OW4A 5J9ZA 2J5EA 2AYPA 4FODA 3OCGA 4I6QA 1Z5MA 4KIPA 5HOAA 1YXVA 4EOMA 2QOQA 4CRSA 4UY9A 3PUPA 3FZRA 4MH7A 4O38A 2R0IA 2XKEA 2OJ9A 3NYOA 5CVHA 5AUZA 5EKOA 4HYHA 5M55A 3WI6A 4AW5A 3BU5A 3OFMA 4IVAA 4X6QC 4FMQA 5FP6A 3ZTXA 4TYHB 5EYMA 3VRZA 4ACHA 3W2RA 4OBQA 3VUKA 3L9LA 3F82A 3ETAA 3NNWA 3ZLXA 4OBOA 5FM2A 4NFMA 4YHTA 3WYYA 1OL7A 4A9YA 2HZIA 4BIEA 4RVMA 3RZFA 3L8SA 4PMSA 4X2GA 4G3DA 4WOVA 4ERKA 3QD2B 5HE0A 4C4EA 5EDRA 5C1QB 3NS9A 4XRLA 3O7LB 1YHWA 1HCLA 1KV1A 2HW7A 3CJGA 2DUVA 2R7BA 2O3PA 3E3PA 5JK3A 2UZDA 3HL7A 3EKNA 3GCUA 3EWHA 2C3LA 3WZEA 4BZDA 5AFVA 4MXXA 3F5GA 5H2UA 3IW4A 4NCTC 4Y73A 5ETFA 4IJPA 4EJ7A 2FSTX 4C37A 4G34A 1WBOA 1Q99A 3DBFA 1A9UA 3TTIA 2Y4PA 3QYWA 2B9FA 3UC4A 5CANA 2ZV9A 2PMLX 2QO9A 5IQCA 3A4OX 3E88A 4FEVA 1JOWB 2WEVA 3NW5A 3R9RA 3UE4A 1NVQA 2W4KA 3OXZA 4F65A 4A9SA 4AF3A 4WBOA 4G6NA 2DS1A 4HNFA 3U55A 3F5XA 2GS6A 2CNQA 4FTLA 4X2KA 5DR2A 4D58A 2JIUA 5IQHA 2R3NA 4CT1A 4H58A 4CKIA 4FT0A 4WG3A 2YCSA 2ITXA 4O7LA 4X3FA 2R3OA 3Q2JA 2Y6MA 4L7SA 3W2CA 3OVVA 4U7ZA 2YWPA 3HDNA 4CLIA 4DE4A 2JBPA 2YN8A 4ITIA 2WMTA 3VWAA 4RIWA 5M08A 1XJDA 4ZJJA 4I94A 4C4FA 5CF5A 1CKPA 4TKSA 4OTDA 4ZTSA 1OVEA 2VZ6A 2XNBA 1OZ1A 3AD4A 4IE9A 1EH4A 3TWJA 2X2KA 3BYVA 5IA1A 4ZS4A 3QA0A 3DK7A 3OXTA 3PVGA 3QQLA 4U3ZA 5HTBA 2ERKA 5HCZA 3ACKA 4FNYA 4WG4A 3TUBA 3HECA 3UNKA 4B6LA 3UNJA 2WMVA 4M8TA 4MCVA 1YWRA 4FL3A 2JD5A 3BGZA 3DLSA 4X3JA 2R7IA 3FC1X 4EH6A 2J0JA 5BVFA 2ITPA 1R39A 4O7YA 4YPSA 3MPMA 2VNYA 4QYFA 4FKIA 2A4LA 2XIRA 3PPZA 1GIHA 4XMOA 3VN9A 1K2PA 5CU0A 5K5NA 4TWOA 3M42A 4RBLA 3VUDA 1FMKA 4BBMA 2VV9A 4L44A 1YI6A 5M53A 4F9YA 1G8SA 5J8IA 3R28A 3LFAA 4QMQA 4M15A 3CBLA 2ZMCA 3FYKX 3OCTA 4XV9A 5DOSA 3NIEA 3C0GA 4M0YA 3W8LA 2BZKB 3C0HA 4HVHA 4ZMFA 3MSSA 3FBVA 4OBPA 4GH2A 5AIRA 4FBXA 3W2PA 5D9HA 3ZLSA 3NCZA 4IWDA 4RIXB 3PJ8A 4G6LA 2PZIA 3EFWA 5ANOA 4NU1A 3RNYA 3KXNA 3FZOA 3W55A 5AM6A 4GK3A 5HG9A 3EH9A 3ORKA 1OPLA 4FUYA 1ZWSA 4IWOA 2PSQA 4DGGA 3QUEA 5FDPA 3PRFA 5DT0A 3U87A 5JFWA 5C8KA 2BTRA 3NYVA 4V05A 3VC4A 4IWPA 3LFDA 2JC6A 3V5WA 4IZ5A 5KHWA 5DR9A 2H9VA 4EOKA 4YTHA 2QO7A 3UBDA 4GUEA 4IDTA 3ZC6A 4CG8A 3ENHA 4NL0A 5B2MA 5E8ZA 1IAHA 2JDVA 3V6SA 2CKEA 5BVDA 5ETCA 4PPAA 3PSCA 1H25A 4GVJA 4U41A 4USDA 4ZSLA 4CTBA 3SLSA 4WO5A 3UJGA 3H9RA 3EB0A 4O0YA 5EI2A 5AV2A 3R7YA 4WSQA 3BV2A 2BDWA 3LE6A 3E62A 2C1BA 4H3PA 3BWFA 2B53A 3ZOSA 4AFEA 2XK4A 3TJDA 2WEIA 3V8SA 5LARA 2O63A 2OIQA 3AQVA 2JFLA 3QD3A 2PVKA 4RC4A 1OL1A 3RZBA 3ZHPC 4L43A 3RAKA 4E3CA 3LFEA 5HD7A 3NWWA 4D4SA 3FZPA 4BR3A 4M84A 3AT3A 1OKWA 2BDJA 1P5EA 3U54A 2VTIA 3P5KA 2V5QA 3Q96A 1Q97A 4R78A 3CXWA 2PE1A 4IW0A 4JIAA 4YNEA 5BX0A 2X39A 1XH9A 4YO6A 2B0QA 3FLWA 3BLRA 4I21A 3ZSIA 3OWKA 3ZO2A 4OTIA 4QMUA 1U54A 4ANNA 4DCEA 3VBYA 1NVSA 3O0GA 3G0EA 4BDCA 3I0QA 2HWOA 2OZAA 3MA6A 4WIHA 2JKKA 4BWKA 4TYEA 3PY1A 4R5SA 4F1OA 4RC2A 3ZEPA 2QU5A 4J7BA 2BZHB 4KKEA 3LJ0A 3DAJA 4IX3A 4V04A 3VVHA 4GK2A 5A6NA 3W8QA 3ANQA 5IQGA 3RAIA 3QQGA 1JQHA 3PSDA 5K0KA 1IA9A 1O6LA 5D1JA 3PY0A 4IANA 1ATPE 4QNYA 1CMKE 3MS9A 5CXHA 3V8TA 3ZS5A 4AGDA 2CKQA 5BYLA 4QMOA 5ICPA 3F9NA 3TUDA 1E1VA 1PW2A 2W7XA 2XNOA 4FKTA 1YQJA 3KXHA 2JITA 3RPRA 2Z7RA 2X2MA 4C3PA 5ANKA 5AUYA 1IG1A 2X7OA 3WIKA 1OB3A 1URCA 2HELA 4ZK5A 2YIQA 1WBSA 4H36A 4NJ3A 4TZRA 5GJDA 2WPAA 4EH5A 5AP6A 3GUBA 2ITOA 3UIBA 4H1MA 4S31A 5C03A 3ULZA 4ACDA 4IFGA 2VTPA 4GEOA 4RJ8A 4ANBA 2PE0A 2XF0A 3BHUA 5E8VA 4DFNA 5IH6A 1SVHA 5A4TA 5E8WA 1I44A 5LMBA 4NSTA 2LAVA 3QTWA 5EHYA 3Q6WA 3QRJA 5FQDC 4YBKA 4J97A 1XHAA 3F7WA 1R0PA 4O1PA 2PVHA 2W1EA 3OS3A 4HYUA 4HW7A 5FP5A 3B8QA 4AFJA 5IEVA 2CMWA 4FZAB 3D5UA 3PA3A 4FIGA 4N0SA 5TR6A 4HVGA 3BEAA 4D5KA 4HJOA 1J7IA 4MTAA 3DBQA 3HAVA 1OMWA 2GHMA 4BDFA 4C38A 3ID6C 3THBA 3A60A 4DFXE 5CY3A 1QPDA 3E7VA 5J7HA 5K9IA 1KE6A 3MH3A 4I5PA 5CYIA 3IQ7A 3MH2A 4YC6A 2VO0A 4I6FA 1UU7A 4CKJA 3V01A 4LL5A 3QCSA 5DNRA 3R6XA 2A0CX 3H0ZA 2PUNA 1PKGA 4BCQA 4HGTA 4K11A 3V8WA 3BX5A 4EKKA 3NDMA 5CT0A 4UB7A 5CEMA 3VBWA 2X8IA 3F6XA 3D83A 3QC4A 3UGCA 4FK3A 2X4FA 3U4WA 5IUIA 3RCJA 4FV8A 3FXWA 4W4XA 3O71A 1UWHA 4UWCA 4PV0A 5FLFA 2H34A 3UIXA 5I3OA 4PMTA 4UMQA 2YEXA 3AC8A 4JAJA 4IX6A 3AMBA 5LQFA 3UPZA 3HV3A 5AJQA 2CN8A 2J0KA 4Q2AA 3ATTA 4M3QA 1BYGA 3PXYA 1Z57A 1FVTA 3UYSA 4D0WA 5KMJA 4N6ZA 4H3QA 5AMNA 5AR7A 2P2HA 4FNZA 3PWYA 3RPYA 4BDJA 3ITZA 5HIEA 3GU4A 3HZTA 5JQ8A 1XBCA 4QP1A 4BBFA 2R3IA 3D15A 4WNKA 3TG1A 4DLJA 5JKGA 1ZMWA 3EFJA 3JXWA 1KE8A 5E8XA 3OW3A 4F6WA 1YXSA 2ZM1A 1ZARA 3Q4UA 3QWKA 5AP2A 2XCHA 3RGFA 2XBJA 1TKIA 1Q3DA 3HVCA 4M66A 2FUMA 5CU6A 4D0XA 3U6IA 3N4UA 3JVSA 1XH5A 3FKNA 3PP1A 3QGYA 4XUFA 5D7AA 5E8TA 5AP7A 3WBLA 4O86A 5T3QA 4FKVA 3SW7A 2YCRA 5D12A 2J4ZA 2H96A 4K18A 4TT7A 4DGMA 5B2LA 4QP3A 5KX8A 2YDIA 3K5UA 3ORIA 1ZYJA 2HZ0A 2JBOA 3ZU7A 5HORA 3Q60A 4R3RA 4PDYA 4FF8A 1BMKA 3NX8A 3KL8A 4YJPA 4QT1A 5FXSA 2PPQA 3ET7A 1Q8UA 4E6QA 3FV8A 3PA4A 2UW9A 4C8BA 4NK9A 3TT0A 2W5HA 5KMMA 2HIWA 2BAQA 4K6ZA 5HVJA 3F5PA 4E6CA 3QL8A 2VTHA 4DG0E 4ORKA 3R22A 1NY3A 5E1EA 3N9XA 2XVDA 4O7SA 3R1QA 3ZXTA 1GZOA 1F0QA 1RJBA 3FL5A 4PP9A 5D7VA 2GPHA 4BGQA 4RX9A 1MRVA 3L9NA 5CX9A 3AC2A 4CQEA 3DBDA 1VYWA 4N4SA 5GINE 3BI6A 2CKOA 4IWQA 4FG8A 4MXZA 4NTTA 2GNGA 4OT6A 4EHGA 5IQFA 4F0GA 2WB8A 5BQ0A 5EM7A 3R02A 1Q8WA 5I9WA 3MY0A 2PVNA 3LM5A 4FGRA 1K9AA 1HCKA 2Y7JA 3DT1A 3UPXA 3LJ1A 4HGEA 4CFVA 3DKOA 2XJ2A 2Y9QA 4XOZA 4YJNA 3VW8A 4QYYA 4F9CA 2R3FA 4RRVA 1XWSA 4CMOA 5AAGA 4Q5HA 5IEYA 3ZCLA 2AUHA 2XM8A 2YCFA 3CP9A 3HDMA 2QHMA 2XK8A 4YJQA 3MWUA 4DH5A 5L2IA 2IW6A 3V6RA 1YVJA 4JRVA 4KNBA 2YM3A 4L46A 3RK5A 4NM3A 5FEEA 3HA6A 3SQQA 4B8MA 3SOAA 4QYEA 5AP3A 4UMUA 4HCTA 3RJCA 4UMRA 3ROCA 2ITYA 2WIHA 4FTRA 2WTIA 4PDSA 4U97A 5GIPE 4H05A 2RL5A 4B0GA 5FEQA 4C62A 4JAIA 3C4ZA 2RFSA 4S30A 1Y57A 1KE5A 2Z02A 3I7BA 4A9UA 4P90A 1FPUA 2ITVA 4G31A 4WRGA 5IA2A 2JKMA 3KN5A 3LIJA 3RK9A 3G51A 5EYKA 4CXAA 3FMDA 3H3CA 4BKJA 4CV8A 2OLCA 4PX6A 1Q62A 4ID7A 4AOTA 4OT5A 3TIZA 1IA8A 4CMUA 4EK4A 4D4VA 5IUGA 2GSFA 3RWQA 5CU3A 3R7UA 4AN3A 4AZSA 3NMUF 4AN9A 1H24A 5E8SA 5EQPA 5ANGA 5IEXA 2Z60A 3O51A 4J95A 4M12A 4RX8A 2BROA 4MF1A 4D4YA 4EONA 3W2QA 4FEUA 3C5IA 4FSMA 2WTDA 4HGSA 4Z9LA 4O96A 5IPJA 1GIJA 1P14A 1JSUA 2JGZA 4YJRA 2YIXA 3TV7A 3QZFA 4AZFA 5EOLA 3ZFXA 3FDNA 5TT7A 3UO5A 5I9UA 3C0IA 5BMMA 2R2PA 5AP4A 3UO4A 2VX1A 3WF8A 3KB7A 3WE8A 2F4JA 3C7QA 2PVRA 1H4LA 4G2FA 5AR8A 5CSHA 4AAAA 5GZAA 4CD0A 3QAME 4J53A 5M4FA 4BWXA 4WHZA 4YNOA 4AOIA 5DPVA 4IC8A 4NKSA 5FGKA 1M2RA 2W4OA 3TZMA 2B52A 1SMHA 2OO8X 4JJRA 4R77A 1XH4A 4CQGA 3S00A 2I0HA 4KBAA 3BEGA 2YM8A 3UMXA 2VTQA 2RG5A 2C5YA 4W4YA 5IU2A 4NW5A 3SGCA 4D1ZA 1BUHA 2EXCX 4QYGA 3VUMA 3ZBFA 4E7WA 5GZ9A 2C0OA 3RI1A 3U9CA 4GCJA 4YGAA 4D2TA 1H00A 2F7XE 2I40A 1WZYA 2WO6A 4EYMA 1WMKA 3E5AA 2ZV7A 3FPQA 3U51A 3CD3A 2RIOA 3G6GA 4IAYA 5EM5A 1DI8A 2BZIB 1YWVA 2CSNA 3D2IA 4UWBA 3DJ6A 5ANJA 3QKKA 4TWPA 4FI1A 3MY1A 3CR0A 3HMIA 2BRNA 5HIBA 1J91A 3HMPA 4X7QA 3DTCA 4RVTA 5CF4A 3QRKA 1J3HA 2IWIA 3KVWA 4FTQA 3PLAE 2R64A 4BFMA 2ZAZA 1V0OA 3PG3A 1OBGA 4JG8A 3KULA 3VS2A 4BVUA 3S2PA 3EN7A 5EW3A 5HCYA 1URWA 4C02A 2VNWA 3FXXA 1WBVA 2R0UA 3EQHA 4CMTA 3LCDA 4CT2A 3C4EA 4E5BA 4EK5A 1JNKA 4FV6A 5EQYA 3QTXA 3MJ2A 4MWHA 4FV9A 5LVNA 4O0XA 1OECA 4EUTA 4CZTA 5GJFA 2WOUA 4NJDA 5HGIA 3OG7A 1LEWA 2W1FA 4DFLA 3TUCA 3KK9A 4MVFA 4JG7A 2OF2A 4LRJA 2VWBA 3EJ1A 3VS6A 3R71A 1Q5KA 2WTVA 3ZEWA 4R7IA 3IECA 3C5UA 4M97A 3UVPA 4HVDA 4NM0A 4YR8A 1NW1A 1WAKA 3HV7A 4HCVA 4X3FB 3TACA 1GAGA 4JRNA 4IH8A 1L3RE 3FI2A 5CAOA 3TI1A 4ZZNA 1AD5A 2Y8OA 3I0OA 4G3EA 5HO6A 4FV3A 2VWWA 2JAVA 3UDBA 1SZMA 4I5MA 4BF2A 1OUKA 4QMLA 4EOJA 4I20A 3ULIA 3R30A 2W1ZA 3AC5A 3QQFA 4R3CA 4RLKA 5CZHA 3SRVA 4C4GA 3EHAA 3FQHA 4ZMEA 3UTOA 2HXQA 2OIDA 3R7VA 4Z7GA 2PMOX 4PL5A 4C58A 3NYNA 2XJ1A 3QZGA 3CLYA 1NA7A 2XYUA 3FKOA 3QTUA 4ZY4A 2V22A 3CPCA 4F63A 3QA8A 4CNHA 2UZOA 3EN4A 5AP0A 2YZLA 3GC8A 2B9HA 1W0XC 3LLAA 2X8EA 5HEZA 5GIOE 2BIKB 4L8MA 1IEPA 3RMFA 4LFIA 4CFMA 4CTCA 3F7ZA 3JR1A 2CKPA 3EIDA 1XBAA 2C5XA 5CT7A 4C4IA 1ZMVA 3EQFA 5K0XA 5AV3A 4RWIA 2UZEA 3BU6A 4F1MA 3SDJA 3FSKA 4G3CA 4FSQA 2YERA 1QPCA 2UVYA 4S2ZA 4UX9A 2BDFA 2X4ZA 4O7ZA 4EOQA 2O2UA 3ZO1A 3KN6A 3LPBA 2PU8A 4IXPA 4FX3A 5K3YA 2ESMA 3Q9YA 2GDOA 3CTJA 3T3UA 4ZLYA 5FTGA 1MQBA 3M2WA 4L3PA 5CQWA 3ROYA 3TNQB 4AP7A 3S4QA 5KO1A 3UQCA 4YSMA 4ZTMA 4F64A 5JGDA 3VQUA 2PVJA 3SVVA 3LVPA 2VO3A 2UZTA 4DTBA 4KKGA 3ORMA 5IQEA 2WIPA 5AADA 4AZTA 1YOJA 4O1OA 1CSNA 4M69A 3P7AA 5KKRB 3TM0A 2ZB0A 5CU2A 3W1FA 4ZIMA 2OH0E 1Q8ZA 2VTMA 2WD1A 2Q0NA 3CCNA 3KA0A 3MGYA 4ITHA 5DN3A 4F7SA 2W99B 4O84A 3GVUA 3NUXA 4XS2A 3LCKA 2F9GA 4U9AA 3ZUTA 2GS7A 4ALWA 4V0GB 4AE6A 1UNLA 4U44A 4GVAA 5HTCA 4XG2A 3KRJA 2EVAA 4YJVA 2OSCA 1H27A 3N51A 4FV0A 4FV5A 4IZ7A 5GHVA 3D4QA 1M2QA 1PXPA 2WMWA 5FD2A 2C69A 5IA5A 2YM7A 4JOAA 1MRUA 4FIEA 3SXFA 2EXEA 1ZY4A 4XYFA 5JRQA 2A27A 3RPOA 5E92A 3F3VA 4QP6A 3ATSA 3QQJA 3OEFX 5M4IA 5A3XA 2P55A 2J6MA 4O0SA 3Q52A 3G9NA 4P5QA 3TNWA 4BCHA 2WNTA 3U8WA 2WQBA 5K5XA 1W7HA 3BLQA 1PY5A 4ZS0A 4PPCA 4NCTA 1W98A 1BI8A 4FL1A 4BZNA 4DEAA 2BRHA 4RJ3A 5BYYA 4CCBA 3ZSHA 1UA2A 4C2VA 4FOBA 4IM2A 4ZTHA 5IMXA 3I6UA 5AUTA 4RPVA 3NNUA 2BVAA 4DCAA 2I6LA 5AAFA 2V55A 3KU2A 5DBXA 4G6OA 3VHEA 4Z55A 1WVWA 2UZVA 4O7TA 4YC3A 2O65A 5L2WA 1U54B 2B9IA 4PL3A 3PXZA 5DIAA 2XB7A 3FMHA 5AUVA 4AG8A 3UOKA 1WCCA 2OZAB 2VUWA 5ITAA 4QQ5A 1PYEA 1ZXEA 4GSBA 2W05A 2WMUA 1ZZ2A 1B6CB 4MHAA 4MYGA 4D5HA 4BI2A 4CYIA 2C6MA 2OFUA 2PVFA 3PXKA 1J7LA 4L6QA 1YDSE 5CAUA 5HBEA 2XS0A 4YP8A 1PRYA 5HI2A 3DB6A 4MKCA 5TE0A 3RP9A 2G2FA 4IAKA 4NWMA 4UV0A 4XG9A 5E90A 3TKIA 2B1PA 2H8HA 5M09A 3P79A 5M06A 3OUKA 2CLXA 1JKKA 3B2WA 2WTKC 4DT9A 2XEZA 2E9UA 2QLQA 2V62A 5EG3A 3TNPC 4YSJA 3UZRA 1FVRA 4FNXA 1CKIA 3Q4TA 4UYAA 5JFVA 3R0TA 4DN5A 3F5UA 4JR3A 5LMAA 5DG5A 5H8EA 4Z16A 3GT8A 1Z9XA 1RDQE 3G6HA 4GJ2A 2VTJA 1M14A 3FKLA 3GFWA 4PP7A 3FXZA 3EQDA 2OXYA 4Y85A 4FIJA 3IW8A 3DKCA 4F99A 2G15A 1REKA 3PXRA 3P78A 3M1SA 4TNBA 3OC1A 4KB8A 5CSVA 4AACA 2YM5A 4KIQA 3WF7A 3NGAA 3QKLA 4BDKA 5IZFA 4OR5A 5L4QA 2VGOA 1FVVA 4DEDA 4IAFA 4N57A 2O0UA 1YW2A 4DH3A 4IBMA 4FZFB 3FMJA 4IB3A 3W2SA 5DRDA 5E7RA 3OCSA 4CV9A 4I4FA 5D41A 2YZAA 1ND4A 3DFAA 1RE8A 3DJ5A 3NRMA 4BCMA 4O7WA 5HESA 3BELA 3K5VA 2JKQA 3Q5ZA 3QCXA 4RSSA 3QLGA 5E1SA 3UIUA 4D9UA 1V0BA 5I5ZA 4EOPA 2QOIA 2GTNA 4CFFA 3IW6A 3GOKA 4IFCA 4FKPA 3DPKA 2ZJWA 4BBEA 4G16A 5HG8A 2QCSA 4YPDA 4Q9SA 2C68A 3IDPA 2E9NA 1UWJA 2CGWA 3MN3A 3O96A 4ZSJA 4YLJA 4PL4A 3BPRA 2J0LA 5DE2A 2JDTA 4QP2A 3WILA 3CQUA 2X2LA 2PZYA 3QXOA 1W8CA 4FSRA 3RWPA 1OPKA 2C6KA 2W9FB 3IDBA 4JQ8A 4ZLZA 4R7HA 4OTQA 4KS8A 4QRCA 4X6RA 3VNTA 4ZAUA 2XK6A 3K54A 3DGKA 4C2WA 4F70A 3HV5A 5HO8A 3DDQA 4ENYA 1YRPA 2B7AA 4MNFA 5DT4A 4JVGA 5AP5A 1ZYLA 4EH8A 4PQNA 2HOGA 3O2MA 4EQUA 1M7QA 1WBNA 4FSZA 3KREA 1L8TA 3C4CA 1UKHA 4ZTRA 3R8ZA 4C3RA 4Y8DA 4EOSA 1K3AA 2ITTA 4XHKB 4RQVA 5IA3A 2BUJA 5L6OA 4C61A 4IAZA 4PPBA 3IOPA 3OOGA 3AC1A 4C7TA 1QPJA 3HGKA 4X2JA 3A7GA 4JDIA 1GZKA 4QTEA 5CVGA 4ITJA 3R00A 4JG6A 2F7ZE 3EYHA 2CCHA 4ZXTA 3R9DA 4C4JA 2IW8A 4JR7A 5FRIA 4F9BA 2RGPA 4AA4A 4FKQA 5ANDA 3K3JA 3NUSA 4AT4A 2IZSA 2O5KA 5M44A 3AT2A 1OL6A 4FSUA 4DFYA 1W84A 4W8EA 4PMPA 3V5LA 4I0RA 3MPTA 4Y5QA 5T68A 5HG5A 3ZYAA 3FQSA 4LYNA 5EQEA 1GZ8A 4H39A 3NLBA 3BBWA 4JDHA 3EN5A 3N4TA 4Y5HA 2Z8CA 3GC9A 2QG5A 4Y83A 2BHEA 4XOYA 3OEZA 2ETKA 4TTHB 3FZSA 4S33A 1QPEA 3MBLA 2C6OA 2VTAA 3AOXA 3H10A 4XG3A 4ACMA 5EW8A 1U46A 2ZOQA 5EH0A 5JRSA 3W32A 2G2HA 4YTFA 3BYMA 4GS6A 3Q9ZA 4XP0A 4Y95A 3A7HA 3GI3A 4EH7A 2NNWB 4BTFA 3ZRMA 2XNMA 3OZ6A 1BX6A 3TXOA 2QHNA 2XKFA 3L8VA 4I4EA 3VUIA 2WU7A 4DH8A 3CQWA 4RA4A 2PK9A 4D1SA 4KA3A 4PWNA 1MP8A 1W83A 2VTRA 3OWJA 3Q9XA 4QQJA 5F94A 3E8DA 4C4HA 3FJQE 2NP8A 2X7GA 3VBXA 2VO6A 4BDIA 3QWJA 4QNAA 3NCGA 4JS8A 2IZTA 1J7UA 3MJ1A 1BKXA 4EHEA 2XK7A 4AX8A 3EFKA 5HQ0A 5AUWA 5BVEA 4DTKA 3ZRKA 4ANOA 3ELJA 1RW8A 1JBPE 4IC7A 4QD6A 2R3PA 2XIKA 3OXIA 4NIFA 1KE9A 1Q8TA 2YAAA 2UZLA 4U8ZA 4TL0A 5JGBA 5AR2A 3LMHA 3ANRA 3FI4A 5A6OA 4BICA 1J1CA 3ZO4A 1TVOA 3UG2A 4IM0A 3HMMA 2WMQA 4GV1A 4W9XA 3LW0A 5L2SA 3QF9A 3GC7A 5J9LA 5GZ8A 4I6HA 4OTPA 4E5WA 4RIYA 3F2NA 3PPJA 5CTPA 1DS5A 5H9BA 3QRUA 1YXXA 3HUBA 3GB2A 4MQ2A 4EYJA 2YHVA 3OWLA 3JVRA 3QRTA 4FNWA 5IDPA 1S9JA 3ALOA 3JY9A 5CAVA 4FVRA 5C9CA 4F0IA 3D0EA 3GNIB 3A2CA 4OTWA 2ZV8A 3BKBA 5CAQA 4DTAA 1RQQA 3RBWA 3R8UA 3GU8A 3DS6A 4L7FA 1U5QA 2DYLA 1M52A 3COHA 4XV3A 4E20A 3ORZA 5BMSA 4KUJA 5FXRA 4R5YA 3OY1A 4QMPA 1A48A 4I23A 2UV2A 1QCFA 4GYIA 5DYJA 3SG8A 1PF8A 4F6UA 3AT4A 4LL0A 4E4LA 4B9DA 4II5A 3EOCA 4BKZA 4TYJA 4OAUC 1OUYA 3OCBA 3ZLYA 3ENMA 4B99A 4XJ0A 3QX2A 4BTJA 5CI7A 2R3JA 4FKGA 2IG7A 2EXMA 4D1XA 4GUBA 3VRYA 5BVWA 4L68A 5CXZA 1Q4LA 2FVDA 4AZWA 4E73A 4S34A 4D2PA 3OROA 4Z7HA 3DKGA 4F7NA 4O7RA 3BE9A 4YO4A 2ZV2A 2ITQA 2NRYA 3ZM4A 3UC3A 4ZP5A 4RZVA 4YZCA 4FZ7A 2P33A 3MB7A 2RFDA 4BHNA 2C3JA 4AW0A 2RF9A 3D9VA 4PDOA 3BIZA 4DEEA 5A4EA 3MTLA 1GNGA 5DMZA 2F57A 4Y72A 1KOAA 2BHHA 4YC8A 3T3VA 5J1WA 4G1WA 4TW9A 4DYMA 4CZUA 5JH6A 1PXMA 3L8PA 3DXQA 3NUUA 1H1SA 3IPHA 4EH4A 2OU7A 1Y91A 2ERZE 4BGHA 2VRXA 3C4WA 3POOA 2GS2A 2WU6A 4EQMA 1GY3A 2YJSA 3HRCA 4QP4A 3MH0A 3TV6A 3LCOA 4J1RA 3VUHA 4YJTA 5HICA 3UP2A 3REPA 3CGFA 4IQ6A 4ACCA 5AR4A 3LFSA 3A7FA 1YI4A 4F7JA 3FWQA 3N4VA 3QFVA 5C4LA 4IM3A 1G8AA 3DNEA 4RWJA 3NNXA 3O17A 3TJCA 2WTCA 1O6YA 4UBAA 4XG6A 3VULA 3WF9A 2UZUE 3U6HA 1SVEA 2XNNA 4MF0A 3KULB 2W06A 5FBNC 5M57A 3VUTA 2ZB1A 4A4OA 4OTHA 4FTIA 4WA9A 2OH4A 4MXCA 3HMOA 3AXWA 3PTGA 5FTOA 4AW2A 3RPSA 4RX5A 3BCEA 4CSVA 2EB2A 3PE1A 3KXZA 4BL1A 3HAMA 1WBPA 1PMUA 3NEWA 3COIA 4O6LA 2CCIA 4FTOA 4P5ZA 4CGAA 4NW6A 5CNNA 4OGRA 3Q6UA 2PMNX 4F6SA 4MAOA 1CDKA 4I6BA 3QQHA 3CIKA 3RK7A 5JGAA 4O2ZA 3NSZA 2YIWA 4IZYA 4R6VA 2BIYA 2XKDA 3SKCA 1HOWA 5HLNA 3Q32A 2XH5A 3ZFYA 2YFXA 4FIFA 4R3PA 4DAWA 1OPJA 4G9RA 5FG8A 1WBWA 3IK3A 4AWIA 4XG4A 3ODYX 2XZSA 2ZM4A 4ERWA 2W1DA 3OF0A 3OT3A 4HNIA 5I0BA 2Q83A 4I93A 4QMTA 4EEVA 2QNJA 1H08A 1Q3WA 4Y46A 3VJOA 2W4JA 3U6JA 4KIOA 1M17A 3O50A 4A9RA 1TQMA 4BN1A 3QTZA 3DOGA 4X2NA 4JQEA 3LFBA 2REIA 2ETRA 2OJIA 2VTNA 4IVBA 4JX3A 1PXLA 4FT7A 1Y8GA 1STCE 4OTGA 2J0IA 3VQHA 4EZ7A 3DB8A 2V7OA 3Q53A 3E64A 1BL6A 3JY0A 4I22A 3V5QA 4DEHA 4EHVA 3HNGA 4WT6A 4ZZOA 5IG1A 4IAIA 1U4DA 2V0DA 2WHBA 3MIAA 4FKLA 1R1WA 4AZVA 4BTKA 4IAAA 5J9YA 4BYIA 3LJ2A 2X6DA 5AX3A 4USEA 2UW0A 4LG4A 5HLWA 5AEPA 4GT3A 3ZM9A 5EK7A 3UYTA 3PJ2A 4YLKA 4YJUA 3KXXA 3PIYA 5L6WL 4L01A 4FKRA 2P2IA 4FL2A 1XQZA 2ITUA 2JEDA 3RM7A 4GKHA 4ASDA 3KMUA 3ODZX 3P08A 3G9LX 3RM6A 4LGDA 3F69A 2YIRA 3MH1A 4BDEA 5M51A 2BZJA 5FDXA 4CLJA 2W9ZB 3QALE 4C57A 4HPTE 1XR1A 2Z2WA 2E9VA 3NR9A 4U3YA 2R3LA 2GQRA 5IMEA 4RG0A 4ZOGA 4KRDA 4LOOA 3DFCB 3LAUA 4JX7A 4KINA 2CNUA 4S32A 1WVYA 2XRUA 3D14A 5M56A 1OIRA 4NKAA 1ZYDA 5AWMA 4FA2A 1JPAA 4FGBA 2QOOA 2WQOA 4KKHA 3G90X 3NW7A 2VWXA 4EL9A 4QQTA 3VIDA 3RAHA 3A62A 5L2QA 5KMNA 3VF8A 4RJ6A 1OM1A 4O0UA 4UXQA 3LHJA 2HZNA 4AGUA 2UZWE 3MFSA 4KRCA 2R5TA 1UNGA
chains in the Genus database with same CATH superfamily
3IONA 1H07A 2KTYA 2QOHA 3FY2A 4O6EA 2R3MA 2IVUA 4PUZA 4RWLA 1IRKA 4G5JA 3E93A 4O4BB 3ZLWA 1KWPA 4BDAA 4G17A 3R8LA 3UZTA 4QP9A 3TCPA 4C59A 5HTIA 3NPCA 4AXAA 2NRUA 3KRWA 3Q9WA 3ZONA 2J5FA 4IX5A 5J95A 1H01A 5JFSA 5E8UA 3NVKI 3CE3A 4JBVA 3TN8A 5ETIA 3ZSGA 4EOIA 4FV7A 4RT7A 3BWJA 4HPUE 4QTBA 1UU8A 3MI9A 5IH4A 3TNHA 4DFBA 4QTAA 4QMNA 4XBRA 1QMZA 4LQMA 2UW3A 3QUDA 3QX4A 3ZMMA 4O83A 2FB8A 1JWHA 2FA2A 4L42A 3BLHA 4IZAA 4LI5A 3P7BA 5CSXA 1QL6A 5H8GA 3WZKA 4BDHA 1TQPA 2C6IA 2CLQA 4FSWA 2HENA 5H8BA 4F4PA 4R7BA 2PWLA 4RJ5A 2WMRA 2YJRA 2C0TA 2YM6A 3DCVA 5KCVA 4FT9A 3FQEA 1E1XA 2C6EA 2ZDUA 2QOBA 3GCVA 3AD6A 4M67A 3R7OA 3PIXA 4RFMA 1UU9A 4WSYA 2QURA 1ZYSA 2UVXA 1YXUA 4EBWA 1Y6AA 2WAJA 1KOBA 3KMWA 4I24A 4XEYA 4CFUA 2WMAA 3F2RA 4XLIA 4DEGA 4JMQA 5L3AA 2EWAA 1KE7A 2WZJA 4XRJA 2WQEA 3PXQA 4G3GA 4GYGA 1OKZA 5FM3A 4BIBA 1B38A 4GL9A 1ZMUA 4GRBA 4BCGA 1ZOEA 3C4XA 4RGJA 3A4PA 1XMLA 1AQ1A 4D2RA 2UW7A 5IA4A 3LCSA 4APCA 3NW6A 4AQCA 1LPUA 4IACA 4U5JA 3UVRA 3RKBA 3MV5A 4QPAA 3T9IA 3EQCA 2OI4X 2XEYA 1CTPE 1ZRZA 2X9FA 2YA9A 3PA5A 4HYSA 2IO6A 3NAXA 4BC6A 4GFMA 4AGWA 4UMTA 4W8DA 3SD0A 3H30A 2X8DA 4UYNA 2C6TA 3PUFC 3W2OA 4O82A 2VX0A 2YDKA 2RFNA 1Q41A 4FVQA 5L8JA 3ZRLA 5HBJA 3FMEA 1LEZA 3CTHA 2V7AA 3HA8A 2IJMA 2HZ4A 3TZ9A 4RIWB 3EN9A 2HXLA 5LVLA 5CQUA 3G15A 1JKSA 4MWIA 5AUXA 4JT3A 5CI6A 4UMPA 5FUTA 4YTCA 1JAMA 3TKUA 2CGUA 2FSLX 1X8BA 4XLVA 3PJCA 2IZUA 4JL9A 3GU5A 3VS7A 1P4OA 4M14A 3Q5IA 4RQKA 4FZDB 2HYYA 1KSWA 4I3ZA 3EL8A 5IUHA 4AOJA 4RZWA 1PMNA 3A8XA 5HD4A 4BCKA 4CFWA 4ANMA 4BI0A 5DR6A 2YLFA 3F88A 3QGWA 4E5AX 4FT5A 2PVLA 5IQBA 4USFA 2XIZA 3KKVA 3PVBA 3DKFA 3FHRA 3LXKA 3BBTB 4QTDA 2JIVA 3FL4A 3KXMA 3WF5A 2C5NA 4DGNA 3QZHA 4G9CA 4EI4A 4O21A 4ZEGA 5DEYA 5LWNA 5ACBC 1PXNA 2FH9A 3R7IA 3PYYA 3PRIA 2QG7A 3QTIA 3IG7A 2SRCA 3PXFA 5C8MA 5DVRA 4R1YA 3V3VA 4MK0A 3RTPA 4P2KA 2EB3A 3H0YA 4CKRA 5JN2A 2XJ0A 4HVSA 4AGCA 3KRXA 3QTRA 3GC0A 3U4UA 3GEQA 1O9UA 3RAWA 4RFZA 4XBUA 3SAYA 2OIBA 3LFCA 4GJ3A 2ETMA 3A8WA 3HMNA 4J8NA 3S3IA 2ZYBA 1T45A 3MDYA 1A06A 1OI9A 5EHOA 4ZSEA 4EOOA 1U5RA 5I9XA 2QR8A 4XV2A 4EKLA 5FTQA 3AD5A 4IHPA 3L9MA 4QYHA 1YOLA 2OJJA 5HX6A 3ZDIA 2NO3A 2F49A 2W1CA 5JFXA 4DBXA 4BCPA 4FK6A 5EFQA 2PZRA 4QMXA 3BYSA 3IGGA 3OHTA 4FZ6A 5EI8A 3NIZA 5J87A 3W10A 3WIGA 5DFPA 4AN2A 5CF8A 3I81A 5C8NA 2BMCA 2BR1A 1M2PA 3KEXA 4MD9E 4O0WA 5I9VA 3DXPA 4R1VA 2QOFA 4WG5A 3W18A 2WELA 3I60A 1JSTA 4JNWA 5B2KA 5CEKA 2XBAA 4K33A 3BQRA 4TRLA 3RCDA 3UZPA 5L8LA 3ORLA 2X9EA 3OUNB 3PJ1A 4O22A 3E92A 2OJFE 4E6DA 2J90A 4RLLA 2P3GX 1UNHA 5J1VA 3PFQA 2E9PA 4YZDA 4QMMA 3TDWA 3B2TA 3C9WA 5HVKA 2FO0A 3K3IA 4NYEA 5CNOA 1P4FA 2PL0A 3II5A 5E9EA 3WYXA 2DWBA 3AGMA 2YAKA 3LMGA 4QPSA 2HY81 1TZDA 4J71A 4LV8A 4NZWB 4A4LA 4AQKA 2XNGA 1H1WA 5LWMA 4IVDA 4HGLA 3D2KA 4O2PA 3R83A 2XKCA 3GENA 4NUSA 1ERKA 1PXIA 3PLSA 3EQIA 4ASXA 1FINA 1PKDA 1PMEA 1SNUA 2PTKA 3NUYA 4YBJA 4BRXA 5IH5A 1DI9A 3PZEA 5TKDA 4HVIA 2W1GA 4FG7A 2PUPA 2B54A 2E9OA 3IGOA 4CRLA 4FSNA 3MA3A 3EL7A 5LCJA 5ANEA 4MEDA 1GOLA 1YWNA 3MVMA 3QTQA 3DK6A 3GU7A 3OP5A 3K2LA 3HRFA 4KIKA 3WOWA 1YXTA 4K1BA 3D7TA 3R1SA 2Q0BA 4B8LA 5HNIX 4BDBA 2F7EE 3DU8A 1VZOA 3OY3A 5D11A 3PZHA 3QBNA 2VTTA 2X7FA 4I0TA 2GHLA 3F61A 4M0ZA 2WGJA 4QMZA 4XP3A 4PNKA 4DEIA 5JZJA 1XH7A 3TTJA 5F9EA 2Y4IC 1ZOGA 3EQGA 4D9TA 3I4BA 4FTMA 3C4FA 4FTJA 4JQ7A 4L3LA 4NIFB 3TZ8A 3VAPA 2E2BA 3VUGA 5HG7A 4C35A 4XG7A 4G5PA 5A4LA 2OK1A 5AA9A 3ZBXA 4TN6A 3UQFA 4JI9A 3F66A 4F9AA 5FBOA 2AC5A 3FLYA 1JSVA 3KQ7A 4EK8A 5KBRA 2YWVA 4KBCA 3OWPA 4D2VA 4GKIA 1MUOA 4YZBA 4E93A 4XCUA 5BYZA 3PG1A 3LM0A 2QR7A 3I7CA 3BHVA 4RIYB 4BB4A 5EW9A 3T8OA 3KK8A 1PXOA 2QOLA 4U42A 3TV4A 5J79A 2C3KA 2WMXA 3O8UA 2QU6A 4DITA 1XH8A 2QOKA 1R3CA 4ZY5A 2GNIA 3CS9A 5HNGA 3WZJA 2XALA 4MUQA 3AKKA 5IQDA 5I9ZA 4BDGA 3LQ8A 2BFXA 2GNJA 4NM7A 3UP7A 3ERKA 3ZFMA 3MTFA 3BU3A 3LFFA 3QCYA 2G1TA 4WUNA 3DAKA 3KXGA 4FSYA 1YKRA 3QC9A 4QQCA 3E8NA 4DLIA 3QD4A 2BPMA 3UODA 3PVWA 4FEWA 4MNEA 4E4MA 5CSWA 2J2IB 3MVJA 5LCKA 1NT2A 5KBQA 3V5JA 2BKZA 4E4XA 1OKVA 1V0PA 2J9MA 4LV7A 3R63A 3CPBA 3IW5A 2GFCA 2OF4A 5LVMA 5CU4A 2YISA 4KSQA 3UVQA 1XH6A 2GHGA 3NUPA 1OBDA 5AR5A 3R9NA 4JLCA 5IQIA 5EM8A 3DJ7A 2OFVA 3FZTA 4FTCA 3VBTA 1BL7A 3HRBA 3WE4A 3UNZA 4DBNA 3LZBA 4U6RA 3BRBA 5AV0A 4HCUA 3R8VA 2J50A 2XM9A 4AT3A 2JKOA 1VR2A 4GG5A 2FSMX 5C01A 3CQEA 4EHZA 1NXKA 4KBKA 4UN0C 4FIIA 2VWVA 4TYIA 3ZUVA 3AGLA 1U59A 2JDSA 5HE2A 3AMAA 4IMYA 2XIXA 3SOCA 1E9HA 4E1ZA 5GNKA 4X3FC 4CFXA 5IF1A 3DLZA 2FYSA 4YTIA 5ANIA 2YM4A 4JBPA 4CG9A 2BFYA 2H6DA 3DZQA 4LMUA 3VBQA 2CGVA 2ITNA 3COKA 3O8PA 4C33A 3R1YA 4EC9A 4EQCA 2F2CB 1YDTE 1H28A 5KZIA 2WQNA 3DAEA 3ZXZA 4M68A 4M13A 5JEBA 4I5CA 4MD7E 3EQBA 5JZNA 4ZJVA 4XNEA 1DAYA 2IVVA 4O27B 1YDRE 4C3FA 4E6AA 2J7TA 4PNIA 1G3NA 2VAGA 5HU3A 2QODA 3R9HA 4AXDA 4FTTA 3O5AA 3OTUA 3DV3A 4PF4A 1OIQA 4BDDA 1S9IA 2Z7SA 4I92A 3RHKA 2PZPA 4QP7A 4BCFA 3R21A 2VTLA 4FKUA 1AGWA 3MYGA 2PUUA 3QKMA 5ACKA 3WARA 2YDJA 4B7TA 4RA5A 1IAJA 2BRGA 4XP2A 2C6LA 4UALA 2YACA 2XK9A 2C30A 2QONA 4WBBB 4ZZMA 4FVPA 4U81A 4KS7A 3BGQA 1VYZA 3DXNA 3P7CA 3LXLA 4GT5A 4L53A 1UKIA 2ITZA 3A7IA 4XH6A 5BUJA 4I1ZA 1YI3A 2W5AA 2XNEA 3IDCA 3OBJA 3I5ZA 4V0GA 5IDNA 3FLQA 4DGLC 1B39A 5DHJA 3QXPA 4KD1A 3EYGA 3B8RA 3PSBA 1UV5A 5E8YA 3VHKA 3UOHA 4U45A 5CEPA 5J5TA 3KRLA 4MBLA 4C34A 2IVSA 5LOHA 1FGKA 4EUUA 5KE0A 4DHZA 4ZSGA 4I41A 5I3RA 2XAOA 5CASA 5CZIA 1YHVA 1H0VA 4IIRA 4MXYA 3ORPA 4MX9A 4FTKA 4D2SA 3TIYA 3H9OA 3UQGA 4GU9A 2R3QA 3P0MA 4TXCA 2WMBA 2IW9A 3LCTA 2Z7QA 4EORA 5HO7A 3SHEA 5KKRC 2YABA 4GG7A 2CPKE 4TYHA 4ACGA 4IX4A 2QKRA 4O4FA 1OGYA 3ACJA 4AA5A 3SC1A 2BTSA 4FKJA 4EC8A 1KV2A 3FMKA 3MIYA 3EQPA 1Y8YA 1JKTA 1WVXA 3CGOA 2QLUA 3D5VA 4FYNA 4NM5A 3IOKA 5AV4A 4LV5A 4QMVA 3PP0A 1PXJA 3UOLA 4FV1A 4AU8A 2VWYA 4O81A 3VJNA 4BWPA 4FC0A 2XCKA 3V51A 4R8QA 2OKRA 2NPQA 4FR4A 4N70A 1CKJA 3P86A 3FYJX 5HLPA 1SM2A 4TPTA 2W1IA 4F7LA 3VS1A 5HNBA 2VN9A 3O8TA 3F3WA 1PHKA 3OT8A 2R3HA 4F9WA 1OGUA 4FTNA 3MVHA 3A61A 4MBJA 4YHJA 3TEIA 1J1BA 4NTSA 4ANQA 4GFOA 3FLSA 3FMNA 4J8MA 4FKWA 2X81A 4RC3A 4BI1A 5I9YA 1IR3A 3PPKA 3HV4A 4OTFA 3C51A 4DDIA 1FMOE 3F2AA 3ZZEA 4P4CA 3ALNA 1BI7A 3R2YA 3FLZA 3TKHA 4EOLA 4L67A 5BVOA 3LKMA 5IQAA 4WRSA 2DQ7X 2WXVA 1VEBA 5DA3A 4DGOA 4IEBA 3WF6A 2R9SA 3QHRA 5DWRA 5CEQA 4FT3A 2FGIA 1JVPP 4CEGA 4AS0A 4D4RA 5M4UA 1I09A 3JUHA 4C0TA 4MQ1A 5DH3A 5D10A 4KSPA 5L8KA 5EI6A 2VGPA 5L6PA 3E8CA 3FUPA 4ALUA 3KCKA 2EU9A 3NVMB 4DH7A 3NUAA 3I6WA 4P7EA 3FHIA 3FZ1A 3DZOA 4RWKA 4U79A 5HKMA 2HAKA 5A4QA 1W2CA 2PUIA 3TDVA 3W33A 1OIUA 3QRIA 3FMLA 5LJJA 4DH1A 4LMNA 4LOQA 5E4HA 3RALA 4IB1A 2BAKA 1YHSA 3W0MA 3S95A 4UWYA 4EK6A 4AA0A 3SW4A 1KUTA 3TNIA 2QOCA 4GT4A 5A4CA 4WD5A 3IO7A 3QLFA 2RFEA 5AM7A 5BPYA 2EUFB 5HIDA 5JT2A 3MVLA 3HP2A 3R73A 1MRYA 2JLDA 4UZDA 2I0EA 4V01A 5EM6A 3CSVA 3GBZA 4HYIA 1PJKA 5LVOA 4EWQA 4ANLA 4AAYA 4GU6A 2XUUA 4TWNA 1SVGA 1NVRA 3FI8A 5TO8A 4DFZE 4LRMA 4C36A 2PHKA 3UOJA 4BHZA 1SNXA 4K9YA 3KCFA 1F3MC 3A99A 5TOZA 3HX4A 4F08A 1H26A 3CJFA 2B4SB 3PWDA 2BILB 5H3QA 2JFMA 4ZLOA 5EKNA 5KMOA 1LUFA 2YLEA 1GJOA 4UZHA 4FYOA 3Q4ZA 5BUIA 3GGFA 2WQMA 1PYXA 3GCPA 3WZUA 2QD9A 1FQ1B 3CD8A 2GU8A 4DC2A 3IKAA 3LQ3A 4I5HA 2PMIA 2YCQA 4H1JA 4PY1A 4BGGA 4DF3A 4XV1A 2JDOA 3WZDA 3R8PA 4NFNA 2O8YA 2ZM3A 3COMA 4ZTQA 4IADA 2OGVA 2UW6A 2QQ7A 3DA6A 4RIXA 5IISA 3VF9A 3DK3A 3I1AA 2CN5A 3AC3A 2AC3A 5L2TA 2ACXA 3QTSA 5I4NA 4A4XA 1UU3A 4A9TA 4QPMA 3BQCA 5BUEA 5DEWA 4AT5A 3BE2A 3LQ5A 3MFRA 1H0WA 4PMMA 4J99A 3FLNC 3KC3A 2C47A 3CEKA 3PY3A 4JBOA 5DRBA 5GJGA 5C27A 2RSVA 3DTWA 3G33A 3D94A 4X21A 4XX9A 4YZMA 2WTWA 4BTMA 5CENA 2VX3A 3MFUA 1ZLTA 3GP0A 3CC6A 5CSPA 3OOMA 1VJYA 4DHFA 5A14A 4H3BA 2UZNA 4DEBA 4A7CA 3QYZA 3CKXA 3NAYA 4ZJIA 1ZZLA 3QD0A 5BVKA 4FG9A 5BVNA 2C5OA 4QMWA 3UMWA 3R01A 5DT3A 3UO6A 3CY2A 4O0RA 5HVYA 3BYOA 3W16A 1V1KA 1JLUE 2W5BA 3P4KA 3EQRA 3CKWA 3MPAA 2XK3A 4YLLA 4E4NA 5A46A 1ST0A 5AV1A 3TMOA 3NZ0A 4MXOA 3IS5A 4BZOA 4BY9E 2R4BA 3NYXA 5HZNA 3DNDA 1FBNA 3P1AA 4EJNA 3PDTA 3SRVB 3R7EA 2X1NA 1YOMA 5KHXA 3RPVA 5LVPA 5A54A 2PYWA 3KRRA 4RIOA 2Y6OA 3MB6A 5K4IA 1Y6BA 3DQWA 2CNVA 4IVCA 3C50A 5HE3A 3VBVA 2ZMDA 2GQSA 2CHLA 3VONA 2GNFA 4U0IA 4LDTA 5E91A 3I79A 3MW1A 2GMXA 4MD8E 4DG2E 2B55A 4RX7A 2C3IB 2OG8A 2C0IA 5J5SA 4TYGA 2Y0AA 3BLAA 3L8XA 2CDZA 4EZ3A 2ZDTA 2UZBA 3FI3A 3JYAA 2HWPA 5EYDA 3EZRA 3UG1A 3LFNA 2UW8A 3D5WA 5CVFA 3NUNA 4YURA 4MXAA 4K2RA 4AXFA 4FEXA 3PE2A 4A06A 1REJA 3HV6A 3HEGA 4WNPA 3PJ3A 3FAAA 5EOBA 3SXSA 2XA4A 4FRFA 3QZIA 4PTEA 3ZUUA 4EK3A 2OBJA 5AP1A 3DBEA 3O23A 2A1AB 2HCKA 4PTCA 5FEDA 3EN6A 4F1TA 2ONLA 2W17A 2W96B 4D2WA 4L9IA 3EMGA 1P2AA 4KAOA 4BYJA 1JKLA 4ZTLA 3F3TA 4IJ9A 2XYNA 3BHHA 4JDJA 1H8FA 4UEUA 3MY5A 4ALVA 4CFNA 4YU2A 1OL5A 4FUXA 4NT4A 3SG9A 3NNVA 2RG6A 4LM5A 5LXMA 1ZY5A 3HP5A 4DINA 5AA8A 3F3ZA 4A07A 2GNLA 4W4WA 4U43A 5CLPA 4J98A 4OW8A 2R3GA 1GIIA 4L00A 2YITA 5JSMA 3OD6X 3QCQA 4J96A 4GMYA 4K8AA 1LR4A 2A19B 3A7JA 4M69B 3C1XA 4FKSA 5M4CA 4DA5A 4QDVA 5AX9A 3LMIA 3R1NA 4FEQA 2C4GA 1DM2A 4KWPA 4L52A 5HBHA 5HHWA 2XRWA 1WBTA 4L45A 4U80A 5M07A 3GQIA 3DY7A 3UIMA 1XO2B 2ONLC 1OITA 1LP4A 1APME 4YZ9A 3V04A 3L9PA 4ONAA 2FSOX 5AIKA 4O0VA 5FXQA 5DLSA 3EFLA 4D28A 3ZZWA 1G5SA 2GQGA 4FV2A 2XMYA 4FV4A 1W82A 5KNJA 4YUQA 4N6YA 4DHJA 4GFGA 3F3UA 5CEIA 3VS3A 5KUPA 3SA0A 5F1ZA 1BLXA 2JDRA 5A9UA 4Q5EA 2VU3A 4PRJA 5HX8A 2F2UA 4RJ7A 1Q61A 4JXFA 4QP8A 2Y4IB 2BCJA 4UXLA 3LOKA 4O91A 2XIYA 5F4NA 4ENXA 5JQ5A 2WKMA 1M7NA 3DQXA 5KMIA 2WTKB 2JAMA 3G2FA 4GIIA 2OICA 3VS0A 4YMJA 4ZY6A 1ZYCA 2JIIA 2WTJA 5HE1A 3W0NA 3Q4CA 5FWKK 2IN6A 4YHFA 5T6KA 3RVGA 4LRKA 1PXKA 5AUUA 4IB0A 1H1RA 4EZ5A 1H1PA 3KY2A 2HW6A 4YJSA 5KMKA 5LMKA 3GXLA 4J52A 2RKUA 2VWIA 3CY3A 3GFEA 3KF4A 3RINA 3L1SA 4BCOA 4KIKB 3KGAA 1R78A 3MFTA 4GIHA 3D7TB 4RFYA 4X0MA 4HOKA 5IKWA 3GU6A 3S1HA 3GQLA 4DG3E 5AAEA 4TWCA 4ZTNA 4JBQA 2BALA 4ASEA 5F20A 1PMVA 3AMYA 2QI8A 2UUEA 4OLIA 1T46A 4HZRA 2OW3A 4K77A 2YIYA 4BCNA 3O7LD 4HZSA 3DDPA 4LOPA 5G6VA 2PZ5A 1CM8A 2X6EA 2BAJA 3PIZA 3V5TA 3VO3A 4NEUA 4EH3A 5KMLA 3Q2MA 4TNDA 3V5PA 1UVRA 2BRMA 5CS6A 2OWBA 3AC4A 3E3BX 3FPMA 2C6DA 2P4IA 2I0YA 5BNJA 2PULA 3SXRA 3MESA 2C5VA 3ORTA 3Q3BA 3BHTA 3E8EA 3R2BA 3KF7A 3GCSA 4JDKA 5HU9A 5LMKC 4WKQA 4PDPA 2OZOA 3OMVA 3POZA 5F95A 2IPXA 4G3FA 4DFUA 1ZAOA 3LXPA 2BRBA 1OKYA 3FY0A 3M11A 4FKOA 4F0FA 3G0FA 4OTRA 4EH9A 2G9XA 5C26A 3FMMA 3JPVA 2GNHA 4W4VA 4WNOA 4LUEA 3T9TA 3UDSA 3ORXA 3BYUA 3QHWA 1OIYA 4U40A 3S0OA 4FTUA 5G1XA 3P23A 4LGHA 2KULA 2IZRA 3E87A 1TQIA 1Q8YA 2QKWB 4LUDA 3TL8A 1FGIA 5J7BA 5CAPA 2OXXA 1XKKA 4MBIA 4QOXA 5DI1A 1DAWA 4ANSA 3LLTA 3BZ3A 4I0SA 4BKYA 4CCUA 4QTCA 5CALA 2R3RA 2I7QA 2CGXA 2HK5A 5EDPA 5EHLA 2BKKA 3LFQA 2I1MA 2QO2A 4GW8A 2UVZA 4FSTA 4MNEB 4OUCA 1H1QA 2P0CA 4APPA 3GOPA 2XP2A 3CTQA 2A2AA 2GTMA 4CYJA 3E63A 4EWHA 4RVLA 4QO9A 2OXDA 2VWUA 4WNMA 2OJGA 3E7OA 2LGCA 5K4JA 2G01A 4FICA 3VS5A 4ASZA 4K0YA 4B4LA 4BIDA 3NFGB 2UW5A 3IW7A 3QQKA 3OBGA 2VTSA 5KZ0A 2QC6A 4QDEA 2VTOA 3U9NA 1Q24A 4QMSA 3D7ZA 4WUAA 2C1AA 2UW4A 4CZYB 1GZNA 3D5XA 5ETAA 3BV3A 2ZVAA 3SX9A 4E26A 3H4JA 3ZC5A 2WFYA 5CEOA 5JMSA 3GCQA 3VW6A 3BHYA 4XG8A 4E8AA 4AW1A 4W9WA 1MQ4A 2J0MB 3R04A 4ZSAA 4GK4A 4FTAA 2WMSA 4QMYA 3TYKA 5TF9A 4LGGA 3QU0A 4BCIA 3G5DA 2W0JA 3VS4A 3ZDUA 3QQUA 2G2IA 3I5NA 4RMZA 4AUAA 1FOTA 3EKKA 3HKOA 2VD5A 3HLLA 3TZ7A 2WOTA 1F5QA 4ARKA 1SYKA 4TY1A 3FSFA 3RHXA 4AZEA 5B7VA 3AG9A 2I0VA 2PVMA 4RJ4A 3KVXA 4D55A 2J51A 3HUCA 4X2FA 3EZVA 5EDQA 3ZO3A 1O6KA 4DT8A 4O0TA 3ZH8A 3FE3A 5AR3A 2HY0A 5EYCA 4EBVA 1XBBA 3LXNA 5HCXA 2VO7A 4OAVB 2O64A 4YJOA 3RNIA 2Z7LA 3KFAA 4PTGA 2VWZA 4RVKA 3P9JA 2R3KA 4KABA 3DBCA 2PE2A 4FJVA 4FE2A 4CVAA 3QUPA 4F09A 4O7NA 2W1HA 4FIHA 2X0GA 3KMMA 4L3JA 2ITWA 4EH2A 1ZOHA 4FOCA 2XNPA 3BGPA 3PVUA 3OTVA 3FC2A 2GFSA 4NH1A 1OL2A 4M7IA 3R9OA 1R0EA 4JIKA 2QVSE 3Q04A 3R7GA 5CWZA 3R8MA 5DGZA 5C4KA 2IVTA 2GCDA 4Z3VA 4O7VA 2PVYA 3C13A 4BCJA 3ORNA 5IA0A 1WFCA 3HYHA 5B0XA 3JS2A 5CF6A 2CJMA 1IASA 4Q9ZA 2PY3A 3SV0A 4AE9A 4IB5A 4IDVA 3FEGA 2B9JA 4YZNA 3H9FA 3OW4A 5J9ZA 2J5EA 2AYPA 4FODA 3OCGA 4I6QA 1Z5MA 4KIPA 5HOAA 1YXVA 4EOMA 2QOQA 4CRSA 4UY9A 3PUPA 3FZRA 4MH7A 4O38A 2R0IA 2XKEA 2OJ9A 3NYOA 5CVHA 5AUZA 5EKOA 4HYHA 5M55A 3WI6A 4AW5A 3BU5A 3OFMA 4IVAA 4X6QC 4FMQA 5FP6A 3ZTXA 4TYHB 1VLRA 5EYMA 3W0SA 3VRZA 4ACHA 3W2RA 3BL9A 4OBQA 3VUKA 3L9LA 3F82A 3ETAA 3NNWA 3ZLXA 4OBOA 5FM2A 4NFMA 4YHTA 3WYYA 1OL7A 4A9YA 2HZIA 4BIEA 4RVMA 3RZFA 3L8SA 4PMSA 4X2GA 4G3DA 4WOVA 4ERKA 3QD2B 5HE0A 4C4EA 5EDRA 5C1QB 3NS9A 4XRLA 3O7LB 1YHWA 1HCLA 1KV1A 2HW7A 3CJGA 2DUVA 2R7BA 2O3PA 3E3PA 5JK3A 2UZDA 3HL7A 3EKNA 3GCUA 3EWHA 2C3LA 3WZEA 4BZDA 5AFVA 4MXXA 3F5GA 5H2UA 3IW4A 4NCTC 4Y73A 5ETFA 4IJPA 4EJ7A 2FSTX 4C37A 4G34A 1WBOA 1Q99A 3DBFA 1A9UA 3TTIA 2Y4PA 3QYWA 2B9FA 3UC4A 5CANA 2ZV9A 2PMLX 2QO9A 5IQCA 3A4OX 3E88A 4FEVA 1JOWB 2WEVA 3NW5A 3R9RA 3UE4A 1NVQA 2W4KA 3OXZA 4F65A 4A9SA 4AF3A 2AQXA 4WBOA 4G6NA 2DS1A 4HNFA 3U55A 3F5XA 2GS6A 2CNQA 4FTLA 4X2KA 5DR2A 4D58A 2JIUA 5IQHA 2R3NA 4CT1A 4H58A 4CKIA 4FT0A 4WG3A 2YCSA 2ITXA 4O7LA 4X3FA 2R3OA 3Q2JA 2Y6MA 4L7SA 3W2CA 3OVVA 4U7ZA 2YWPA 3HDNA 4CLIA 4DE4A 2JBPA 2YN8A 4ITIA 2WMTA 3VWAA 4RIWA 5M08A 1XJDA 4ZJJA 4I94A 4C4FA 5CF5A 1CKPA 4TKSA 4OTDA 4ZTSA 1OVEA 2VZ6A 2XNBA 1OZ1A 3AD4A 4IE9A 1EH4A 3TWJA 2X2KA 3BYVA 5IA1A 4ZS4A 3QA0A 3DK7A 3OXTA 3PVGA 3QQLA 4U3ZA 5HTBA 2ERKA 5HCZA 3ACKA 4FNYA 4WG4A 3TUBA 3HECA 3UNKA 4B6LA 3UNJA 2WMVA 4M8TA 4MCVA 1YWRA 4FL3A 2JD5A 3BGZA 3DLSA 4X3JA 2R7IA 3FC1X 4EH6A 2J0JA 5BVFA 2ITPA 1R39A 4O7YA 4YPSA 3MPMA 2VNYA 4QYFA 4FKIA 2A4LA 2XIRA 3PPZA 1GIHA 4XMOA 3VN9A 1K2PA 5CU0A 5K5NA 4TWOA 3M42A 4RBLA 3VUDA 1FMKA 4BBMA 2VV9A 4L44A 1YI6A 5M53A 4F9YA 1G8SA 5J8IA 3R28A 3LFAA 4QMQA 4M15A 3CBLA 2ZMCA 3FYKX 3OCTA 4XV9A 5DOSA 3NIEA 3C0GA 4M0YA 3W8LA 2BZKB 3C0HA 4HVHA 4ZMFA 3MSSA 3FBVA 4OBPA 4GH2A 5AIRA 4FBXA 3W2PA 5D9HA 3ZLSA 3NCZA 4IWDA 4RIXB 3PJ8A 4G6LA 2PZIA 3EFWA 5ANOA 4NU1A 3UDZA 3RNYA 3KXNA 3FZOA 3W55A