5EH0A

Rapid discovery of pyrido[3,4-d]pyrimidine inhibitors of monopolar spindle kinase 1 (mps1) using a structure-based hydridization approach
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
279
structure length
258
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDGTVNYMPPEAIKDMKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Dual specificity protein kinase TTK
publication title Rapid Discovery of Pyrido[3,4-d]pyrimidine Inhibitors of Monopolar Spindle Kinase 1 (MPS1) Using a Structure-Based Hybridization Approach.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 258
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5eh0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5eh0A01
4XP0A 2CHLA 2VO3A 4KIPA 3D5WA 5IQDA 4HCTA 1KWPA 3BHVA 3BV2A 3FPQA 4YLKA 4IAIA 4YJVA 2FO0A 3RPYA 2YHVA 4YZBA 3RPOA 1OMWA 3JY0A 3PDTA 3UZTA 2PVHA 2G01A 4CRSA 4AXAA 3T3VA 1OKWA 2ZOQA 2R2PA 3FJQE 3NR9A 5DWRA 3FC1X 4QP4A 4HVHA 4BTFA 5F4NA 4K8AA 5DOSA 4D5HA 1JWHA 2V22A 2Z7RA 3LZBA 4N6YA 4DN5A 1Q8YA 4KRDA 3F66A 3MFRA 4RPVA 1Q24A 3BI6A 4TNDA 1ZMWA 3OF0A 4M69A 1NXKA 2YIQA 3UZPA 4CEGA 4C37A 4RWKA 1K2PA 3MIAA 2PVJA 3GFEA 2UW6A 4DAWA 4E26A 5L2IA 5L8KA 2ITZA 1WBWA 3A7GA 3PXYA 3LMGA 3C1XA 3QXPA 4J1RA 5FEEA 4F7LA 2VTPA 4JAIA 5E8UA 5HX6A 4AN2A 2YACA 4G9RA 2R7BA 4RX5A 3SA0A 2WTVA 1AD5A 5H2UA 3BYOA 3GU8A 1KE7A 4O0RA 1W84A 2BIYA 4V0GB 4L6QA 5D12A 4RJ5A 5FQDC 4AWIA 4ZEGA 4OBPA 3I5NA 5LVLA 4WIHA 4U45A 3AC5A 4BCJA 3NZ0A 2OZOA 3QZHA 4EH6A 4X3JA 5BVOA 2X4FA 4YR8A 5EW8A 2JBPA 3NIEA 4R3RA 5DVRA 5IUIA 2Y6MA 3L8VA 3UYTA 3GU4A 2YLFA 4R1YA 4RZWA 4UN0C 2XCKA 3V8WA 4AW0A 3HX4A 4RIYB 4YLLA 3HLLA 3A7HA 2Z7LA 3C0HA 3EQRA 4QMSA 4W8EA 3NVKI 4RFYA 2VWIA 3PP1A 4K2RA 4PP9A 5DT4A 4XG4A 3V8SA 1Q99A 2X2LA 2IW9A 3L9PA 4O7LA 3LFEA 1ZZ2A 4R1VA 5AX9A 2C6KA 3U54A 3JYAA 4GFMA 2R0IA 3DK3A 2PPQA 2V62A 3QCXA 1PYXA 4D28A 4FGRA 1GZNA 4QP7A 5JH6A 1O6LA 2F57A 2UZDA 3MJ1A 4KAOA 3C4EA 2P0CA 4FNXA 2J0JA 2JD5A 2YIXA 3DAEA 4GUBA 2ZDTA 2XKDA 2YEXA 1PF8A 1A06A 3DB8A 4ZZNA 5HG7A 4EHZA 2BMCA 4CMTA 3QC9A 2C3KA 2UZTA 1I44A 4ARKA 3V01A 4OTIA 4IWPA 4KBCA 3JUHA 5BQ0A 3HL7A 1XBCA 3DFAA 4LOPA 5C4KA 2I6LA 3OD6X 5L2WA 4FIGA 5AV4A 2B9JA 3G6GA 4C3PA 3NYXA 4EOJA 1H1WA 2I40A 1IG1A 2OJGA 2PMIA 3N9XA 5LOHA 4U42A 1FVTA 3FZTA 3R9RA 2QOIA 4BDAA 2GNHA 2WOTA 2IZSA 4FTMA 3R9NA 3EB0A 5EHYA 3BLHA 1AQ1A 3ZO4A 4FV1A 5AP4A 4BI0A 2UW3A 1Q41A 4RX7A 3RPRA 2FSMX 2PVFA 4L7FA 4F08A 1O6YA 3HP2A 4BKJA 2B9FA 4WRSA 1H00A 4GT4A 4MBLA 2UVZA 4WBBB 3OW4A 3W8QA 3CY2A 4FG9A 3R8PA 4I5PA 4R5SA 3DDQA 1REJA 4XH6A 4GSBA 4YJPA 5CEMA 3QRJA 4IWOA 2G2IA 3SAYA 4CZUA 4V05A 3NS9A 3QQFA 4B7TA 3I6UA 4DTBA 3HRCA 4RMZA 2I7QA 1WBTA 2CGWA 2QKRA 2ZJWA 2JIIA 4IZYA 4AGUA 2BZKB 2UW5A 3AC8A 4I6BA 2GU8A 4Q5HA 4YJTA 5KO1A 1V0PA 1YDRE 1JPAA 2OZAB 5CSHA 2BTRA 5DEWA 5CENA 5EI8A 4RIXB 1AGWA 3SC1A 3ET7A 5HVKA 3UDBA 1XO2B 1GOLA 2J9MA 3PUPA 4EYJA 3ODYX 4KIKB 4PUZA 5J1WA 3OEZA 3COMA 5DE2A 1YHSA 4D5KA 4BY9E 5E8XA 3V5PA 4PPBA 3Q9YA 3KMUA 3MV5A 2PVKA 4FMQA 3WE8A 4BYJA 2OJ9A 2WQEA 1Q5KA 3R2BA 5AR4A 4IEBA 1GZKA 1TQIA 4B9DA 4EH3A 1Y57A 2PZRA 3QYZA 4U40A 5KMLA 3FXWA 1ZYSA 2P2IA 5KMIA 4O2ZA 2NNWB 1ZYJA 2R3LA 5FM2A 3PIYA 4UY9A 2OGVA 1UU9A 2ITWA 3U9NA 3KULB 3W16A 4YLJA 2F4JA 5BNJA 4XCUA 4E5WA 2QO2A 2WMAA 3P7CA 3WF8A 3ZFXA 4L44A 2WQOA 3OROA 3DNDA 3GUBA 2R3QA 4EONA 5FP5A 1XH8A 3GCSA 4NW5A 2WTWA 5DYJA 4JL9A 5FDPA 4NWMA 3A4OX 1JKLA 4JVGA 4FKLA 3KVXA 5AP3A 4AA4A 4ANOA 3GU6A 2OXXA 2ITQA 3OFMA 2C6LA 4ACCA 5CAVA 5HCXA 4OW8A 4IHPA 2VU3A 4EKLA 5EDPA 4EJNA 4AF3A 4DG2E 4A9TA 4E73A 3A4PA 1H28A 5AJQA 3QA8A 4O7YA 2YM4A 1OB3A 3EZRA 2YM8A 3HDMA 3MPAA 1MRVA 2OWBA 4QYEA 3GOPA 4XNEA 5K4JA 2OK1A 4BTMA 4IAYA 4D2WA 5T68A 3OHTA 2YIRA 2YDKA 4CCBA 4D1ZA 5BMSA 1KV1A 3R7VA 1PMVA 2PSQA 4U43A 3L8XA 4LGHA 3R0TA 4BZDA 4G2FA 1FOTA 2H34A 4I22A 4S34A 3PVBA 3LJ1A 5BUIA 3QUPA 4HGSA 4XG2A 3VBTA 3VVHA 3BU5A 3QKLA 2RKUA 1ZYLA 4IB1A 4MXOA 3A2CA 3RCDA 3HMPA 4GKHA 3KN6A 2XK7A 5I3RA 2IN6A 3W32A 5L6PA 3D5VA 2GDOA 3Q6UA 3ZZWA 4EOOA 2JC6A 4MTAA 2OFVA 3Q32A 3VUGA 3EZVA 4FICA 4EZ5A 3Q4CA 4QMZA 3PVWA 3SOCA 4ZSEA 4WOVA 3TZ8A 1ZARA 3FMKA 2V7AA 4K18A 4OTFA 3C50A 4BCNA 3OVVA 4ZTNA 3VS7A 1IRKA 3GBZA 2PYWA 3UNZA 4CQEA 4B6LA 2X7GA 3PJ3A 3CEKA 2VGPA 2W9FB 5DRBA 3UOKA 1X8BA 4O7VA 3VIDA 3GVUA 4ACHA 2BALA 4NIFB 4FV0A 4EEVA 2WMRA 3FMNA 3JS2A 3NNXA 5EI6A 5FRIA 3BGQA 3GU5A 4D2VA 3DPKA 3EFLA 5FDXA 2QOHA 2YM5A 2QOKA 4IE9A 4TYGA 4NTTA 4DLJA 1OECA 4L53A 3DLZA 3HV6A 5IISA 3DK6A 4M66A 4HYUA 2CNQA 1BI7A 3E5AA 2PVRA 4AZSA 3QTRA 1OKZA 3O8TA 3D14A 4PMTA 4IM0A 2JGZA 5AADA 2H8HA 4O7WA 2RG6A 2W0JA 3VAPA 4AT5A 2ITOA 4QQTA 5BVDA 2R3FA 4FG7A 3CQWA 1CM8A 3DZOA 3ZRKA 5JQ8A 3E3BX 5HE0A 3MVHA 3VWAA 2XNNA 1NVQA 3LFQA 4FVPA 2CCHA 5HO8A 3TL8A 2X0GA 4FTAA 1FBNA 1XH5A 4D9TA 3O51A 5GIPE 4DEDA 4DFLA 4FT0A 1RE8A 4TYEA 4UB7A 1XKKA 3QAME 4AGWA 4OGRA 3QKKA 4ZZMA 3UOHA 5LWMA 2XIXA 2JITA 4FYNA 3VN9A 2B55A 4YBJA 5IQEA 4I3ZA 2R3HA 1DAWA 3ZSGA 3LFCA 3MESA 3H30A 4MXYA 4YSMA 2BHHA 2JKQA 3EN9A 4TPTA 2VNWA 4EH8A 3PSDA 4FTUA 4XRJA 4RVMA 3TZ7A 1SM2A 4C2WA 1K3AA 2CGUA 3KY2A 1JSUA 2VWVA 2JFMA 4H3PA 3HA8A 3DKCA 5BVWA 4D2TA 3QRTA 1DI8A 4O21A 2UW9A 4CT1A 3VS2A 3QKMA 5F20A 3ENMA 1WBPA 3QHWA 4FZAB 4C4EA 4K0YA 1KE9A 1YXXA 5C27A 3K3JA 1P14A 1U46A 4G31A 4IQ6A 4J97A 4DGLC 4MF1A 3TN8A 4D4YA 3ZH8A 3T9TA 4MX9A 4AE9A 4FZDB 2FA2A 2ZM1A 4W9XA 2CKOA 3NCZA 3A61A 4OUCA 2YIWA 4ID7A 2VUWA 3TIYA 4AZEA 4BYIA 3SD0A 3VUKA 4ACGA 1YOMA 3PVUA 5JRQA 3D0EA 4YNEA 3V6RA 5JQ5A 1FINA 5D9HA 3FLSA 2UZUE 4KSPA 3OBJA 5HLNA 1PKGA 3FQHA 3G33A 4XUFA 4F99A 5E8ZA 2BRNA 4FZ7A 1ZZLA 5IUHA 4XYFA 4EOPA 3LCSA 5HTBA 4C57A 1FMKA 3ZRLA 3LCOA 2OXYA 2BUJA 1UKHA 4JLCA 3FXXA 1FVVA 4DEBA 4RJ6A 5ANDA 3Q9WA 2ZAZA 3ZLYA 4DFZE 3FE3A 4FTQA 4FR4A 1H27A 4OTWA 5D41A 3EH9A 4BDKA 2ERZE 5CNOA 2B1PA 2QO9A 2GCDA 1BUHA 3NYNA 3VW6A 3QA0A 5HKMA 2GQGA 3PXKA 2OF4A 4U44A 2PULA 4AAAA 4E93A 1UWHA 4WHZA 2ONLC 4RLLA 3ZSIA 2OF2A 2C3IB 4WUAA 4F6WA 2V5QA 3OWKA 2NPQA 3LIJA 1YWRA 3TCPA 1MRUA 2WIPA 5CZHA 1V0BA 3PTGA 3GOKA 3MB6A 5AEPA 5IH6A 4EC9A 4O7NA 2XNOA 2C69A 4BHZA 4J71A 3REPA 3FMHA 4BR3A 1BI8A 2JDVA 3Q3BA 3QTXA 4QQCA 1W7HA 3FL4A 3ULZA 3AXWA 3FSFA 3CC6A 3BU3A 5AP2A 2NRUA 4R3CA 3OWPA 5GJFA 4EK3A 4Z55A 1B6CB 3GEQA 2QVSE 4QMWA 2BDFA 1P5EA 3B2WA 3BELA 3DDPA 5GHVA 5HIBA 4DA5A 5HBHA 5J8IA 4YJSA 3RTPA 3O17A 3TKIA 3NEWA 2OBJA 4NCTA 5KMKA 2JDRA 3H9RA 1H24A 4HVSA 4DGGA 3ZU7A 4J53A 5CT7A 5L6OA 4C3FA 3FPMA 2CGXA 3R6XA 2J2IB 3BE9A 3BGZA 5CVGA 2ITTA 3NUXA 3P78A 3PRFA 1F3MC 3NCGA 1CKJA 4XBUA 3DAKA 3RHXA 4F65A 3KEXA 4FKJA 3BHTA 2JAMA 4DINA 3O96A 2VTMA 2XYNA 5BX0A 2BKKA 4J8NA 5K4IA 3C13A 2XKCA 3W8LA 3CS9A 4XV1A 3MN3A 1G3NA 2W1IA 4JRNA 3TV7A 4XV3A 2GNJA 5GJDA 3NW6A 4EORA 5AM6A 5CS6A 1OKVA 1J3HA 4DFUA 5ANIA 4TKSA 3Q4TA 1IEPA 2GSFA 2XNBA 4QMYA 3BWFA 3AC1A 3EL7A 2R3RA 4HYIA 3EKKA 1QL6A 4U80A 2R3JA 2ZV9A 5I9XA 4AOJA 4D0XA 3VBQA 4C59A 2UZWE 4TWNA 1H0VA 4JIKA 4W4WA 5AAGA 1BKXA 5E4HA 3AD6A 4CMOA 2XJ2A 2FSOX 4IX4A 3UNJA 5AIRA 3ORNA 4Y83A 4BDJA 3ID6C 1PXMA 1R78A 2PHKA 3DS6A 3VBYA 4ACMA 1OI9A 2WIHA 5A4EA 2YWPA 4XG8A 1H8FA 5CTPA 2A27A 3ZMMA 2YDIA 4GFOA 5LVNA 2OJIA 4GG7A 4K11A 4Z7GA 1VYZA 2F7XE 3UIBA 2XKEA 4ZSGA 2F9GA 4A7CA 3Q60A 3LCKA 5KX8A 1R0EA 4DGOA 5DMZA 2QOOA 3G9LX 2WTKB 3IW4A 3PE2A 2XJ0A 5A54A 4G9CA 5IDNA 1GNGA 2Y4IB 3NYOA 3C4ZA 1IR3A 1CTPE 2XK6A 4IVDA 4O0SA 5CEQA 2BAQA 4ANLA 3TM0A 2VRXA 4IADA 3ALNA 3BKBA 2YCRA 3PXFA 3RBWA 5JGAA 2JLDA 4PTEA 3FC2A 3OCBA 2F49A 1ERKA 3Q2JA 5LCJA 3W2SA 3PG3A 3WOWA 4FOBA 3NNVA 3HRFA 2FSLX 1WBNA 4E6QA 3ZLXA 1PXJA 2CJMA 2H9VA 2XEYA 3QFVA 5J7BA 2Z7SA 2CN8A 3OXZA 2J0LA 2FGIA 3AMBA 4JBOA 3FLWA 2BZJA 3U6IA 1BMKA 1DS5A 3FYKX 5FBOA 4S2ZA 4DTAA 3PE1A 2B52A 2QOBA 2WELA 3KFAA 4YU2A 2Z7QA 3FMEA 4XG9A 4AZVA 3UPZA 2W4JA 2W4OA 1HCKA 1KE8A 4GG5A 4K9YA 3B8RA 3QD4A 4MXCA 4NM5A 4O38A 5BYYA 4CKJA 3TUBA 4LMNA 4FV6A 4CMUA 2X2MA 1PYEA 2BAJA 3S4QA 4QPAA 3JR1A 3V5TA 3SV0A 4EKKA 3M11A 3R2YA 4USEA 2YITA 4EQMA 4UXQA 2VO0A 4IX5A 4HJOA 5KBQA 3C51A 2YERA 2IVTA 2PMNX 3VJOA 2PVLA 4BKYA 2KULA 5CY3A 4DH5A 3G0FA 4FUXA 1OVEA 4TXCA 2REIA 4XLIA 5HE3A 4CVAA 3R30A 3BQCA 4S32A 4A9SA 4MCVA 4FE2A 4O1PA 3HAMA 4YP8A 3DXQA 3O7LB 4JG8A 3UO5A 1HOWA 5D7VA 4YC8A 1YQJA 1OIUA 3LW0A 5EI2A 4CZTA 2RFDA 1PXKA 4M0ZA 5AR2A 3R7YA 4IBMA 4PMSA 3R21A 2BRHA 4CKIA 2FVDA 2UVYA 4X3FA 4WO5A 4GU6A 3ZXTA 3FYJX 5HG9A 1LPUA 3UQFA 5E1EA 2PE2A 2OH4A 2ZYBA 2YDJA 2IZTA 1Z57A 3I7BA 4L7SA 4C0TA 2Q83A 2OW3A 3AOXA 4BWXA 4FKUA 3SVVA 3VUIA 3R9OA 2EUFB 2JAVA 4BC6A 4D1SA 5AMNA 1FGIA 3BBTB 3HVCA 3KCFA 2E9UA 2VTIA 3I79A 4FODA 4NFMA 4AUAA 5LJJA 1YWVA 5K3YA 2QLUA 5DNRA 1H1RA 4UXLA 4KSQA 3K5VA 5T6KA 1CKPA 2C30A 4BICA 4CG8A 3SRVB 2HZIA 4FL3A 5KZIA 2I0VA 4PDPA 3MS9A 2ETRA 4UZDA 1WVXA 4NJDA 3PWDA 4ZLYA 5LMKC 5G1XA 4QPMA 4GIIA 4BCIA 2WTDA 3EQHA 5L8JA 3WILA 2WTIA 4WG5A 3T9IA 2YAKA 1R39A 3UTOA 4ZTLA 5B7VA 2PMLX 1U54B 4M12A 2ZMCA 4DLIA 4JG6A 3RAKA 1UNGA 3TV4A 3F7WA 4KS7A 1G8SA 4LGDA 3ZEWA 2GTMA 3U9CA 5LMBA 5C8NA 3PP0A 4KRCA 2IG7A 4EQUA 4Y8DA 1XH4A 4BGHA 4USFA 4FEWA 3SG9A 3LFBA 4ZLOA 3GQIA 3UP7A 3AD4A 5E1SA 5IA3A 1L3RE 4BCPA 3F3VA 3G9NA 4PPAA 3R8UA 3G15A 5B2LA 3CR0A 2WMQA 3D5XA 3UVRA 5E7RA 2WMBA 3H9OA 1WVYA 3ORIA 4C58A 1WFCA 3TXOA 2OKRA 4WUNA 4P4CA 1UV5A 3P23A 4L01A 5DR2A 4EZ3A 3AMYA 5CF6A 2UV2A 2QR8A 3QGYA 4A9UA 2GHGA 3R1NA 5ICPA 1ND4A 3RM6A 4ZXTA 3HYHA 3MWUA 4ONAA 5T3QA 3TACA 3TEIA 3EQDA 1OM1A 2AYPA 3FQEA 3Q53A 4RC4A 4BDBA 5KCVA 3SHEA 4W8DA 4FZ6A 3QCSA 4RJ4A 3TDVA 2JIUA 4U0IA 4NTSA 4FEUA 4YTHA 4ZAUA 3ACJA 4M97A 2VTLA 4TYHA 4EYMA 3O8UA 4JR7A 4F0GA 5J9YA 2XBAA 3UIMA 3UIUA 4I5CA 3TKUA 3U87A 1PXLA 5KHWA 4W9WA 4YPDA 5B2KA 2YJRA 3DBQA 3V5JA 1BL6A 4EK8A 4RIYA 2HCKA 3LHJA 5EW3A 5CAUA 4YHFA 3IGGA 5M4FA 4LYNA 2ZMDA 2OU7A 2JFLA 4QP8A 1M52A 3QTUA 4C38A 3ZUUA 2CMWA 4AZTA 2WMXA 4PRJA 3DJ7A 4RVKA 3PVGA 3TKHA 3M42A 3HMOA 3MH0A 3QZFA 3Q96A 4KWPA 2XNEA 4J96A 3DFCB 3E93A 5JKGA 1QMZA 2GQSA 4DH1A 5IA1A 4FKQA 3RHKA 3BHHA 3QCYA 4UALA 4YJOA 5CF8A 5H9BA 3SGCA 2RF9A 2O0UA 3KF4A 5JZJA 3BYMA 1PXPA 1WMKA 4DBXA 4LUEA 3VO3A 4U9AA 2YN8A 3KK8A 3MW1A 2QR7A 4X6RA 3PZEA 3ORZA 5B0XA 1OL5A 1ZOGA 5G6VA 2R4BA 2FYSA 2DQ7X 2WOUA 3E8DA 2I0HA 3MFUA 3POOA 1XH9A 3ZUVA 4D58A 4I0SA 3D7TB 3WF7A 3R00A 3MY5A 3AT2A 2C0TA 4TRLA 4MVFA 4X2JA 2I1MA 4C36A 1H1SA 2NRYA 2QONA 4YTIA 4AFJA 5A46A 4OAUC 5EDRA 4ASZA 2EWAA 4JRVA 3MH3A 4E6DA 2XA4A 1EH4A 4AP7A 2WMWA 4RIWB 1OL7A 4GIHA 3D2KA 3TUDA 3FKLA 2W1GA 3K2LA 4Y5HA 4M3QA 2UVXA 3O8PA 5DR6A 3UJGA 4RGJA 5C8MA 5CAOA 4UV0A 3ORMA 3N4VA 5HE1A 5I9UA 2VZ6A 1YW2A 2EXEA 2HY81 4BRXA 5JFXA 4IAKA 2X7FA 3F5PA 3RWQA 4UMPA 3HEGA 2R3MA 2X9EA 5J87A 4ALVA 5K5NA 1JQHA 5EFQA 5TKDA 5KE0A 3UE4A 1H4LA 3FUPA 4HVGA 4L9IA 2C3LA 1B39A 2XK3A 1OBDA 1PXOA 3OMVA 1ZYCA 4L8MA 3BGPA 4WNMA 2HAKA 1PRYA 2OZAA 4IDVA 5CEIA 4FUYA 3ERKA 3D4QA 4TT7A 5HI2A 1OPLA 2XNPA 3NW5A 3OOMA 4KIKA 3VBXA 5KMMA 4FEXA 3R7GA 3R7UA 3PIZA 4L68A 3DGKA 4BTJA 4C4JA 1XH6A 3A62A 4YHTA 4MXZA 5AR5A 3SKCA 5AA9A 2HWPA 1V1KA 2HZ0A 2JEDA 3R22A 5CU0A 4FBXA 4RA4A 3PA3A 3TIZA 3IGOA 3H3CA 2HELA 4RRVA 3BYVA 1YOLA 4ZK5A 1ZAOA 4F63A 5E8YA 2AUHA 3KULA 4PDOA 4FL1A 4RWIA 5JSMA 2V7OA 3KRRA 4KS8A 3PJ8A 3ZC6A 2UZOA 4OT6A 4UBAA 4QMVA 4ZTRA 1IAHA 1QPEA 3AC2A 3GC0A 3HP5A 5IA5A 4PDYA 2ZVAA 2ZM4A 4TN6A 2UUEA 3O2MA 3OOGA 2UW4A 4FKGA 4AX8A 3CSVA 5HTCA 2G1TA 2YJSA 3OCSA 4QOXA 4HVIA 3PYYA 3OTUA 3WI6A 4R7BA 2KTYA 4LL5A 4FSZA 2EXMA 3QQJA 2GS7A 5JFVA 4QRCA 2JKKA 4UEUA 5ANOA 4I94A 2WTKC 3SXSA 2F7ZE 4BWPA 1JBPE 2GS6A 4N6ZA 4PPCA 3NX8A 3FLYA 3FY0A 2Y4IC 4G3EA 2C47A 5AUXA 3LE6A 3RK9A 3TV6A 4QMQA 3H9FA 3QQGA 4E7WA 4EOQA 4KKEA 4H3QA 4V01A 4I6QA 5I0BA 1ZMVA 5HNIX 4WG4A 3E7VA 3CD3A 1Q8TA 4JQEA 2SRCA 3DQWA 3VHKA 4O7RA 5I5ZA 4AGCA 3VQUA 4L67A 3GENA 4ZJJA 4C4IA 2QOFA 2OIDA 3Q2MA 3EHAA 3FZOA 2GQRA 5L2TA 2VWBA 3E8EA 1KV2A 3IKAA 3V04A 4GCJA 2E2BA 4O86A 2PL0A 2XZSA 4FV9A 4ZMEA 4HCVA 1GZOA 3U6JA 3QTQA 3BLQA 4JQ7A 3VS6A 3HV4A 4JQ8A 4L3PA 3DU8A 5K9IA 4C61A 3CBLA 4UMUA 3EYHA 2C68A 3NW7A 4MXXA 4AN9A 4NM7A 3HKOA 4I23A 4RA5A 5FTOA 5L2QA 3UQGA 4QMNA 4ORKA 1Q3WA 4PDSA 4FV4A 5CSVA 1JSTA 3IK3A 3QX2A 4RFZA 3COHA 5I9ZA 5IQAA 5IU2A 4I4EA 4FTRA 3IG7A 3PWYA 3SX9A 5LMKA 3TT0A 3PY0A 5E90A 2XYUA 3VS0A 3MY1A 4IMYA 3R04A 4FZFB 5HEZA 2WZJA 4OBQA 2IPXA 3LOKA 4NIFA 3RKBA 3Q9ZA 2WU7A 2J6MA 3C0IA 2XUUA 3KF7A 3P7BA 5DPVA 1G8AA 5M08A 3ATTA 4KIQA 5J9ZA 1IAJA 4O2PA 3QF9A 4FV8A 5CEOA 3IW7A 2BDJA 5GINE 2GMXA 2VTNA 4NK9A 1PY5A 2YFXA 4XP2A 3WBLA 3IOPA 3RPSA 3ITZA 4DFXE 4BI2A 3OT8A 5EKOA 3UVPA 3C7QA 4FSTA 4C4FA 3F3WA 5DFPA 4D2PA 2BRBA 3ZCLA 3RWPA 1PXIA 2P2HA 3FI3A 5J5TA 5A6OA 3DBEA 4MH7A 4ERWA 3TNQB 3ZLSA 4JNWA 4FSUA 3KXZA 5DLSA 4NM3A 2G2FA 5TF9A 4S33A 4IAZA 4O27B 3VS3A 3F88A 3FBVA 4HNFA 3HAVA 4NFNA 2BFXA 2C6TA 4IAFA 4Y72A 4BTKA 2HYYA 3EQFA 3PPKA 2E9OA 4IVBA 4R3PA 4BHNA 2W17A 2B7AA 5F94A 3GNIB 4FK6A 5HNBA 4DH3A 3POZA 4OAVB 3UMWA 4FIEA 1T46A 2XIZA 2CN5A 4WSYA 1KSWA 3TNHA 3GI3A 4L52A 4AN3A 3ZOSA 5AA8A 4EHVA 4IANA 4NL0A 3K5UA 2UZBA 2X39A 3GP0A 4F9YA 4XV9A 5IQBA 5DG5A 3JY9A 4XP3A 4E3CA 5KZ0A 2VO6A 5D10A 2IW8A 2R64A 1U5RA 4AT4A 3E88A 3KC3A 4ZJVA 4CFVA 5M4IA 4DGMA 4H36A 3IOKA 4AW1A 2BROA 3FI2A 4ZLZA 1J7UA 4QMXA 4CYIA 4ZY6A 3FMJA 5KKRB 2CKEA 2VTAA 4FI1A 1P4FA 5DT3A 4QTBA 2F2UA 3RZFA 1XH7A 4CLJA 3QX4A 1Q62A 4O83A 2YM6A 4BDEA 2OFUA 2EXCX 2QOLA 1WBSA 3G5DA 1MRYA 4CV8A 2RFSA 3KVWA 4EUTA 3Q04A 3IDBA 4MNEB 2CNUA 5C8KA 2WEIA 2WTJA 3NSZA 5HVYA 4DCEA 3UPXA 3NUNA 3UBDA 4AS0A 2XS0A 4L46A 3C9WA 2GNLA 1KOBA 3NUUA 3GCQA 3C4FA 2YM3A 3EQCA 4MEDA 3UG2A 4QT1A 4J8MA 4Y85A 3FLZA 1XBAA 5M07A 4OR5A 1GAGA 4QP2A 4YMJA 2QU5A 3BE2A 3FZRA 1ZYDA 2QU6A 4QYFA 3TJDA 3EFWA 4K1BA 5KMNA 3DBFA 2GHLA 4PQNA 4RC2A 4TYJA 3CTHA 4U79A 4G3DA 4KUJA 2ZDUA 5HLWA 3LJ0A 4GJ2A 2YZAA 1E9HA 3K54A 3I81A 4J95A 2ZV7A 2VWYA 4QP6A 5FBNC 3ZO2A 3B2TA 4G6LA 1MQBA 2DS1A 4I6HA 4RQKA 3MVJA 4O6EA 4JDIA 4W4YA 2A4LA 4D0WA 4WNOA 4GUEA 4MNFA 4IZ5A 3ZHPC 3MVLA 5JEBA 2C6DA 1OIRA 4ZTQA 4AW5A 2RIOA 2O2UA 4H1JA 4P5ZA 3KK9A 1WBVA 4G6NA 2E9NA 4KA3A 4LRJA 4G5JA 1S9JA 2G15A 3TNPC 4O91A 5DGZA 5L2SA 3AG9A 3QGWA 3F5XA 4QYGA 3F3ZA 4QYYA 1JAMA 4I0TA 4Q5EA 3WARA 1VEBA 4CCUA 5LVPA 4YURA 3LFSA 5M53A 3ALOA 4FIJA 2UZNA 2C5NA 2ITPA 2QOCA 3UOLA 1XHAA 5JK3A 1XQZA 4DTKA 5CALA 5M51A 4RC3A 4H3BA 4X7QA 3E62A 3QRKA 1J7IA 3BV3A 2WQBA 1CMKE 3MTLA 4S31A 3R7EA 4UWBA 2Z8CA 4PMMA 5BYZA 3KXMA 4N70A 5AV2A 3LVPA 4MF0A 2EU9A 2BZHB 2XB7A 3I6WA 3LAUA 3FI8A 2W5BA 1RQQA 2GPHA 3WIGA 1U59A 3NUAA 4IB5A 3F3TA 1Z9XA 2BRGA 2NO3A 5AX3A 3V5QA 4EL9A 4AG8A 4GRBA 1UVRA 3R8LA 2ZV2A 5IF1A 2YZLA 5CI7A 4RQVA 4YUQA 2BFYA 5DRDA 3A7IA 4PTCA 5EM7A 4EK4A 4F0FA 4DH8A 2XBJA 4IX6A 3BQRA 3LXNA 3VHEA 2GS2A 3O7LD 5CVFA 3RALA 1NW1A 2P3GX 4FKSA 5DEYA 5LCKA 2I0YA 2RFEA 3LM0A 4CSVA 4AA5A 1QPJA 2HW7A 1YKRA 3COIA 4OLIA 4YHJA 2XIRA 4LRMA 5HBJA 4HNIA 4W4XA 3PZHA 4E4LA 2CPKE 4P2KA 5ACKA 5FGKA 2PUPA 3UP2A 3VQHA 4IIRA 1J1BA 3MB7A 3EFKA 3L9LA 5L3AA 3A7JA 1H1PA 5HO7A 5E9EA 4TZRA 3ZYAA 3LMIA 5AIKA 4A07A 3UQCA 4UZHA 4TWOA 3SQQA 4YO4A 1V0OA 1SNUA 5J9LA 1GIJA 3ZS5A 4O7TA 5L8LA 2H96A 3AT4A 4PP7A 4LV5A 4RBLA 3LFFA 3QBNA 5AUTA 2YCSA 4ANNA 1JKKA 1YHVA 3LQ8A 4A9YA 5HU3A 2Y0AA 2RGPA 3ZM4A 1Q8ZA 4ZSLA 5FEQA 3EN5A 4FX3A 4U6RA 4FEVA 1ZWSA 2UZVA 4BGQA 2J0KA 3EN7A 2C0IA 3KKVA 2JDOA 4ENXA 3ZXZA 5M57A 3QLGA 1ZOHA 4FOCA 5FXSA 1YOJA 5HGIA 4DITA 1ZXEA 2OSCA 5IA4A 2WXVA 4BBMA 3UMXA 4ZZOA 4CFFA 5EQEA 3D9VA 3U6HA 1H08A 5E91A 5HBEA 3R1QA 3TTIA 3RNYA 2OIBA 2IJMA 3EMGA 5D11A 4RWLA 5EYKA 2JIVA 1OL2A 3C4XA 3Q52A 1YDTE 1Y8YA 3CD8A 4FKRA 4H39A 4YZCA 4NYEA 4ASXA 3UODA 4K6ZA 2Z2WA 3FY2A 5IDPA 3B8QA 4YPSA 1P2AA 3KB7A 1OBGA 4TL0A 3E7OA 3R63A 2Z02A 4DCAA 5CI6A 4F9AA 4EWQA 3KXHA 1GJOA 4RT7A 4DFYA 4B0GA 1Q97A 4E1ZA 3ENHA 1GIIA 2QD9A 4PX6A 3BIZA 3OC1A 2VTJA 3QRIA 4IM3A 4BVUA 4CFXA 4E4MA 3I0OA 5M06A 4QTAA 3SLSA 3KXNA 2QLQA 5FG8A 5HG8A 1HCLA 5BUEA 3R8VA 3S95A 2QQ7A 1H07A 4MAOA 3V3VA 4NUSA 4RJ7A 4JIAA 4I41A 4BI1A 2OLCA 2BAKA 1IA9A 4C2VA 3KGAA 5AP6A 2W1DA 5AUYA 3GQLA 3NAXA 3N4TA 4RX8A 3O50A 3OT3A 4NT4A 4EH9A 2IVVA 3ULIA 3C4WA 4NEUA 3D5UA 4TW9A 3F69A 2W4KA 3TDWA 5EG3A 3FZ1A 2B53A 1PMNA 4WD5A 4WSQA 3R7OA 2FSTX 3MIYA 3OS3A 1NT2A 2FH9A 5K5XA 4L00A 3KRWA 2VTTA 3DAJA 3IPHA 4IFGA 1E1VA 2XRWA 3L1SA 4TNBA 4CYJA 4O84A 4QTEA 4AGDA 1ATPE 4LMUA 3RNIA 4F7NA 4C35A 4BBFA 1BX6A 5EKNA 5IA0A 4IW0A 3FZSA 3TNWA 3IO7A 3HUCA 4YC6A 2X9FA 3G51A 2O63A 2XCHA 4JX3A 1RDQE 4R7HA 2VGOA 5E8TA 5AR8A 3PPZA 5HG5A 3EQPA 2EB2A 3EN6A 3FHIA 3IECA 5CEKA 5L6WL 2QO7A 4IZ7A 4Z3VA 1H26A 4BIEA 4FV3A 2ACXA 3C4CA 2WD1A 5ETAA 3M1SA 5HCZA 2WMSA 1IASA 1YHWA 3EYGA 3AC3A 1U54A 3PSCA 3OWLA 4K33A 5AAEA 3QL8A 2XIYA 4K77A 4EI4A 2NP8A 3I1AA 3TG1A 4AE6A 4EOMA 3HMIA 5E8WA 4I5MA 1UU8A 2X7OA 3CQEA 4KNBA 1BYGA 4FKPA 3DKGA 2P4IA 3CLYA 3SXFA 3IDPA 1XR1A 4ALWA 5FD2A 3DTWA 4X21A 3RGFA 3CJGA 3DBCA 1YXUA 4EOKA 5I9YA 1Y6BA 3R83A 5CSXA 1OUYA 3L8SA 3RAIA 5AUVA 4CG9A 2XK4A 1NVSA 1O9UA 2R3IA 2X8IA 4QMMA 3AD5A 5IQGA 5FM3A 3CQUA 3KA0A 1CDKA 4QYHA 3Q4UA 5ETIA 3HECA 4LM5A 3ZTXA 4O7SA 3MDYA 4E20A 2XNMA 2VTQA 4CFMA 4EHGA 1YXSA 2VV9A 2XJ1A 2XIKA 4R8QA 4M0YA 2O3PA 4J99A 5LMAA 2LAVA 2B0QA 1DAYA 2ERKA 5C01A 1UU3A 5HIEA 3GU7A 5D7AA 4L3LA 5CLPA 4FVRA 2EB3A 2HZ4A 1UKIA 4KABA 5DT0A 3EIDA 3NRMA 1OPJA 2PVMA 2X1NA 3PLSA 4BBEA 3ORXA 4IVCA 3LKMA 2UW0A 4TYIA 3FLQA 5IUGA 1M2QA 1LP4A 4RG0A 4PV0A 3DKFA 5LWNA 2BVAA 3D15A 4X2FA 4OTPA 2HW6A 2XK8A 3PIXA 3T3UA 3TWJA 4E6CA 2ZB1A 3VS5A 4IFCA 5LXMA 2FUMA 3F82A 3ZM9A 3BX5A 2C4GA 3V5WA 3BRBA 4FT3A 4O0TA 4XRLA 5J7HA 3Q6WA 3CKWA 4BCQA 2ITNA 4ZJIA 2WMTA 1PKDA 4NH1A 5F95A 5M55A 4QMUA 2C6MA 3AQVA 3CY3A 5KKRC 5EM8A 4O96A 2QODA 2YM7A 4YTCA 3N51A 3UZRA 2VAGA 4M67A 4I6FA 5IZFA 3FV8A 1M7NA 2PZPA 3PFQA 4FT9A 4PWNA 2PE0A 5AP1A 4RJ8A 3SW4A 3DTCA 4BDFA 3FL5A 2WQMA 3EQBA 4MKCA 2J4ZA 4EOSA 4NKSA 4F0IA 2ETKA 2OI4X 2VTHA 4NW6A 3NLBA 4FSWA 4QTCA 3FHRA 3U51A 1JLUE 3W2QA 4NJ3A 4BDCA 4FTTA 4ANMA 2XF0A 4FKOA 2VX1A 4U5JA 5EOBA 4F1OA 4QQJA 3Q5IA 1DM2A 4FKWA 3BZ3A 3PY1A 4U3ZA 3KREA 2J50A 5EYDA 5GZ9A 4N57A 3NWWA 2BCJA 1RJBA 2VTSA 3F5GA 1JNKA 3F3UA 3ORPA 4OTQA 4ZTMA 1SVEA 2QOQA 3QRUA 4FYOA 5CWZA 4XOZA 2BTSA 5E92A 2XK9A 5M4UA 4EOLA 4AZFA 2GTNA 2R5TA 3G0EA 4A9RA 4LGGA 1KOAA 2VO7A 3OW3A 4FF8A 1I09A 3CTQA 1R3CA 2ESMA 4V0GA 1NA7A 3GCPA 2C6EA 4RIWA 2QKWB 3TNIA 2W1EA 3HZTA 1URWA 4N0SA 3AGLA 5EM6A 2RL5A 3O71A 3GXLA 3QC4A 4FIFA 1FQ1B 1YVJA 2WTCA 3ELJA 3FI4A 3D83A 4FSNA 4GU9A 3RK5A 2YISA 4AOIA 2OICA 1W0XC 3QHRA 5H8GA 1ZRZA 3FLNC 3W2CA 3OWJA 3OBGA 3AT3A 2ONLA 3CCNA 3F6XA 4EQCA 5HU9A 4JBVA 4X3FB 4EBVA 3MFSA 5J95A 2BKZA 4MBIA 3OP5A 1NY3A 4CV9A 2CGVA 4C4HA 3S2PA 5CXHA 5HD7A 2HENA 3ZDIA 1OL1A 1XJDA 1WCCA 5HQ0A 3U55A 5E8SA 2H6DA 4F9CA 4CRLA 3DV3A 4NSTA 4AU8A 3GFWA 1XBBA 2XVDA 5CNNA 4WNPA 4M13A 1QCFA 2B4SB 4TWCA 3ZLWA 3ACKA 4LUDA 3VF8A 4LRKA 4BZOA 5BYLA 4BFMA 3SW7A 2PUIA 5ITAA 4LOQA 2E9PA 4DBNA 3PXRA 5HORA 4DH7A 4CKRA 3A8XA 1LUFA 2QC6A 3IDCA 4GKIA 4ZS4A 3ORKA 5EHOA 5FXRA 4EBWA 5M56A 1SVHA 3A60A 4U41A 4A4LA 5IEYA 3MGYA 4FEQA 1SZMA 3KXGA 4J52A 5ANKA 4YSJA 4FIHA 3HV3A 4YTFA 4HCUA 4BCFA 4RJ3A 3UIXA 4AFEA 4NU1A 4CFNA 4QO9A 5FXQA 3E92A 1GZ8A 2W1HA 4GS6A 2X81A 5CXZA 1QPDA 1Z5MA 1PHKA 4QMOA 5HHWA 2CSNA 5A4TA 2WMVA 2X4ZA 4G3GA 5AV3A 2O5KA 4ANBA 3TTJA 3R7IA 4E5BA 5EQYA 4GJ3A 4MD8E 4MHAA 4LOOA 4PL3A 4MWIA 4UWCA 4FKIA 4N4SA 3UYSA 1CSNA 4O0UA 1OIQA 3ZC5A 2DWBA 3I4BA 3IS5A 4R77A 4C33A 4D2SA 4GL9A 3PA5A 4HPUE 5AP0A 2JKMA 4B8LA 5LVOA 2C0OA 5BVEA 2QCSA 5CF5A 3HMMA 3R01A 4QNAA 5B2MA 1OGUA 4HVDA 4R5YA 4KKGA 1OIYA 2QHNA 3F5UA 4DG3E 1FGKA 4BCGA 3Q4ZA 1J7LA 4YJQA 4F09A 4BCOA 2W1CA 4UX9A 4FNYA 4YZDA 4TYHB 3VW8A 2A0CX 3R28A 4O0YA 5EW9A 3V5LA 4RIXA 4IACA 4APPA 5C26A 3GC9A 2Y8OA 3HV5A 3V51A 2C5YA 4P90A 4X0MA 5IG1A 2GFCA 2PVYA 2Z60A 3EFJA 2PU8A 4G1WA 3KU2A 4FV5A 4L42A 5A9UA 2BDWA 4GVAA 5KBRA 5DH3A 5JN2A 4F1MA 3VS1A 3F9NA 3FEGA 3W2PA 3QUEA 4MD9E 2IZUA 4IWQA 4M7IA 3LFDA 4Z7HA 5DA3A 1W82A 3FMLA 3D94A 5IQCA 2XM9A 2XKFA 5M44A 4EWHA 2W05A 4MYGA 1H01A 1O6KA 3S00A 3BCEA 2GNFA 3QD2B 4MD7E 4X2GA 3ODZX 1W98A 5DI1A 3QU0A 2C5VA 3WYYA 2J5FA 4IB0A 4EH7A 4AZWA 2J0IA 3VC4A 4XBRA 3KRLA 3PG1A 3LM5A 4UMRA 4QD6A 5J5SA 2WHBA 3P79A 4ANQA 4DFNA 4UMTA 3M2WA 4G17A 3ETAA 4QMTA 1J1CA 5GIOE 4WKQA 5CSWA 3R9DA 4MQ1A 4U97A 3RCJA 4B4LA 4IC7A 2BPMA 4GK3A 4YGAA 4L45A 2HOGA 5FEDA 2O64A 3R73A 5CQWA 1JKTA 3W2OA 4A06A 4M69B 3P0MA 4D1XA 2R7IA 1BLXA 1FMOE 4QP3A 3CGOA 1PMUA 4JG7A 3FMMA 2C6OA 3RINA 3THBA 4F7SA 5EQPA 3AMAA 2HIWA 4I92A 5AP7A 4FGBA 3DNEA 5DN3A 5HTIA 3MJ2A 5FLFA 4I5HA 3CPCA 3QYWA 4J98A 4DEGA 3MBLA 2OJJA 2UW7A 1NVRA 5EYMA 3UGCA 2VWXA 3GC7A 4JS8A 5HESA 4DC2A 3BYSA 2ETMA 3IW5A 4E6AA 4WBOA 1KE6A 2WO6A 4C02A 3FMDA 4FG8A 3FKNA 3PXQA 4IDTA 1S9IA 3FXZA 2I0EA 3ZZEA 4XJ0A 4BDHA 5ANEA 3VNTA 4CNHA 3KL8A 4LL0A 2YLEA 2WMUA 3NUSA 2B9IA 4IH8A 3PY3A 4XS2A 3P86A 5IKWA 2J90A 5C4LA 4JX7A 4FK3A 4W4VA 5HIDA 4LFIA 3RJCA 2LGCA 3NUYA 5J1VA 4WG3A 4G3FA 1A9UA 2O8YA 2RSVA 1FPUA 1WZYA 3BHYA 3DA6A 3DCVA 3MPMA 4NCTC 3BBWA 4MXAA 4O81A 1MP8A 3ZFYA 4H05A 4XEYA 1PXNA 3E3PA 3G2FA 4QMPA 1R0PA 4AACA 5AUUA 4GW8A 4QP1A 1M17A 1WAKA 2W96B 2V55A 5ANJA 4CTBA 5CASA 3NAYA 1Y91A 1APME 2W5HA 4IAAA 4DT8A 3P9JA 4GK4A 5EYCA 3ROYA 5HZNA 3DXPA 3MYGA 4CXAA 2W1FA 1VR2A 4FTNA 5M09A 1ZOEA 4LG4A 4MBJA 4GV1A 3NUPA 3VUDA 4QNYA 4U7ZA 4ZIMA 4ZP5A 4EH5A 4FTLA 4YZMA 4FTOA 3KRJA 4F1TA 1M7QA 3ANQA 2X6DA 4IJ9A 3OUNB 3CGFA 3R8ZA 2IVSA 4FSRA 4PTGA 3RAWA 4EC8A 3ZBFA 4IJPA 2VWUA 5HICA 4USDA 1U5QA 4G6OA 3LCDA 3LJ2A 3SXRA 3DQXA 1JKSA 2QG5A 4MNEA 4DG0E 4U8ZA 4FV2A 3AC4A 4YBKA 3ATSA 3UOJA 5AFVA 1RW8A 4KD1A 4F64A 3I5ZA 1U4DA 4NM0A 4C3RA 5C03A 2PUUA 2CKPA 2VD5A 3D7ZA 2CKQA 3QD0A 1JSVA 1OUKA 3KRXA 5FUTA 4CGAA 4BF2A 1OKYA 3JPVA 4AT3A 4B8MA 2CNVA 1ZLTA 3PJ1A 3UVQA 5BPYA 4ENYA 4DEAA 4RWJA 4MK0A 3H0YA 3QLFA 5AP5A 4E4XA 2C5XA 4IX3A 4CZYB 1F0QA 3RMFA 3ZONA 2BIKB 4TTHB 5BVFA 5IQFA 2JDSA 4XOYA 2XP2A 2W99B 4FKVA 3OCGA 2UW8A 3DT1A 4OBOA 5IQHA 2B9HA 3T8OA 2VX3A 4G34A 2HK5A 2PMOX 3QD3A 2VX0A 5AV1A 3HGKA 3LXKA 3H0ZA 4JXFA 3VUMA 1TKIA 3MSSA 3F2AA 4FTIA 5KMJA 5TE0A 3CIKA 3HMNA 4YO6A 2CLXA 3MI9A 2G2HA 3QTSA 3D2IA 4S30A 5I9VA 3EQIA 4OT5A 4IM2A 4HGLA 4YZNA 4HYSA 3BYUA 3P1AA 3VF9A 4QQ5A 4A4XA 3N4UA 3K3IA 5CAQA 3QWJA 3VUHA 4FSYA 4BZNA 4BCMA 3BWJA 5HLPA 4ALUA 3CKXA 2PVNA 4M8TA 4D4RA 4R7IA 2IO6A 4IVAA 4L3JA 4XG3A 3L9MA 4GEOA 3ZFMA 5D1JA 2BZIB 5CQUA 2YA9A 4ZS0A 2GHMA 4BN1A 4FKTA 4O0WA 3JVSA 4ZOGA 3BU6A 3LLTA 3ORLA 3VS4A 1Y6AA 3LPBA 2HZNA 4ACDA 1YI4A 4C62A 2CCIA 4O1OA 1LEZA 2X2KA 3OZ6A 3C5IA 4A4OA 4M14A 4HOKA 1SMHA 3EKNA 5K0KA 2BHEA 3SOAA 3PJ2A 4ITIA 1J91A 5I4NA 3WIKA 5EH0A 1L8TA 3P5KA 2R9SA 5I9WA 2VTRA 2DUVA 2WFYA 2YCQA 2ZV8A 5DIAA 3WZDA 4U81A 5DBXA 1Q4LA 5HD4A 3H4JA 1Q3DA 4O7ZA 1F5QA 2ITYA 3NNUA 4GMYA 3WE4A 5A4QA 2VWWA 3KN5A 3AGMA 5ACBC 3U4WA 5AUZA 3ZO3A 5CU2A 4P5QA 3FKOA 2F2CB 4ITJA 4X3FC 5CVHA 4ZSAA 3P4KA 1ZMUA 4L43A 3U8WA 3HUBA 4DF3A 5CZIA 1PW2A 1PMEA 2B54A 4D2RA 3OXIA 5F9EA 3UC3A 3JXWA 3RZBA 5IA2A 1JOWB 4WA9A 4O0XA 5A6NA 1UU7A 4DFBA 1ZY4A 3R1YA 2UZEA 3C5UA 3BEAA 4RZVA 4CQGA 4X2KA 5LVMA 1VYWA 3VRYA 3OY3A 4OTRA 4FSMA 3QXOA 3ZSHA 2UZLA 4QP9A 4EJ7A 3OXTA 3IONA 2OIQA 2PZIA 5IEVA 4HYHA 3HDNA 4HZRA 3DK7A 4M84A 4PL5A 5CU4A 2OO8X 4Z16A 3GGFA 2Y7JA 5KHXA 1KE5A 2W1ZA 3A8WA 3EJ1A 1VZOA 4UMQA 5TR6A 3IW8A 4O0VA 3A99A 3VUTA 4PNIA 5BVKA 4YJUA 2XM8A 4I0RA 5FP6A 5GZ8A 3EL8A 3EN4A 4IB3A 1TVOA 3OTVA 3F2NA 4JBQA 4UYNA 2XMYA 4JR3A 4PMPA 3F2RA 3RM7A 5GJGA 5AM7A 5A14A 4ZTSA 2HXLA 3TZ9A 1OL6A 3EWHA 5EHLA 2HXQA 2ITUA 3ZO1A 2WB8A 4F4PA 1GY3A 3QQHA 5H8BA 3MA6A 3DY7A 4MWHA 3MTFA 4ERKA 4EOIA 2PZYA 4I20A 4O82A 2Y6OA 4R78A 3C0GA 4I24A 3W55A 5ANGA 5I3OA 4ANSA 2PWLA 4KB8A 5EM5A 2WU6A 4HPTE 2Q0NA 5C9CA 3R02A 1JVPP 3LQ3A 3E63A 4E8AA 1WBOA 4G3CA 4F6UA 5FTGA 4GK2A 4O22A 2WKMA 4NKAA 1MUOA 4HZSA 2OG8A 5GZAA 1KUTA 4FNZA 3MY0A 3BLRA 3KCKA 5A4LA 2QURA 1YRPA 5JZNA 3ANRA 1QPCA 3GT8A 2R3OA 4CD0A 4RIOA 1URCA 4DT9A 3CTJA 5HCYA 1PJKA 5LQFA 1A48A 4I21A 3E64A 4IC8A 3ZDUA 2WPAA 5H8EA 4YNOA 3LQ5A 4RLKA 5IMXA 4RX9A 2OXDA 4LI5A 4NZWB 3COKA 4UYAA 3DXNA 3VULA 3JVRA 4FSQA 3MH2A 2VWZA 2IWIA 3MH1A 4PF4A 3VRZA 3GCUA 1STCE 3PRIA 4YZ9A 3R71A 2IZRA 4BCHA 4JT3A 3DLSA 4DE4A 1M14A 4I1ZA 3R8MA 3QZGA 1R1WA 4AQCA 4GVJA 2EVAA 4J7BA 4QPSA 1YDSE 4QTDA 4WT6A 2A19B 4C34A 2PE1A 4OTDA 4F9WA 3O0GA 2WQNA 3V6SA 1OZ1A 2W5AA 4JBPA 1K9AA 1W83A 2R3GA 3DKOA 4C4GA 5HX8A 2ITXA 3NPCA 4BDDA 3F61A 5C1QB 2RFNA 3DBDA 3WYXA 4BKZA 1LEWA 1T45A 5BVNA 3NYVA 3F7ZA 5IH4A 2CLQA 5BUJA 3ORTA 2BRMA 3HA6A 4CTCA 5CU3A 2WAJA 3RAHA 3OG7A 3TI1A 4WRGA 2IW6A 5JGBA 3P08A 3H10A 1H1QA 4IZAA 4F6SA 1SVGA 3UC4A 1Y8GA 3LFNA 3QTIA 3FZPA 3I60A 3Q9XA 4FTCA 4ZTHA 4JAJA 4ZMFA 2IVUA 5J79A 1FVRA 3ROCA 4G5PA 4FNWA 4KBAA 1CKIA 3UO4A 5KUPA 4GT5A 5JGDA 5HNGA 4CFUA 2X8EA 1E1XA 5DHJA 4BDIA 4KINA 4Y95A 4OTHA 5HVJA 3TJCA 4EK5A 4EUUA 2A2AA 5JRSA 3A7FA 5DR9A 4EZ7A 4AA0A 5CSPA 1UNLA 5TT7A 4X6QC 4JOAA 2YIYA 4BL1A 3P7AA 2J0MB 4P7EA 5AR7A 1TQMA 3I0QA 1SYKA 2G9XA 4D4SA 3QUDA 4G16A 3GB2A 3EOCA 5CYIA 5HE2A 3ZEPA 4D9UA 1XWSA 4JDJA 2C1AA 4DEIA 3LMHA 1Q8WA 1YXTA 2AC5A 5HOAA 4BCKA 5JT2A 3FSKA 3FAAA 2JDTA 2R0UA 4XV2A 3R1SA 3S0OA 4EH4A 3LXPA 1H25A 2QI8A 3RP9A 4C8BA 4CLIA 4MQ2A 3S1HA 3UNKA 3SRVA 3V8TA 1M2RA 1B38A 3NVMB 3DB6A 4Q9SA 4TY1A 3L8PA 3QWKA 3RK7A 1G5SA 2QG7A 5IQIA 3PXZA 3IQ7A 1M2PA 4BWKA 2GNIA 2Y4PA 3LFAA 2OH0E 4IWDA 2F7EE 3W1FA 5KMOA 3U4UA 2FB8A 5CX9A 2P33A 4JDKA 3WZJA 4FA2A 2C6IA 4LQMA 5A4CA 4BIDA 2YCFA 5BMMA 3EQGA 4ZY5A 4H1MA 4B99A 4D4VA 1YI6A 3DJ5A 4UWYA 3VJNA 4XG6A 5ETCA 4IXPA 3ZBXA 3WF9A 2YABA 1REKA 4H58A 2PTKA 2VTOA 1ZY5A 3MVMA 4PL4A 5AWMA 3RVGA 1GIHA 4BB4A 3WZKA 2A1AB 3E8CA 4HGTA 2Y9QA 5A3XA 4O6LA 3BPRA 5IEXA 3LCTA 4CT2A 2J7TA 3NDMA 2PUNA 3PPJA 2GNGA 3CP9A 5M4CA 2GFSA 5AUWA 5HO6A 4XX9A 4OTGA 4E5AX 4BGGA 3NMUF 4PNKA 4FT7A 3KXXA 2ZB0A 3CE3A 2X8DA 4FIIA 3WF6A 4I4FA 4M68A 3TUCA 3I7CA 3QALE 4BDGA 4F9BA 5IH5A 4I93A 2WNTA 4PY1A 3GC8A 3RPVA 3UG1A 3WZUA 4ASDA 1YWNA 1LR4A 1P4OA 4EH2A 2J51A 1SNXA 2ZM3A 3CXWA 3PSBA 2PK9A 4DHFA 2ITVA 2X6EA 3HV7A 5AR3A 3LXLA 2HY0A 4D55A 5LARA 4APCA 4DEHA 3E87A 1YXVA 2WEVA 5ETFA 4XLVA 3KMMA 4HGEA 2W7XA 3BHUA 2W9ZB 3CPBA 2YAAA 2DYLA 2C1BA 2Q0BA 4YC3A 3W18A 1IA8A 2VN9A 4AW2A 4JJRA 3LLAA 3SG8A 5AV0A 2BR1A 3W2RA 4Q9ZA 1H0WA 4EK6A 4ITHA 5EK7A 5FTQA 2P55A 3QZIA 3E8NA 3SDJA 5JFWA 3QTWA 3NNWA 3MFTA 4RSSA 5IMEA 2JBOA 4R6VA 2C3JA 3QQLA 4U3YA 5K0XA 2XNGA 2R3PA 4BIBA 3QCQA 5CAPA 4FT5A 4V04A 4F7JA 3GCVA 5CF4A 4Y73A 3KMWA 4Q2AA 1UA2A 4F70A 4DGNA 5CANA 3OEFX 4ZY4A 3PLAE 3BEGA 4KIOA 3CJFA 3W10A 2QHMA 4M15A 1Q61A 3PA4A 5TO8A 2YWVA 5TOZA 3NIZA 5L4QA 3D7TA 3ZRMA 4FL2A 1UWJA 3G6HA 3FWQA 4RVLA 3UO6A 2V0DA 3WZEA 4DEEA 4DYMA 5KNJA 3OY1A 1WVWA 4YJRA 3II5A 4FC0A 3VBVA 4GYIA 5JFSA 4E4NA 1MQ4A 5AAFA 5F1ZA 1UNHA 2XEZA 4GT3A 4YJNA 3TZMA 4KBKA 2R3KA 3IW6A 3OCTA 2C5OA 4GYGA 4KKHA 4XMOA 4EHEA 5CT0A 2BILB 4QMLA 2PZ5A 2XH5A 5GNKA 3MA3A 4GH2A 1DI9A 2CDZA 4JI9A 4FTKA 1OPKA 1TQPA 3W33A 3R9HA 2O65A 3NGAA 2JKOA 2R3NA 2WGJA 4C7TA 4HW7A 3DOGA 4X2NA 4CFWA 1YI3A 5IPJA 3QQUA 3ZUTA 4ASEA 4RFMA 2QNJA 5JMSA 3G90X 4TWPA 4XHKB 2PY3A 3MPTA 3KQ7A 2J5EA 3HNGA 2AC3A 3QTZA 3O23A 3DJ6A 4FV7A 3DZQA 3L9NA 2RG5A 3S3IA 1BL7A 5EOLA 5CU6A 4FTJA 5CEPA 2HWOA 3PJCA 1Q8UA 5H3QA 2W06A 4XG7A 4FVQA 2VNYA 3FQSA 4WNKA 3FDNA 4AOTA 3QQKA 4II5A 4LV8A 5EDQA 4Y46A 3WF5A 4Y5QA 4Z9LA 3RI1A 1VJYA 3HRBA 4GFGA 5FWKK 5E8VA 2XRUA 3VBWA 4ZSJA 3Q5ZA 1W8CA 2E9VA 1OITA 3OUKA 4JDHA 2OJFE 4RVTA
chains in the Genus database with same CATH superfamily
4XP0A 2CHLA 2VO3A 4KIPA 3D5WA 5IQDA 4HCTA 1KWPA 3BHVA 3BV2A 3FPQA 4YLKA 4IAIA 4YJVA 2FO0A 3RPYA 2YHVA 4YZBA 3RPOA 1OMWA 3JY0A 3PDTA 3UZTA 2PVHA 2G01A 4CRSA 4AXAA 3T3VA 1OKWA 2ZOQA 2R2PA 3FJQE 3NR9A 5DWRA 3FC1X 4QP4A 4HVHA 1W2DA 4BTFA 5F4NA 4K8AA 5DOSA 4D5HA 1JWHA 2V22A 2Z7RA 3LZBA 4N6YA 4DN5A 1W2FA 1Q8YA 4KRDA 3F66A 3MFRA 4RPVA 1Q24A 3BI6A 4TNDA 1ZMWA 3OF0A 4M69A 1NXKA 2YIQA 3UZPA 4CEGA 4C37A 4RWKA 1K2PA 3MIAA 2PVJA 3GFEA 2UW6A 4DAWA 4E26A 5L2IA 5L8KA 4DDGA 2ITZA 1WBWA 3A7GA 3PXYA 3LMGA 3C1XA 3QXPA 4J1RA 5FEEA 4F7LA 2VTPA 4JAIA 5E8UA 5HX6A 4AN2A 2YACA 4G9RA 2R7BA 4RX5A 3SA0A 2WTVA 1AD5A 5H2UA 3BYOA 3GU8A 1KE7A 4O0RA 1W84A 2BIYA 4V0GB 4L6QA 5D12A 4RJ5A 5FQDC 4AWIA 4ZEGA 4OBPA 3I5NA 5LVLA 4WIHA 4U45A 3AC5A 4BCJA 3NZ0A 2OZOA 3QZHA 4EH6A 4X3JA 5BVOA 2XANA 2X4FA 4YR8A 5EW8A 2JBPA 3NIEA 4R3RA 5DVRA 5IUIA 2Y6MA 3L8VA 3UYTA 3GU4A 4FRFA 2YLFA 4R1YA 4RZWA 4UN0C 2XCKA 3V8WA 4AW0A 3HX4A 4RIYB 4YLLA 3HLLA 3A7HA 2Z7LA 3C0HA 3EQRA 4QMSA 4W8EA 3NVKI 4RFYA 2VWIA 3PP1A 4K2RA 4PP9A 5DT4A 4XG4A 3V8SA 1Q99A 2X2LA 5BV3A 2IW9A 3L9PA 4O7LA 3LFEA 1ZZ2A 4R1VA 5AX9A 2C6KA 3U54A 3JYAA 4GFMA 2R0IA 3DK3A 2PPQA 2V62A 3QCXA 1PYXA 4D28A 4FGRA 1GZNA 4QP7A 5JH6A 1O6LA 2F57A 2UZDA 3MJ1A 4KAOA 3C4EA 2P0CA 4FNXA 2J0JA 2JD5A 2YIXA 3DAEA 4GUBA 2ZDTA 2XKDA 2YEXA 1PF8A 1A06A 3DB8A 4ZZNA 5HG7A 4EHZA 2BMCA 4CMTA 3QC9A 2C3KA 2UZTA 1I44A 4ARKA 3V01A 4OTIA 4IWPA 4KBCA 3JUHA 5BQ0A 3HL7A 1XBCA 3DFAA 4LOPA 4AAYA 5C4KA 2I6LA 3OD6X 5L2WA 4FIGA 5AV4A 2B9JA 3G6GA 4C3PA 3NYXA 4EOJA 1H1WA 2I40A 1IG1A 2OJGA 2PMIA 3N9XA 5LOHA 4U42A 1FVTA 3FZTA 3R9RA 2QOIA 4BDAA 2GNHA 2WOTA 2IZSA 4FTMA 3R9NA 3EB0A 5EHYA 3BLHA 1AQ1A 3ZO4A 4FV1A 2IF8A 5AP4A 4BI0A 2UW3A 1Q41A 4RX7A 3RPRA 2FSMX 2PVFA 4L7FA 4F08A 1O6YA 3HP2A 4BKJA 2B9FA 4WRSA 1H00A 4GT4A 4MBLA 2UVZA 4WBBB 3OW4A 3W8QA 3CY2A 4FG9A 3R8PA 4I5PA 4R5SA 3DDQA 1REJA 4XH6A 4GSBA 4YJPA 5CEMA 3QRJA 4IWOA 2G2IA 3SAYA 4CZUA 4V05A 3NS9A 3QQFA 4B7TA 3I6UA 4DTBA 3HRCA 4RMZA 2I7QA 1WBTA 2CGWA 2QKRA 2ZJWA 2JIIA 4IZYA 4AGUA 2BZKB 2UW5A 3AC8A 4I6BA 2GU8A 4Q5HA 4YJTA 5KO1A 1V0PA 1YDRE 1JPAA 2OZAB 5CSHA 2BTRA 5DEWA 5CENA 5EI8A 4RIXB 1AGWA 3SC1A 3ET7A 5HVKA 3UDBA 1XO2B 1GOLA 2J9MA 3PUPA 4EYJA 3ODYX 4KIKB 4PUZA 5J1WA 3OEZA 3COMA 1ST0A 5DE2A 1YHSA 4D5KA 4BY9E 5E8XA 3V5PA 4PPBA 3Q9YA 3KMUA 3MV5A 2PVKA 4FMQA 3WE8A 4BYJA 2OJ9A 2WQEA 1Q5KA 3R2BA 5AR4A 4BJJA 4IEBA 1GZKA 1TQIA 4B9DA 4EH3A 1Y57A 2PZRA 3QYZA 4U40A 5KMLA 3FXWA 1ZYSA 2P2IA 5KMIA 4O2ZA 2NNWB 1ZYJA 2R3LA 5FM2A 3PIYA 4UY9A 2OGVA 1UU9A 2ITWA 3U9NA 3KULB 3W16A 4YLJA 2F4JA 5BNJA 4XCUA 4E5WA 2QO2A 2WMAA 3P7CA 3WF8A 3ZFXA 4L44A 2WQOA 3OROA 3DNDA 3GUBA 2R3QA 4EONA 5FP5A 1XH8A 3GCSA 4NW5A 2WTWA 5DYJA 4JL9A 5FDPA 4NWMA 3A4OX 1JKLA 4JVGA 4FKLA 3KVXA 5AP3A 4AA4A 4ANOA 3GU6A 2OXXA 2ITQA 3OFMA 2C6LA 4ACCA 5CAVA 5HCXA 4OW8A 4IHPA 2VU3A 4EKLA 1ST4A 5EDPA 4EJNA 4AF3A 4DG2E 4A9TA 4E73A 3A4PA 1H28A 5AJQA 3QA8A 4O7YA 2YM4A 1OB3A 3EZRA 2YM8A 3HDMA 3MPAA 1MRVA 2OWBA 4QYEA 3GOPA 4XNEA 5K4JA 2OK1A 4BTMA 4IAYA 4D2WA 5T68A 3OHTA 2YIRA 2YDKA 4CCBA 4D1ZA 5BMSA 1KV1A 3R7VA 1PMVA 2PSQA 4U43A 3L8XA 4LGHA 3R0TA 4BZDA 4G2FA 1FOTA 2H34A 4I22A 4S34A 3PVBA 3LJ1A 5BUIA 3QUPA 4HGSA 4XG2A 3VBTA 3VVHA 3BU5A 3QKLA 2RKUA 1ZYLA 4IB1A 4MXOA 3A2CA 3RCDA 3HMPA 4GKHA 3KN6A 2XK7A 5I3RA 2IN6A 3W32A 5L6PA 3D5VA 2GDOA 3Q6UA 3ZZWA 4EOOA 2JC6A 4MTAA 2OFVA 3Q32A 3VUGA 3EZVA 4FICA 4EZ5A 3Q4CA 4QMZA 1OGYA 3PVWA 3SOCA 4ZSEA 4WOVA 3TZ8A 1ZARA 3FMKA 4MUQA 4QDVA 2V7AA 4K18A 4OTFA 3C50A 4BCNA 3OVVA 4ZTNA 3VS7A 1IRKA 3GBZA 2PYWA 3UNZA 4CQEA 4B6LA 2X7GA 3PJ3A 3CEKA 2VGPA 2W9FB 5DRBA 3UOKA 1X8BA 4O7VA 3VIDA 3GVUA 4ACHA 2BALA 4NIFB 4FV0A 4EEVA 2WMRA 3FMNA 3JS2A 3NNXA 5EI6A 5FRIA 3BGQA 3GU5A 4D2VA 3DPKA 3EFLA 5FDXA 2QOHA 2YM5A 2QOKA 4IE9A 4TYGA 4NTTA 4DLJA 1OECA 4L53A 3DLZA 3HV6A 5IISA 3DK6A 4M66A 4HYUA 2CNQA 1BI7A 3E5AA 2PVRA 4AZSA 3QTRA 1OKZA 3O8TA 3D14A 4PMTA 4IM0A 2JGZA 5AADA 2H8HA 4O7WA 2RG6A 2W0JA 3VAPA 4AT5A 2ITOA 4QQTA 5BVDA 2R3FA 4FG7A 3CQWA 1CM8A 3DZOA 3ZRKA 5JQ8A 3E3BX 5HE0A 3MVHA 3VWAA 2XNNA 1NVQA 3LFQA 4FVPA 2CCHA 5HO8A 3TL8A 2X0GA 4FTAA 1FBNA 1XH5A 4D9TA 3O51A 5GIPE 4DEDA 4DFLA 4FT0A 1RE8A 4TYEA 4UB7A 1XKKA 3QAME 4AGWA 4OGRA 3QKKA 4ZZMA 4O4CA 3UOHA 5LWMA 2XIXA 2JITA 4FYNA 3VN9A 2B55A 4YBJA 5IQEA 4I3ZA 2R3HA 1DAWA 3ZSGA 3LFCA 3MESA 3H30A 4MXYA 4YSMA 2BHHA 2JKQA 3EN9A 4TPTA 2VNWA 4EH8A 3PSDA 4FTUA 4XRJA 4RVMA 3TZ7A 1SM2A 4C2WA 1K3AA 2CGUA 3KY2A 1JSUA 2VWVA 2JFMA 4H3PA 3HA8A 3DKCA 5BVWA 4D2TA 3QRTA 1DI8A 4O21A 2UW9A 4CT1A 3VS2A 3QKMA 5F20A 3ENMA 1WBPA 3QHWA 4FZAB 4C4EA 4K0YA 1KE9A 1YXXA 5C27A 3K3JA 1P14A 1U46A 4G31A 4IQ6A 4J97A 4DGLC 4MF1A 3TN8A 4D4YA 3ZH8A 3T9TA 4MX9A 4AE9A 4FZDB 2FA2A 2ZM1A 4W9XA 2CKOA 3NCZA 3A61A 4OUCA 2YIWA 4ID7A 2VUWA 3TIYA 4AZEA 4BYIA 3SD0A 3VUKA 4ACGA 1YOMA 3PVUA 5JRQA 3D0EA 4YNEA 3V6RA 5JQ5A 1FINA 5D9HA 3FLSA 2UZUE 4KSPA 3OBJA 5HLNA 1PKGA 3FQHA 3G33A 4XUFA 4F99A 5E8ZA 2BRNA 4FZ7A 1ZZLA 5IUHA 4XYFA 4EOPA 3LCSA 5HTBA 4C57A 1FMKA 3ZRLA 3LCOA 2OXYA 2BUJA 1UKHA 4JLCA 3FXXA 1FVVA 4DEBA 4RJ6A 5ANDA 3Q9WA 2ZAZA 3ZLYA 4DFZE 3FE3A 4FTQA 4FR4A 1H27A 4OTWA 5D41A 4I6LA 3EH9A 4BDKA 2ERZE 5CNOA 2B1PA 2QO9A 2GCDA 1BUHA 3NYNA 3VW6A 3QA0A 5HKMA 2GQGA 3PXKA 2OF4A 4U44A 2PULA 4AAAA 4E93A 1UWHA 4WHZA 2ONLC 4RLLA 3ZSIA 2OF2A 2C3IB 4WUAA 4F6WA 2V5QA 3OWKA 2NPQA 3LIJA 1YWRA 3TCPA 1MRUA 2WIPA 5CZHA 1V0BA 3PTGA 3GOKA 3MB6A 5AEPA 5IH6A 4EC9A 4O7NA 2XNOA 2C69A 4BHZA 4J71A 3REPA 3FMHA 4BR3A 1BI8A 2JDVA 3Q3BA 3QTXA 4QQCA 1W7HA 3FL4A 3ULZA 3AXWA 3FSFA 3CC6A 3BU3A 5AP2A 2NRUA 4R3CA 3OWPA 5GJFA 4EK3A 4Z55A 1B6CB 3GEQA 2QVSE 4QMWA 2BDFA 1P5EA 3B2WA 3BELA 3DDPA 5GHVA 5HIBA 4DA5A 5HBHA 5J8IA 3BL9A 4YJSA 3RTPA 3O17A 3TKIA 3NEWA 2OBJA 4NCTA 5KMKA 2JDRA 3H9RA 1H24A 4HVSA 4DGGA 3ZU7A 4J53A 5CT7A 5L6OA 4C3FA 3FPMA 2CGXA 3R6XA 2J2IB 3BE9A 3BGZA 5CVGA 2ITTA 3NUXA 3P78A 3PRFA 1F3MC 3NCGA 1CKJA 4XBUA 3DAKA 3RHXA 4F65A 3KEXA 4FKJA 3BHTA 2JAMA 4DINA 3O96A 2VTMA 2XYNA 5BX0A 2BKKA 4J8NA 5K4IA 3C13A 2XKCA 3W8LA 3CS9A 4XV1A 3MN3A 1G3NA 2W1IA 3AKLA 4JRNA 3TV7A 4XV3A 2GNJA 4AXCA 5GJDA 3NW6A 4EORA 5AM6A 5CS6A 1OKVA 1J3HA 4DFUA 5ANIA 4TKSA 3Q4TA 1IEPA 2GSFA 2XNBA 4QMYA 3BWFA 3AC1A 3EL7A 2R3RA 4HYIA 3EKKA 1QL6A 4U80A 2R3JA 2ZV9A 5I9XA 4AOJA 4D0XA 3VBQA 4C59A 2UZWE 4TWNA 1H0VA 4JIKA 4W4WA 5AAGA 1BKXA 5E4HA 3AD6A 4CMOA 2XJ2A 2FSOX 4IX4A 3UNJA 5AIRA 3ORNA 4Y83A 4BDJA 3ID6C 1PXMA 1R78A 2PHKA 3DS6A 3VBYA 4ACMA 1OI9A 2WIHA 5A4EA 2YWPA 4XG8A 1H8FA 3W0MA 5CTPA 2A27A 3ZMMA 2YDIA 4GFOA 5LVNA 2OJIA 4GG7A 4K11A 4Z7GA 1VYZA 2F7XE 3UIBA 2XKEA 4ZSGA 2F9GA 4A7CA 3Q60A 3LCKA 5KX8A 1R0EA 4DGOA 5DMZA 2QOOA 3G9LX 2WTKB 3IW4A 3PE2A 2XJ0A 5A54A 4G9CA 5IDNA 1GNGA 2Y4IB 4DHIB 3NYOA 3C4ZA 1IR3A 1CTPE 2XK6A 4IVDA 4O0SA 5CEQA 2BAQA 4ANLA 3TM0A 2VRXA 4IADA 3ALNA 3BKBA 2YCRA 3PXFA 3RBWA 5JGAA 2JLDA 4PTEA 3FC2A 3OCBA 2F49A 1ERKA 3Q2JA 5LCJA 3W2SA 3PG3A 3WOWA 4FOBA 3NNVA 3HRFA 2FSLX 1WBNA 4E6QA 3ZLXA 1PXJA 2CJMA 2H9VA 2XEYA 3QFVA 5J7BA 2Z7SA 2CN8A 3OXZA 2J0LA 2FGIA 3AMBA 4JBOA 3FLWA 2BZJA 3U6IA 1BMKA 1DS5A 3FYKX 5FBOA 4S2ZA 4DTAA 3PE1A 2B52A 2QOBA 2WELA 3KFAA 4YU2A 2Z7QA 3FMEA 4XG9A 4AZVA 3UPZA 2W4JA 2W4OA 1HCKA 1KE8A 4GG5A 4K9YA 3B8RA 3QD4A 4MXCA 4NM5A 4O38A 5BYYA 4CKJA 3TUBA 4LMNA 4FV6A 4CMUA 2X2MA 1PYEA 2BAJA 3S4QA 4QPAA 3JR1A 3V5TA 3SV0A 4EKKA 3M11A 3R2YA 4USEA 2YITA 4EQMA 4UXQA 2VO0A 4IX5A 4HJOA 5KBQA 3C51A 2YERA 2IVTA 2PMNX 3VJOA 2PVLA 4BKYA 2KULA 5CY3A 4DH5A 3G0FA 4FUXA 1OVEA 4TXCA 2REIA 4XLIA 5HE3A 4CVAA 3R30A 3BQCA 4S32A 4A9SA 4MCVA 4FE2A 4O1PA 3HAMA 4YP8A 3BLAA 3DXQA 3O7LB 4JG8A 3UO5A 1HOWA 5D7VA 4YC8A 1YQJA 1OIUA 3LW0A 5EI2A 4CZTA 2RFDA 1PXKA 4M0ZA 5AR2A 3R7YA 4IBMA 4PMSA 3R21A 2BRHA 4CKIA 2FVDA 2UVYA 4X3FA 4WO5A 4GU6A 3ZXTA 3FYJX 5HG9A 1LPUA 3UQFA 5E1EA 2PE2A 2OH4A 2ZYBA 2YDJA 2IZTA 1Z57A 3I7BA 4L7SA 4C0TA 2Q83A 2OW3A 3AOXA 4BWXA 4FKUA 3SVVA 3VUIA 3R9OA 2EUFB 2JAVA 4BC6A 4D1SA 5AMNA 1FGIA 3BBTB 3HVCA 3KCFA 2E9UA 2VTIA 3I79A 4FODA 4NFMA 4AUAA 5LJJA 1YWVA 5K3YA 2QLUA 3KIOC 5DNRA 1H1RA 4UXLA 4KSQA 3K5VA 5T6KA 1CKPA 2C30A 4BICA 4CG8A 3SRVB 2HZIA 4FL3A 5KZIA 2I0VA 4PDPA 3MS9A 2ETRA 4UZDA 1WVXA 4NJDA 3PWDA 4ZLYA 5LMKC 5G1XA 4QPMA 4GIIA 4BCIA 2WTDA 3EQHA 5L8JA 3WILA 2WTIA 4WG5A 3T9IA 2YAKA 1R39A 3UTOA 4ZTLA 5B7VA 2PMLX 1U54B 4M12A 2ZMCA 4DLIA 4JG6A 3RAKA 1UNGA 3TV4A 3F7WA 4KS7A 1G8SA 4LGDA 3ZEWA 2GTMA 3U9CA 5LMBA 5C8NA 3PP0A 4KRCA 2IG7A 4EQUA 4Y8DA 1XH4A 4BGHA 4USFA 4FEWA 3SG9A 3LFBA 4ZLOA 3GQIA 3UP7A 3AD4A 5E1SA 5IA3A 1L3RE 4BCPA 3F3VA 3G9NA 4PPAA 3R8UA 3G15A 5B2LA 3CR0A 2WMQA 3D5XA 3UVRA 5E7RA 2WMBA 3H9OA 1WVYA 3ORIA 4C58A 4QDEA 1WFCA 3TXOA 2OKRA 4WUNA 4P4CA 1UV5A 3P23A 4L01A 5DR2A 4EZ3A 3AMYA 5CF6A 2UV2A 2QR8A 3QGYA 4A9UA 2GHGA 3R1NA 5ICPA 1ND4A 3RM6A 4ZXTA 3HYHA 3MWUA 4ONAA 5T3QA 3TACA 3TEIA 3EQDA 1OM1A 2AYPA 3FQEA 3Q53A 4RC4A 4BDBA 5KCVA 3SHEA 4W8DA 4FZ6A 3QCSA 1XMLA 4RJ4A 3TDVA 2JIUA 4U0IA 4NTSA 4FEUA 4YTHA 4ZAUA 3ACJA 4M97A 2VTLA 4TYHA 4EYMA 3O8UA 4JR7A 4F0GA 5J9YA 2XBAA 3UIMA 3UIUA 4I5CA 3TKUA 3U87A 1PXLA 5KHWA 4W9WA 4YPDA 5B2KA 2YJRA 3DBQA 3V5JA 1BL6A 4EK8A 4RIYA 2HCKA 3LHJA 5EW3A 5CAUA 4YHFA 3IGGA 5M4FA 4LYNA 2ZMDA 2OU7A 2JFLA 4QP8A 1M52A 3QTUA 4C38A 3ZUUA 2CMWA 4O4FA 4AZTA 3BL7A 2WMXA 4PRJA 3DJ7A 4RVKA 3PVGA 3TKHA 3M42A 3HMOA 3MH0A 3QZFA 3Q96A 4KWPA 2XNEA 4J96A 3DFCB 3E93A 5JKGA 1QMZA 2GQSA 4DH1A 5IA1A 4FKQA 3RHKA 3BHHA 3QCYA 4UALA 4YJOA 5CF8A 5H9BA 3W0PA 3SGCA 2RF9A 2O0UA 3KF4A 5JZJA 3BYMA 1PXPA 1WMKA 2ZFYA 4DBXA 4LUEA 3VO3A 4U9AA 2YN8A 4O4DA 3KK8A 3MW1A 2QR7A 4X6RA 3PZEA 3ORZA 5B0XA 1OL5A 1ZOGA 5G6VA 2R4BA 2FYSA 2DQ7X 2WOUA 3E8DA 2I0HA 3MFUA 3POOA 1XH9A 3ZUVA 4D58A 4I0SA 3D7TB 1VLRA 3WF7A 3R00A 3MY5A 3AT2A 2C0TA 4TRLA 4MVFA 4X2JA 2I1MA 4C36A 1H1SA 2NRYA 2QONA 4YTIA 4AFJA 5A46A 4OAUC 5EDRA 4ASZA 2EWAA 4JRVA 3MH3A 4E6DA 2XA4A 1EH4A 4AP7A 2WMWA 4RIWB 1OL7A 4GIHA 3D2KA 3TUDA 3FKLA 2W1GA 3K2LA 4Y5HA 2XARA 4M3QA 2UVXA 3O8PA 5DR6A 3UJGA 4RGJA 5C8MA 5CAOA 4UV0A 3ORMA 3N4VA 5HE1A 5I9UA 2VZ6A 1YW2A 2EXEA 2HY81 4BRXA 5JFXA 4IAKA 2X7FA 3F5PA 3RWQA 4UMPA 3HEGA 2R3MA 2X9EA 5J87A 4ALVA 5K5NA 1JQHA 5EFQA 5TKDA 5KE0A 3UE4A 1H4LA 3FUPA 4HVGA 4L9IA 2C3LA 1B39A 2XK3A 1OBDA 1PXOA 3OMVA 1ZYCA 4L8MA 3BGPA 4WNMA 2HAKA 1PRYA 2OZAA 4IDVA 5CEIA 4FUYA 3ERKA 3D4QA 4TT7A 5HI2A 1OPLA 2XNPA 3NW5A 3OOMA 4KIKA 3VBXA 5KMMA 4FEXA 3R7GA 3R7UA 3PIZA 4L68A 3DGKA 4BTJA 4C4JA 1XH6A 3A62A 4YHTA 4MXZA 5AR5A 3SKCA 5AA9A 2HWPA 1V1KA 2HZ0A 2JEDA 3R22A 5CU0A 4FBXA 4RA4A 3PA3A 3TIZA 3IGOA 3H3CA 2HELA 4RRVA 3BYVA 1YOLA 4ZK5A 1ZAOA 4F63A 5E8YA 2AUHA 3KULA 4PDOA 4FL1A 4RWIA 5JSMA 2V7OA 3KRRA 4KS8A 3PJ8A 3ZC6A 2UZOA 4OT6A 4UBAA 4QMVA 4ZTRA 1IAHA 1QPEA 3AC2A 3GC0A 3HP5A 5IA5A 4PDYA 2ZVAA 2ZM4A 4TN6A 2UUEA 3O2MA 3OOGA 2UW4A 4FKGA 4AX8A 3CSVA 5HTCA 2G1TA 2YJSA 3OCSA 4QOXA 4HVIA 3PYYA 3OTUA 3WI6A 4R7BA 2KTYA 4LL5A 4FSZA 2EXMA 3QQJA 2GS7A 5JFVA 4QRCA 2JKKA 4UEUA 5ANOA 4I94A 2WTKC 3SXSA 2F7ZE 4BWPA 1JBPE 2GS6A 4N6ZA 4PPCA 3NX8A 3FLYA 3FY0A 2Y4IC 4G3EA 2C47A 5AUXA 3LE6A 3RK9A 3TV6A 4QMQA 3H9FA 3QQGA 4E7WA 4EOQA 4KKEA 4H3QA 4V01A 4I6QA 5I0BA 1ZMVA 5HNIX 4WG4A 2NYAA 3E7VA 3CD3A 1Q8TA 4JQEA 2SRCA 3DQWA 3VHKA 4O7RA 5I5ZA 4AGCA 3VQUA 4L67A 3GENA 4ZJJA 4C4IA 2QOFA 2OIDA 3Q2MA 3EHAA 3FZOA 2GQRA 5L2TA 2VWBA 3E8EA 1KV2A 3IKAA 3V04A 4GCJA 2E2BA 4O86A 2PL0A 2XZSA 4FV9A 4ZMEA 4HCVA 1GZOA 3U6JA 3QTQA 3BLQA 4JQ7A 3VS6A 3HV4A 4JQ8A 4L3PA 3DU8A 5K9IA 4C61A 3CBLA 4UMUA 3EYHA 2C68A 3NW7A 4MXXA 4AN9A 4NM7A 3HKOA 4I23A 4RA5A 5FTOA 5L2QA 3UQGA 4QMNA 4ORKA 1Q3WA 4PDSA 4FV4A 5CSVA 1JSTA 3IK3A 3QX2A 4RFZA 3COHA 5I9ZA 5IQAA 5IU2A 4I4EA 4FTRA 3IG7A 3PWYA 3SX9A 5LMKA 3TT0A 3PY0A 5E90A 2XYUA 3VS0A 3MY1A 4IMYA 3R04A 4FZFB 5HEZA 2WZJA 4OBQA 2IPXA 3LOKA 4NIFA 3RKBA 3Q9ZA 2WU7A 2J6MA 3C0IA 2XUUA 3KF7A 3P7BA 5DPVA 1G8AA 5M08A 3ATTA 4KIQA 5J9ZA 1IAJA 4O2PA 3QF9A 4FV8A 5CEOA 3IW7A 2BDJA 5GINE 2GMXA 2VTNA 4NK9A 1PY5A 2YFXA 4XP2A 3WBLA 3IOPA 3RPSA 3ITZA 4DFXE 4BI2A 3OT8A 5EKOA 3UVPA 3ML1A 3C7QA 4FSTA 4C4FA 3F3WA 5DFPA 4D2PA 2BRBA 3ZCLA 3RWPA 1PXIA 2P2HA 3FI3A 5J5TA 5A6OA 3DBEA 4MH7A 4ERWA 3TNQB 3ZLSA 4JNWA 4FSUA 3KXZA 5DLSA 4NM3A 2G2FA 5TF9A 4S33A 4IAZA 4O27B 3VS3A 3F88A 3FBVA 4HNFA 3HAVA 4NFNA 2BFXA 2C6TA 4IAFA 4Y72A 4BTKA 2HYYA 3EQFA 3PPKA 2E9OA 4IVBA 4R3PA 4BHNA 2W17A 2B7AA 5F94A 3GNIB 4FK6A 5HNBA 4DH3A 3POZA 4OAVB 3UMWA 4FIEA 1T46A 2XIZA 2CN5A 4WSYA 1KSWA 3TNHA 3GI3A 4L52A 4AN3A 3ZOSA 5AA8A 4EHVA 4IANA 4NL0A 3K5UA 2UZBA 2X39A 3GP0A 4F9YA 1G8KA 4XV9A 5IQBA 5DG5A 3JY9A 4XP3A 4E3CA 5KZ0A 2VO6A 5D10A 2IW8A 2R64A 1U5RA 4AT4A 3E88A 3KC3A 4ZJVA 4CFVA 5M4IA 4DGMA 4H36A 3IOKA 4AW1A 2BROA 3FI2A 4ZLZA 1J7UA 4QMXA 4CYIA 4ZY6A 3FMJA 5KKRB 2CKEA 2VTAA 4FI1A 1P4FA 5DT3A 4QTBA 4BJJB 2F2UA 3RZFA 1XH7A 4CLJA 3QX4A 1Q62A 4O83A 2YM6A 4BDEA 2OFUA 2EXCX 2QOLA 1WBSA 3G5DA 1MRYA 4CV8A 2RFSA 3KVWA 4EUTA 3Q04A 3IDBA 4MNEB 2CNUA 5C8KA 2WEIA 2WTJA 3NSZA 5HVYA 4DCEA 3UPXA 3NUNA 3UBDA 4AS0A 2XS0A 4L46A 3C9WA 2GNLA 1KOBA 3NUUA 3GCQA 3C4FA 2YM3A 3EQCA 4MEDA 3UG2A 4QT1A 4J8MA 4Y85A 3FLZA 1XBAA 5M07A 4OR5A 1GAGA 4QP2A 4YMJA 2QU5A 3BE2A 3FZRA 1ZYDA 2QU6A 4QYFA 3TJDA 3EFWA 4K1BA 5KMNA 3DBFA 2GHLA 4PQNA 4RC2A 4TYJA 3CTHA 4U79A 4G3DA 4KUJA 2ZDUA 5HLWA 3LJ0A 4GJ2A 2YZAA 1E9HA 3K54A 3I81A 4J95A 2ZV7A 2VWYA 4QP6A 5FBNC 3ZO2A 3B2TA 4G6LA 1MQBA 2DS1A 4I6HA 4RQKA 3MVJA 4O6EA 4JDIA 4W4YA 2A4LA 4D0WA 4WNOA 4GUEA 4MNFA 4IZ5A 3ZHPC 3MVLA 5JEBA 2C6DA 1OIRA 4ZTQA 4AW5A 2RIOA 2O2UA 4H1JA 4P5ZA 3KK9A 1WBVA 4G6NA 2E9NA 4KA3A 4LRJA 4G5JA 1S9JA 2G15A 3TNPC 4O91A 5DGZA 5L2SA 3AG9A 3QGWA 3F5XA 4QYGA 3F3ZA 4QYYA 1JAMA 4I0TA 4Q5EA 3WARA 1VEBA 4CCUA 5LVPA 3AKKA 4YURA 3LFSA 5M53A 3ALOA 4FIJA 2UZNA 2QOCA 2C5NA 2IEWA 2ITPA 1XHAA 3UOLA 1XQZA 4DTKA 5CALA 5JK3A 5M51A 4RC3A 4H3BA 4X7QA 3E62A 3QRKA 1J7IA 3BV3A 2WQBA 1CMKE 3MTLA 4S31A 3R7EA 4UWBA 2Z8CA 4PMMA 5BYZA 3KXMA 4N70A 5AV2A 3LVPA 4MF0A 2EU9A 2BZHB 2XB7A 3I6WA 3L