5LJJA

Crystal structure of human mps1 (ttk) in complex with reversine
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
281
structure length
264
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMEYGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTDSQVGTVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Dual specificity protein kinase TTK
publication title Structural basis of reversine selectivity in inhibiting Mps1 more potently than aurora B kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 264
sequence length 281
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ljjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ljjA01
4CLIA 4IWOA 4WG5A 4FKGA 3VS7A 4FT3A 4RRVA 2ZV7A 4GH2A 3AC2A 4FTRA 1YWRA 3PA4A 3UJGA 3ANRA 3C4FA 4ZLYA 1OVEA 4S30A 4CYJA 3V5WA 4D55A 1ZY4A 3W16A 3F3VA 5AUTA 5DMZA 1WBNA 1NVSA 2ETKA 4YJRA 5M4IA 2W1GA 1H8FA 3POZA 4RJ7A 4U42A 3U54A 3EQFA 3NYNA 3NRMA 2VZ6A 3GCVA 3H30A 1Q8UA 4ZTQA 2CCHA 4UWBA 5GZAA 2JFMA 4JIKA 4GKHA 4O7RA 3F3ZA 4HNIA 4I24A 3MFUA 2J4ZA 2UZNA 3HEGA 2ERZE 2F4JA 3FY0A 3PA5A 5F4NA 2XRUA 4GFOA 5FLFA 5L3AA 1U4DA 5HBJA 1JOWB 2VX0A 1OL1A 3VO3A 1KE5A 3UTOA 3SD0A 1A06A 4RJ3A 3EL8A 3JS2A 3QF9A 3PRIA 3FHIA 2W7XA 3HL7A 5A9UA 4RFZA 2RFEA 5J7HA 1ERKA 1IA8A 5EYDA 3U6JA 2XA4A 3DS6A 4FKLA 2RF9A 3BQRA 5BVOA 1U54B 2VWYA 2X0GA 1ZXEA 3P79A 3QRIA 4N6ZA 3D2KA 3OCTA 4JRNA 1QPCA 3GC9A 4FNYA 3V3VA 5BVFA 3OUKA 2X81A 4MXYA 4ASEA 4KD1A 5L8LA 3UQFA 2VO6A 5H8EA 4EK8A 4O1PA 1QCFA 2V5QA 3R9NA 3FEGA 3JVRA 3R6XA 3Q60A 1AGWA 3HX4A 4OTHA 2IWIA 4RWIA 4BTFA 4TKSA 5HO7A 5IA4A 4I0SA 1YWVA 1Z5MA 3OY1A 3W2RA 5KMNA 3I0OA 2BALA 1VZOA 2OF2A 3TUCA 4ZMFA 3R22A 4B6LA 4YJVA 4KIKA 3F3WA 4TWOA 4PNKA 4A7CA 3KXXA 3M2WA 3W55A 5FDPA 4FR4A 4ZK5A 5M51A 3DXPA 5CANA 2XK4A 3E8DA 3V5PA 4AFJA 4C58A 3L8VA 4H1JA 3IOPA 5CAUA 3FLYA 2C4GA 4YNEA 2A0CX 2E9PA 1PKGA 3MPTA 2GQGA 2J0IA 5AR4A 2HWOA 4EORA 3DAJA 3RZFA 3KVXA 1HCKA 2QOCA 1OKZA 3K3JA 4OUCA 3JVSA 4BI1A 5BYZA 4GV1A 4P2KA 2PVFA 4IH8A 4RVMA 4L68A 2YCSA 4OGRA 4RWJA 3V8SA 3AG9A 1PXLA 5AEPA 5FTOA 2B1PA 3U4UA 5M07A 4QMMA 4GK4A 4IANA 4YPDA 1OIYA 5ETCA 3KRXA 4F7SA 5FM3A 3QQUA 4DE4A 2VO7A 3VF8A 3TT0A 2GNHA 2UZWE 4FTCA 3LM0A 4BTJA 2YACA 4FV7A 1Q99A 5H9BA 2PY3A 3FY2A 4TY1A 2CCIA 4AZSA 3E64A 5CSWA 4IADA 5FP5A 5KHXA 1JQHA 2O65A 1YXSA 1WBTA 4M69B 2BKZA 2WB8A 3OWJA 5J1VA 1JPAA 4W4XA 3CEKA 2BPMA 4XRLA 3EB0A 3VUKA 3ZSGA 2UZDA 2OLCA 3TNPC 2QQ7A 4QMTA 3W32A 2WTCA 3JR1A 2WELA 4BDKA 2JEDA 2XNEA 3EN7A 1OM1A 3CLYA 1GJOA 4J98A 4N70A 2BR1A 2WIPA 4UZDA 4GMYA 3KULB 5AR5A 3BZ3A 4H3QA 4TYEA 4RIYB 4ZS0A 3UODA 2OIQA 2FSOX 4CMTA 3COIA 4CQEA 1CM8A 5J7BA 2CNVA 3Q5IA 1T45A 1ZZ2A 2BZIB 2R2PA 3NNUA 4XS2A 3AGLA 3KN6A 2B54A 2VUWA 3HMMA 3P7CA 4FSUA 1MRUA 3VIDA 4GK3A 2Y6MA 1H26A 3MVHA 3GEQA 5J5TA 2GSFA 5CEQA 1UWJA 3PJ8A 4B8MA 4L46A 3OWPA 4G1WA 4X2JA 4G31A 4ORKA 1FGIA 3R04A 5DYJA 3RALA 2X9FA 4TYGA 4DBNA 2R5TA 3HRCA 1RE8A 2UZOA 2I0YA 5HI2A 5LCJA 3RAHA 3QHRA 2C6OA 3FKLA 3JY9A 1XBCA 4YNOA 5G1XA 4ZJIA 1OBGA 3I5ZA 3Q4ZA 2WNTA 4GSBA 4XJ0A 4F6UA 4UYNA 2C1BA 5ANOA 5AP6A 2I7QA 4J97A 4FEXA 2VWZA 3FDNA 4RFYA 4HYIA 5F94A 5IQFA 3VUIA 1H1RA 3F5UA 3IQ7A 4ZOGA 5ANGA 3UO4A 4F1OA 4L52A 2ACXA 2WKMA 2CGXA 5AM7A 4DH8A 4RX9A 2W1ZA 1ZOEA 2VU3A 3OROA 4W4YA 5K5NA 3TJCA 2FH9A 4NTTA 3P86A 1SMHA 4AE9A 5IH4A 5LMAA 4BCNA 4QMZA 3QC4A 4RA5A 4W8EA 4Q2AA 5AUWA 2RFNA 3OWLA 2UW8A 4MYGA 5AMNA 3DJ5A 5KCVA 3HV4A 3LM5A 4DF3A 4A06A 1PF8A 4MXAA 4U97A 3L9NA 2WOUA 4O6LA 5ICPA 2C6KA 5HESA 2C6TA 1Q8YA 2QONA 2R3NA 2WTKC 3EKKA 3N9XA 4UXLA 1OIQA 2PZIA 4OBQA 5EI2A 3TXOA 3LMHA 4PPBA 4RJ4A 5CX9A 5AJQA 2WMVA 2YM7A 4O0RA 4QQJA 5HTCA 4U43A 2YN8A 2J5FA 4DFBA 5IF1A 4KWPA 1XQZA 4F7JA 4FEVA 3LXNA 3MB7A 1VJYA 4BZNA 4MNEA 3FYKX 4V05A 4I41A 3NNWA 4XP2A 3FHRA 3QRTA 4JX3A 4QYHA 5HGIA 2UW6A 4RGJA 3DNEA 3GI3A 4WNOA 1YXUA 5CI6A 2J90A 3P1AA 3R02A 4Y5HA 5IQCA 4E5BA 5HE0A 2JBOA 2W1EA 2WMUA 3EQHA 4W9XA 1Y91A 4PDOA 5T3QA 3R7IA 4QYGA 2XIXA 3KU2A 4KKGA 3MH0A 1O6LA 4NZWB 4R1YA 2WMBA 4U45A 4L9IA 3F5XA 2YM4A 4ANOA 4EQMA 2OSCA 3PIZA 2A4LA 3KRRA 5HLPA 4YC3A 4C3PA 5ANEA 2IVTA 5HNBA 4NCTA 2ONLA 5CQUA 3VS1A 4JG7A 3ZC5A 1XR1A 5FBNC 4TRLA 3PFQA 3VBYA 3TZ7A 4FTAA 1W83A 3CJGA 3DTWA 4MBJA 2ONLC 2EXEA 2ZDUA 4JLCA 4NCTC 4QMSA 3ZDUA 3ZSIA 3NMUF 2BIYA 3QRJA 3V8WA 1VR2A 3E8EA 1PKDA 3S95A 3G2FA 4QP3A 5K0XA 4FODA 3A7IA 4MBLA 1BX6A 5EG3A 1KOAA 3K54A 4CD0A 5M09A 3UIMA 1G5SA 4FTUA 2AC3A 2PSQA 2JAMA 2VTLA 3E8CA 5CENA 3W2PA 4EWHA 4FKUA 4A4OA 4D1ZA 1NVRA 2AYPA 3NS9A 1M2PA 3WZEA 3OMVA 3EQPA 4CZYB 3Q9WA 2YCFA 4D2WA 3ORXA 4EUTA 5L6OA 5J1WA 4HYSA 2PVJA 4CZUA 2W9FB 2ITXA 2QI8A 3C4ZA 4MX9A 3N4VA 5DG5A 3PIXA 4FSNA 1OKVA 4FL1A 3R8MA 5JKGA 2QD9A 4LRJA 2UVZA 2BCJA 4D4VA 2XB7A 2W0JA 5JGDA 1WBPA 3Q04A 2ZB0A 5IEXA 5KZ0A 4EOQA 4C38A 1YRPA 3ALNA 3H0YA 3QUEA 3QWJA 2J6MA 4XRJA 5CNNA 2OIBA 3ZO3A 1GIJA 4JDIA 1FBNA 2WD1A 3MBLA 2V7OA 3QWKA 3K3IA 4FGBA 4BKJA 5CALA 3LFAA 4F9AA 4YJOA 2JKMA 1M2RA 3I7BA 4QP1A 3KCKA 4S2ZA 4AT4A 4YSJA 3OW4A 2FGIA 4J1RA 5JH6A 4O81A 3KF4A 5CEKA 3LKMA 2OJIA 4ASXA 4GFMA 2FB8A 3CD8A 3PZEA 5KO1A 2UVYA 5FP6A 5M55A 5JMSA 4FSQA 4I6BA 4F0GA 5JSMA 2C6MA 3PPZA 4PRJA 3VW8A 3PSDA 4RIXA 4V0GA 2XF0A 5J9YA 2O64A 4CKRA 2VWVA 3A4PA 2W5BA 2X8DA 3AD5A 4FBXA 2PU8A 5FDXA 5HD7A 3F6XA 3ENMA 3ULZA 4O7VA 1PXNA 3S3IA 1OGUA 3EQBA 4IVBA 2EUFB 5AP4A 3ZRKA 5GZ8A 4BL1A 4RJ6A 3LHJA 3I4BA 1DM2A 3O7LD 3PJ2A 3G0EA 4IBMA 3NUYA 2QOQA 4EZ7A 3BU5A 4QMLA 5J95A 5A4CA 3GP0A 2OI4X 4G3FA 3O8UA 5TE0A 2XKFA 2QOFA 2XM9A 3EIDA 3QQGA 2HWPA 5AUXA 3UNKA 2R9SA 3U9CA 3QTRA 3F9NA 1X8BA 4I4EA 2C3KA 2GTMA 1S9IA 2YM8A 4NSTA 4KIPA 5GNKA 4BCQA 5KHWA 4FV4A 2ERKA 2YDKA 3GB2A 3RGFA 2I0EA 1MUOA 2A2AA 4WRGA 5CZIA 4ZSJA 3UVPA 1H1WA 1YW2A 3W2OA 4EZ3A 2HOGA 5KNJA 5ETFA 2XP2A 4JDJA 3IW7A 3Q6WA 2XK6A 3B8QA 3SXFA 4L3PA 4XG7A 3TCPA 4DEIA 5HCYA 1RDQE 3EN5A 4AUAA 4WHZA 2IPXA 4FTLA 3E7VA 4XBRA 2C5OA 3P0MA 4KBKA 1YHSA 5LCKA 4ACHA 3SA0A 2NNWB 1CKJA 5CY3A 4B7TA 4F7LA 3MSSA 3LOKA 4LI5A 4R7HA 4XG2A 2VTMA 4FT9A 4DCEA 2OFVA 2YEXA 3FMMA 3F69A 5IUIA 2XIZA 3PY0A 4DAWA 2W99B 4PMTA 4MXXA 3WF6A 4FTOA 4FIHA 4CFUA 3LLAA 3KN5A 4OAVB 3UVQA 2WAJA 4G5JA 4G3EA 4RIWB 2V22A 3DXQA 5BVDA 4A4LA 3UE4A 5I9WA 3CQEA 4I1ZA 3T3UA 1BL6A 4N0SA 4OT5A 5CXHA 1XBBA 2JDTA 4FYOA 5DT0A 5M44A 1F0QA 4Z7HA 3QTZA 4Y5QA 4WRSA 2OZAB 3NLBA 2JKOA 4IB5A 3WZKA 1IA9A 2VAGA 1SYKA 2OU7A 4O7TA 4CGAA 3O2MA 3ZM9A 5F9EA 5CU3A 3BI6A 5BPYA 4BWKA 4BDAA 2R3GA 4KS7A 5D7AA 5TOZA 3ZBXA 4CTCA 2XNOA 3UZRA 3JXWA 3ROYA 5TO8A 3ZU7A 5HG5A 3A60A 2WTKB 4AP7A 3NYOA 3R8PA 4IE9A 1ND4A 1PMVA 3RM7A 3VUTA 4C34A 3W1FA 3DBDA 1F5QA 3FPQA 4PV0A 2PE0A 2PUPA 3Q2MA 2WEIA 1WCCA 3RINA 4E6CA 1FQ1B 3D5VA 4RSSA 1CTPE 3M42A 4PL4A 4WBBB 3LFSA 4XUFA 5CT7A 3MY0A 3RBWA 1MRVA 3FQHA 4J95A 3G6HA 2W05A 2FVDA 3R7YA 4RVKA 4BIEA 4UEUA 5EH0A 4CKIA 2UZVA 2YM5A 4Y73A 2IW9A 4XNEA 3FV8A 3COHA 4DH1A 3PXYA 4CFMA 2A27A 4RWKA 4OTWA 4YJSA 1KSWA 3SXRA 1M7QA 3F88A 3GU7A 2R3OA 3T9IA 1WZYA 4HZSA 3E5AA 2R3HA 5DEWA 4DGOA 5CU6A 3NZ0A 3DU8A 3HDMA 4AW1A 5JZJA 4RZWA 4E4NA 1LEWA 5E1EA 3IO7A 2YIXA 4IX4A 4HVDA 5IU2A 3QXOA 1YWNA 2PL0A 4FSRA 4YLKA 5CEOA 1KE8A 3ZM4A 4R3RA 3IGOA 4ERWA 4JJRA 2Z02A 4PMPA 3LFBA 3FC1X 3O96A 3HP5A 2FSTX 4X21A 4FTMA 4EYMA 4FEUA 2Z7LA 4IAAA 3R9DA 3C9WA 3QTIA 4OTQA 3G5DA 4PPCA 3IDCA 3E3PA 1WMKA 3RAWA 1H1SA 2F9GA 4LOOA 4C3FA 1H25A 3EZVA 3PXRA 5F1ZA 4EC8A 4D9TA 3LCDA 4LGHA 3C5UA 1ZZLA 3NNVA 3PJCA 4EOSA 5HU9A 2EB3A 4TTHB 4EJ7A 4AXAA 2XEYA 3R30A 3R9HA 4M97A 5IUGA 2OJ9A 3VJOA 3G33A 5K0KA 3JUHA 5C4KA 3ORKA 4DH5A 4O7NA 4DT9A 3IW8A 2BRGA 3Q32A 4YC8A 3UP7A 2QR7A 3VULA 3IPHA 4C2VA 3LQ8A 1PXIA 5DH3A 3L9MA 4AW2A 5BUJA 4X2NA 1QMZA 3PLSA 1LP4A 5IH6A 4UMUA 1WFCA 2XKDA 3PPKA 5E92A 3QZFA 2CHLA 3IS5A 1WVXA 4FKWA 3HGKA 3DTCA 5CTPA 1REKA 3MFSA 4G5PA 4HYUA 4EH2A 1J3HA 4HZRA 4KKEA 3UPXA 4W4VA 4ANLA 5FUTA 4FSYA 4M13A 3VS5A 4E6AA 3ATTA 5A4EA 2HK5A 3G51A 4HVHA 5AADA 5KMJA 5KBQA 4CG9A 4E3CA 3HNGA 3H3CA 4D4RA 1KOBA 4RC2A 4D4YA 2YWVA 3R9RA 3QQJA 3MVLA 4AN3A 4H36A 4L45A 3OVVA 4GW8A 3O71A 1AD5A 2Y4IC 3OD6X 5D1JA 4EK6A 4ENXA 5LJJA 3UQCA 4K0YA 5IA5A 3RWPA 5DE2A 5HCZA 3VRYA 3O8TA 2ZDTA 3MPMA 4WNPA 4MVFA 4V01A 5IA1A 5DVRA 4U9AA 4QMNA 1XBAA 2ZM4A 4O6EA 5BQ0A 5DI1A 3DQXA 5JFWA 2VTHA 4AACA 1NY3A 4NKAA 4FE2A 2VTTA 1M7NA 2W4OA 1DI9A 3PUPA 4MAOA 2R3QA 3N4TA 4FUXA 3GOKA 5KUPA 3R7GA 2OH4A 2ITWA 4L3LA 3HV3A 3R2YA 2PUNA 1BLXA 1OL2A 3N51A 3FJQE 2XCKA 2E2BA 2X6EA 3UNJA 4F9BA 3VVHA 3ZUTA 3II5A 3V5QA 3DLSA 4OTIA 4Y72A 3VHEA 5GIOE 5GJGA 1R1WA 4F9CA 5FXRA 3ZEPA 3R73A 3DDQA 5IMEA 4IWPA 5H8BA 3UP2A 4ENYA 3R71A 2WU7A 5BVWA 3AMAA 2GFCA 3CSVA 4IJPA 3BU3A 3CC6A 3L8SA 4WSYA 2CGWA 4RBLA 4I92A 4QMPA 4O1OA 4JAIA 4YJQA 4EOKA 2JBPA 3PJ1A 3LMGA 3BE2A 4W8DA 5T6KA 1R0PA 4CFFA 3U9NA 4Q9SA 5FBOA 1U59A 1GZ8A 4FZDB 4BDEA 5A6OA 4F6WA 3UIXA 4FKJA 3KMWA 4GT3A 3TM0A 5IQDA 2W4KA 3UO5A 5EYMA 4QMQA 4F7NA 5C27A 3D7TA 4KNBA 2WTWA 3SX9A 4EOIA 3DZQA 4KB8A 3Q4UA 4E8AA 1VYWA 5LWNA 4C3RA 3VN9A 1I09A 3BLQA 3QRUA 4JQ7A 3ZUVA 4DLJA 4D0XA 4O86A 2C1AA 5HLWA 3GC0A 4GIHA 5FM2A 4L01A 1DAYA 3KXGA 1EH4A 3ZRMA 2VTSA 3RAIA 3U4WA 4P4CA 4DEBA 4L67A 1FMKA 2X6DA 4DEHA 5AP5A 3ID6C 4X3FC 3LFCA 5L2TA 3DA6A 3PIYA 3EFKA 5EYCA 2GHMA 2CDZA 4QPMA 5BMMA 3RPRA 2ESMA 1F3MC 2XM8A 4IX6A 4O22A 4UMQA 2C5VA 3RPYA 3T9TA 4E1ZA 4J53A 3GT8A 4MXCA 3O23A 1H0WA 4RC3A 4DFXE 3HVCA 1BUHA 1ATPE 3DPKA 4IAIA 3ERKA 2YFXA 1ZOHA 5JFVA 2CLQA 2HY81 3PJ3A 3D83A 3QD0A 5CU2A 4ZSEA 3FMHA 3W2QA 3OBJA 3ODYX 4MH7A 4XG3A 2YAAA 4XOZA 5DR9A 5EM6A 4FOCA 1Q8ZA 4IM3A 5HVKA 4XBUA 4I20A 4BDGA 4U3ZA 4TWPA 3RP9A 3MWUA 1GOLA 4FV8A 5AV0A 4WSQA 3R8VA 4QMOA 3FL5A 5HU3A 4WIHA 4B99A 5JK3A 5DR6A 3HUBA 2WFYA 3TUDA 3PXZA 1Z9XA 1DS5A 5CVHA 4K33A 4AA4A 2PYWA 3BHVA 3OCSA 4L6QA 4PQNA 4DN5A 4FTJA 3UC4A 3FLNC 2X2KA 4I93A 4PMMA 5AX9A 3BU6A 4CTBA 3W8QA 2WMWA 3M11A 1ZYJA 5AV2A 3PTGA 4AQCA 5LARA 3A4OX 5CSVA 2I6LA 4B8LA 4DGGA 3DKOA 5D11A 4ZZOA 4UMPA 3NIEA 4RIOA 3V51A 5IA3A 5HIEA 1FOTA 3BKBA 3NDMA 3QCYA 4XOYA 5DRDA 3SW4A 2WMSA 4M66A 3NUPA 3V6RA 2R4BA 4IB1A 2WMAA 4J7BA 4JIAA 2P0CA 1XKKA 5HBHA 1YXXA 4G3DA 2DYLA 4OTRA 4IWQA 1MQ4A 1ZWSA 5AUYA 3E62A 4C4IA 4E6QA 4EK3A 5DHJA 4PDSA 3UQGA 3HDNA 2WU6A 3FZTA 5E90A 1UV5A 4ZSGA 3RKBA 3GCQA 5J79A 4FKIA 1MRYA 4S32A 3ZFMA 3IKAA 2ITZA 3CQUA 5AR8A 3OS3A 3PE1A 4IC8A 3HMPA 4UBAA 2IZTA 4XHKB 3RPVA 4XG9A 3L9PA 4YUQA 3WBLA 4BIDA 2BFXA 3GCSA 5L8KA 2OW3A 1ZYSA 5EM8A 4M14A 4PTEA 4BWPA 3QZHA 4FKRA 1CMKE 2B9IA 4C36A 5CSHA 3HV5A 4WNMA 3ORIA 2YERA 3RCJA 3ZUUA 3FKNA 5J87A 4UY9A 4Y46A 4EI4A 5EK7A 1JVPP 4AZFA 3SQQA 3LFDA 4N6YA 4ZTNA 5AP7A 4C0TA 4B4LA 3IDPA 1B6CB 3R28A 4E7WA 2BRNA 3HAVA 3AC1A 1H08A 2ITVA 4NWMA 4R3PA 2YIYA 4YZNA 3CTHA 4RQVA 3P5KA 3D5XA 3CIKA 3E93A 1FMOE 4L44A 2VWWA 4J71A 3QX4A 4QOXA 3QAME 4WA9A 3Q9XA 4CCUA 2OF4A 5JQ5A 4LM5A 5GJFA 3FUPA 1W8CA 2YAKA 4DH7A 4YZDA 3HZTA 1VEBA 3SOCA 2BROA 2O0UA 2Y4IB 2E9VA 4QD6A 4FC0A 4FIJA 4XV3A 4EOOA 4O7ZA 3GOPA 4GJ3A 3A7JA 3NR9A 3OXIA 5EOLA 1M2QA 2ITOA 4G2FA 4OW8A 2OJJA 2QOBA 4MK0A 4IM2A 4DITA 4EBWA 3BLRA 1J1CA 4AT5A 1YHWA 4HCVA 3D9VA 2HIWA 3BQCA 3R8LA 3U8WA 4QP8A 4BTMA 1YOMA 2ITUA 4C61A 4QP7A 1UU7A 4E73A 4G16A 1Q4LA 3V5LA 2B7AA 1E9HA 3D2IA 3E87A 3QKMA 2JGZA 3RTPA 3H4JA 3IDBA 2HXLA 3TV7A 5I0BA 3WARA 3F2RA 3KXHA 1GZNA 3MTLA 4F63A 4NK9A 3F61A 2R3LA 3R83A 4X6QC 2QLQA 3CR0A 1YHVA 3O7LB 4R7BA 3KCFA 2YZAA 4ZY4A 3LCTA 4FF8A 4JT3A 3AT3A 3WE4A 2DUVA 4BCFA 2RG5A 5J5SA 5IQIA 4NIFA 4EHGA 4QMWA 2HZIA 3MDYA 3RNIA 3KRLA 3DAKA 3SV0A 3TIYA 3SC1A 2Y4PA 3PY3A 1V1KA 1PXOA 2F57A 1Y6BA 1OL6A 3LJ0A 3MN3A 4BR3A 4NW5A 5KKRB 4U0IA 4QMVA 4FVRA 2UVXA 2ZM3A 3KXNA 3WIGA 4AX8A 2C3JA 5IDNA 5M08A 5DFPA 5DRBA 3IK3A 5GJDA 4BCGA 3TDVA 5CVGA 1XH5A 4BCMA 3GU6A 2XBAA 3I6UA 4U3YA 5HEZA 2O2UA 1ZYLA 4FL3A 5HBEA 4FTTA 4FUYA 2HZ4A 3OP5A 4IXPA 3QL8A 4DH3A 5I9YA 3UBDA 3ZO2A 2GNIA 3FI2A 2PE1A 5C1QB 2XRWA 2OH0E 4HGEA 3D7TB 3L8PA 4FVPA 2OICA 4PTCA 4WKQA 5FWKK 4Y85A 4ZAUA 4M15A 5KMKA 2WTJA 4AF3A 5EM5A 2R3KA 1UVRA 4HGSA 1NW1A 4I23A 3TIZA 2GPHA 1NXKA 2GS2A 3VS2A 3GGFA 4X2FA 4EH8A 4BB4A 4S33A 1G8SA 4X3FB 3DBCA 2BVAA 4HYHA 2UZLA 1SNUA 3QKLA 5HE2A 4IDTA 2VO0A 3CKXA 5CSXA 4NJ3A 4PUZA 3QCSA 1R39A 2G9XA 3U51A 3WIKA 4I3ZA 3FLQA 5B0XA 5J9ZA 4ZTMA 3IECA 3OEZA 4R77A 4R6VA 2F7ZE 3GVUA 3O8PA 3QBNA 1G3NA 3LAUA 3VUMA 5IMXA 3PPJA 1PXKA 1U5RA 4YJUA 3TUBA 4CSVA 3UYSA 5CNOA 3EQDA 3VS0A 3ZLSA 3KFAA 4APCA 1YI4A 3DOGA 3CPBA 5HNGA 3W8LA 2A1AB 2WO6A 3A7FA 3MH1A 3VBTA 3ZEWA 3L8XA 4FTKA 3R1YA 4FG9A 4KSQA 2BRHA 2FA2A 4IAZA 1TKIA 2R3FA 1W0XC 3S2PA 2ITPA 3SGCA 4JAJA 1Q8WA 3MA6A 1KV2A 4YJTA 3U6HA 3QXPA 3RM6A 4F9YA 1ZRZA 4G3CA 3A61A 3D7ZA 3HYHA 4GG5A 4BI0A 3ZZWA 4C2WA 4EJNA 2C68A 5EDQA 3OTUA 4BDJA 5JFSA 5HTIA 3C4XA 4LMNA 3A99A 4KS8A 1Y8GA 3BYVA 4FV3A 4ITIA 4M68A 5IEYA 2HXQA 4M67A 4XCUA 5AWMA 3LPBA 5I9XA 5BUEA 5C8NA 1YDTE 2C69A 1IG1A 2QU5A 2CJMA 4QPAA 3WI6A 1Q8TA 3NSZA 4BCKA 4FT0A 4DEGA 1XH9A 5DLSA 4RT7A 1H01A 2E9UA 4GIIA 4OTDA 2JDVA 2J51A 2YJSA 1KV1A 3FI4A 4W9WA 3KK9A 5HG7A 3RK7A 4AG8A 1TQMA 2VV9A 2OO8X 3QA8A 4KBAA 4BCJA 2P2IA 4CVAA 2I40A 2QO2A 1IAJA 2W1HA 4CXAA 4AA5A 4NW6A 1XWSA 3LW0A 3VBXA 2VRXA 2VNYA 5EYKA 1O6YA 3DLZA 3O17A 1FINA 4QYEA 4C4EA 2VX1A 3DK7A 5AIKA 3SG8A 3ZXTA 3TKIA 3NNXA 4DHFA 2QG5A 5E1SA 4I5HA 3NCZA 2JD5A 2IZSA 4FTNA 3WZUA 4U81A 4AW5A 5K4IA 3HV7A 3FZOA 5DN3A 1GIHA 5CAPA 3KKVA 3ZC6A 4ACCA 4G6LA 2UZTA 2BZKB 4G9RA 2XJ0A 2X4ZA 4AOIA 4I5PA 1G8AA 3D5WA 3RAKA 3COMA 3TV4A 5HE3A 4ZSLA 3CTJA 5I3OA 4F70A 2CKQA 3EFLA 4FIFA 1PJKA 4C4HA 3NUXA 2WOTA 4KIKB 2UZEA 3CBLA 1Y6AA 4ID7A 4O21A 5C9CA 3SRVA 4EOPA 5JGAA 5BYLA 4R7IA 4U8ZA 3C4WA 4ACMA 3GFWA 3P08A 1OZ1A 4OTFA 4O83A 2GCDA 5B2LA 2VN9A 5BMSA 4DT8A 3CPCA 3OZ6A 4K1BA 3UOHA 4I94A 2BHEA 2OK1A 3R21A 4PPAA 4O84A 3CXWA 4NFMA 2RFSA 2PHKA 2BZJA 4M7IA 4C35A 3IW6A 5K5XA 5ACBC 1S9JA 4F9WA 5KMLA 2JKQA 3FQEA 3I60A 2NRYA 3PVWA 2Q0NA 4G17A 4AGUA 3EJ1A 5C01A 2ITTA 5HIDA 2UZUE 2BZHB 4DTAA 3AOXA 4IC7A 5AA9A 5CAVA 4RWLA 5L2SA 5CZHA 4K2RA 2NRUA 4H05A 4C57A 2EXCX 3AC4A 5LMBA 3UOJA 2Z7RA 2NP8A 3CJFA 3AXWA 4JBOA 4RA4A 4IZ5A 5EKOA 5C8KA 4KRCA 5HD4A 3E7OA 1FVRA 3ETAA 4A07A 5I9ZA 3PVBA 5LMKA 4TT7A 3Q53A 4I0RA 4K77A 2HENA 4AOTA 4BKZA 1O6KA 1Q41A 3E92A 5HQ0A 4BHZA 5FG8A 3GU5A 4YZ9A 2B9FA 3QQLA 4JVGA 3UOKA 2QURA 3QD2B 5LMKC 1STCE 5FXSA 4AAAA 4MNFA 4TYHA 4KINA 5CLPA 4BKYA 3N4UA 2J9MA 3CD3A 5AUVA 4AS0A 4BICA 4M3QA 3FMJA 1Q61A 2BHHA 1VYZA 4IW0A 4FV2A 4R78A 4FGRA 2C0OA 2WZJA 3GCPA 4O38A 4DINA 1Q24A 3HRFA 1QPEA 3BBWA 1OB3A 4EOMA 5I3RA 2GS7A 3LJ2A 4AZWA 4FEWA 3EOCA 3MTFA 2YM6A 3C0HA 4XMOA 3TZ8A 4BRXA 3QTXA 2C6DA 4F1TA 4YO4A 3GQIA 4M0ZA 2ETMA 4PNIA 3TZ9A 4ZLZA 4YTFA 3BWJA 3ACKA 5T68A 2ZOQA 2PULA 4PL3A 1IASA 4TN6A 3R1SA 4YZBA 3LFQA 3EN9A 5DWRA 3ZOSA 2XK9A 1URWA 2W5HA 4IVCA 3VBQA 3DBFA 3VS3A 4UX9A 1OITA 1PHKA 2PVNA 3Q52A 4EOJA 5EDRA 2GDOA 4QPSA 3DY7A 3D4QA 5A54A 5A4QA 3PRFA 5L6PA 3C50A 3DZOA 3ATSA 5GZ9A 3SAYA 5E8YA 3QRKA 4WO5A 3VC4A 5FRIA 4FNZA 4Y95A 4A9SA 2OWBA 3R1NA 3R8UA 4EBVA 4IWDA 2RKUA 3DFAA 3G9NA 3KMMA 4G3GA 4BZOA 3F2AA 4RJ8A 3UYTA 4BVUA 4S34A 3RWQA 3TKUA 4IB3A 2C6IA 4G9CA 4EHVA 5H2UA 4LQMA 3BRBA 4ZS4A 3DQWA 2YA9A 4AFEA 2CNQA 1YI3A 1UKIA 1YDRE 3MYGA 4IAYA 4FKSA 2OKRA 5D10A 4U6RA 1UU9A 2J2IB 2B55A 3F7WA 3UZTA 3L1SA 4LV8A 2XNNA 4ITJA 2B9HA 5AAGA 4IMYA 2H8HA 4O2PA 4MF0A 3NWWA 4P5ZA 4YJNA 3FBVA 5DOSA 3C51A 3RMFA 4X3JA 2Q0BA 3HA8A 3SOAA 4BDIA 4E5AX 5AUUA 5KBRA 2GQRA 4EQUA 4TL0A 5JRQA 2CGUA 3PXFA 3CTQA 2XKEA 5I9UA 3P7AA 4ZY5A 3LE6A 1T46A 2QKWB 3O50A 4FTQA 4YTHA 4IB0A 4AGCA 4PL5A 4USEA 3NYXA 4EHZA 4MNEB 3BELA 5L8JA 4AN9A 3NUAA 2C30A 4IM0A 5JRSA 3IONA 5CEPA 2GFSA 5HO8A 5E8ZA 1KE9A 2YIWA 5I5ZA 4XLVA 3KK8A 4O7WA 4WG4A 5ETIA 1ZYDA 1Y8YA 2X2MA 3ZDIA 2BDFA 3HAMA 4TYJA 5I4NA 3PZHA 1KWPA 3W2SA 2AC5A 3HP2A 4ANNA 2UZBA 2JLDA 2X8EA 5TT7A 3UG2A 1UWHA 1H24A 3GU8A 4OT6A 2P2HA 1NVQA 3SHEA 3R0TA 4B9DA 5L2WA 2JDRA 1UKHA 4ASDA 3QFVA 3QQFA 4LRMA 5L2IA 2H34A 3FSFA 4BCHA 3LZBA 4DYMA 3FI8A 2CKOA 3RPSA 2QU6A 3QTUA 4AT3A 4YZCA 4QP9A 4CV8A 5EOBA 4GVAA 1HCLA 3V6SA 2QOIA 4H39A 3F82A 3HV6A 2XS0A 3PY1A 4DFUA 4RJ5A 3F7ZA 1ZARA 2C0TA 4AOJA 5EFQA 4E6DA 5L4QA 3TL8A 3REPA 4DCAA 5B2MA 3G15A 5IDPA 5LOHA 2O3PA 1W7HA 2RSVA 3EQCA 2ZB1A 1L8TA 3B2WA 2IW8A 5C03A 5LWMA 2VTNA 4M84A 3KA0A 4O7LA 3ALOA 2QODA 4D9UA 4WG3A 3CGOA 2CPKE 4K8AA 5D9HA 3U87A 3DK6A 2B53A 4FV1A 4BCPA 2XH5A 4IAFA 3VQUA 3TDWA 1DAWA 4C4JA 4BBEA 2H9VA 3OHTA 4FOBA 5CYIA 5M57A 4ZJJA 4R3CA 4RVLA 4O96A 3QCXA 4I0TA 4HVIA 2O63A 3IG7A 3FSKA 5AP3A 2LAVA 3QLFA 4RLLA 3PG1A 4YHFA 4MQ2A 2F7EE 3HMOA 1JKTA 2J5EA 3Q3BA 3WF7A 3AD6A 4O0WA 3EL7A 1CSNA 2WMXA 4R5SA 4ACGA 4CT2A 4D5KA 3OT3A 5AA8A 2GMXA 2YJRA 4EYJA 4QTBA 1PXJA 1GNGA 2XYNA 4YSMA 5IQAA 1JKLA 1JSVA 3FWQA 4XV2A 3LXLA 3QA0A 3ZRLA 4QO9A 2CNUA 3I0QA 2OG8A 2JFLA 1A48A 4N4SA 3FXWA 3BYUA 4BI2A 4FSMA 4H3BA 3PXKA 2B0QA 1M14A 2V55A 3ZFYA 2C3LA 3QTQA 3MIYA 2BILB 2C5XA 3BLHA 4FI1A 4NKSA 4XP3A 2BIKB 3HLLA 3WF8A 4RIXB 4KIQA 4V0GB 2Y9QA 1IEPA 4YGAA 4MBIA 4HGLA 3SDJA 2ETRA 2WQNA 1YXVA 4IJ9A 5EHOA 3KMUA 3QHWA 4O0UA 4YURA 3S00A 5CASA 3AD4A 5CU0A 4QYYA 4ZP5A 2Z8CA 4I6HA 4Y8DA 2VO3A 3POOA 4BWXA 3K5UA 1PMEA 4FNWA 3DB8A 1JSTA 2RG6A 3VWAA 5A46A 4FSTA 5JEBA 4GT4A 5HX6A 2H96A 2KULA 3KQ7A 4P90A 5AAFA 2RIOA 4E20A 2BUJA 3TG1A 4HGTA 3NUUA 4M69A 5E8UA 3SVVA 2GHGA 4IZYA 1ZMUA 2IN6A 4RMZA 2AUHA 2QOLA 4D2RA 5EHLA 2YLEA 1W98A 5I9VA 3ORTA 3S0OA 1ZMWA 3VS4A 5ETAA 1RW8A 1XH7A 2EU9A 3CGFA 5FD2A 3RJCA 4RZVA 4M0YA 3V5JA 2R3IA 1UA2A 5AR7A 3KULA 4L43A 1LEZA 4V04A 4PF4A 5FTQA 4QQ5A 5AFVA 1H1QA 3H9OA 3KRJA 2C6LA 4KSPA 4QTDA 4RIYA 3GC8A 4H58A 1AQ1A 4UWCA 2WQMA 3P4KA 1KE6A 5JQ8A 3LQ3A 3B8RA 1YKRA 4EKKA 3M1SA 3C1XA 3OCBA 3AC5A 3ZMMA 4FT7A 2QOOA 4NUSA 2PZPA 1FPUA 5CVFA 2VWUA 1MP8A 4P5QA 1WBVA 1JAMA 3V5TA 5BUIA 2HZ0A 2X8IA 5ANIA 1IR3A 4AGDA 4ALVA 3FPMA 5F20A 4NM5A 4QTEA 5IA0A 4WUNA 3GQLA 1TVOA 3ENHA 4QMUA 3ZO1A 4ALUA 4CT1A 4CMOA 5JGBA 5M4FA 4ACDA 1OECA 1RQQA 5HORA 1WBWA 4PDYA 4USFA 5D12A 3Q5ZA 3E88A 4EC9A 5IG1A 3TJDA 4MXOA 3PG3A 2PZYA 3MVJA 2V0DA 3OTVA 3BEAA 5ITAA 3NW7A 2W96B 3WZJA 4EH5A 2PWLA 4KRDA 2ZMCA 1UNLA 3BV3A 3OCGA 5KZIA 3SKCA 2UW3A 3LXPA 3ULIA 3GBZA 2C5NA 2W1CA 1BMKA 3QKKA 4FZFB 4U5JA 5AM6A 5DNRA 3BYMA 3LVPA 4FIGA 4JDKA 5D7VA 4A9TA 1H27A 5LXMA 3QYWA 3BHYA 1FVTA 4I22A 3L9LA 3UOLA 3SXSA 3MFRA 1OUYA 5HZNA 4FV5A 4E4XA 2OGVA 4QNYA 1YVJA 1IAHA 3UMXA 3QZIA 2QO9A 2R3RA 3I81A 4FEQA 2PVHA 4A9UA 3DB6A 2WQBA 4LRKA 2BMCA 1CKIA 3KB7A 2I1MA 2NO3A 4YMJA 2X39A 5GHVA 4LMUA 4CFWA 4FSZA 1OPLA 3F5PA 4JG8A 5IQEA 2DS1A 2QNJA 2UW0A 1DI8A 3MV5A 1P4OA 4JQ8A 4JQEA 3ZZEA 2QOHA 4YBKA 5H3QA 3GCUA 2R7BA 4BGHA 3W10A 5B2KA 1PXPA 1YXTA 2CMWA 1GAGA 2XIYA 2R7IA 3NUNA 5LVNA 4FKOA 5CU4A 5A4LA 4FYNA 2JDSA 4L8MA 4EH7A 4UWYA 3EQRA 4U7ZA 4OBPA 3LFNA 4IFCA 5CSPA 2JIUA 1U46A 5JN2A 5FQDC 3LXKA 4QMYA 4G34A 2YZLA 5IZFA 2JITA 5LVLA 4AWIA 4RC4A 4D5HA 3TV6A 4XLIA 3HA6A 3SLSA 5HNIX 3NCGA 4BY9E 1MQBA 2WXVA 2Y6OA 3PVGA 3MI9A 3O0GA 4GL9A 4EONA 3S4QA 1YQJA 2NPQA 4M12A 5AUZA 2F7XE 4NT4A 5GIPE 3E63A 3BV2A 4DBXA 1XHAA 3R01A 5IEVA 2DQ7X 5HE1A 5DR2A 2YWPA 3QALE 4PY1A 3HMIA 3NX8A 4RFMA 2PVMA 4ANBA 2YM3A 4RX5A 3NGAA 3QLGA 2Z60A 5K3YA 5CT0A 3ZHPC 2XNGA 1O9UA 4CFVA 5HX8A 2QG7A 4ANSA 3C5IA 3PDTA 3ZXZA 1XH4A 2C0IA 3A2CA 3FMEA 5BVKA 2X1NA 3MIAA 4NM3A 2BDJA 3VS6A 3ET7A 4R8QA 1LPUA 4IQ6A 3KC3A 4A9YA 1H28A 4EKLA 3BBTB 5EM7A 3JPVA 4KIOA 4CKJA 4DFZE 3NYVA 2VTQA 4UB7A 4UALA 4NFNA 3F3UA 3NUSA 2HZNA 4QTAA 4O0YA 3DAEA 4ZTLA 3OUNB 3NW6A 3EFWA 3V04A 1JSUA 2HW6A 5E7RA 4QTCA 4RLKA 2PMIA 4EOLA 4EH4A 3OC1A 3ZFXA 5C4LA 4EH9A 4JOAA 4JX7A 3BE9A 4TPTA 4U79A 3VQHA 4TYIA 3VAPA 1OMWA 4M8TA 2VTJA 3SW7A 1BL7A 1PMUA 2ITNA 3AGMA 4YC6A 4BTKA 5K4JA 1QL6A 3ZBFA 5F95A 1APME 4L42A 4YP8A 4A4XA 5KMIA 2BFYA 2A19B 3FZSA 4GG7A 3WZDA 3VUDA 2XJ2A 1OBDA 3BEGA 5AV4A 1UU8A 1H1PA 4ZTRA 4LOQA 1GZOA 1REJA 4J52A 3BYOA 2GNJA 1TQPA 4R1VA 3W2CA 3DKCA 5CF5A 3R00A 4GU6A 3DGKA 4DEEA 1Q97A 5E8VA 3LCOA 4HPTE 2ZAZA 2HELA 5M06A 1BKXA 1XH6A 2OXDA 3CP9A 1XJDA 4TNBA 2QHNA 5HO6A 5JZNA 2GS6A 3OBGA 4ZLOA 3C4CA 2PVYA 4GUBA 4GT5A 4K6ZA 5D41A 4ZTSA 2OJGA 4D2PA 5GINE 5CEIA 3LJ1A 4UMRA 4F0IA 2XUUA 4GK2A 4JBPA 1OIRA 3TNQB 2IO6A 5M56A 5DBXA 3QC9A 4NM7A 3DBEA 1SZMA 4KA3A 4DFNA 5FGKA 3DJ7A 4FG7A 3HECA 4A9RA 3EFJA 3P7BA 1J7UA 1P2AA 4AA0A 3E8NA 3Q96A 2W17A 2X7FA 1SM2A 3R7OA 3TNHA 2OZOA 2UW5A 3OXZA 4WNKA 1Q5KA 3QUPA 4IVAA 5EHYA 5HCXA 4PMSA 2WQOA 3OF0A 3CY2A 3PA3A 3R7UA 2X2LA 3PSBA 3TI1A 4FT5A 5IUHA 3FLWA 4DLIA 2GTNA 3RVGA 4Z16A 5IISA 3OOMA 5C26A 4PDPA 3R7EA 4G6OA 5J8IA 2QOKA 2J0KA 3R7VA 2Y7JA 5BX0A 4FSWA 3LFFA 2P3GX 3UPZA 3FYJX 3KXZA 3UGCA 2BAQA 4FTIA 5HLNA 3WYXA 4E4LA 3EWHA 5CAQA 4C7TA 1LUFA 3UG1A 2UW7A 2J0LA 5EW3A 3CQWA 1OKYA 2QO7A 4FV9A 5IQHA 5M4CA 1GIIA 3MH3A 3MPAA 4BBMA 2GQSA 4OBOA 3D5UA 1WBSA 4GYGA 3LFEA 2XZSA 4E93A 2JIIA 4F6SA 2VTPA 2CN5A 4W4WA 2BRBA 3F5GA 5IA2A 4C8BA 4QQTA 2WGJA 3TWJA 4LL5A 3QCQA 3LCSA 2PZRA 2QLUA 3FMDA 4KBCA 4QMXA 4EQCA 4QT1A 4BC6A 5FEEA 3NAYA 5DIAA 4F65A 2Y8OA 1U5QA 4RIWA 4BZDA 4BDBA 3DK3A 1WVWA 3W18A 3RHKA 4JG6A 4Q5HA 4BGGA 1UU3A 3ZCLA 1QPDA 2RGPA 2OZAA 4F1MA 1FGKA 2OJFE 2E9OA 2W9ZB 3NAXA 4YLJA 1NA7A 4YHJA 1K2PA 1SNXA 2VX3A 3GFEA 4IIRA 1OPKA 2G2HA 1PRYA 4WUAA 1Q62A 1JKSA 2HAKA 2BTSA 3C0IA 3UIBA 1WBOA 4I5MA 1V0OA 1KUTA 3Q9ZA 3EQIA 3AMBA 3OXTA 3DKGA 3LLTA 2YDIA 3QQHA 4ZEGA 4UN0C 4X6RA 4FK6A 1SVHA 4B0GA 3LCKA 2W4JA 5AV3A 5EKNA 3MY1A 5HIBA 1ZLTA 4KKHA 4LG4A 3BYSA 5ANKA 2WIHA 2IZUA 4II5A 3ODZX 3NIZA 4BF2A 4D4SA 4OLIA 3NPCA 2PVRA 3F66A 3K2LA 2FYSA 3ITZA 2XVDA 4GJ2A 4BDFA 4N57A 4O27B 2VTIA 3KXMA 4X2KA 4ALWA 4FG8A 4HCUA 4U41A 3WF5A 3VW6A 1SVGA 3IGGA 3R1QA 1V0PA 2PMNX 2WMRA 1J91A 3GNIB 5DA3A 4F08A 4ZTHA 4F99A 5FXQA 3GC7A 3QTWA 4QQCA 3HMNA 2O8YA 1I44A 2J7TA 1XH8A 4XH6A 5DEYA 2XK3A 2IVUA 4TNDA 5A14A 4EEVA 4LUEA 4H1MA 3VBWA 5IQGA 2DWBA 4AGWA 4FNXA 2PTKA 2QC6A 2ZV9A 1M17A 4U40A 4ZMEA 4MQ1A 2UUEA 4CV9A 5IPJA 2XEZA 2X7GA 3HUCA 3MJ2A 3DV3A 4H3PA 4RQKA 3ORZA 5ANDA 1H07A 3FLZA 3TZMA 2J0MB 4ZZNA 3B2TA 2GU8A 4FX3A 3ROCA 3PP1A 5EQPA 2C3IB 2ZJWA 3A7GA 4C37A 5CWZA 1JBPE 5DPVA 5CQWA 4DG2E 4PTGA 2YITA 4DGMA 3LMIA 2UW4A 2XIKA 5LVOA 1R3CA 4ANQA 3DJ6A 3WF9A 3MFTA 4BYIA 1P4FA 4EH3A 3TKHA 1ZY5A 2B4SB 2CKEA 1B38A 5E8TA 3FL4A 2SRCA 1ZMVA 3CY3A 3EH9A 4DEAA 2ZMDA 4TXCA 3DKFA 3MA3A 3BGZA 3G9LX 1H4LA 2VNWA 4Q5EA 5HTBA 3I1AA 5CS6A 2P55A 1YI6A 2PZ5A 2C47A 3ZONA 3ZTXA 4EHEA 5AIRA 3NW5A 2BRMA 4AZTA 3C13A 2PUUA 5FTGA 3PYYA 2B9JA 4UZHA 4D1XA 3G6GA 4MTAA 4X7QA 4IZAA 4EUUA 2FO0A 4F4PA 5KX8A 3WE8A 3V01A 3KEXA 2CGVA 4XV1A 3UIUA 3A7HA 1V0BA 5ACKA 3BHUA 3H10A 3ZLYA 2WTDA 5TKDA 2YCRA 3FMKA 4BDDA 2Z7SA 2FUMA 2PE2A 4KABA 3FLSA 3T3VA 2PVLA 3RHXA 3CE3A 1BI7A 4F09A 4RPVA 4OTPA 4XG6A 2WHBA 2EB2A 3VRZA 2UV2A 3MB6A 1B39A 4AU8A 3IW5A 3HRBA 3P78A 3PVUA 2BKKA 2QHMA 5BYYA 5JFXA 2R3JA 2WQEA 4FICA 3UMWA 1PXMA 3EHAA 4DC2A 5HG9A 1K9AA 2CLXA 3BGPA 4O0TA 4C62A 1E1XA 3ACJA 4F0FA 4JBVA 2YDJA 4HVGA 4APPA 3UVRA 5BVEA 2WMQA 2WTVA 2EXMA 5CAOA 4QP4A 4YPSA 4DGNA 3AMYA 3QX2A 2XJ1A 3FAAA 3MGYA 3OT8A 4J96A 3VNTA 4D1SA 4NYEA 4E4MA 3PP0A 1L3RE 2HW7A 5HVJA 3FZRA 3FZ1A 4LGDA 4QRCA 4K9YA 5AAEA 5AX3A 3OWKA 4IX5A 4NM0A 4PP9A 5BNJA 5LVMA 4MWIA 1R78A 4YLLA 3U6IA 1PW2A 3W33A 1OUKA 2F2CB 3PE2A 4JBQA 3UZPA 2OFUA 4FZ7A 2B52A 3DBQA 5KMMA 3GENA 1OIUA 2ITYA 3ZO4A 4E26A 3QU0A 2QKRA 4GFGA 4I6FA 2CN8A 3BHHA 4I21A 5B7VA 1LR4A 2ZV8A 4MD8E 1YOLA 2XNBA 4XG8A 4IEBA 4YHTA 2ZM1A 4YJPA 5ANJA 5EW9A 4NIFB 4EH6A 5IQBA 1GY3A 1WAKA 3D0EA 3OY3A 5C8MA 3TNWA 4QYFA 3CCNA 4O91A 3BPRA 4PX6A 4AW0A 1K3AA 3IW4A 3I6WA 2JKKA 5AR3A 1YOJA 2R0IA 4JR3A 5A3XA 3WOWA 3MJ1A 4Z9LA 3FMLA 1YDSE 4K11A 1PYEA 4HOKA 3VBVA 2H6DA 4GKIA 4BGQA 4NH1A 2X4FA 3KL8A 4FMQA 3C7QA 4FK3A 4YZMA 2YIQA 4O0SA 3D94A 4XX9A 5CI7A 2JDOA 3H9RA 3MH2A 2CKPA 1OKWA 4CEGA 3GUBA 2XK8A 4FL2A 4ARKA 4OR5A 5A4TA 4L7SA 2XYUA 4NTSA 4C59A 3E3BX 4DEDA 5LVPA 3P9JA 1CDKA 4AZEA 2XKCA 4ASZA 1PYXA 3AC3A 2FSMX 4EK4A 4Z3VA 2R64A 4HW7A 2YHVA 4J99A 2YLFA 3QZGA 4AN2A 3EZRA 3QUDA 4AZVA 3VHKA 4NJDA 3RI1A 3NVKI 4HPUE 2RFDA 2OXXA 2ZV2A 5CF6A 4GEOA 3Q6UA 3RCDA 5J9LA 3I7CA 5AP1A 2YISA 4YTIA 3WYYA 3HKOA 2W1IA 3I5NA 2WEVA 3ORNA 3VUGA 3KREA 2R3PA 4XP0A 4ZIMA 4C4FA 2PPQA 2WMTA 3FKOA 4NU1A 2EVAA 2VWBA 4I6QA 2XBJA 3NVMB 1Y57A 4IAKA 5TR6A 4D0WA 4IVDA 4RVTA 3RK5A 1H0VA 3BIZA 4MHAA 4ANMA 1R0EA 2GNFA 3H9FA 4BIBA 4C33A 2G2FA 4F64A 5CEMA 4FKPA 4TWNA 2IG7A 4O82A 2HCKA 5E8SA 3PXQA 5H8GA 4GYIA 3VF9A 2VGPA 2Q83A 4ZY6A 2G1TA 2C6EA 4XV9A 1BI8A 1UNGA 3EQGA 4IACA 1J7IA 2G15A 2W1FA 2YIRA 3PWDA 4IZ7A 3VUHA 5EDPA 5L6WL 2V7AA 2R3MA 1Q3DA 3THBA 5E91A 2R0UA 3TN8A 3UC3A 4O7YA 4TZRA 4JNWA 3EN4A 2GNGA 3F3TA 4RX7A 4DG0E 4AE6A 4HNFA 1OPJA 4GU9A 1OI9A 2ZYBA 1GZKA 2X9EA 4BHNA 1Q3WA 2WTIA 2J50A 3UNZA 4UV0A 4NEUA 1QPJA 4WOVA 2XMYA 4U80A 4CFXA 3FXZA 3AT4A 3A62A 4LV5A 5HOAA 3KF7A 2JIVA 2X7OA 4J8MA 3IOKA 4PWNA 1BYGA 2V62A 3I79A 2OXYA 2LGCA 3JY0A 2ZVAA 2F2UA 4Z55A 3GXLA 1P14A 3DNDA 4MD9E 5AR2A 4CG8A 2OBJA 3S1HA 4TWCA 4ZXTA 3CS9A 3EN6A 4C02A 1TQIA 1PY5A 4UXQA 3MS9A 2KTYA 2VWIA 4WD5A 3QYZA 5FEQA 5CF4A 4CZTA 2XNMA 4RX8A 5EQYA 3BX5A 3WILA 4G6NA 3TNIA 3T8OA 4FIEA 3QGYA 5E8WA 3RK9A 3K5VA 4JS8A 1WVYA 5BVNA 1U54A 4DTBA 3ZH8A 4IFGA 4Q9ZA 2YCQA 4LYNA 4EWQA 2VTAA 3JYAA 3GU4A 4TW9A 2E9NA 4BCIA 4ONAA 3AT2A 1UNHA 2XIRA 2BTRA 1SVEA 4IX3A 5DT3A 3ZS5A 5G6VA 4YO6A 4CYIA 2ITQA 2IVVA 4U44A 1ZYCA 2PMLX 4L3JA 2I0HA 4K18A 1P5EA 2PUIA 2G2IA 4GRBA 1HOWA 2QR8A 3FQSA 4EK5A 2IJMA 2P33A 4JI9A 2PK9A 2UW9A 3CKWA 3U55A 1ZAOA 3A8XA 4X0MA 2VTRA 5EQEA 2G01A 2JC6A 2OIDA 4XG4A 3SRVB 3ZLXA 3OEFX 2REIA 3QD3A 4D2SA 2JAVA 4X2GA 3R8ZA 3MVMA 4Y83A 4JXFA 3DT1A 4CQGA 2GHLA 3PLAE 4ITHA 2PMOX 4OTGA 2I0VA 3D14A 4LUDA 1OL7A 2W06A 4FV6A 4XYFA 3OG7A 5KE0A 5HICA 2BAJA 4CRSA 2W1DA 4FKTA 4FZAB 2VGOA 3FMNA 2XCHA 3A8WA 4BN1A 3ORMA 4R5YA 5LQFA 3KRWA 4KUJA 3EYHA 4DGLC 1JNKA 5M53A 4BBFA 5DGZA 5E4HA 4ZJVA 4D2VA 4MKCA 4FKVA 3LQ5A 3VJNA 3C0GA 5JT2A 1JWHA 5AP2A 5IKWA 1E1VA 3DCVA 2BDWA 3TTIA 3F2NA 3EYGA 3Q4TA 2IW6A 1IRKA 1M52A 2VTOA 3RNYA 3KGAA 3BGQA 3FZPA 3KVWA 3Q4CA 3OFMA 4BFMA 4EZ5A 3UDBA 4CFNA 4YBJA 3DFCB 2IVSA 3OOGA 4FKQA 5FEDA 4YU2A 4TYHB 4GS6A 4USDA 2XK7A 1ZOGA 4D58A 4KAOA 3ZYAA 4LOPA 4MXZA 4FA2A 4YR8A 3Q2JA 4FVQA 3ZLWA 4CCBA 4O2ZA 4D2TA 3R63A 5L2QA 3H0ZA 2O5KA 4I5CA 1XO2B 1J1BA 4LL0A 4MWHA 4QNAA 4BDCA 4DFLA 4JRVA 3RPOA 4CRLA 4HJOA 5K9IA 1URCA 1A9UA 4ZZMA 3TEIA 5E9EA 2FSLX 2CSNA 3ANQA 3LIJA 3QTSA 2HYYA 2IZRA 3AC8A 5HKMA 4DTKA 5CF8A 2RL5A 1PMNA 4EL9A 3QGWA 4UYAA 5IH5A 4GCJA 5EI6A 3O51A 4GVJA 5KKRC 4D28A 4JR7A 4O0XA 2GNLA 4OAUC 1RJBA 4ZSAA 2XNPA 3V8TA 4HVSA 1JKKA 3PWYA 5TF9A 3G90X 5EI8A 1FVVA 4NL0A 4DG3E 1CKPA 5DT4A 5E8XA 4JDHA 3ORPA 5EW8A 2C5YA 1OL5A 3C4EA 3NEWA 1H00A 5AV1A 4RG0A 2QVSE 5KMOA 5M4UA 5A6NA 3ORLA 2J0JA 3BHTA 3P23A 3Q9YA 4MF1A 5HVYA 3BWFA 3R2BA 4QP2A 4E5WA 2HY0A 2EWAA 3FXXA 3R9OA 4JL9A 2W5AA 3BCEA 4FZ6A 3RZBA 2Z7QA 3FC2A 4WT6A 4CMUA 1J7LA 3FE3A 3AQVA 5AP0A 3TACA 2QCSA 4X3FA 3EKNA 4QP6A 4GUEA 2P4IA 5CXZA 4FIIA 4BCOA 4P7EA 4UMTA 5HG8A 1NT2A 3D15A 1JLUE 2VWXA 3MY5A 3DXNA 4FV0A 2F49A 2PVKA 4BYJA 2WPAA 4IHPA 4IDVA 2BAKA 3ZSHA 4CLJA 3EMGA 2VD5A 5HHWA 1KE7A 4WBOA 3MW1A 3PSCA 3UO6A 4BDHA 4L53A 3COKA 4CNHA 3DDPA 4J8NA 3G0FA 4DFYA 4L00A 4O0VA 4PP7A 3ELJA 4MD7E 2YABA 4Z7GA 2Y0AA 3MESA 1W82A 3QD4A 4L7FA 3OW3A 4DA5A 2Z2WA 1Z57A 4HCTA 4YTCA 3SG9A 3FI3A 3KY2A 4S31A 4MEDA 3TTJA 4LFIA 4ERKA 4O7SA 4LGGA 4I4FA 4C4GA 4MCVA 4XEYA 1W84A 3QQKA
chains in the Genus database with same CATH superfamily
4CLIA 4IWOA 4WG5A 4FKGA 3VS7A 4FT3A 4RRVA 2ZV7A 4GH2A 3AC2A 4FTRA 3AKKA 1YWRA 3PA4A 3UJGA 3ANRA 3C4FA 4ZLYA 1OVEA 4S30A 4CYJA 3V5WA 4D55A 1ZY4A 3W16A 3F3VA 5AUTA 5DMZA 1WBNA 1NVSA 2ETKA 4YJRA 5M4IA 2W1GA 1H8FA 3POZA 4RJ7A 4U42A 3U54A 3EQFA 3NYNA 3NRMA 2VZ6A 3GCVA 3H30A 1Q8UA 4ZTQA 2CCHA 4UWBA 5GZAA 2JFMA 4JIKA 4GKHA 4O7RA 3F3ZA 4HNIA 4I24A 3MFUA 3BL9A 2J4ZA 2UZNA 3HEGA 2ERZE 2F4JA 3FY0A 3PA5A 5F4NA 2XRUA 4GFOA 5FLFA 5L3AA 1U4DA 5HBJA 1JOWB 2VX0A 1OL1A 3VO3A 1KE5A 3UTOA 3SD0A 1A06A 4RJ3A 3EL8A 3JS2A 3QF9A 3PRIA 3FHIA 2W7XA 3HL7A 5A9UA 4RFZA 2RFEA 5J7HA 1ERKA 1IA8A 5EYDA 3U6JA 2XA4A 3DS6A 4FKLA 2RF9A 3BQRA 5BVOA 1U54B 2VWYA 2X0GA 1ZXEA 3P79A 3QRIA 4N6ZA 1VLRA 3D2KA 3OCTA 4JRNA 1QPCA 3GC9A 4FNYA 3V3VA 5BVFA 3OUKA 3AKLA 2X81A 4MXYA 4ASEA 4KD1A 5L8LA 1ST4A 3UQFA 2VO6A 5H8EA 4EK8A 4O1PA 1QCFA 2V5QA 3R9NA 3FEGA 3JVRA 3R6XA 3Q60A 1AGWA 3HX4A 4OTHA 2IWIA 4RWIA 4BTFA 4TKSA 5HO7A 5IA4A 4I0SA 1YWVA 1Z5MA 3OY1A 4O4FA 3W2RA 3I0OA 5KMNA 2BALA 1VZOA 2OF2A 3TUCA 4ZMFA 3R22A 4B6LA 4YJVA 4KIKA 3F3WA 4TWOA 4DDIA 4O4DA 4PNKA 4A7CA 3KXXA 3M2WA 3W55A 5FDPA 4FR4A 4ZK5A 5M51A 3DXPA 5CANA 2XK4A 3E8DA 3V5PA 4AFJA 4C58A 3L8VA 4H1JA 3IOPA 5CAUA 3FLYA 2C4GA 4YNEA 2A0CX 2E9PA 1PKGA 3MPTA 2GQGA 2J0IA 5AR4A 2HWOA 4EORA 3DAJA 3RZFA 3KVXA 1HCKA 2QOCA 1OKZA 3K3JA 4OUCA 3JVSA 4BI1A 5BYZA 4GV1A 4P2KA 2PVFA 4IH8A 4RVMA 4L68A 2YCSA 4OGRA 4RWJA 3V8SA 3W0QA 3AG9A 1PXLA 5AEPA 5FTOA 2B1PA 3U4UA 5M07A 4QMMA 4GK4A 4IANA 4YPDA 1OIYA 5ETCA 3KRXA 4F7SA 5FM3A 3QQUA 4DE4A 2VO7A 3VF8A 3TT0A 2GNHA 2UZWE 4FTCA 3LM0A 1ST0A 4BTJA 2YACA 4FV7A 1Q99A 5H9BA 2PY3A 3FY2A 4TY1A 2CCIA 4AZSA 3E64A 5CSWA 4IADA 5FP5A 5KHXA 1JQHA 2O65A 1YXSA 1WBTA 4M69B 2BKZA 2WB8A 3OWJA 5J1VA 1JPAA 4W4XA 3CEKA 2BPMA 4XRLA 3EB0A 3VUKA 3ZSGA 2UZDA 2OLCA 3TNPC 2QQ7A 4QMTA 3W32A 2WTCA 3JR1A 2WELA 4BDKA 2JEDA 2XNEA 3EN7A 1OM1A 3CLYA 1GJOA 4J98A 4N70A 2BR1A 2WIPA 4UZDA 4GMYA 3KULB 5AR5A 3BZ3A 4H3QA 4TYEA 4RIYB 4ZS0A 3UODA 2OIQA 2FSOX 4CMTA 3COIA 4CQEA 1CM8A 5J7BA 2CNVA 3Q5IA 1T45A 1ZZ2A 2BZIB 2R2PA 3NNUA 4XS2A 3AGLA 3KN6A 2B54A 2VUWA 3HMMA 3P7CA 4FSUA 1MRUA 3VIDA 4BJJA 4GK3A 2Y6MA 1H26A 3MVHA 3GEQA 5J5TA 2GSFA 5CEQA 1UWJA 3PJ8A 4B8MA 4L46A 3OWPA 4G1WA 4X2JA 4G31A 4ORKA 1FGIA 3R04A 5DYJA 3RALA 2X9FA 4TYGA 4DBNA 2R5TA 3HRCA 1RE8A 2UZOA 2I0YA 5HI2A 5LCJA 3RAHA 3QHRA 2C6OA 3FKLA 3JY9A 1XBCA 4YNOA 5G1XA 4ZJIA 1OBGA 3I5ZA 3Q4ZA 2WNTA 4GSBA 4XJ0A 4F6UA 4UYNA 2C1BA 5ANOA 5AP6A 2I7QA 4J97A 4FEXA 2VWZA 3FDNA 4RFYA 4HYIA 5F94A 5IQFA 3VUIA 1H1RA 3F5UA 3IQ7A 4ZOGA 5ANGA 3UO4A 4F1OA 4L52A 2ACXA 2WKMA 2CGXA 5AM7A 4DH8A 4RX9A 2W1ZA 1ZOEA 2VU3A 3OROA 4W4YA 5K5NA 3TJCA 2FH9A 4NTTA 3P86A 1SMHA 4AE9A 5IH4A 5LMAA 4BCNA 4QMZA 3QC4A 4RA5A 3TMOA 4W8EA 4Q2AA 5AUWA 2RFNA 3UDZA 3OWLA 2UW8A 4MYGA 5AMNA 3DJ5A 5KCVA 3HV4A 3LM5A 4DF3A 4A06A 1PF8A 4MXAA 4U97A 3L9NA 2WOUA 4O6LA 5ICPA 2C6KA 5HESA 2C6TA 1Q8YA 2QONA 2R3NA 2WTKC 3EKKA 3N9XA 4UXLA 1OIQA 2PZIA 4OBQA 5EI2A 3TXOA 3LMHA 4PPBA 4RJ4A 5CX9A 5AJQA 2WMVA 2YM7A 4O0RA 4QQJA 5HTCA 4U43A 2YN8A 2J5FA 4DFBA 5IF1A 4KWPA 1XQZA 4F7JA 4FEVA 3LXNA 3MB7A 1VJYA 4BZNA 4MNEA 3FYKX 4V05A 4I41A 3NNWA 4XP2A 3FHRA 3QRTA 4JX3A 4QYHA 5HGIA 2UW6A 4RGJA 3DNEA 3GI3A 4WNOA 1YXUA 5CI6A 2J90A 3P1AA 3R02A 4Y5HA 5IQCA 4E5BA 5HE0A 2JBOA 2W1EA 2WMUA 3EQHA 4W9XA 1Y91A 4PDOA 5T3QA 3R7IA 4QYGA 2XIXA 3KU2A 4KKGA 3MH0A 1O6LA 4NZWB 4R1YA 2WMBA 4U45A 2IEWA 4L9IA 3F5XA 2YM4A 4ANOA 4EQMA 2OSCA 3PIZA 2A4LA 3KRRA 5HLPA 4YC3A 4C3PA 5ANEA 2IVTA 5HNBA 4NCTA 2ONLA 5CQUA 3VS1A 4JG7A 3ZC5A 1XR1A 5FBNC 4TRLA 3PFQA 3VBYA 3TZ7A 4FTAA 1W83A 3CJGA 3DTWA 4MBJA 2ONLC 2EXEA 2ZDUA 4JLCA 4NCTC 4QMSA 3ZDUA 3ZSIA 3NMUF 2BIYA 3QRJA 3V8WA 1VR2A 3E8EA 1PKDA 3S95A 3G2FA 4QP3A 5K0XA 4FODA 3A7IA 4MBLA 1BX6A 5EG3A 1KOAA 3K54A 4CD0A 5M09A 3UIMA 1G5SA 4FTUA 2AC3A 2PSQA 2JAMA 2VTLA 3E8CA 5CENA 3W2PA 4EWHA 4FKUA 4A4OA 4D1ZA 1NVRA 2AYPA 3NS9A 1M2PA 3WZEA 3OMVA 3EQPA 4CZYB 3Q9WA 2YCFA 4D2WA 3ORXA 4EUTA 5L6OA 5J1WA 4HYSA 2PVJA 4CZUA 2W9FB 2ITXA 2QI8A 3C4ZA 4MX9A 3N4VA 5DG5A 3PIXA 4FSNA 1OKVA 4FL1A 3R8MA 5JKGA 2QD9A 4LRJA 2UVZA 2BCJA 4D4VA 2XB7A 2W0JA 5JGDA 1WBPA 3Q04A 2ZB0A 5IEXA 5KZ0A 4EOQA 4C38A 1YRPA 3ALNA 3H0YA 3QUEA 3QWJA 2J6MA 4XRJA 5CNNA 2OIBA 3ZO3A 1GIJA 4JDIA 1FBNA 2WD1A 3MBLA 2V7OA 3QWKA 3K3IA 4FGBA 4BKJA 5CALA 3LFAA 4F9AA 4YJOA 2JKMA 1M2RA 3I7BA 4QP1A 3KCKA 4S2ZA 4AT4A 4YSJA 3OW4A 2FGIA 4J1RA 5JH6A 4O81A 3KF4A 5CEKA 3LKMA 2OJIA 4ASXA 4GFMA 2FB8A 3CD8A 3PZEA 5KO1A 2UVYA 5FP6A 5M55A 5JMSA 4FSQA 4I6BA 4F0GA 5JSMA 2C6MA 3PPZA 4PRJA 3VW8A 3PSDA 4RIXA 4V0GA 2XF0A 5J9YA 2O64A 4CKRA 2VWVA 3A4PA 2W5BA 2X8DA 3AD5A 4FBXA 2PU8A 5FDXA 5HD7A 3F6XA 3ENMA 3ULZA 4O7VA 1PXNA 3S3IA 1OGUA 3EQBA 4IVBA 2EUFB 5AP4A 3ZRKA 5GZ8A 4BL1A 4RJ6A 3LHJA 3I4BA 1DM2A 3O7LD 3PJ2A 3G0EA 4IBMA 3NUYA 2QOQA 4EZ7A 3BU5A 4QMLA 5J95A 5A4CA 3GP0A 2OI4X 4G3FA 3O8UA 5TE0A 2XKFA 2QOFA 2XM9A 3EIDA 3QQGA 2HWPA 5AUXA 3UNKA 2R9SA 3U9CA 3QTRA 3F9NA 1X8BA 4I4EA 2C3KA 2GTMA 1S9IA 2YM8A 4NSTA 4KIPA 5GNKA 4BCQA 5KHWA 4FV4A 2ERKA 2YDKA 3GB2A 3RGFA 2I0EA 1MUOA 2A2AA 4WRGA 5CZIA 4ZSJA 3UVPA 1H1WA 1YW2A 3W2OA 4EZ3A 2HOGA 5KNJA 1W2DA 5ETFA 2XP2A 4JDJA 3IW7A 3Q6WA 2XK6A 3B8QA 3SXFA 4LDTA 4L3PA 4XG7A 3TCPA 4DEIA 5BV3A 5HCYA 1RDQE 3EN5A 4AUAA 4WHZA 2IPXA 4FTLA 3E7VA 4XBRA 3W0OA 2C5OA 3P0MA 4KBKA 1YHSA 5LCKA 4ACHA 3SA0A 2NNWB 1CKJA 5CY3A 4B7TA 4F7LA 3MSSA 3LOKA 4LI5A 4R7HA 4XG2A 2VTMA 4FT9A 4DCEA 2OFVA 2YEXA 3FMMA 3F69A 5IUIA 2XIZA 3PY0A 4DAWA 2W99B 4PMTA 4MXXA 3WF6A 4FTOA 4FIHA 4CFUA 3LLAA 3KN5A 4OAVB 3UVQA 2WAJA 4G5JA 4G3EA 4RIWB 2V22A 3DXQA 5BVDA 4A4LA 3UE4A 5I9WA 3CQEA 4I1ZA 3T3UA 1BL6A 4N0SA 4OT5A 5CXHA 1XBBA 2JDTA 4FYOA 5DT0A 5M44A 1F0QA 4Z7HA 3QTZA 4Y5QA 4WRSA 2OZAB 3NLBA 2JKOA 4IB5A 3WZKA 1IA9A 2VAGA 1SYKA 2OU7A 4O7TA 4CGAA 3O2MA 3ZM9A 5F9EA 5CU3A 3BI6A 5BPYA 4BWKA 4BDAA 2R3GA 4KS7A 5D7AA 5TOZA 3ZBXA 4CTCA 2XNOA 3UZRA 3JXWA 3ROYA 5TO8A 3ZU7A 5HG5A 3A60A 2WTKB 4AP7A 3NYOA 3R8PA 4IE9A 1ND4A 1PMVA 3RM7A 3VUTA 4C34A 3W1FA 3UDTA 3DBDA 1F5QA 3FPQA 4PV0A 2PE0A 2PUPA 3Q2MA 2WEIA 1WCCA 3RINA 4E6CA 1FQ1B 3D5VA 4RSSA 1CTPE 3M42A 4PL4A 4WBBB 3LFSA 4XUFA 5CT7A 3MY0A 3RBWA 1MRVA 3FQHA 4J95A 3G6HA 2W05A 2FVDA 3R7YA 4RVKA 4BIEA 4UEUA 5EH0A 4CKIA 2UZVA 2YM5A 4Y73A 2IW9A 4XNEA 3FV8A 3COHA 4DH1A 3PXYA 4CFMA 2A27A 4RWKA 4OTWA 4YJSA 1KSWA 3SXRA 1M7QA 3F88A 3GU7A 2R3OA 3T9IA 1WZYA 4HZSA 3E5AA 2R3HA 5DEWA 4DGOA 5CU6A 3NZ0A 3DU8A 3HDMA 4AW1A 5JZJA 4RZWA 4E4NA 1LEWA 5E1EA 3IO7A 2YIXA 4IX4A 4HVDA 5IU2A 3QXOA 1YWNA 2PL0A 4FSRA 4YLKA 5CEOA 1KE8A 3ZM4A 4R3RA 3IGOA 4ERWA 4JJRA 2Z02A 4PMPA 3LFBA 3FC1X 3O96A 3HP5A 2FSTX 4X21A 4FTMA 4EYMA 4FEUA 2Z7LA 4IAAA 3R9DA 3C9WA 3QTIA 4OTQA 3G5DA 4PPCA 2XALA 3IDCA 3E3PA 1WMKA 3RAWA 1H1SA 2F9GA 4LOOA 4C3FA 1H25A 3EZVA 3PXRA 5F1ZA 4EC8A 4D9TA 3LCDA 4LGHA 3C5UA 1ZZLA 3NNVA 3PJCA 4EOSA 5HU9A 2EB3A 4TTHB 4EJ7A 4AXAA 2XEYA 3R30A 3R9HA 4M97A 5IUGA 2OJ9A 3VJOA 3G33A 5K0KA 3JUHA 5C4KA 3ORKA 4DH5A 4O7NA 4DT9A 3IW8A 2BRGA 3Q32A 4YC8A 3UP7A 2QR7A 3VULA 3IPHA 4C2VA 3LQ8A 1PXIA 5DH3A 3L9MA 4AW2A 5BUJA 4X2NA 1QMZA 3PLSA 1LP4A 5IH6A 4UMUA 1WFCA 2XKDA 3PPKA 5E92A 3QZFA 2CHLA 3IS5A 1WVXA 4FKWA 3HGKA 3DTCA 5CTPA 1REKA 3MFSA 4G5PA 4HYUA 4EH2A 1J3HA 4HZRA 4KKEA 3UPXA 4W4VA 4ANLA 5FUTA 4FSYA 4M13A 3VS5A 4E6AA 3AKJA 3ATTA 5A4EA 2HK5A 3G51A 4HVHA 5AADA 5KMJA 5KBQA 4CG9A 4E3CA 3HNGA 3H3CA 4D4RA 1KOBA 4RC2A 4D4YA 2YWVA 3R9RA 3QQJA 3MVLA 4AN3A 4H36A 4L45A 3OVVA 4GW8A 4I6LA 3O71A 1AD5A 2Y4IC 3OD6X 1TZDA 5D1JA 4EK6A 4ENXA 5LJJA 4K0YA 5IA5A 3RWPA 5DE2A 3UQCA 5HCZA 3VRYA 3O8TA 2ZDTA 3MPMA 4WNPA 4MVFA 4V01A 5IA1A 5DVRA 4U9AA 4QMNA 1XBAA 2ZM4A 4O6EA 5BQ0A 1W2FA 3DQXA 5DI1A 2VTHA 5JFWA 4F78A 4AACA 1NY3A 4NKAA 4FE2A 2VTTA 1M7NA 2W4OA 1DI9A 3PUPA 4MAOA 2R3QA 3N4TA 4FUXA 3GOKA 5KUPA 3R7GA 2OH4A 2ITWA 4L3LA 3HV3A 3R2YA 2PUNA 1BLXA 1OL2A 3N51A 3FJQE 2XCKA 2E2BA 2X6EA 3UNJA 4F9BA 3VVHA 3ZUTA 3II5A 4LV7A 3V5QA 3DLSA 4OTIA 4Y72A 3VHEA 5GIOE 5GJGA 1R1WA 4F9CA 5FXRA 3ZEPA 3R73A 3DDQA 5IMEA 4IWPA 5H8BA 3UP2A 4ENYA 3R71A 2WU7A 5BVWA 3AMAA 4DHIB 2GFCA 3CSVA 4IJPA 3BU3A 3CC6A 3L8SA 4WSYA 2CGWA 3TYKA 4RBLA 4I92A 4QMPA 4O1OA 4JAIA 4YJQA 4EOKA 2JBPA 3PJ1A 3LMGA 3BE2A 4W8DA 5T6KA 1R0PA 4CFFA 3U9NA 4Q9SA 5FBOA 1U59A 1GZ8A 4FZDB 4BDEA 5A6OA 4F6WA 3UIXA 4FKJA 3KMWA 4GT3A 3TM0A 5IQDA 2W4KA 3UO5A 5EYMA 4QMQA 4F7NA 5C27A 3D7TA 4KNBA 2WTWA 3SX9A 4EOIA 3DZQA 4KB8A 3Q4UA 4E8AA 1VYWA 5LWNA 4C3RA 3VN9A 1I09A 3BLQA 3QRUA 4JQ7A 3ZUVA 4DLJA 4D0XA 4O86A 2C1AA 5HLWA 3GC0A 4GIHA 5FM2A 4L01A 1DAYA 3KXGA 1EH4A 3ZRMA 2VTSA 3RAIA 3U4WA 4P4CA 4DEBA 4L67A 1FMKA 2X6DA 4DEHA 5AP5A 3ID6C 4X3FC 3LFCA 5L2TA 3DA6A 3PIYA 3EFKA 5EYCA 2GHMA 2CDZA 4QPMA 5BMMA 3RPRA 2ESMA 1F3MC 2XM8A 4IX6A 4O22A 4UMQA 2C5VA 3RPYA 3T9TA 4E1ZA 4J53A 3GT8A 4MXCA 3O23A 1H0WA 4RC3A 4DFXE 3HVCA 1BUHA 1ATPE 3DPKA 4IAIA 3ERKA 2YFXA 1ZOHA 5JFVA 2CLQA 2HY81 3PJ3A 3D83A 3QD0A 5CU2A 4ZSEA 3FMHA 3W2QA 3OBJA 3ODYX 4MH7A 4XG3A 2YAAA 4XOZA 5DR9A 5EM6A 4FOCA 1Q8ZA 4IM3A 5HVKA 4XBUA 4I20A 4BDGA 4U3ZA 4TWPA 3RP9A 3MWUA 1GOLA 4FV8A 5AV0A 4WSQA 3R8VA 4QMOA 3FL5A 5HU3A 4WIHA 4B99A 5JK3A 5DR6A 3HUBA 2WFYA 3TUDA 3PXZA 1Z9XA 1DS5A 5CVHA 4K33A 4AA4A 2PYWA 3BHVA 3OCSA 4L6QA 4PQNA 4DN5A 4FTJA 3UC4A 3FLNC 2X2KA 4I93A 4PMMA 5AX9A 3BU6A 4CTBA 3W8QA 2WMWA 3M11A 1ZYJA 5AV2A 3PTGA 4O4CA 4AQCA 5LARA 3A4OX 5CSVA 2I6LA 4B8LA 4DGGA 3UDSA 3DKOA 5D11A 4ZZOA 4UMPA 3NIEA 4RIOA 3V51A 5IA3A 5HIEA 1FOTA 3BKBA 3NDMA 3QCYA 4XOYA 5DRDA 3SW4A 2WMSA 4M66A 3NUPA 3V6RA 2R4BA 4IB1A 2WMAA 4J7BA 4JIAA 2P0CA 1XKKA 5HBHA 1YXXA 4G3DA 2DYLA 4OTRA 4IWQA 1MQ4A 1ZWSA 5AUYA 3E62A 4C4IA 4E6QA 4EK3A 5DHJA 4PDSA 3UQGA 3HDNA 2WU6A 3FZTA 5E90A 1UV5A 4ZSGA 3RKBA 3GCQA 5J79A 4FKIA 1MRYA 4S32A 4FRFA 3IKAA 3ZFMA 2ITZA 3CQUA 5AR8A 3OS3A 3PE1A 4IC8A 3HMPA 4UBAA 2IZTA 4XHKB 3RPVA 4XG9A 3L9PA 4YUQA 3WBLA 4BIDA 2BFXA 3GCSA 5L8KA 2OW3A 1ZYSA 5EM8A 4M14A 4PTEA 4BWPA 3QZHA 4FKRA 1CMKE 2B9IA 4C36A 5CSHA 3HV5A 4WNMA 3ORIA 2YERA 3RCJA 3ZUUA 3FKNA 5J87A 4UY9A 4Y46A 4EI4A 5EK7A 1JVPP 4AZFA 3SQQA 3LFDA 4N6YA 4ZTNA 5AP7A 4C0TA 4B4LA 3IDPA 1B6CB 3R28A 4E7WA 2BRNA 3HAVA 3AC1A 1H08A 2ITVA 4NWMA 4R3PA 2YIYA 4YZNA 3CTHA 4RQVA 3P5KA 2X0QA 3D5XA 3CIKA 4MUQA 3E93A 1FMOE 4L44A 2VWWA 4J71A 3QX4A 4QOXA 3QAME 4WA9A 3W0NA 1W2CA 3Q9XA 4CCUA 2OF4A 5JQ5A 4LM5A 5GJFA 3FUPA 1W8CA 1TFFA 2YAKA 4DH7A 4YZDA 3HZTA 1VEBA 3SOCA 2BROA 2O0UA 2Y4IB 2E9VA 4QD6A 4FC0A 4FIJA 4XV3A 4EOOA 4O7ZA 3GOPA 4GJ3A 3A7JA 3NR9A 3OXIA 5EOLA 1M2QA 2ITOA 4G2FA 4OW8A 2OJJA 2QOBA 4MK0A 4IM2A 4DITA 4EBWA 3BLRA 1J1CA 4AT5A 1YHWA 4HCVA 3D9VA 2HIWA 3BQCA 3R8LA 3U8WA 4QP8A 4BTMA 1YOMA 2ITUA 4C61A 4QP7A 1UU7A 4E73A 4G16A 1Q4LA 3V5LA 2B7AA 1E9HA 3D2IA 3E87A 3QKMA 2JGZA 3RTPA 3H4JA 3IDBA 2HXLA 3TV7A 5I0BA 3WARA 3F2RA 3KXHA 1GZNA 3MTLA 4F63A 4NK9A 3F61A 2R3LA 3R83A 4X6QC 2QLQA 1YHVA 3CR0A 3O7LB 4R7BA 3KCFA 2YZAA 4ZY4A 3LCTA 4FF8A 4JT3A 3AT3A 3WE4A 2DUVA 4BCFA 2RG5A 5J5SA 5IQIA 4NIFA 4EHGA 4QMWA 2HZIA 3MDYA 3RNIA 3KRLA 3DAKA 3SV0A 3TIYA 3SC1A 2Y4PA 3PY3A 1V1KA 1PXOA 2F57A 1Y6BA 1OL6A 3LJ0A 3MN3A 4BR3A 4NW5A 5KKRB 4U0IA 4QMVA 4FVRA 2UVXA 2ZM3A 3KXNA 3WIGA 4AX8A 2C3JA 5IDNA 3KIOC 5M08A 5DFPA 5DRBA 3IK3A 5GJDA 4BCGA 3TDVA 5CVGA 1XH5A 4BCMA 3GU6A 2XBAA 3I6UA 4U3YA 5HEZA 2O2UA 1ZYLA 4FL3A 5HBEA 4FTTA 4FUYA 2HZ4A 3OP5A 4IXPA 3QL8A 4DH3A 5I9YA 1XMMA 3UBDA 3ZO2A 2GNIA 3FI2A 2PE1A 5C1QB 2XRWA 2OH0E 4HGEA 3D7TB 3L8PA 4FVPA 2OICA 4PTCA 4WKQA 5FWKK 4Y85A 4ZAUA 4M15A 5KMKA 2WTJA 4AF3A 5EM5A 2R3KA 1UVRA 4HGSA 1NW1A 4I23A 3TIZA 2GPHA 4FJVA 1NXKA 2GS2A 3VS2A 3GGFA 4X2FA 4EH8A 4BB4A 4S33A 1G8SA 4X3FB 3DBCA 2BVAA 4HYHA 2UZLA 1SNUA 3QKLA 5HE2A 4IDTA 2VO0A 3CKXA 5CSXA 4NJ3A 4PUZA 3QCSA 1R39A 2G9XA 3U51A 3WIKA 4I3ZA 3FLQA 5B0XA 5J9ZA 4ZTMA 3IECA 3OEZA 4R77A 4R6VA 2F7ZE 3GVUA 3O8PA 3QBNA 1G3NA 3LAUA 3VUMA 4AAYA 5IMXA 3PPJA 1PXKA 1U5RA 4YJUA 3TUBA 4CSVA 3UYSA 5CNOA 3EQDA 3VS0A 3ZLSA 3KFAA 4APCA 1YI4A 3DOGA 3CPBA 5HNGA 3W8LA 2A1AB 2WO6A 3A7FA 3MH1A 3VBTA 3ZEWA 3L8XA 4FTKA 3R1YA 4FG9A 4KSQA 2BRHA 2FA2A 4IAZA 1TKIA 2R3FA 1W0XC 3S2PA 4QEBA 2ITPA 3SGCA 4JAJA 1Q8WA 3MA6A 1KV2A 4YJTA 3U6HA 3QXPA 3RM6A 4F9YA 1ZRZA 4G3CA 3A61A 3D7ZA 3HYHA 4GG5A 4BI0A 3ZZWA 4AXCA 4C2WA 4EJNA 2C68A 5EDQA 3OTUA 4BDJA 5JFSA 5HTIA 3C4XA 4LMNA 2XAOA 3NFFB 4AQKA 3A99A 4KS8A 1Y8GA 3BYVA 4FV3A 4ITIA 4M68A 5IEYA 2HXQA 4M67A 4XCUA 5AWMA 3LPBA 5I9XA 5BUEA 5C8NA 1YDTE 2C69A 1IG1A 2QU5A 2CJMA 4QPAA 3WI6A 1Q8TA 3NSZA 4BCKA 4FT0A 4DEGA 1XH9A 5DLSA 4RT7A 1H01A 2E9UA 4GIIA 4OTDA 2JDVA 2J51A 2YJSA 1KV1A 3FI4A 4W9WA 3KK9A 5HG7A 3RK7A 4AG8A 1TQMA 2VV9A 2OO8X 3QA8A 4KBAA 4BCJA 2P2IA 4CVAA 2I40A 2QO2A 1IAJA 2W1HA 4CXAA 4AA5A 4NW6A 1XWSA 3LW0A 3VBXA 2VRXA 2VNYA 5EYKA 1O6YA 3DLZA 3O17A 1FINA 4QYEA 4C4EA 2VX1A 3DK7A 5AIKA 3SG8A 3ZXTA 3TKIA 3NNXA 4DHFA 2QG5A 5E1SA 4I5HA 3NCZA 2JD5A 2IZSA 4FTNA 3WZUA 4U81A 4AW5A 5K4IA 3HV7A 3FZOA 5DN3A 1GIHA 5CAPA 2XAMA 3KKVA 3ZC6A 4ACCA 4G6LA 3O5AA 2UZTA 2BZKB 4G9RA 2XJ0A 2X4ZA 4AOIA 4I5PA 1G8AA 3D5WA 3RAKA 3COMA 3TV4A 5HE3A 4ZSLA 3CTJA 5I3OA 4F70A 2CKQA 3EFLA 4FIFA 1PJKA 2ZFYA 4C4HA 3NUXA 2WOTA 4KIKB 2UZEA 3CBLA 1Y6AA 4ID7A 4O21A 5C9CA 3SRVA 4EOPA 5JGAA 5BYLA 4R7IA 4U8ZA 3C4WA 4ACMA 3GFWA 3P08A 1OZ1A 4OTFA 4O83A 2GCDA 5B2LA 2VN9A 5BMSA 4DT8A 3CPCA 3OZ6A 4K1BA 3UOHA 4I94A 2BHEA 2OK1A 3R21A 4PPAA 1XMLA 4O84A 3CXWA 4NFMA 2RFSA 2PHKA 2BZJA 4M7IA 4C35A 3IW6A 5K5XA 5ACBC 1S9JA 4F9WA 5KMLA 2JKQA 3FQEA 3I60A 2NRYA 3PVWA 2Q0NA 4G17A 4AGUA 3EJ1A 5C01A 2ITTA 5HIDA 2UZUE 2BZHB 4DTAA 3AOXA 4IC7A 5AA9A 5CAVA 4RWLA 5L2SA 5CZHA 4K2RA 2NRUA 4H05A 4C57A 2EXCX 3AC4A 5LMBA 3UOJA 2Z7RA 2NP8A 3CJFA 3AXWA 4JBOA 4RA4A 4IZ5A 5EKOA 3VONA 5C8KA 4KRCA 5HD4A 3E7OA 1FVRA 3ETAA 4A07A 5I9ZA 3PVBA 5LMKA 4TT7A 3Q53A 4I0RA 4K77A 2HENA 4AOTA 4BKZA 1O6KA 1Q41A 3E92A 5HQ0A 4BHZA 5FG8A 3GU5A 4YZ9A 2B9FA 3QQLA 4JVGA 3UOKA 2QURA 3QD2B 5LMKC 1STCE 5FXSA 4AAAA 4MNFA 4TYHA 4KINA 5CLPA 4BKYA