5LJJA

Crystal structure of human mps1 (ttk) in complex with reversine
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
281
structure length
264
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMEYGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTDSQVGTVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of reversine selectivity in inhibiting Mps1 more potently than aurora B kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dual specificity protein kinase TTK
total genus 67
structure length 264
sequence length 281
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ljjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ljjA01
3SAYA 5GZAA 1CKPA 3MY1A 3BZ3A 4WHZA 4AOTA 3F9NA 4RJ5A 4QP2A 5C8NA 2JDVA 2FO0A 3EN5A 4XX9A 4ZJIA 4YMJA 5K5NA 4FT5A 5FEQA 4RX7A 2GNGA 3PG3A 3NPCA 3UO5A 5L2QA 3TV6A 4DEAA 4FTAA 4L43A 3ZLYA 1Q8TA 3EKKA 5CSVA 3QD3A 1RDQE 3G51A 4RG0A 5EM5A 1ZXEA 3E8NA 2UW6A 5EQPA 4AZEA 4MTAA 2VWZA 3U9CA 5HTCA 3GEQA 3Q4CA 4NM7A 5BVKA 5C27A 1ZMUA 2IN6A 1U4DA 3VS0A 2WKMA 3FKNA 4GFMA 4FOBA 4C57A 3WIGA 1IAJA 3TXOA 5IKWA 5KMNA 3CTHA 4QNYA 1I09A 3O0GA 5JRSA 3VS3A 3FSFA 5CEQA 4BKYA 3I0QA 4PMSA 4HNFA 4QD6A 5ETIA 2PPQA 4EK3A 4U3YA 5CT0A 1KE9A 2V62A 3HX4A 1TVOA 4RJ4A 4NM5A 1H1RA 2VX1A 4V0GB 4ZY5A 3UZRA 4EK4A 2HY0A 3JPVA 3D83A 1EH4A 2G2FA 4QP4A 4C3PA 3UTOA 4EH2A 5A4LA 2B0QA 3QALE 4XNEA 4DTAA 3R0TA 5TOZA 3OWLA 3MJ2A 3HA6A 2GNLA 1RJBA 2R0UA 3KMUA 3OEFX 4L9IA 5AP1A 1G5SA 1FVVA 1Q5KA 3R1SA 3VUIA 1APME 2JIIA 3KF4A 3PXFA 4F99A 1OPLA 4G3CA 4AOIA 3LFNA 3NYOA 3UMWA 4DHFA 3E92A 3NYNA 3FZTA 4HYUA 4O96A 4ZOGA 2A19B 3D7TA 3NGAA 3UZTA 2PSQA 4FEQA 5K5XA 3QTUA 5GZ9A 1OB3A 4ZAUA 3G5DA 4DYMA 1ZARA 1W98A 2XM9A 4R5YA 4RBLA 5HVKA 4CCBA 2OH4A 3FYKX 2XEZA 1XWSA 3LCDA 4UWBA 4ASDA 2XA4A 4QRCA 4OUCA 5IISA 5J9LA 3GCVA 3QGYA 4IAAA 1YDRE 4CFVA 1U46A 4K9YA 5BPYA 1R39A 4C4IA 5HNBA 4F7JA 4QMMA 3HUCA 2F7EE 4GG5A 4MH7A 3T8OA 4CT2A 3AD5A 4G3DA 2BROA 3O8UA 5FDXA 3W10A 3Q96A 5E92A 1YOLA 3ACJA 5DE2A 4ZIMA 4BWPA 3ATSA 4HZRA 4QMOA 4IX4A 3TDVA 3L8XA 5E8VA 4A7CA 5AEPA 3JXWA 5CF4A 5JFVA 4YTFA 4YJOA 2UW3A 2PHKA 4JQ8A 4QTDA 4F0FA 3K5VA 2XM8A 3NEWA 4HNIA 4ZSGA 5F95A 3UQFA 2JDSA 4I22A 3QCSA 2EB3A 4MXCA 2JDOA 2GS2A 4IZ5A 5EOLA 3NVKI 3KK9A 2VV9A 4IB1A 4IWDA 4KKHA 4V04A 4CLJA 4H05A 1Y8YA 1ZOEA 4XRJA 2C1BA 1FOTA 5D11A 2C30A 2OIBA 4ZP5A 2UW0A 3TV4A 3WZEA 2XKDA 2Y4PA 4HCUA 2WMRA 4TWCA 4WNMA 3GVUA 3ZRKA 4MNEB 2GQGA 3F66A 5JGDA 5D9HA 4FKPA 1OKWA 4BDCA 4ZS0A 1M7NA 3HP5A 2XIXA 2UZOA 3TT0A 3DU8A 5ICPA 4YJRA 5IQFA 3OW3A 3FV8A 2XNEA 2BFYA 2Z8CA 3I60A 4ZK5A 1H28A 4IWOA 3DQWA 3KRLA 2GHGA 1GIJA 3EQPA 3O51A 3RALA 1DAWA 4L7FA 4F9CA 1G8AA 1YHSA 2YIRA 1NVRA 3HMMA 4I21A 5F4NA 2GQRA 3CQWA 3ORNA 4QYHA 4CV9A 5T6KA 1FINA 4LRJA 3V5WA 5I5ZA 4BR3A 2XK4A 1OMWA 4CYJA 3LIJA 3W2SA 4GV1A 3DKOA 2O5KA 4FEUA 5L6PA 2JGZA 4G9CA 5CWZA 4KA3A 4AXAA 3NSZA 1U5QA 3ZXZA 5JGAA 2OZAA 3F61A 4F6UA 4K0YA 2O3PA 2UV2A 4I3ZA 4AACA 4EH5A 4BCMA 1IASA 4MWHA 1H0WA 4D5HA 3VS6A 4QNAA 2B9IA 3VUGA 4BHZA 3LOKA 4FF8A 3DXQA 3KREA 3MPTA 3BI6A 2BILB 3KRJA 4I24A 2FGIA 3WF5A 3BGQA 3A4PA 3NUYA 1REJA 2PWLA 4FTCA 3SOCA 1K2PA 4AW5A 3MA3A 4NT4A 3IO7A 4L42A 4XV3A 4YZBA 3R9OA 4O0SA 3GFEA 3GUBA 4IACA 3CQUA 5EDRA 1FBNA 2CNQA 5CVGA 3MYGA 5EYMA 3R63A 2ITVA 4YHJA 5AP3A 4CD0A 4D1SA 1OVEA 4FKGA 4KIOA 5AX3A 2OSCA 4X2KA 1H4LA 5TKDA 3QQKA 1FQ1B 4U6RA 3P7AA 3ZEPA 5CF8A 5KUPA 4BCIA 4F6SA 4JQEA 4CFNA 2R3KA 4OBOA 1MQBA 5LCKA 4CLIA 2A2AA 5I9VA 4I0RA 3DKCA 4IC7A 4AE6A 3LQ3A 4E6QA 2YEXA 4AN9A 2FUMA 3LFSA 2XNNA 4GUEA 3QZFA 5LJJA 1P4OA 3N51A 2HXQA 2C6IA 5J7BA 5AX9A 1NT2A 5CEKA 3DTWA 4M97A 5TE0A 4J71A 1LP4A 4DBNA 4E4LA 4NCTA 4P4CA 5KHXA 3BGZA 3SKCA 4RVLA 2QKWB 3VQUA 4CNHA 4CKJA 5CNOA 3TZ9A 3FKOA 2JIUA 2WTIA 1SVEA 3KXZA 2C3KA 5HO7A 4DTKA 4GIIA 5A4CA 5E8YA 5IQDA 5JFSA 4FT9A 4ZSEA 1U54A 1YXUA 2FSLX 3D7TB 3GB2A 1UU8A 1PJKA 3ZZEA 3QTQA 2YZLA 2WD1A 4OLIA 1O6LA 3E93A 5EK7A 5M07A 4BY9E 3EB0A 2PVFA 4ALWA 5CAPA 1Z57A 3B8RA 4DG3E 2R4BA 3QZIA 2Y8OA 2FSMX 4PMMA 4WIHA 5BVOA 3VBXA 4MCVA 4ITHA 3PVGA 4QMYA 5AAFA 1BI7A 4X2GA 2HZ0A 5D12A 4O0TA 1Q24A 4B8LA 3V51A 3WE4A 5ETCA 2XK8A 4BDDA 3A7JA 4XG8A 4Y5QA 5LWMA 4K1BA 2YM6A 1Q97A 2YCFA 5L4QA 2PVMA 2B1PA 2HXLA 3RCDA 5AUTA 1H1PA 4BTFA 3OT8A 4RA5A 2UVZA 5HG9A 3MA6A 4KIKB 5CU6A 2WU6A 4TPTA 1YQJA 4D5KA 4DN5A 4M7IA 3R9NA 2QOQA 3CSVA 4B7TA 2Y4IC 3ORIA 4O2ZA 5IZFA 4CRSA 2B54A 4JI9A 1YHWA 3AGLA 2OH0E 3VUMA 2XEYA 5DHJA 5IQEA 2OI4X 2VTLA 5E8UA 4DAWA 4OTHA 4AGDA 2YITA 1Q99A 2X8IA 3C5IA 3HZTA 4BDAA 1JVPP 4OTRA 4BDEA 3GU8A 1GIIA 5EYCA 5LMKA 1YI4A 3R8PA 2Z7LA 3BEGA 3GBZA 2VD5A 2ZV9A 3QTXA 4PQNA 4XJ0A 3FZOA 3GNIB 3KA0A 3W2PA 3ZBXA 5EG3A 4EUUA 1PXIA 3EN7A 1WBNA 2CDZA 4F1OA 3GC8A 3O17A 2NRUA 3R1QA 3LFDA 4FIGA 3VW8A 3FXZA 2QOFA 2WMVA 4EWHA 4FNZA 4I5PA 5IQBA 3KN6A 3GCQA 3G0EA 1JSVA 4FOCA 5AUWA 4DFXE 3MWUA 1YWVA 4KIQA 4YNOA 5AWMA 3N4VA 4R78A 4RJ6A 3WE8A 1GIHA 3QWKA 2C3IB 3E64A 3RM7A 3ZUTA 3NNXA 4GMYA 4A9YA 5H8BA 5IQGA 1OECA 3OVVA 4QP3A 3OF0A 5E8XA 3RCJA 5CAOA 4QMXA 3OMVA 1OIYA 5CI7A 4EBVA 3GQIA 4USEA 2V7AA 3CY2A 1PXJA 4BCQA 5IQHA 5EQYA 3RAIA 2YABA 1OIQA 4YZ9A 4EJ7A 1X8BA 2BZHB 3BWJA 3ZUVA 2QODA 3OW4A 4TNDA 3FLNC 3ALOA 5HD4A 3OUNB 2NO3A 4A4OA 3QQLA 4IHPA 5TR6A 4TKSA 3RWPA 4EKKA 4ZTRA 2YM4A 3UZPA 2A27A 4DF3A 3R22A 4CKRA 2BKZA 5EM7A 4F65A 4MQ1A 3HUBA 3R8ZA 4O0VA 5FG8A 3OG7A 3TUDA 4BTKA 4O0WA 2X4FA 3LM5A 2BTSA 2FSTX 2JBPA 4A06A 2X8EA 3LXPA 4BC6A 1BLXA 4APCA 1RW8A 4L7SA 4MXXA 3VJNA 2WMAA 4X21A 5CXZA 2ITQA 3HV4A 2UW9A 3BU3A 4O2PA 3PFQA 4OTGA 2W5HA 2J90A 3MN3A 3W2QA 4Z16A 5DG5A 4RZWA 3CC6A 4FGRA 4QMNA 1KE8A 5J9YA 5LVNA 3TTJA 4GVJA 4L6QA 2I0EA 2YLFA 3ATTA 3FC1X 4UXQA 5HZNA 3NYVA 4MNFA 3VULA 1M17A 4QMLA 1ND4A 4H1MA 2WXVA 4IM0A 1KUTA 3EFLA 5FBNC 3KCKA 4M84A 3FBVA 5IU2A 2BRNA 4DEHA 4E4MA 5AP4A 5LOHA 2FB8A 4RIOA 4D9UA 1CSNA 3S0OA 1OKVA 3D4QA 3LFQA 3R00A 2EB2A 3KL8A 3HDMA 4N4SA 5HICA 3ZFYA 4AW1A 3UC4A 4AZVA 5L6WL 2Z7RA 2GHMA 1YRPA 1ZYJA 4U79A 4KBAA 4GVAA 3BLRA 3SG8A 3D5WA 1XHAA 2VTHA 2ZJWA 4KNBA 3R9RA 4DGLC 3PIZA 4YTIA 4ENYA 4AGCA 4LRKA 2PTKA 3BPRA 2VTNA 1O9UA 3UQCA 5C4LA 3UNKA 3DBFA 3FYJX 2RIOA 5FTOA 4CFUA 5K4IA 4EOKA 2KULA 1YOMA 2XRUA 3FLSA 3WZJA 5L6OA 3F3VA 5FXSA 4AGUA 3RWQA 3MB7A 4EZ7A 2C6KA 3HYHA 4G6LA 4QMUA 2ZAZA 4D2VA 3CJFA 4WG5A 3QA0A 2QVSE 4MQ2A 5IDNA 1PW2A 1OI9A 1J91A 3B8QA 3QC4A 4G3FA 3F69A 3F6XA 4M69A 2DUVA 4RWIA 3S95A 4ZLZA 4ORKA 4EHZA 2WIHA 1JKKA 3CEKA 3W32A 4AFJA 3FAAA 3SXRA 1IAHA 3BLHA 4FYOA 2IW6A 2XCHA 2OK1A 2RFDA 3QBNA 5F20A 5AAEA 4AW2A 5HCXA 3A8WA 1CMKE 3F5XA 4PTGA 3ENMA 2VWWA 4FGBA 4O22A 3NMUF 5I9UA 2UZDA 4O84A 2VTSA 2G01A 2ZMCA 4L68A 5FM2A 2XK6A 4FZ7A 5DH3A 3JR1A 3A4OX 3FHIA 4KKGA 3QKLA 4O7WA 5ANDA 3FQEA 4O7VA 2QR7A 3QQUA 3D2KA 4FNXA 3PY3A 3V6SA 2QLUA 3TNQB 3FEGA 4BIBA 2OIQA 3O8PA 4FV6A 4X7QA 4J95A 4C4HA 3EZVA 2OF2A 3JY9A 2V55A 4FVQA 1FPUA 4DLJA 3EQFA 4MBLA 1U5RA 3MVMA 1NVSA 2E9UA 4XV1A 2AC3A 3I6WA 4XP3A 3AGMA 5JFXA 2X8DA 4RIXB 2UVYA 3KVXA 2BAJA 3AMYA 4M0ZA 4DCAA 3TN8A 1GZOA 3NAXA 3NNUA 3BV3A 4EYJA 5HE2A 5FEDA 2I0YA 3HNGA 3IDBA 3PZEA 2WMSA 2V7OA 4IB5A 4X3JA 5CEPA 4LM5A 3SLSA 3F7WA 1ZZLA 4C61A 1UV5A 4W9WA 4GT4A 2J6MA 2QOKA 5AADA 4NTTA 3DY7A 2OICA 4LV8A 3SDJA 2X9EA 3CTJA 4DE4A 3KULB 3OWJA 4ASZA 3FPMA 2ZM4A 3R30A 3CPCA 3QTRA 4C36A 4JXFA 1OBGA 3RP9A 4FK3A 1W84A 4QQ5A 4L3JA 1G3NA 5E1EA 3G2FA 1GNGA 2F2UA 2O65A 5F1ZA 3HGKA 3OTVA 4TNBA 3L8PA 3EL7A 4PX6A 3IDPA 4O86A 4GJ2A 3E62A 4BGHA 4DEBA 2XYUA 4FKTA 4RJ7A 3DK3A 1XJDA 4IX6A 4RJ3A 1B39A 1SZMA 4UMQA 4CGAA 3C0HA 1I44A 2WEIA 4FV7A 4WOVA 4O21A 4ZZOA 4CG9A 3UO6A 1PXPA 3WF9A 2X6EA 3S2PA 3CP9A 2JKQA 1JNKA 4XG4A 4CRLA 3FDNA 2I1MA 3ZHPC 2VWBA 3BKBA 2VTAA 5HIEA 4BCPA 5AUUA 3ORLA 3KRXA 4CT1A 4DFUA 1MRVA 2OG8A 4XYFA 1JKLA 3CIKA 3VRZA 4ACGA 4P5QA 3GU5A 4CV8A 5K9IA 4PTEA 4IWQA 2IO6A 3OWKA 3MIAA 2WTWA 5DRBA 3L9MA 5CYIA 4FSUA 4ITJA 2BRHA 3P9JA 3EKNA 4QP6A 2I7QA 3VUDA 1JSTA 2R2PA 4CVAA 5ACBC 5CI6A 3FMLA 1WBWA 3EMGA 4E6AA 4UX9A 4IXPA 3F2AA 4FKRA 1H08A 4U8ZA 4XLVA 3RINA 4EK6A 4JG6A 2R3LA 4R3PA 3DBEA 4G2FA 4AOJA 3OCBA 4DG2E 2CN5A 2VN9A 1RE8A 4I6BA 4QP8A 3ULIA 4FSMA 3FMDA 3MTLA 4RFYA 5IA0A 5A14A 3DFAA 4IAFA 2O64A 4G17A 4G3GA 2X7FA 3A61A 4C62A 1UNHA 3VNTA 4RWLA 3AOXA 2CN8A 4YNEA 1XH4A 4MXOA 1XBCA 4LL0A 4E6DA 4H3PA 2GPHA 4QQTA 3FI4A 4G1WA 4U0IA 3RAWA 2JBOA 3KRRA 4XRLA 3V01A 3ZBFA 3MW1A 3LHJA 3LCKA 1DS5A 3SVVA 2P2HA 5D10A 4NL0A 2H8HA 4W8DA 4C3RA 2JIVA 5AUVA 2IVSA 1JKSA 1H27A 2OIDA 2Q0NA 2RSVA 3Q60A 2VX3A 4H58A 3IOPA 4MD9E 5HG8A 3R04A 3LMGA 5CQWA 5A54A 3BHTA 4P5ZA 3BV2A 1SNXA 4D28A 3SG9A 4MYGA 2R3RA 3TDWA 3DXNA 3BELA 1MRYA 2RF9A 2WOUA 3MVHA 4CQEA 3PA5A 2WQMA 4FEWA 3V5QA 4Q9SA 3QXOA 2F57A 2J0LA 5CVHA 3Q32A 4W4WA 1OKYA 4LFIA 4XG9A 4XLIA 3WILA 2CCHA 4BKZA 4DT9A 2P2IA 2V5QA 1M52A 4BZNA 3FI2A 3LCTA 1K3AA 4UBAA 4F0GA 5C1QB 3OC1A 2RG6A 5HIDA 5L8JA 1JBPE 3EH9A 2X1NA 3PRFA 4RT7A 1FVRA 3NIEA 3G90X 2F4JA 3G6GA 3A60A 3FMKA 4YHFA 1Q3WA 3HP2A 4QMZA 3HRFA 4JNWA 3POOA 2IG7A 4O7TA 3GFWA 3SC1A 4S30A 1L8TA 4YBKA 4RIWB 5C03A 4O0UA 3L8VA 3LJ1A 3F3TA 3ORPA 1J3HA 1URWA 4GJ3A 3MV5A 4HPTE 5DGZA 4L44A 3LW0A 1S9JA 4L45A 3TACA 3LXLA 1P5EA 2HOGA 1WFCA 4UMPA 4XV2A 5I9ZA 5CEIA 4QPSA 4QMSA 3MGYA 1VR2A 4I93A 1XO2B 3WOWA 5E91A 2VTRA 4IB3A 4BDHA 4TT7A 3R1YA 2YAAA 2C6DA 4AW0A 4O83A 5DIAA 1B38A 4ENXA 5AFVA 2C6EA 3PWDA 3SRVB 4BDIA 1B6CB 5IA4A 3AC4A 3QQGA 2W4OA 5AUXA 4X2FA 5IMEA 4WUAA 4PNKA 4PL3A 2RG5A 4LGDA 3KULA 5AMNA 4C4FA 2Q83A 4FNWA 4R5SA 1M2PA 5IQCA 3C4XA 4U40A 4KS7A 4PP9A 2Z7SA 3QHWA 3LM0A 2R3OA 4EQCA 1R0PA 3O23A 3H4JA 4E5WA 1P4FA 1LUFA 5M08A 2QOLA 2W1HA 2JC6A 4DFBA 2HIWA 4P90A 4FIJA 3LXKA 3GGFA 3PY0A 4YBJA 4BWXA 3BHUA 3PYYA 4D2PA 2XIZA 4IFCA 3T3UA 3NCZA 1YWNA 4NIFA 5CSWA 2RGPA 4I6FA 3LJ0A 5EM6A 4Z55A 1Q4LA 4XHKB 2XYNA 4M66A 4WUNA 5CLPA 4BTMA 2ZDUA 5M09A 3OEZA 2PZIA 3OCGA 2V0DA 3VBWA 3VUKA 2YCQA 4DGNA 5A6NA 4K2RA 5JT2A 3D5VA 4ZTMA 3R02A 4KB8A 4M0YA 4AN2A 4RLLA 2QOOA 5CNNA 3W2OA 1YXXA 2NRYA 4XOYA 5HVJA 5JN2A 3BQRA 2R3NA 4YZCA 3NX8A 5CX9A 1G8SA 3E8DA 4ASEA 3G9NA 5FRIA 5J5TA 3R9DA 4FBXA 4L67A 4OT5A 3Q4TA 4YJPA 3E7OA 4IX3A 5FLFA 4KWPA 3ZXTA 3S4QA 4M14A 1H00A 4MWIA 4HCVA 2JITA 2QHMA 4M8TA 4IM2A 4R3CA 3JVSA 4D2WA 3DFCB 4U3ZA 1CTPE 3GP0A 3N4TA 3DXPA 3GOPA 4G5JA 4GFOA 2VGPA 4AN3A 4FEXA 2F2CB 4HYHA 4UWYA 3KGAA 3T3VA 4RA4A 3QRIA 3K3JA 4IZAA 4JAIA 4YSMA 5DPVA 2UW7A 3F5GA 3Q53A 4FZ6A 3RK9A 5LARA 1WBVA 3F2RA 5DN3A 3UVPA 5AIRA 4FTIA 2QHNA 3EYGA 3F82A 2XP2A 4LMUA 5JRQA 2WPAA 3R9HA 2XK7A 4P2KA 2YN8A 4LV5A 4I0TA 4OR5A 1UNGA 5A9UA 3N4UA 3ROCA 2CLXA 2UZUE 4GU9A 4ZSLA 3HA8A 2CGWA 4MF1A 5HLPA 3UNJA 3LMIA 3W33A 3U54A 1UKHA 3NIZA 1GJOA 4IVAA 2OFVA 5AR7A 2B55A 2YA9A 3PVUA 1L3RE 3MIYA 4W4XA 1QMZA 3QXPA 5L2SA 5IQIA 3SXSA 4PWNA 3GU4A 3ZRMA 2OXXA 4BYJA 3FL4A 4EOQA 4YTHA 3EQCA 3W1FA 1TQPA 3I7BA 3OOGA 3MY5A 2WTJA 3QL8A 2WB8A 4W4YA 1REKA 4AZWA 3HMOA 4G16A 2JKKA 3MTFA 3P1AA 2J9MA 5CF6A 3MVLA 2WTCA 2VO7A 5AA8A 2F7ZE 2IZUA 2PVLA 3TKUA 5CF5A 5M53A 3QF9A 2QOBA 2DQ7X 4O1PA 4NU1A 3OP5A 3PVWA 1T46A 3DLSA 3TKIA 4RX8A 4D1ZA 2HWOA 2QO2A 3UOHA 2YM3A 4EYMA 4BWKA 3I79A 1YDSE 2VO0A 4JX7A 3P23A 5D7VA 4U41A 2CJMA 4LRMA 1ZY4A 4CCUA 4GK4A 4EL9A 4D55A 2PVYA 4RQKA 3U4UA 5L2TA 1H1WA 2HW6A 3AMBA 2I0HA 3JUHA 4UWCA 3UO4A 4QO9A 2C69A 4E93A 4YJUA 4FSYA 3KXGA 5HX6A 5IH5A 4IEBA 4RIWA 2RL5A 4EK5A 3FY2A 4Y46A 2H34A 3KY2A 3VW6A 1IG1A 4BRXA 3LVPA 4F09A 3H9OA 2VWVA 4WD5A 5KO1A 5HCYA 4FIEA 2E9PA 4Y5HA 4O38A 2F7XE 4YZNA 4GKHA 4FEVA 5EW9A 5JGBA 1YKRA 2VNYA 3A7GA 3Q4ZA 4Q2AA 4KD1A 3IW8A 2YZAA 4RPVA 4XUFA 3ZMMA 4WNPA 4XMOA 2VNWA 2ZV2A 1UNLA 5KMLA 3P5KA 3P86A 2JDRA 4I20A 3TNIA 3UOJA 2GS7A 4AAAA 3DAEA 1UA2A 1Y8GA 3JY0A 2HZNA 3U9NA 5JH6A 5B0XA 1ZY5A 5KMMA 3EJ1A 4U44A 3EFWA 2YJRA 4FC0A 4FG8A 4D9TA 4QTAA 2QOIA 1ZMVA 4E5AX 3F88A 3LAUA 3R2YA 5AP7A 2CGVA 3QTZA 4BN1A 2WMXA 4LGGA 3SA0A 3IKAA 4PY1A 5AM7A 3RK7A 2YAKA 2B9JA 2PVNA 1BUHA 2ZMDA 3FMEA 3K5UA 4ZTNA 5GJDA 1KV2A 4NSTA 3W2CA 3CXWA 3KF7A 3PP0A 4JOAA 4FUXA 3ELJA 2ZB0A 5M4FA 2YIXA 3FMJA 2GFSA 4O82A 3HMNA 2X9FA 4R77A 4FMQA 4R6VA 2OZOA 3IG7A 3P78A 3VBVA 3R2BA 3VHEA 4DEEA 2CKPA 2OJ9A 4JIKA 2WMUA 3PY1A 4Y95A 2W4KA 4ZXTA 2C0IA 4L01A 4FSWA 3Q9ZA 4IB0A 3IK3A 3V5JA 3LLTA 5A4EA 2J2IB 2W96B 5FQDC 4H3QA 1H25A 1ZYCA 3NR9A 5LMAA 1IRKA 5E4HA 4IZYA 4K18A 3PE1A 4KS8A 1AD5A 1ZMWA 3V8SA 2YIQA 3U6JA 2J4ZA 4IAKA 3SX9A 2OJIA 2IZTA 1PYEA 1Z9XA 4NM3A 3O7LD 4GW8A 4FV8A 3DPKA 4I41A 4EOJA 4HCTA 4WRGA 3TEIA 5I3RA 3ID6C 4MBIA 2C0OA 4PMPA 3ITZA 4J8MA 3VC4A 4FL1A 3W2RA 3LFCA 3R21A 3E3BX 4QYEA 3TJDA 4IAZA 2R9SA 1ZYSA 4J8NA 4I0SA 1IA8A 4RWKA 5EW8A 3KEXA 4NKAA 1QPJA 3QYZA 4EOPA 4HVSA 3ZTXA 2PE0A 2WTVA 4BTJA 4D0XA 5IA5A 2XIKA 4I1ZA 4DEIA 1BMKA 4OGRA 2EXCX 3R7GA 5AP6A 3QRJA 3UOLA 4GUBA 4UZHA 4G34A 2QOHA 4O0YA 3S00A 3CD8A 3PXZA 4U43A 5BVWA 4PPBA 5GNKA 2OZAB 2BTRA 4FSRA 2W5BA 3G0FA 4A9TA 4LYNA 5HD7A 1H24A 3C51A 3Q5ZA 4FV5A 1PHKA 3D15A 4TYHB 2YJSA 1R1WA 3ZYAA 3R28A 1F3MC 2P0CA 4I92A 4ZY6A 5C26A 5BVDA 4YZDA 4RGJA 5BVFA 1JAMA 3RBWA 4F9WA 5JQ5A 1PXOA 3QTWA 2IWIA 2ITTA 5CAQA 1UWHA 3UGCA 3VS1A 4YC3A 4ANNA 4ZJVA 2B9FA 4M13A 4EBWA 2Y6MA 2G2IA 5M06A 4F7NA 3OY1A 4USFA 4AGWA 2B9HA 3QCYA 4QYGA 3DLZA 2O2UA 3PXKA 2XNPA 3D7ZA 4BB4A 3MH3A 1ZWSA 4PF4A 2BFXA 4J96A 2WQEA 2UZLA 4WSYA 4X3FB 4ANOA 2QO9A 2WTKC 5ANGA 3FC2A 4GYIA 4BCNA 1Q8UA 2XUUA 4PDYA 1MRUA 3C5UA 4CZUA 4ERKA 2XJ1A 2PZ5A 5ITAA 4AA0A 1CKIA 3HECA 2CSNA 1H1QA 4O27B 4YP8A 2YACA 4HW7A 1LEWA 5M44A 2BAQA 3AXWA 5HE3A 4IADA 5LVLA 3CS9A 3OT3A 2JFLA 1R3CA 5HI2A 3UG2A 3QCQA 1V1KA 1QL6A 2WU7A 3C9WA 4JG8A 4PDPA 4DITA 5BYLA 4UY9A 4I4EA 4B6LA 4EOLA 1JWHA 2OU7A 3RPRA 5LQFA 1FMOE 3TI1A 5I9WA 3DKGA 4NK9A 2OW3A 1PY5A 1KOAA 3CKXA 2A4LA 4MD8E 2HCKA 3LZBA 3Q5IA 4FKWA 3KXHA 4XV9A 1WVWA 3NWWA 3ZLXA 2WNTA 3ORKA 5KMKA 1KE7A 4BICA 5IUIA 2W1DA 4WG4A 2C1AA 3BLQA 3VS4A 3VWAA 2C6MA 4FVRA 1PMVA 4HPUE 4TL0A 5DOSA 5HX8A 2PYWA 3QU0A 3COIA 3Q2MA 3R7IA 2IVUA 2VTQA 3QQHA 4N6YA 3NUXA 5CU2A 3H9RA 4XS2A 2VGOA 2R3IA 3II5A 3ZS5A 4D2TA 4MX9A 4TWNA 3QLGA 3C50A 3FKLA 2VTIA 3DQXA 4AZSA 5BMSA 2E9NA 4DGOA 4C4JA 2IVVA 2NP8A 2ZB1A 5BNJA 4IIRA 3QYWA 2QR8A 3EQIA 1NA7A 1VEBA 4BDFA 4E26A 3C4FA 1O6YA 5G6VA 4H3BA 4EQUA 2R3HA 4IAYA 5KBQA 3VUTA 5L8KA 2W5AA 4UB7A 3DZQA 4R1VA 1UU9A 2HELA 2XKFA 4MXZA 2ETKA 3OFMA 4O6EA 5FD2A 4EKLA 2XNBA 3ANQA 3Q3BA 2QLQA 3MH2A 5AP0A 4F9YA 2J0KA 3DV3A 5CU4A 4FODA 4MBJA 5J95A 4FSNA 3NLBA 4ZEGA 2PUNA 4YC8A 4TYEA 2ONLC 4FYNA 5HIBA 4K33A 4O1OA 4OW8A 2QNJA 2Y6OA 3DS6A 2C68A 3E87A 3ET7A 3P08A 3AMAA 3PE2A 2C6OA 3H0ZA 3LJ2A 2PZPA 1PMUA 1YI3A 3MPAA 4FKLA 4FX3A 4L8MA 3GU6A 4FI1A 3KXNA 2OBJA 2VWXA 4KBKA 3CQEA 3PP1A 4E1ZA 4RX5A 4Y73A 4N57A 5C4KA 5HBJA 3WZKA 4S33A 4JDHA 4DINA 2ETMA 5F9EA 2R3JA 3HEGA 3QUEA 1NXKA 4N0SA 3QD2B 3PTGA 1BX6A 4DEGA 3DA6A 2C3JA 2QQ7A 3FQHA 3PVBA 3QTSA 4OAVB 3CPBA 3MH1A 4B99A 1GAGA 3LPBA 3R7VA 3P4KA 3GC9A 2GTNA 3GXLA 4I94A 1STCE 2XVDA 4PMTA 4XBRA 5EHLA 5E8SA 4L3LA 2VTJA 2VTOA 2WQBA 2ITOA 3PJ2A 3QRTA 3RAHA 4FTOA 2G15A 2YDIA 4DH5A 3MJ1A 2BHEA 2UUEA 4WA9A 4LL5A 5I0BA 1YW2A 2WGJA 1PKGA 2FVDA 2C0TA 3F3UA 5I3OA 3OXIA 3QAME 4O7ZA 4BI1A 2ZV7A 2ONLA 3VHKA 4FK6A 4D1XA 3D0EA 2ETRA 4TRLA 3ROYA 1DI9A 5IEVA 5AV4A 4FV0A 4LGHA 4QMQA 5FM3A 4M3QA 4E20A 4CTBA 2C6LA 2ZYBA 4ZTQA 2XH5A 4IZ7A 3NUPA 4XG2A 3HAVA 2JDTA 2YM7A 2CKOA 4UZDA 3UMXA 4C8BA 1W8CA 4C59A 4DGMA 1Q8YA 3UQGA 4Z7HA 1F5QA 3SQQA 5A4QA 2RKUA 5HNGA 4L3PA 1OITA 5CAUA 3DBQA 3G15A 4LUEA 4CFWA 2PUPA 5EQEA 2XKCA 5AUZA 4MVFA 2E9OA 5M4IA 2HAKA 3PLAE 4ACHA 3IDCA 4CQGA 3P0MA 2XJ0A 5JKGA 3G33A 3HLLA 4BYIA 3Q6WA 4WNKA 4IVDA 2XK3A 3LFFA 1ZYDA 2QD9A 3B2TA 5ETFA 2XIYA 5EYKA 5B2KA 5GJFA 4Z3VA 2XNMA 5AR8A 4YJSA 3KKVA 5DYJA 4JBQA 3DTCA 4BIDA 1ZOGA 5AM6A 3QCXA 4U45A 1OIRA 2I6LA 3QGWA 1H01A 1J7UA 4YHTA 4CEGA 2R3MA 1SVGA 2WQOA 5JZNA 4FV3A 4NFMA 3NNWA 3RZFA 3NW7A 4RJ8A 4YO4A 4LOOA 2XBJA 4FL3A 2HENA 3PG1A 4X2NA 4BBEA 4YR8A 5A6OA 4IANA 2PK9A 4FT7A 4FTNA 3IW5A 1YVJA 2ITYA 1KSWA 5AAGA 1GOLA 3AD6A 5AUYA 4I4FA 4IBMA 4B4LA 1LPUA 2PE2A 3IOKA 5T68A 3R8MA 3V8TA 3SHEA 1S9IA 2VU3A 3GCSA 3IW4A 2QG7A 4FTTA 3OBGA 3FZ1A 5EI8A 2JFMA 2CPKE 5DMZA 4FZFB 3I81A 4IJ9A 1R78A 4I5CA 4NWMA 2IW9A 1XBBA 2UZTA 3TTIA 4FTMA 3ZZWA 5LVPA 2OO8X 2A0CX 5GINE 3COHA 2OF4A 2WZJA 3E8EA 4RIXA 5FXRA 3AC8A 5IQAA 5CSHA 3DGKA 3QQFA 3ZDIA 2IPXA 1M2RA 4XG3A 5EHYA 5EKOA 4HVGA 4EORA 2W9ZB 5TT7A 4ACDA 2QURA 4WBBB 5A4TA 2BMCA 3ZU7A 5AIKA 1Q41A 3S3IA 4M69B 2PMIA 2IW8A 3R7YA 3W16A 5DA3A 5EDPA 1OKZA 3I5ZA 4TYJA 4FV4A 4FV1A 3U8WA 5DFPA 1KE5A 1Q61A 4DGGA 1XH9A 4G6NA 3ZLSA 3NCGA 4CG8A 2W9FB 5CSXA 4QYFA 3PXYA 3VUHA 3ZLWA 4O81A 1PF8A 5HG7A 1Y91A 3OS3A 4AT4A 2OJGA 3AC2A 2ITWA 3LQ5A 4LI5A 4NEUA 2HZIA 2ITXA 3EFJA 2AYPA 4TXCA 1OL1A 5DRDA 4ZTSA 4QTEA 4J52A 3BCEA 2HW7A 5HE1A 1Q8ZA 3FLZA 3NZ0A 3FMHA 3OHTA 4LQMA 4OTFA 4PNIA 3FE3A 3PIXA 3GCPA 4ANLA 1HCKA 1UU3A 2PZRA 4F70A 1ZRZA 3T9TA 1BYGA 2QO7A 5AR2A 2P55A 3DAJA 3E88A 3ERKA 3EZRA 2CHLA 1A06A 4O91A 1W7HA 3H30A 4EOMA 4OBQA 3FXWA 1V0PA 4M68A 4BI0A 3IS5A 4NFNA 2OFUA 2FYSA 5H8GA 2VX0A 2BR1A 4QMPA 2PY3A 3GENA 5AV2A 2OGVA 3NUNA 1GZKA 1OL6A 4ASXA 5HEZA 4RIYB 4ZMEA 1JSUA 4L00A 4GEOA 4K8AA 4X3FC 4DH7A 4FV9A 2JAMA 3HAMA 4PV0A 3PWYA 5M55A 2JKOA 3KMMA 3QFVA 2J0JA 1FGIA 1O6KA 3DJ7A 3QA8A 4X0MA 5EI2A 3KU2A 2BIKB 3A7IA 5KBRA 2Z02A 4UEUA 5DR9A 5EI6A 4J1RA 3O71A 4FR4A 5FXQA 3UPZA 4NJ3A 3PJ3A 4U80A 4CTCA 4RRVA 4H36A 1M2QA 1CKJA 4S34A 4UYNA 3HRBA 5LXMA 3AD4A 2X39A 3Q9XA 2WEVA 1XH6A 4DA5A 1DI8A 3KC3A 3R73A 2GQSA 5C01A 3IGOA 3QTIA 3V8WA 4CSVA 3QZGA 3OWPA 4IE9A 3UNZA 3O96A 1XR1A 1ZYLA 4UN0C 4IFGA 3RVGA 4DLIA 1QPCA 3PJCA 5E8WA 4IH8A 4FE2A 5A3XA 3RKBA 2UZVA 4NW5A 4XOZA 3R6XA 1E1VA 3PJ1A 4BCKA 2J0IA 2PMNX 4EH4A 2GDOA 1M7QA 3HV6A 4A9SA 3A99A 4D2RA 3PDTA 3BHHA 4J7BA 1ATPE 4MEDA 2HK5A 4A4LA 4BI2A 4JRNA 4GH2A 3ZOSA 3HV5A 3KQ7A 1KE6A 3QRKA 5EHOA 1OGUA 1BI8A 4O7LA 2C6TA 3F2NA 4FL2A 5J1VA 4GFGA 2YERA 2IZSA 1QPDA 4Q5HA 2EUFB 4X6QC 3LMHA 4MXYA 2WMBA 1AGWA 1PXMA 3SV0A 5HBHA 1IEPA 5CS6A 3UE4A 3FHRA 3EQDA 4ZS4A 2XJ2A 3BYSA 3DAKA 3ZO2A 2W1GA 3D5UA 4O0RA 3NNVA 1OM1A 3R8VA 5CEMA 1ERKA 3EIDA 4I5HA 5E8ZA 2YLEA 2CGXA 3DNDA 4TZRA 2PUIA 3MI9A 4KSPA 3KCFA 4DC2A 3PSDA 2CLQA 3GQLA 3R7EA 4BDJA 5L8LA 1NW1A 4AF3A 4E8AA 4KKEA 3EN9A 5IPJA 1OUKA 4A9RA 3AQVA 4PPCA 3WBLA 4EK8A 2PVKA 2WMTA 3RZBA 2O63A 4C2VA 5C8KA 3OBJA 3I5NA 4KINA 5AR4A 3K2LA 3VIDA 4YJQA 3FLYA 4GK3A 5B2MA 4F6WA 4D4SA 4JR7A 5DI1A 4K6ZA 3SXFA 3UODA 2EXEA 5CT7A 5T3QA 3VRYA 4DH8A 3LKMA 2ZDTA 5KMIA 3SW4A 5IF1A 3DK6A 2E2BA 2GTMA 4FT3A 3DBCA 3WARA 5ANEA 3ZO3A 4BDGA 5M51A 4BCOA 3EOCA 1SMHA 5KMJA 4Y72A 4JBVA 2W1CA 3QUPA 4FUYA 2XBAA 4O6LA 3KXXA 3R7OA 4LOQA 4GS6A 4RVMA 3PXQA 5EFQA 4W9XA 2A1AB 3HRCA 4EH9A 2B7AA 3SRVA 5FP6A 4U9AA 3DNEA 5JQ8A 3E5AA 3R01A 1H07A 3A7FA 3GI3A 1J7IA 4ITIA 5ACKA 3EQHA 4BL1A 4AFEA 4OT6A 3FQSA 4F9AA 3DJ5A 5IH6A 3S1HA 4FZDB 2FH9A 3V3VA 3BU6A 4I23A 5CZIA 4O7YA 3VS2A 3A62A 4Y83A 2LGCA 3L9NA 5DWRA 2C3LA 2HZ4A 1JQHA 3DDQA 5ANKA 3GCUA 4X6RA 3ZRLA 4OTDA 3UP7A 4BDBA 3TNHA 4CKIA 1WAKA 2VWYA 1JPAA 3T9IA 3QD0A 2VO6A 4IX5A 3AG9A 3SOAA 3H9FA 4H1JA 1GZ8A 3ZSHA 1K9AA 3O7LB 4FKUA 4JJRA 4XEYA 1ZAOA 1IR3A 2BZIB 5HQ0A 1PXLA 5KNJA 1VYZA 2CKQA 1GY3A 3IQ7A 4I6HA 3OZ6A 5GIOE 1T45A 4BCHA 3N9XA 4YJVA 5JMSA 2GFCA 2PL0A 3M2WA 3QUDA 4BCGA 4D58A 2WMQA 5J5SA 3CD3A 5I9YA 2CMWA 4D4VA 3OD6X 4FKIA 5CZHA 4DEDA 3W8QA 4CMTA 2YHVA 5M4UA 3EN4A 2J7TA 2ERZE 2UZBA 3R1NA 2UW8A 3TKHA 5H8EA 4ANSA 2PUUA 1TKIA 2ITNA 4NM0A 2QG5A 4BBMA 3GC0A 5HU3A 4ZLOA 4Y85A 2HYYA 2QU5A 4WNOA 3ZSGA 3MDYA 4S2ZA 3F3ZA 4YZMA 3RI1A 2Q0BA 4J99A 4RX9A 3D14A 4D4YA 5HO6A 4IWPA 4FIFA 4R7IA 2E9VA 4ID7A 4M67A 5M56A 4PDOA 3ZO1A 3WZUA 4BFMA 5KKRC 1SM2A 2J0MB 4C33A 2WOTA 5AP5A 4IM3A 1OL7A 4KABA 5J9ZA 3WYYA 4RFMA 3MS9A 1DAYA 4L53A 4NIFB 3K54A 2PMLX 2V22A 4AP7A 3QD4A 3NUUA 5C9CA 2VRXA 2OXDA 4NZWB 3R8UA 1BL6A 3CE3A 1OZ1A 2F9GA 2R64A 2GNIA 2YFXA 3EYHA 4TTHB 5FUTA 4ZMFA 2XIRA 3LFEA 3UBDA 3JYAA 3BYVA 3WF7A 3A2CA 5LWNA 2J50A 4ALUA 4CFXA 3ETAA 1AQ1A 4A07A 4LG4A 5BUEA 2ACXA 3D5XA 4OTIA 1BKXA 4JBPA 2WQNA 3NUSA 2C47A 1VYWA 4GSBA 1WBSA 4TN6A 4RSSA 3RHXA 3U4WA 5LVOA 4OBPA 3VBYA 4U5JA 4NYEA 2QI8A 2ESMA 3E7VA 4FKVA 4JLCA 4S32A 4JRVA 3I7CA 3DB8A 1YDTE 1W82A 3W18A 4DFNA 2QKRA 2X2LA 1CM8A 3Q9YA 2IJMA 3G6HA 4FKOA 1Q62A 3BU5A 5CU3A 5FTQA 3SD0A 4FA2A 2VO3A 4J97A 4NH1A 4EWQA 2CCIA 3FLWA 4QTBA 4XG6A 4F4PA 5BX0A 4DBXA 4C7TA 5CANA 5HNIX 4FKSA 5FBOA 1YXVA 2NNWB 2BKKA 4IQ6A 4BGGA 2BDWA 3DT1A 2IZRA 3E63A 2C5XA 3MY0A 5M4CA 3CR0A 3ZFMA 4G31A 5IMXA 4F63A 2REIA 3DKFA 2LAVA 3V5LA 5D41A 3PIYA 2R0IA 2GS6A 2OJJA 2JKMA 3PJ8A 4U7ZA 2BZKB 4YLLA 2UVXA 5D1JA 4F1TA 5FDPA 4BF2A 5HHWA 4QP1A 3ZH8A 2C5VA 4FTJA 4PTCA 1FMKA 2RFEA 2W06A 2VWUA 3GC7A 4AQCA 2XCKA 2JAVA 4WSQA 1V0BA 1UKIA 3MFRA 3RM6A 2R7IA 4YPDA 5CXHA 2X6DA 3NAYA 4YO6A 4XBUA 4FZAB 2G9XA 2W17A 3GT8A 3MVJA 4II5A 2PE1A 4DT8A 4FG9A 3RK5A 5HLNA 2BZJA 1UVRA 2C4GA 4N6ZA 3DBDA 3VAPA 5BVNA 4BDKA 4C2WA 2C5YA 4IDTA 4V01A 4IW0A 2J5FA 4XG7A 3VBQA 3K3IA 4F1MA 2GSFA 5DR6A 5I9XA 1PMNA 1H1SA 1UWJA 3VS5A 5FTGA 5CQUA 3UDBA 4GU6A 2Z2WA 3KXMA 2WO6A 3HDNA 3REPA 4EJNA 4EONA 2R3FA 4TYGA 4R7BA 5HKMA 3TZ8A 1PMEA 3UVQA 1BL7A 5J8IA 4YJNA 3ZUUA 2AC5A 2O8YA 4AZTA 3EHAA 3UPXA 3D94A 4YU2A 1MUOA 2P4IA 4JIAA 4GL9A 4D0WA 1SYKA 2UW4A 3MFTA 4ERWA 2SRCA 4M12A 4R3RA 4EOIA 4MKCA 4ZTHA 4C4EA 4WKQA 3OUKA 5HCZA 5BMMA 2DYLA 3ZO4A 3C7QA 3KB7A 3OCTA 4E3CA 3MBLA 2VTTA 4ZLYA 5FGKA 5BUIA 4HVDA 1H26A 4YGAA 5HTBA 4AT3A 3NS9A 2ERKA 4F0IA 2XK9A 1U54B 2OWBA 3NYXA 4U42A 5L2IA 4KSQA 3TZMA 5C8MA 4YPSA 4FVPA 5KZIA 1Y6BA 2VTMA 2O0UA 2GNFA 5DBXA 4EH8A 3NRMA 1URCA 1XBAA 3H3CA 3F5UA 5HE0A 2R5TA 3D9VA 5IA2A 3UP2A 1YHVA 4JS8A 3HL7A 3BHYA 2P33A 2X4ZA 4FTUA 4JX3A 3ZC5A 4BBFA 5EYDA 4JDIA 4J98A 4L46A 4Q5EA 2JD5A 4ZSJA 4DH3A 2W05A 3IGGA 4K77A 4RC3A 1OL2A 2GMXA 2PVJA 3C4EA 3EQGA 1W83A 2X7OA 3JS2A 3FZSA 4DG0E 3U6HA 3AC1A 3VF8A 3TWJA 2OLCA 3KK8A 3TG1A 3BQCA 4QQJA 5DT4A 1PRYA 4KIKA 3V04A 2XNGA 3ZM9A 4GCJA 4EH7A 3QKMA 3OXZA 4M15A 1IA9A 4TYHA 4E5BA 2F49A 5B7VA 3LE6A 5HOAA 4RC4A 3VVHA 4AE9A 3QRUA 3O2MA 4Q9ZA 4LMNA 4R7HA 2BALA 4EOOA 4XP2A 2PMOX 3AC5A 4IAIA 4CZTA 5CALA 1PXKA 3LFAA 2Y7JA 5K0XA 4IVBA 1DM2A 4A9UA 4FT0A 4TW9A 4OTPA 4IC8A 1UU7A 4EHVA 3AC3A 2X0GA 4EHGA 4ANQA 1SVHA 1GZNA 4CZYB 3FI8A 4X3FA 3MESA 4FSZA 3HV7A 1OL5A 3BHVA 5K4JA 3WIKA 2YIWA 2YDJA 1OPJA 3DDPA 3FXXA 4HVHA 4HYSA 3VN9A 3CBLA 4PL5A 4AUAA 2YIYA 4FTKA 4GKIA 3PRIA 4JQ7A 3HKOA 5H9BA 2EU9A 4V0GA 2BRBA 5GHVA 3F5PA 3CCNA 3HVCA 5CASA 4JDKA 4HGSA 5ETAA 3QX2A 2VTPA 2GU8A 5EW3A 2GNHA 3TCPA 3UYTA 3Q2JA 3G9LX 5AJQA 3C4WA 2GCDA 5LVMA 3C4ZA 5AA9A 2YISA 3ULZA 3B2WA 1WBOA 3LCSA 3R7UA 4WG3A 3POZA 4FIHA 2R3PA 1J1CA 5EH0A 1E9HA 4F08A 5IH4A 4V05A 2QU6A 3MB6A 5J79A 1OIUA 1E1XA 1YWRA 3PSBA 4GT5A 3BBWA 4APPA 4AU8A 3IW7A 3MH0A 3NW6A 3F7ZA 4XP0A 4ZZMA 2ITUA 5JZJA 3WI6A 3R8LA 2ZV8A 4MAOA 4BCJA 4F7SA 3C0GA 5LMBA 2BCJA 4ZTLA 3FY0A 5GJGA 2UZWE 1H8FA 3L9LA 3QKKA 3FSKA 4KIPA 2WTKB 3H10A 5EM8A 4C02A 4J53A 1PXNA 3ALNA 5B2LA 4HGEA 4UMUA 2BIYA 3OROA 4CYIA 4DTBA 4DCEA 5CVFA 4Y8DA 3V6RA 4RC2A 1VZOA 3TUBA 3M11A 4HOKA 4I6QA 5H2UA 5FP5A 4H39A 5FEEA 4EC9A 3H0YA 5DR2A 1LR4A 4FTQA 5IEXA 4FKJA 3KMWA 2WELA 5IA1A 4E7WA 2JEDA 1Q8WA 3I0OA 4MXAA 3RNYA 1U59A 4JG7A 3TIYA 5BYYA 4CFFA 3BRBA 3QWJA 2NPQA 5HORA 3ORZA 4EH6A 2QC6A 5L2WA 1ZOHA 3D2IA 3EFKA 3MFSA 3MSSA 4JL9A 3L8SA 3FMMA 3OOMA 1PKDA 5LCJA 3ORTA 3C0IA 3TZ7A 3NDMA 4DFZE 3QHRA 3UIMA 5AV3A 3ZM4A 2WHBA 3MFUA 3UIUA 4PP7A 5J7HA 3IW6A 2EXMA 3BYOA 2VUWA 2XB7A 1MP8A 2Y9QA 4BHNA 2ZOQA 4QQCA 2QOCA 3ZEWA 5M57A 2Z60A 3E3PA 4UALA 4EI4A 5CEOA 2RFSA 1M14A 4W4VA 5BVEA 3RPOA 4OTWA 3DB6A 5KMOA 3TNPC 2DWBA 3A7HA 3BX5A 2I0VA 2CKEA 3FZRA 3BWFA 3ZC6A 3JVRA 1PYXA 4HJOA 3DCVA 4GK2A 5JEBA 5HO8A 3KRWA 3LQ8A 2RFNA 2ZM3A 4KBCA 4HZSA 1JOWB 1XH8A 2R3GA 3RTPA 2J51A 2UW5A 3DK7A 5EDQA 3FWQA 4F64A 3U87A 1XQZA 2WTDA 4AS0A 3DZOA 1Q3DA 1JLUE 3TL8A 3I1AA 3Q52A 4AA5A 4FTRA 4PPAA 5E8TA 3W55A 2I40A 5KKRB 1A48A 2YCSA 3FL5A 4U81A 2C5OA 5AR5A 1SNUA 1WBTA 5BQ0A 4QTCA 3ENHA 2WMWA 4O7RA 4UXLA 3RNIA 5HTIA 5AP2A 4YUQA 2X81A 3CTQA 4QMVA 5BUJA 4CMOA 4E6CA 5HU9A 4D2SA 5E90A 4W8EA 2QONA 3OY3A 4LOPA 4ACCA 4PDSA 3BEAA 3CJGA 4ZY4A 2ITPA 4MHAA 4E4NA 4AT5A 2W99B 3TUCA 2PZYA 2VAGA 2XS0A 3VJOA 3RMFA 4YSJA 4YLKA 3FPQA 3ORXA 3QZHA 4WRSA 5DEWA 4GT3A 4AG8A 1HCLA 1XH7A 2WAJA 3EQBA 3PPZA 4FICA 4FSTA 5ANOA 2G2HA 4Z9LA 5J1WA 5CTPA 4YTCA 4EUTA 4X2JA 2H96A 5F94A 4IMYA 3TIZA 3ZONA 4HVIA 5CY3A 4RVTA 3VQHA 2YM8A 4YLJA 2XF0A 3IPHA 5AV1A 4ZJJA 2BRMA 4BVUA 4FTLA 5E9EA 4JDJA 4P7EA 2W1IA 4ANMA 3VBTA 1YI6A 3PSCA 4TYIA 3WYXA 4KRCA 2ZVAA 5DNRA 3RHKA 3PA4A 2W0JA 2CGUA 4MF0A 4QMWA 4D4RA 3GOKA 1NY3A 4RMZA 4XCUA 1ZZ2A 2FA2A 5HVYA 4OAUC 3C13A 2R3QA 1OPKA 2VZ6A 4EEVA 3KN5A 5HG5A 4TWOA 2EVAA 2VWIA 4RZVA 4WO5A 4C0TA 4RQVA 3RPSA 3ZFXA 3R83A 3BBTB 4GG7A 4IVCA 1W0XC 3QLFA 3LXNA 5FWKK 4GRBA 2XZSA 1OUYA 2P3GX 3U55A 3VO3A 5HBEA 5JFWA 4JBOA 4GYGA 4C38A 4BKJA 4CMUA 4B8MA 5CAVA 5IEYA 1WZYA 2B4SB 2XNOA 3PLSA 4TWPA 5K3YA 3RAKA 2W7XA 1QPEA 3FUPA 5BYZA 1WVXA 2X2MA 3QC9A 2BHHA 4R8QA 1F0QA 4DH1A 3RPYA 2BDFA 4WT6A 4NCTC 5IA3A 4EC8A 3ACKA 2B52A 3BYUA 2WIPA 5J87A 1WMKA 4DFYA 3EWHA 5KZ0A 5TO8A 4CXAA 1YOJA 1KWPA 4QPAA 4QP9A 3WZDA 4O7SA 4EH3A 5IUGA 2B53A 1HOWA 5HGIA 3Q9WA 2BDJA 3M42A 3I6UA 4ONAA 1A9UA 4WBOA 4E73A 3RGFA 3CLYA 2IVTA 2BVAA 5JK3A 5CU0A 4G9RA 3UYSA 2AUHA 2WFYA 4FG7A 2G1TA 4FNYA 4USDA 2C5NA 3FLQA 5HESA 4IDVA 3SW7A 5AV0A 3BE9A 3Q04A 3L1SA 1WBPA 4OTQA 4F7LA 4NTSA 5KE0A 5E7RA 5LMKC 2HY81 4JAJA 3PUPA 4JVGA 5G1XA 4EZ3A 2H6DA 3RJCA 5I4NA 2XKEA 3UVRA 3TM0A 2BRGA 3FJQE 1TQIA 4B9DA 1P14A 4MD7E 3HMIA 3CY3A 1FGKA 1J1BA 4G6OA 2W1ZA 4N70A 4BIEA 5GIPE 2ZM1A 1P2AA 4R1YA 5KCVA 4QT1A 2KTYA 3PZHA 3THBA 4ARKA 4NUSA 4RLKA 3BGPA 3AT2A 2FSOX 1RQQA 3P79A 4HYIA 3FZPA 1J7LA 3ZDUA 4C35A 4BGQA 3UG1A 4RVKA 5L3AA 3DJ6A 3NUAA 4IJPA 4QPMA 4B0GA 2BAKA 1OBDA 3TV7A 1XKKA 3ODZX 2UZNA 2Y0AA 2DS1A 3F3WA 4UYAA 5AR3A 4UV0A 4C58A 4O0XA 3VS7A 4AX8A 4EZ5A 3QQJA 4YJTA 4PL4A 3CKWA 4I5MA 1ZLTA 4BCFA 2YM5A 3VF9A 2BPMA 3GU7A 1H0VA 4C37A 5HLWA 1Y57A 4ACMA 4O7NA 1V0OA 1WCCA 5ANJA 4YURA 5IDPA 3LLAA 4HGLA 4ZZNA 2OXYA 4C4GA 5IUHA 3SGCA 3CGFA 3ZSIA 3L9PA 3NW5A 4G3EA 3OXTA 2OJFE 2UZEA 4BZDA 4L52A 2JLDA 3P7BA 4JR3A 1VJYA 1LEZA 2YWPA 3COKA 3OCSA 3EN6A 4A4XA 4DFLA 3COMA 3KFAA 2PULA 1JKTA 5GZ8A 3TNWA 3M1SA 3RPVA 2Y4IB 3A8XA 3NVMB 4F9BA 3ORMA 4K11A 3BE2A 1KV1A 3AT3A 2OKRA 3KVWA 3BYMA 2YDKA 2PU8A 4QMTA 4GIHA 4QP7A 3HV3A 3ANRA 3BIZA 4QYYA 4EQMA 4C3FA 4ZSAA 4XH6A 3PPJA 2BUJA 3PXRA 3EL8A 2XRWA 4AA4A 1R0EA 4NKSA 3U51A 4TY1A 3ZCLA 5K0KA 5DT0A 3AT4A 3HMPA 4PRJA 4QOXA 3C1XA 2GNJA 2PVHA 1XH5A 5KX8A 3R71A 2QCSA 5JSMA 2CNVA 2H9VA 4G5PA 4KRDA 4KAOA 4RFZA 5CENA 5TF9A 1Z5MA 3LFBA 2XMYA 3LCOA 4ANBA 1FVTA 1YXTA 5H3QA 2CNUA 4FSQA 3C4CA 3E8CA 4E4XA 5KHWA 2HWPA 3PA3A 2W1EA 4U97A 5DT3A 4KUJA 3UOKA 4NW6A 4RIYA 3UJGA 4ALVA 3CGOA 5IG1A 3WF8A 4HGTA 5DLSA 2Z7QA 4AZFA 5E1SA 3UIXA 1CDKA 3EQRA 3PPKA 4AWIA 3ODYX 5CSPA 3MPMA 1Y6AA 4MNEA 2X7GA 4MK0A 4NJDA 4FKQA 1NVQA 3Q4UA 3O50A 4C34A 4UMRA 3I4BA 3P7CA 3IECA 3DOGA 1KOBA 1YXSA 4JT3A 5ANIA 4EOSA 5EOBA 3FI3A 1QCFA 2X2KA 3UIBA 4RWJA 4CFMA 4EHEA 3U6IA 2W1FA 3UC3A 4UMTA 1MQ4A 1WVYA 1TQMA 4YC6A 5A46A 4LUDA 4FIIA 2GHLA 5DEYA 3V5PA 5EKNA 2YCRA 2ITZA 2PVRA 3IONA 3FMNA 4FV2A 5D7AA 2J5EA 5DVRA 3QX4A 3V5TA 4S31A 2R7BA 4PUZA 2W4JA 4Z7GA 3WF6A 2EWAA 3W8LA 4BZOA 3TJCA 2YWVA 3OTUA 3O8TA 3Q6UA
chains in the Genus database with same CATH superfamily
3SAYA 5GZAA 1CKPA 3MY1A 3BZ3A 4WHZA 4AOTA 3F9NA 4RJ5A 4QP2A 5C8NA 2JDVA 2FO0A 3EN5A 4XX9A 4ZJIA 4YMJA 5K5NA 2NYAA 4FT5A 5FEQA 4RX7A 2GNGA 3PG3A 3NPCA 3UO5A 5L2QA 3TV6A 4DEAA 4FTAA 4L43A 3ZLYA 1Q8TA 3EKKA 5CSVA 3QD3A 1RDQE 3G51A 4RG0A 5EM5A 1ZXEA 3E8NA 2UW6A 5EQPA 4AZEA 4MTAA 2VWZA 4O4CA 3U9CA 5HTCA 3GEQA 3Q4CA 4NM7A 5BVKA 5C27A 1ZMUA 2IN6A 1U4DA 3VS0A 2WKMA 3FKNA 4GFMA 4FOBA 4C57A 3WIGA 1IAJA 3TXOA 5IKWA 5KMNA 3CTHA 4QNYA 1I09A 3O0GA 5JRSA 3VS3A 3FSFA 5CEQA 4BKYA 3I0QA 4PMSA 4HNFA 4QD6A 5ETIA 2PPQA 2IEWA 4EK3A 4U3YA 5CT0A 1KE9A 2V62A 3HX4A 1TVOA 4RJ4A 4NM5A 4O4DA 1H1RA 2VX1A 4V0GB 4ZY5A 3UZRA 4EK4A 3W0QA 2HY0A 3JPVA 3D83A 1EH4A 2G2FA 4QP4A 4C3PA 3UTOA 4EH2A 5A4LA 2B0QA 3QALE 4XNEA 4DTAA 3R0TA 5TOZA 3OWLA 3MJ2A 3HA6A 2GNLA 1RJBA 2R0UA 3KMUA 3OEFX 4L9IA 5AP1A 1G5SA 1FVVA 1Q5KA 3R1SA 3VUIA 1APME 2JIIA 3KF4A 3PXFA 4F99A 1OPLA 4G3CA 4AOIA 3LFNA 3NYOA 3UMWA 4DHFA 3E92A 3NYNA 3FZTA 4HYUA 4O96A 4ZOGA 2A19B 3D7TA 3NGAA 3UZTA 2PSQA 4FEQA 5K5XA 3QTUA 5GZ9A 1OB3A 4ZAUA 3G5DA 4DYMA 1ZARA 1W98A 2XM9A 4R5YA 4RBLA 5HVKA 4CCBA 2OH4A 3FYKX 2XEZA 1XWSA 3LCDA 4UWBA 4ASDA 2XA4A 4QRCA 4OUCA 5IISA 5J9LA 3GCVA 3QGYA 4IAAA 1YDRE 4CFVA 1U46A 4K9YA 5BPYA 1R39A 4C4IA 5HNBA 4F7JA 4QMMA 3HUCA 2F7EE 4GG5A 4MH7A 3T8OA 4CT2A 3AD5A 4G3DA 2BROA 3O8UA 5FDXA 3W10A 3Q96A 5E92A 1YOLA 3ACJA 5DE2A 4ZIMA 4BWPA 3ATSA 4HZRA 4QMOA 4IX4A 3TDVA 3L8XA 5E8VA 4A7CA 5AEPA 3JXWA 5CF4A 5JFVA 4YTFA 4YJOA 2UW3A 2PHKA 4JQ8A 4QTDA 4F0FA 3K5VA 2XM8A 3NEWA 4HNIA 4ZSGA 5F95A 3UQFA 2JDSA 4I22A 3QCSA 2EB3A 4MXCA 2JDOA 2GS2A 4IZ5A 5EOLA 3NVKI 3KK9A 2VV9A 4IB1A 4IWDA 4KKHA 4V04A 4CLJA 4H05A 1Y8YA 1ZOEA 4XRJA 2C1BA 1FOTA 5D11A 4I6LA 2C30A 2OIBA 4ZP5A 2UW0A 3TV4A 3WZEA 2XKDA 2Y4PA 4HCUA 2WMRA 4TWCA 4WNMA 3GVUA 3ZRKA 4MNEB 2GQGA 3F66A 5JGDA 5D9HA 4FKPA 1OKWA 4BDCA 4ZS0A 1M7NA 3HP5A 2XIXA 2UZOA 3TT0A 1W2FA 3DU8A 5ICPA 4YJRA 5IQFA 3OW3A 3FV8A 2XNEA 2BFYA 2Z8CA 3I60A 4ZK5A 1H28A 4IWOA 3DQWA 3KRLA 2GHGA 1GIJA 3EQPA 3O51A 3RALA 1DAWA 4L7FA 4F9CA 1G8AA 1YHSA 2YIRA 1NVRA 3HMMA 4I21A 5F4NA 2GQRA 3CQWA 3ORNA 4QYHA 4CV9A 5T6KA 1FINA 4LRJA 3V5WA 5I5ZA 4BR3A 2XK4A 1OMWA 4CYJA 3LIJA 3W2SA 4GV1A 3DKOA 2O5KA 4FEUA 5L6PA 2JGZA 4G9CA 5CWZA 4KA3A 4AXAA 3AKJA 3NSZA 1U5QA 3ZXZA 5JGAA 2OZAA 3F61A 4F6UA 4K0YA 2O3PA 2UV2A 4I3ZA 4AACA 4EH5A 4BCMA 1IASA 4MWHA 1H0WA 4D5HA 3VS6A 4QNAA 2B9IA 3VUGA 4BHZA 3W0OA 3LOKA 4FF8A 3DXQA 3KREA 3MPTA 3BI6A 2BILB 3KRJA 4I24A 2FGIA 3WF5A 3BGQA 3A4PA 3NUYA 1REJA 2PWLA 4FTCA 3SOCA 1K2PA 4AW5A 3MA3A 4NT4A 3IO7A 4L42A 4XV3A 4YZBA 3R9OA 4O0SA 3GFEA 3GUBA 4IACA 3CQUA 5EDRA 1FBNA 2CNQA 5CVGA 3MYGA 5EYMA 3R63A 2ITVA 4YHJA 5AP3A 4CD0A 4D1SA 1OVEA 4FKGA 4KIOA 5AX3A 2OSCA 4X2KA 1H4LA 5TKDA 3QQKA 1FQ1B 4U6RA 3P7AA 3ZEPA 5CF8A 5KUPA 4BCIA 4F6SA 4JQEA 4CFNA 2R3KA 4OBOA 1MQBA 5LCKA 4CLIA 2A2AA 5I9VA 4I0RA 3DKCA 4IC7A 4AE6A 3LQ3A 4E6QA 2YEXA 4AN9A 2FUMA 3LFSA 2XNNA 4GUEA 3QZFA 5LJJA 1P4OA 3N51A 2HXQA 2C6IA 5J7BA 5AX9A 1NT2A 5CEKA 3DTWA 4M97A 5TE0A 4J71A 1LP4A 4DBNA 4E4LA 4NCTA 4P4CA 5KHXA 3BGZA 3SKCA 4RVLA 2QKWB 3VQUA 4CNHA 4CKJA 5CNOA 3TZ9A 3FKOA 2JIUA 2WTIA 1SVEA 3KXZA 2C3KA 5HO7A 4DTKA 4GIIA 5A4CA 5E8YA 5IQDA 5JFSA 4FT9A 4ZSEA 2XALA 1U54A 1YXUA 2FSLX 3D7TB 3GB2A 1UU8A 1PJKA 3ZZEA 3QTQA 2YZLA 2WD1A 4OLIA 1O6LA 3E93A 5EK7A 5M07A 4BY9E 3EB0A 2PVFA 4ALWA 5CAPA 1Z57A 3PUFC 3B8RA 4DG3E 2R4BA 3QZIA 2Y8OA 2FSMX 4PMMA 4WIHA 5BVOA 3VBXA 4MCVA 4ITHA 3PVGA 4QMYA 5AAFA 1BI7A 4X2GA 2HZ0A 5D12A 4O0TA 1Q24A 4B8LA 3V51A 3WE4A 5ETCA 2XK8A 4BDDA 3A7JA 4XG8A 4Y5QA 5LWMA 4K1BA 2YM6A 1Q97A 2YCFA 5L4QA 2PVMA 2B1PA 2HXLA 3RCDA 5AUTA 1H1PA 4BTFA 3OT8A 4RA5A 2UVZA 5HG9A 3MA6A 4KIKB 5CU6A 2WU6A 4TPTA 1YQJA 4D5KA 4DN5A 4M7IA 3R9NA 2QOQA 2X0QA 3CSVA 4B7TA 2Y4IC 3ORIA 4O2ZA 5IZFA 4CRSA 2B54A 4JI9A 1YHWA 3AGLA 2OH0E 3VUMA 2XEYA 5DHJA 5IQEA 2OI4X 1TZDA 2VTLA 5E8UA 4DAWA 4OTHA 4AGDA 2YITA 1Q99A 2X8IA 3C5IA 3HZTA 4BDAA 1JVPP 4OTRA 4BDEA 3GU8A 1GIIA 5EYCA 5LMKA 1YI4A 3R8PA 2Z7LA 3BEGA 3GBZA 2VD5A 2ZV9A 3QTXA 4PQNA 4XJ0A 3FZOA 3GNIB 3KA0A 3W2PA 3ZBXA 5EG3A 4EUUA 1PXIA 3EN7A 1WBNA 2CDZA 4F1OA 3GC8A 3O17A 2NRUA 3R1QA 3LFDA 4FIGA 3VW8A 3FXZA 2QOFA 2WMVA 4EWHA 4FNZA 4I5PA 5IQBA 3KN6A 3GCQA 3G0EA 1JSVA 4FOCA 5AUWA 4DFXE 3MWUA 1YWVA 4KIQA 4YNOA 5AWMA 3N4VA 4R78A 4RJ6A 3WE8A 1GIHA 3QWKA 2C3IB 3E64A 3RM7A 3ZUTA 3NNXA 4GMYA 4A9YA 5H8BA 5IQGA 1OECA 3OVVA 4QP3A 3OF0A 5E8XA 3RCJA 5CAOA 4QMXA 3OMVA 1OIYA 5CI7A 4EBVA 3GQIA 4USEA 2V7AA 3CY2A 1PXJA 4BCQA 5IQHA 5EQYA 3RAIA 2YABA 1OIQA 4YZ9A 4EJ7A 1X8BA 2BZHB 3BWJA 3ZUVA 2QODA 3OW4A 4TNDA 3FLNC 3ALOA 5HD4A 3OUNB 2NO3A 4A4OA 3QQLA 4IHPA 5TR6A 4TKSA 3RWPA 4EKKA 4ZTRA 2YM4A 3UZPA 2A27A 4DF3A 3R22A 4CKRA 2BKZA 5EM7A 4F65A 4MQ1A 3HUBA 3R8ZA 4O0VA 5FG8A 3OG7A 3TUDA 4BTKA 4O0WA 2X4FA 3LM5A 2BTSA 2FSTX 2JBPA 4A06A 2XAOA 2X8EA 3LXPA 4BC6A 1BLXA 4APCA 1RW8A 4L7SA 4MXXA 3VJNA 2WMAA 4X21A 5CXZA 2ITQA 3HV4A 2UW9A 3BU3A 4O2PA 3PFQA 4OTGA 2W5HA 2J90A 3MN3A 3W2QA 4Z16A 5DG5A 4RZWA 3CC6A 4FGRA 4QMNA 1KE8A 5J9YA 5LVNA 3TTJA 4GVJA 4L6QA 2I0EA 2YLFA 3ATTA 3FC1X 4UXQA 5HZNA 3NYVA 4MNFA 3VULA 1M17A 4QMLA 1ND4A 4H1MA 2WXVA 4IM0A 1KUTA 3EFLA 5FBNC 3KCKA 4M84A 3FBVA 5IU2A 2BRNA 4DEHA 4E4MA 5AP4A 5LOHA 2FB8A 4RIOA 4D9UA 1CSNA 3S0OA 1OKVA 3D4QA 3LFQA 3R00A 2EB2A 3KL8A 3HDMA 4N4SA 5HICA 3ZFYA 4AW1A 3UC4A 4AZVA 5L6WL 2Z7RA 2GHMA 1YRPA 1ZYJA 4U79A 4KBAA 4GVAA 3BLRA 3SG8A 3D5WA 1XHAA 2VTHA 2ZJWA 4KNBA 3R9RA 4DGLC 3PIZA 4YTIA 4ENYA 4AGCA 4LRKA 2PTKA 3BPRA 2VTNA 1O9UA 3UQCA 5C4LA 3UNKA 3DBFA 3FYJX 2RIOA 5FTOA 4CFUA 5K4IA 4EOKA 2KULA 1YOMA 2XRUA 3FLSA 3WZJA 5L6OA 3F3VA 5FXSA 4AGUA 3RWQA 3MB7A 4EZ7A 2C6KA 3HYHA 4G6LA 4QMUA 2ZAZA 4D2VA 3CJFA 4WG5A 3QA0A 2QVSE 4MQ2A 5IDNA 1PW2A 1OI9A 1J91A 3B8QA 3QC4A 4G3FA 3F69A 3F6XA 4M69A 2DUVA 4RWIA 3S95A 4ZLZA 4ORKA 4EHZA 4BJJA 2WIHA 1JKKA 3CEKA 3W32A 4AFJA 3FAAA 3SXRA 1IAHA 3BLHA 4FYOA 2IW6A 2XCHA 2OK1A 2RFDA 3QBNA 5F20A 5AAEA 4AW2A 5HCXA 3A8WA 1CMKE 3F5XA 4PTGA 3ENMA 2VWWA 4FGBA 4O22A 3NMUF 5I9UA 2UZDA 4O84A 2VTSA 2G01A 2ZMCA 4L68A 5FM2A 2XK6A 4FZ7A 5DH3A 3JR1A 3A4OX 3FHIA 4KKGA 3QKLA 4O7WA 5ANDA 3FQEA 4O7VA 2QR7A 3QQUA 3D2KA 4FNXA 3PY3A 3V6SA 2QLUA 3TNQB 3FEGA 4BIBA 2OIQA 3O8PA 4FV6A 1G8KA 4X7QA 4J95A 4C4HA 3EZVA 2OF2A 3JY9A 4FRFA 2V55A 4FVQA 1FPUA 4DLJA 3EQFA 4MBLA 1U5RA 3MVMA 1NVSA 2E9UA 4XV1A 2XAMA 2AC3A 3I6WA 4XP3A 3AGMA 5JFXA 2X8DA 4RIXB 2UVYA 3KVXA 2BAJA 3AMYA 4M0ZA 4DCAA 3TN8A 1GZOA 3NAXA 3NNUA 3BV3A 4EYJA 5HE2A 5FEDA 2I0YA 3HNGA 3IDBA 3PZEA 2WMSA 2V7OA 4IB5A 4X3JA 5CEPA 4LM5A 3SLSA 3F7WA 1ZZLA 4C61A 1UV5A 4W9WA 4GT4A 2J6MA 2QOKA 5AADA 4NTTA 3DY7A 2OICA 4LV8A 3SDJA 2X9EA 3CTJA 4DE4A 3KULB 3OWJA 4ASZA 4AAYA 3FPMA 2ZM4A 3R30A 3CPCA 3QTRA 4C36A 4JXFA 1OBGA 3RP9A 4FK3A 1W84A 4QQ5A 4L3JA 1G3NA 5E1EA 3G2FA 1GNGA 2F2UA 2O65A 5F1ZA 3HGKA 3OTVA 4TNBA 3L8PA 3EL7A 4PX6A 3IDPA 4O86A 4GJ2A 3E62A 4BGHA 4DEBA 2XYUA 4FKTA 4RJ7A 3DK3A 1XJDA 4IX6A 4RJ3A 1B39A 1SZMA 4UMQA 4CGAA 3C0HA 1I44A 2WEIA 4FV7A 4WOVA 4O21A 4ZZOA 4CG9A 3UO6A 1PXPA 3WF9A 2X6EA 3S2PA 3CP9A 2JKQA 1JNKA 4XG4A 4CRLA 3FDNA 2I1MA 3ZHPC 2VWBA 3BKBA 2VTAA 5HIEA 4BCPA 5AUUA 3ORLA 3KRXA 4CT1A 4DFUA 1MRVA 2OG8A 4XYFA 1JKLA 3CIKA 3VRZA 4ACGA 4P5QA 3GU5A 4CV8A 5K9IA 4PTEA 4IWQA 2IO6A 3OWKA 3MIAA 2WTWA 5DRBA 3L9MA 5CYIA 4FSUA 4ITJA 2BRHA 3P9JA 3EKNA 4QP6A 2I7QA 3VUDA 1JSTA 2R2PA 4CVAA 5ACBC 5CI6A 3FMLA 1WBWA 3EMGA 4E6AA 4UX9A 4IXPA 3F2AA 4FKRA 1H08A 4U8ZA 4XLVA 3RINA 4EK6A 4JG6A 2R3LA 4R3PA 3DBEA 4G2FA 4AOJA 3OCBA 4DG2E 2CN5A 2VN9A 1RE8A 4I6BA 4QP8A 3ULIA 4FSMA 3FMDA 3MTLA 4RFYA 5IA0A 5A14A 3DFAA 4IAFA 2O64A 4G17A 4G3GA 2X7FA 3A61A 4O4EA 4C62A 1UNHA 3VNTA 4RWLA 3AOXA 2CN8A 4YNEA 1XH4A 4MXOA 1XBCA 4LL0A 4E6DA 4H3PA 2GPHA 4QQTA 3FI4A 4G1WA 4U0IA 3RAWA 2JBOA 3KRRA 4XRLA 3V01A 3ZBFA 3MW1A 3LHJA 3LCKA 1DS5A 3SVVA 2P2HA 5D10A 4NL0A 2H8HA 4W8DA 4C3RA 2JIVA 5AUVA 2IVSA 1JKSA 1H27A 2OIDA 2Q0NA 2RSVA 3Q60A 2VX3A 4H58A 3IOPA 4MD9E 5HG8A 4DHJA 3R04A 3LMGA 5CQWA 5A54A 3BHTA 4P5ZA 3BV2A 1SNXA 4D28A 2AEGA 3SG9A 4MYGA 2R3RA 3TDWA 3DXNA 3BELA 1MRYA 2RF9A 2WOUA 3MVHA 4CQEA 3PA5A 2WQMA 4FEWA 3V5QA 4Q9SA 3QXOA 2F57A 2J0LA 5CVHA 3Q32A 4W4WA 1OKYA 4LFIA 4XG9A 4XLIA 3WILA 2CCHA 4BKZA 4DT9A 2P2IA 2V5QA 1M52A 4BZNA 3FI2A 2AQXA 3LCTA 1K3AA 4UBAA 4F0GA 5C1QB 3OC1A 2RG6A 5HIDA 5L8JA 1JBPE 3EH9A 2X1NA 3PRFA 4RT7A 1FVRA 3NIEA 3G90X 2F4JA 3G6GA 3A60A 3FMKA 4YHFA 1Q3WA 3HP2A 4QMZA 3HRFA 4JNWA 3POOA 2IG7A 4O7TA 3GFWA 3SC1A 1W2DA 4S30A 1L8TA 4YBKA 4RIWB 5C03A 4O0UA 3L8VA 3LJ1A 3F3TA 3ORPA 1J3HA 1URWA 4GJ3A 3MV5A 4HPTE 5DGZA 4L44A 3LW0A 1S9JA 4L45A 3TACA 3LXLA 1P5EA 2HOGA 1WFCA 4UMPA 4XV2A 5I9ZA 5CEIA 4QPSA 4QMSA 3MGYA 1VR2A 4I93A 1XO2B 3WOWA 5E91A 2VTRA 4IB3A 4BDHA 4TT7A 3R1YA 2YAAA 2C6DA 4AW0A 4O83A 5DIAA 1B38A 4ENXA 5AFVA 2C6EA 3PWDA 3SRVB 4BDIA 1B6CB 5IA4A 3AC4A 3QQGA 2W4OA 5AUXA 4X2FA 5IMEA 4WUAA 4PNKA 4PL3A 2RG5A 4LGDA 3KULA 5AMNA 4C4FA 2Q83A 4FNWA 4R5SA 1M2PA 5IQCA 3C4XA 4U40A 4KS7A 4PP9A 2Z7SA 3QHWA 3LM0A 2R3OA 4EQCA 1R0PA 3O23A 3H4JA 1ST4A 4E5WA 1P4FA 1LUFA 5M08A 2QOLA 2W1HA 2JC6A 4DFBA 2HIWA 4P90A 4FIJA 3LXKA 3GGFA 3PY0A 4YBJA 4BWXA 3BHUA 3PYYA 4D2PA 2XIZA 4IFCA 3T3UA 3NCZA 1YWNA 4NIFA 5CSWA 2RGPA 4I6FA 3LJ0A 5EM6A 4Z55A 1Q4LA 4XHKB 2XYNA 4M66A 4WUNA 5CLPA 4BTMA 2ZDUA 5M09A 3OEZA 4O4FA 2PZIA 3OCGA 5BV3A 2V0DA 3VBWA 3VUKA 2YCQA 4DGNA 5A6NA 4K2RA 5JT2A 3D5VA 4ZTMA 3R02A 4KB8A 4M0YA 4AN2A 4RLLA 2QOOA 5CNNA 3W2OA 1YXXA 2NRYA 4FJVA 4XOYA 5HVJA 5JN2A 3BQRA 2R3NA 4YZCA 3NX8A 5CX9A 1G8SA 3E8DA 4ASEA 3G9NA 5FRIA 5J5TA 3R9DA 4FBXA 4L67A 4OT5A 3Q4TA 4YJPA 3E7OA 4IX3A 5FLFA 4KWPA 3ZXTA 3S4QA 4M14A 1H00A 4MWIA 4HCVA 2JITA 2QHMA 4M8TA 4IM2A 4R3CA 3JVSA 4D2WA 3DFCB 4U3ZA 1CTPE 3BLAA 3GP0A 3N4TA 3DXPA 3GOPA 4G5JA 4GFOA 2VGPA 4AN3A 4FEXA 2F2CB 4HYHA 4UWYA 3KGAA 1TFFA 3T3VA 4RA4A 3QRIA 3K3JA 4IZAA 4JAIA 4YSMA 5DPVA 2UW7A 3F5GA 3Q53A 4FZ6A 3RK9A 5LARA 1WBVA 3F2RA 5DN3A 3UVPA 5AIRA 4FTIA 2QHNA 3EYGA 3NFFB 3F82A 2XP2A 4LMUA 5JRQA 2WPAA 4QDVA 3R9HA 2XK7A 4P2KA 2YN8A 4LV5A 4I0TA 4OR5A 1UNGA 5A9UA 3N4UA 3ROCA 2CLXA 2UZUE 4GU9A 4ZSLA 3HA8A 2CGWA 4MF1A 5HLPA 3UNJA 3LMIA 4DHIB 3W33A 3U54A 1UKHA 3NIZA 1GJOA 4IVAA 2OFVA 5AR7A 2B55A 2YA9A 3PVUA 1L3RE 3MIYA 4W4XA 1QMZA 3QXPA 5L2SA 5IQIA 3SXSA 4PWNA 3GU4A 3ZRMA 2OXXA 4BYJA 3FL4A 4EOQA 4YTHA 3EQCA 3W1FA 4QDEA 1TQPA 3I7BA 3OOGA 3MY5A 2WTJA 3QL8A 2WB8A 4W4YA 1REKA 4AZWA 3HMOA 4G16A 2JKKA 3O5AA 3MTFA 3P1AA 2J9MA 5CF6A 3MVLA 3TMOA 2WTCA 2VO7A 5AA8A 2F7ZE 2IZUA 2PVLA 3TKUA 5CF5A 5M53A 3QF9A 2QOBA 2DQ7X 4O1PA 4NU1A 3OP5A 3PVWA 1T46A 3DLSA 3TKIA 4RX8A 4D1ZA 2HWOA 2QO2A 3UOHA 2YM3A 4EYMA 4BWKA 3I79A 1YDSE 2VO0A 4JX7A 3P23A 5D7VA 4U41A 2CJMA 4LRMA 1ZY4A 4CCUA 4GK4A 4EL9A 4D55A 2PVYA 4RQKA 3U4UA 5L2TA 1H1WA 2HW6A 3AMBA 2I0HA 3JUHA 4UWCA 3UO4A 4QO9A 2C69A 4E93A 4YJUA 4FSYA 3KXGA 5HX6A 5IH5A 4IEBA 4RIWA 2RL5A 4EK5A 3FY2A 4Y46A 2H34A 3KY2A 3VW6A 1IG1A 4BRXA 3LVPA 4F09A 3H9OA 2VWVA 4WD5A 5KO1A 5HCYA 4FIEA 2E9PA 4Y5HA 4O38A 2F7XE 4YZNA 4GKHA 4FEVA 5EW9A 5JGBA 1YKRA 2VNYA 3A7GA 3Q4ZA 4Q2AA 4KD1A 3IW8A 2YZAA 4RPVA 4XUFA 3ZMMA 4WNPA 4XMOA 2VNWA 2ZV2A 1UNLA 5KMLA 3P5KA 3P86A 2JDRA 4I20A 3TNIA 3UOJA 2GS7A 4AAAA 3DAEA 1UA2A 1Y8GA 3JY0A 2HZNA 3U9NA 4AXDA 5JH6A 5B0XA 1ZY5A 5KMMA 3EJ1A 4U44A 3EFWA 2YJRA 4FC0A 4FG8A 4D9TA 4QTAA 2QOIA 1ZMVA 4E5AX 3F88A 3LAUA 3R2YA 5AP7A 2CGVA 3QTZA 4BN1A 2WMXA 4LGGA 3SA0A 3IKAA 4PY1A 5AM7A 3RK7A 2YAKA 2B9JA 2PVNA 1BUHA 2ZMDA 3FMEA 3K5UA 4ZTNA 5GJDA 1KV2A 4NSTA 3W2CA 3CXWA 3KF7A 3PP0A 4JOAA 4FUXA 3ELJA 2ZB0A 5M4FA 2YIXA 3FMJA 2GFSA 4O82A 3HMNA 2X9FA 4R77A 4FMQA 4R6VA 2OZOA 3IG7A 3P78A 3VBVA 3R2BA 3VHEA 4DEEA 2CKPA 2OJ9A 4JIKA 2WMUA 3PY1A 4Y95A 2W4KA 4ZXTA 2C0IA 4L01A 4FSWA 3Q9ZA 4IB0A 3IK3A 3V5JA 3LLTA 5A4EA 2J2IB 2W96B 5FQDC 4H3QA 1H25A 1ZYCA 3NR9A 5LMAA 1IRKA 5E4HA 4IZYA 4K18A 3PE1A 4KS8A 1AD5A 1ZMWA 4AQKA 3V8SA 2YIQA 3U6JA 2J4ZA 4IAKA 3SX9A 2OJIA 2IZTA 1PYEA 1Z9XA 4NM3A 3O7LD 4GW8A 4FV8A 3DPKA 4I41A 4EOJA 4HCTA 4WRGA 3TEIA 5I3RA 3ID6C 4MBIA 2C0OA 4PMPA 3ITZA 4J8MA 3VC4A 4FL1A 3W2RA 3LFCA 3R21A 3E3BX 4QYEA 3TJDA 4IAZA 2R9SA 1ZYSA 4J8NA 4I0SA 1IA8A 4RWKA 5EW8A 3KEXA 4NKAA 1QPJA 3QYZA 4EOPA 4HVSA 3ZTXA 2PE0A 2WTVA 4BTJA 4D0XA 5IA5A 2XIKA 4I1ZA 4DEIA 1BMKA 4OGRA 2EXCX 3R7GA 5AP6A 3QRJA 3UOLA 4GUBA 4UZHA 4G34A 2QOHA 4O0YA 3S00A 3CD8A 3PXZA 4U43A 5BVWA 4PPBA 5GNKA 2OZAB 2BTRA 4FSRA 2W5BA 3G0FA 4A9TA 4LYNA 5HD7A 1H24A 3C51A 3Q5ZA 4FV5A 1PHKA 3D15A 4TYHB 4DHZA 2YJSA 1R1WA 3ZYAA 3R28A 1F3MC 2P0CA 4I92A 4ZY6A 5C26A 5BVDA 4YZDA 4RGJA 5BVFA 1JAMA 3RBWA 4F9WA 5JQ5A 1PXOA 3KIOC 3QTWA 2IWIA 2ITTA 5CAQA 1UWHA 3UGCA 3VS1A 4YC3A 4ANNA 4ZJVA 2B9FA 4M13A 4EBWA 2Y6MA 2G2IA 5M06A 4F7NA 3OY1A 4USFA 4AGWA 2B9HA 3QCYA 1OGYA 4QYGA 3DLZA 2O2UA 3PXKA 2XNPA 3D7ZA 4BB4A 3MH3A 1ZWSA 4PF4A 2BFXA 4J96A 2WQEA 2UZLA 4WSYA 4X3FB 4ANOA 2QO9A 2WTKC 5ANGA 3FC2A 4GYIA 4BCNA 1Q8UA 2XUUA 4PDYA 1MRUA 3C5UA 3BL9A 4CZUA 4ERKA 2XJ1A 2PZ5A 4AXCA 5ITAA 4AA0A 1CKIA 3HECA 2CSNA 1H1QA 4O27B 4YP8A 2YACA 4HW7A 1LEWA 5M44A 2BAQA 3AXWA 5HE3A 1G8JA 4IADA 5LVLA 3CS9A 3OT3A 2JFLA 1R3CA 5HI2A 3UG2A 3QCQA 1V1KA 1QL6A 2WU7A 3C9WA 4JG8A 4PDPA 4DITA 5BYLA 4UY9A 4I4EA 4B6LA 4EOLA 1JWHA 2OU7A 3RPRA 5LQFA 1FMOE 3TI1A 5I9WA 3DKGA 4NK9A 2OW3A 1PY5A 1KOAA 3CKXA 2A4LA 4MD8E 2HCKA 3LZBA 3Q5IA 4FKWA 3KXHA 4XV9A 1WVWA 3NWWA 3ZLXA 2WNTA 3ORKA 5KMKA 1KE7A 4BICA 5IUIA 2W1DA 4WG4A 2C1AA 3BLQA 3VS4A 3VWAA 4F78A 2C6MA 4FVRA 1PMVA 4HPUE 4TL0A 5DOSA 5HX8A 2PYWA 1W2CA 3QU0A 3COIA 3Q2MA 3R7IA 2IVUA 2VTQA 3QQHA 4N6YA 3NUXA 5CU2A 3H9RA 4XS2A 2VGOA 2R3IA 3II5A 3ZS5A 4D2TA 4MX9A 4TWNA 3QLGA 3C50A 3FKLA 2VTIA 3DQXA 4AZSA 5BMSA 2E9NA 4DGOA 4C4JA 2IVVA 2NP8A 2ZB1A 5BNJA 4IIRA 3QYWA 2QR8A 3EQIA 1NA7A 1VEBA 4BDFA 4E26A 3C4FA 1O6YA 5G6VA 4H3BA 4EQUA 2R3HA 4IAYA 5KBQA 3VUTA 5L8KA 2W5AA 4UB7A 3DZQA 4R1VA 1UU9A 2HELA 2XKFA 4MXZA 2ETKA 3OFMA 4O6EA 5FD2A 4EKLA 2XNBA 3ANQA 3Q3BA 2QLQA 3MH2A 5AP0A 4F9YA 2J0K