2H9VA

Structural basis for induced-fit binding of rho-kinase to the inhibitor y27632
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
393
structure length
383
Chain Sequence
SRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDKYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIKQHPFFKNDQWNWDNIRETAAPVVPELSSDIDSSNFDDIEIPKAFVGNQLPFIGFTYYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Rho-associated protein kinase 2
publication title Structural basis for induced-fit binding of Rho-kinase to the inhibitor Y-27632
pubmed doi rcsb
source organism Bos taurus
total genus 116
structure length 383
sequence length 393
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2h9vA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2h9vA01
3TJCA 4NH1A 3PWYA 1WBTA 4RIWA 4CFMA 5KUPA 2HWOA 2JDVA 4EH9A 3F5GA 4FKOA 5IQAA 3F66A 4YJOA 3ZO1A 1QPDA 4IDVA 4JNWA 5JFSA 4X3FA 4RVMA 2PHKA 3RVGA 5HORA 2WTIA 2WMXA 3AOXA 3P78A 5IQIA 4YLKA 3SV0A 4GEOA 3FQSA 4G6LA 3LQ3A 2UVYA 3KK8A 3DGKA 1LPUA 2J0LA 4Y85A 1UV5A 2C30A 3QHWA 4YJQA 5AWMA 4ZK5A 4F6SA 3S0OA 5FRIA 1Q3WA 4PL3A 4U40A 3E3PA 1A9UA 3PA3A 3MH3A 4G5PA 3TDVA 4DA5A 4FIJA 3EN9A 4G34A 1H25A 5EG3A 2YLEA 3HUBA 4LM5A 1Z9XA 3NNWA 4FR4A 3KULB 4NK9A 4WNMA 5AX3A 3V51A 4EKKA 4EBWA 4KIQA 3UQFA 3DU8A 2QKRA 4UWCA 4B7TA 4BCQA 4WNKA 4CXAA 4BKJA 3UC3A 3KC3A 5E1SA 4C61A 3BGPA 3FKNA 2ZMCA 4ZJJA 3Q9ZA 4MNEB 4USDA 1V0BA 3FWQA 3W2RA 1T45A 2HZ4A 2VWBA 3F7WA 3LFNA 4S2ZA 2FSTX 4F6WA 2W9ZB 4FV4A 2WD1A 4BCGA 4EUTA 2ITUA 4FSUA 5E1EA 2YEXA 4D2PA 2R3FA 2QO7A 3SW7A 3NUNA 3IW4A 5HE2A 5CSPA 2ZM1A 4ZTRA 4CZUA 3PYYA 1FQ1B 1PMEA 3DTCA 5AP5A 4EKLA 5DGZA 4LRJA 4BI0A 1UNGA 1FOTA 4GU6A 3W10A 2ZM3A 2IO6A 3ZSGA 2OJGA 3C4FA 3I7CA 3GENA 5EKOA 5C8NA 2ZVAA 3NUXA 1SMHA 4IVDA 3WI6A 4BYJA 5E7RA 3WF7A 2BRBA 4HGTA 4MXYA 5E8VA 5ANGA 3TZ7A 4MF0A 2V62A 5CZIA 2UZUE 4AZEA 2A0CX 3M11A 2WGJA 4C58A 3NIEA 4LRMA 4O0UA 4D2RA 2F9GA 2OFVA 4E7WA 4LQMA 2R64A 2BZIB 3BGQA 4AUAA 5JGDA 3NR9A 5FEEA 3OMVA 2JKMA 4O6LA 5BVDA 4U6RA 3D9VA 3VWAA 3BYVA 4O81A 2W5AA 3DT1A 5BUIA 2W7XA 3CD8A 3HDNA 4M0ZA 3JY9A 5ANEA 5LVPA 2YM3A 2C0TA 3BX5A 2WU6A 5ACKA 4C7TA 4U79A 3KXZA 4IWQA 4M66A 2QU6A 5L4QA 4BRXA 4BTKA 2PVMA 4FL2A 3ZLSA 5DE2A 3BV3A 4DEHA 3VBTA 4UZHA 4RQVA 2WOUA 2R3NA 5FLFA 3D5VA 3OEZA 4F1MA 2ZB1A 3UVPA 2E9OA 1Q61A 3E92A 3O8TA 3PXQA 4YBJA 3UG2A 3N4TA 1GZOA 4II5A 2C6TA 4MH7A 4RX9A 1JSUA 3Q04A 3BLQA 2GPHA 2UZTA 4TWPA 1JSVA 4RIXA 3JUHA 4D0WA 3BHTA 3ORMA 3E8NA 1BL6A 4MVFA 3BWFA 3V5PA 4FV6A 4JS8A 3TACA 4J95A 4A9TA 2BFYA 3LMIA 4CTBA 2R9SA 3PTGA 2C5NA 3RPRA 4A9UA 3D2IA 1OUKA 3KU2A 2XIXA 1PXLA 3R8ZA 1FVVA 3A7FA 4O27B 2PE2A 4HPTE 4FOBA 1OB3A 3BLHA 2J50A 1ZRZA 4L42A 5KZIA 5JN2A 1ZY5A 3D5XA 5BVFA 5DT4A 2RGPA 3UIXA 4DEAA 4FKVA 4QQJA 3TUBA 3W1FA 3AT4A 4L01A 2J51A 3FE3A 2OICA 3BZ3A 3QWKA 4X21A 5AV1A 3V8TA 3VJOA 4C3FA 3JYAA 3AQVA 3F7ZA 2IW8A 3NVKI 4HCUA 3HV5A 4TN6A 3LJ1A 3R8MA 5AMNA 4CKIA 2GQRA 4UXLA 2HAKA 3Q3BA 4CEGA 3DNDA 3ODYX 4IAKA 4S30A 2W1HA 2P33A 3GOKA 4IB5A 4G6NA 4ANMA 5DI1A 1YXUA 4DFBA 3V6RA 3BQCA 4DT9A 1STCE 2RL5A 3ANQA 4GG7A 5L8KA 4AA4A 5JSMA 3IGGA 1H0WA 3BCEA 5CYIA 2PULA 4EH5A 4YU2A 2F2UA 4WNPA 4BCPA 2BKZA 2JD5A 5CF4A 1WVXA 4ALUA 2WMWA 3LKMA 3UDBA 3SHEA 3DJ6A 3MYGA 4IWPA 1NY3A 3ZLXA 4AGCA 3BEGA 1VYZA 3OROA 4FIEA 3I4BA 4C02A 2A27A 1GNGA 2HXQA 3L9NA 4OLIA 1YOJA 4U45A 1RW8A 3A7GA 2PSQA 4E6DA 1HCKA 4XV2A 5EQPA 4O7YA 3EFKA 3DDQA 3T9IA 3MTLA 3CY2A 3MIAA 4F9BA 2IW9A 3ZCLA 5JFVA 1CKIA 4H36A 3SG8A 4IAZA 4F64A 4EOQA 2FB8A 5IA3A 5IQGA 3P4KA 3DV3A 2C5OA 2JEDA 3C5IA 4YJVA 1FPUA 3RAHA 4KBCA 1IA8A 4IFGA 1NXKA 5HX6A 3M42A 4Q2AA 2YWPA 1WBWA 4F4PA 3QKLA 2V5QA 3D7TA 4RJ3A 3W2PA 4RRVA 3KMMA 2QOBA 3QUDA 4X7QA 3ZZEA 4M67A 1R0EA 4K6ZA 3TNWA 1KE9A 3G51A 1H28A 5IPJA 1G3NA 3GU7A 4RZVA 3BLRA 3MDYA 5IEXA 5IMEA 4ERKA 5F95A 1M52A 4ZEGA 4MWHA 4J52A 4EZ7A 2A1AB 3R2BA 1JNKA 2BAQA 2BZHB 3EJ1A 4FV2A 2QODA 4YZDA 3CIKA 5J7BA 3DNEA 1WBSA 2FGIA 2XK4A 3NDMA 4B9DA 3FHRA 4DAWA 4EBVA 2J2IB 3E7OA 4R1VA 3E3BX 2B53A 3GBZA 4NJ3A 4BCOA 1MRVA 3QAME 5EHYA 3FL5A 3E8DA 1MRUA 1AD5A 3LLTA 4PTEA 2JFLA 3DZQA 4IBMA 5E8YA 4FT9A 1URWA 3QWJA 4IANA 4PP7A 2HY81 3AC5A 3MN3A 4YNOA 3QRIA 5M51A 2J0IA 4WA9A 2PYWA 4LMNA 4EORA 4DLJA 5JZNA 3V5QA 1U4DA 3C4CA 4BBFA 5BPYA 4QYEA 3AMBA 2QU5A 4BI1A 1OIYA 4C4FA 4I92A 3WOWA 4BB4A 5A4EA 5K4JA 4ZY5A 1O6LA 2UW3A 3R63A 2OBJA 3VUTA 4ZLOA 3L8SA 1ZYDA 4G31A 1I09A 3H0ZA 1XH5A 3QTZA 4FZ7A 4P2KA 1W7HA 4AWIA 3G2FA 1SVHA 4KS8A 5JGBA 4GJ3A 3QD3A 4FT3A 4AN3A 3NPCA 3R7GA 3ZM9A 2HZ0A 4IHPA 2O3PA 4PDOA 4E73A 3FC1X 3L8PA 4R7HA 4S34A 5L6WL 5CAQA 3NYOA 2OF2A 4CYIA 1BL7A 2CGUA 4FOCA 4RVTA 4PX6A 1J7LA 3LM5A 2PUUA 5GINE 4WHZA 2QURA 5GNKA 3ZDIA 2YIXA 5LCJA 3VIDA 4QMYA 4MHAA 2C6OA 2BPMA 1WCCA 3LJ2A 2Z7QA 5TE0A 3W2SA 4FKIA 1P2AA 3UNKA 4KBAA 5BYZA 4MWIA 3R8PA 3CJFA 1ZOHA 2HK5A 3FMJA 3QQGA 3TM0A 4YZBA 5EFQA 3NUYA 5A4TA 4ASDA 4GKIA 4O7LA 3NLBA 5HTBA 4NL0A 2BHHA 3OOGA 1R39A 4H05A 3OW3A 4KD1A 2WMUA 3MSSA 5C01A 2VTTA 4K2RA 4QMPA 2YCRA 4RWIA 3QGYA 4QTEA 3DKCA 4CGAA 1TQIA 4GVJA 2E9UA 4FTUA 4QD6A 4E1ZA 3CC6A 4F09A 5K9IA 3FSFA 4XCUA 5CVGA 3UBDA 3PPZA 4EQUA 3KULA 4YZCA 5BMMA 4CFNA 3BHUA 5AIRA 3KXMA 1O6YA 4FV7A 4M69A 4RJ6A 4AW5A 3OZ6A 2BRMA 5ICPA 3OEFX 4F1TA 4MNEA 3W16A 3OFMA 2WTKC 5BVKA 4M97A 4KUJA 2XEYA 1NW1A 3VBYA 3O50A 4JQ8A 3R1QA 5HG5A 3MH0A 3NYNA 5FWKK 1W83A 5EDPA 3VHEA 3P7BA 3I6WA 1H27A 4Y5QA 1WBPA 4XG8A 5L6PA 4U3YA 5AX9A 3PXFA 4TXCA 5L2TA 3GB2A 4EH3A 3DK3A 4ARKA 3I5ZA 5LOHA 4O2PA 2PUPA 4EYMA 4FTQA 4BDHA 2HELA 5KMOA 5IQCA 2IJMA 3RGFA 3MBLA 2J9MA 1FMKA 1Y6BA 3OUNB 3RPOA 4BCKA 4DTAA 2PUIA 2DWBA 5ANOA 3G6GA 1M2RA 4QMOA 2WQEA 3QUEA 4QQCA 5FXQA 5JH6A 3HV7A 4NKAA 4JDHA 5DH3A 4ZLYA 4EZ3A 3F5XA 3GC8A 4LG4A 2VO7A 4HVGA 4CKRA 4FBXA 3VAPA 3NX8A 4FYNA 2WOTA 4GYGA 3VS3A 4C0TA 2BHEA 3UZPA 4FZDB 4Z55A 5KNJA 3OT3A 5D7VA 4PTGA 4AACA 2UV2A 4CMOA 4FKRA 3QYZA 2YACA 5FBNC 3VW8A 3DKOA 5FBOA 3FPQA 4RIWB 5A4LA 1U54B 3KFAA 3QTUA 3TIYA 3VS7A 5LMKA 5CVFA 4APCA 4XV9A 2VGOA 3JS2A 3TKUA 5GJDA 3E62A 4L9IA 2PE1A 3LMHA 3DTWA 2XF0A 3QQJA 4RX7A 4C3PA 4E4XA 3PE2A 4BIDA 1OM1A 2YCQA 3UOLA 4IE9A 2RFEA 2VNYA 3BV2A 5GIPE 4DH1A 4FSTA 1XQZA 2GU8A 2GQSA 2UW9A 4FZFB 1UU9A 5BMSA 4KSPA 3V3VA 3IW8A 3EQIA 3W2CA 3A99A 2R3LA 1RE8A 5L8JA 2B54A 2GNFA 5AUYA 4X2KA 2CGXA 2H6DA 2VUWA 3PP1A 4QYYA 5HD7A 4YHTA 4ANNA 4RLLA 4WBBB 4AA5A 4RPVA 4B0GA 2VU3A 4TWCA 1JWHA 4YTIA 1OKZA 3C4XA 3DXQA 3AGMA 4I6BA 4R5YA 4AT4A 5CAPA 2ETMA 5EOBA 2C3JA 2O65A 3SOCA 3V8WA 3RZBA 5AAEA 3R73A 4TW9A 3PXZA 5LVOA 3R8LA 1SVGA 2Z7RA 3DAKA 2Y9QA 2BRHA 4IAYA 1YI3A 1Q8WA 3U55A 2WEVA 3DAJA 3IOPA 3V01A 4HCTA 4F9YA 3F69A 4ACHA 5K5XA 5CT7A 1XWSA 5HCYA 5D9HA 3TKHA 4DG0E 2Z8CA 3KXHA 1OPKA 1M2QA 2Z2WA 3N51A 3ORPA 4XG2A 5T3QA 3S4QA 1BMKA 5CZHA 3OXTA 4DEBA 3W8QA 5E8XA 4PMMA 5KMIA 1W84A 4NM7A 5ITAA 4U97A 2RFNA 4BCMA 5KMMA 3ZFXA 3R1YA 4UEUA 5C03A 1H26A 5A46A 5K4IA 5IU2A 2KTYA 3VVHA 4QYGA 3ZSHA 4HW7A 2UZWE 3F2AA 4GYIA 4TY1A 1UU7A 3WBLA 2F4JA 5GZAA 5L6OA 1E1XA 3H4JA 3K3JA 2XKCA 4I22A 1F5QA 4YC6A 4BKZA 3PZHA 3MA6A 3ENHA 3R9RA 3CKWA 2VD5A 1G5SA 4TTHB 4M7IA 5LVNA 5KX8A 4ZJVA 2XA4A 3ZC5A 2QHMA 2PU8A 4DG3E 4QP4A 4Z7HA 3I0OA 2UVZA 3KN6A 4TWOA 5CTPA 5L2QA 3F2RA 4IAIA 2F57A 3PA5A 4QMXA 5DR6A 4L3PA 5JT2A 5E90A 3P0MA 4FT0A 3SW4A 3VRYA 5HO8A 2BRGA 3DCVA 4DCEA 5J9LA 2OLCA 2W5BA 2WMAA 2G9XA 2YLFA 1JKSA 2YITA 3BHVA 2WIPA 4JBQA 4QQ5A 1Q8YA 5ETFA 2CGVA 4XG7A 2HZNA 3Q32A 4PL4A 4GFMA 4O1PA 2B9FA 3BI6A 4L43A 4OTFA 2O64A 4WBOA 3D0EA 3FZTA 5CWZA 3TXOA 4A9SA 3HNGA 4F7NA 3IGOA 2E9VA 3FLQA 5LVMA 1PRYA 5DHJA 2F7ZE 4EK6A 1KOAA 4GRBA 5AP3A 4MXOA 1H8FA 4D0XA 3EOCA 3U4WA 2CN5A 2G01A 4G6OA 3V5TA 2XK8A 3GXLA 3BKBA 3QCQA 2CCHA 2WXVA 4Y8DA 1VEBA 2VGPA 1ZOEA 3LXKA 4BCFA 4C59A 4O91A 3PRFA 4YGAA 4WKQA 3P86A 1Y6AA 4TZRA 3R7IA 2UW8A 2CN8A 4MNFA 1ZYSA 3TUCA 2HZIA 4RC3A 3QALE 5CAVA 3SLSA 3AG9A 5EW8A 5IA0A 3MPAA 3P23A 2YIQA 5EQYA 3MY0A 1G8SA 4BBMA 4BR3A 4GT4A 2X39A 3QQHA 1J3HA 3FC2A 1YDRE 3HLLA 2YERA 3KF7A 5AP6A 5BYLA 1APME 3NIZA 2YZLA 2EB2A 3HEGA 4PWNA 4FSNA 2UZLA 2JAVA 4EH6A 4QP3A 2F49A 3VS1A 3S3IA 2XIRA 2XYNA 3FUPA 5CXZA 4E3CA 4EH8A 3TV6A 4F7SA 3QXOA 2GS2A 4X2NA 3O17A 3IW5A 3TL8A 3VS6A 2Q0BA 2YWVA 5EM7A 1OBGA 1ZMVA 2UW6A 2IG7A 3HDMA 2FH9A 3NUSA 1Q4LA 3RALA 1TQMA 2FSMX 2C1BA 2XM9A 1M7NA 2QR7A 4WT6A 3VS4A 3QTWA 3KEXA 2PTKA 4I93A 3VJNA 4YJRA 4BL1A 3N4UA 5HNGA 4XH6A 4NW5A 4V04A 3C0GA 1ERKA 4YZNA 3CPBA 4CTCA 4G9RA 3FY2A 3HP2A 3UE4A 1G8AA 4FVPA 3A62A 3ZRMA 4MXZA 3G9LX 1HOWA 4MXCA 4OBQA 3MS9A 4I6FA 3UPXA 4BCIA 1SNUA 1REKA 3IW6A 3LFCA 3M1SA 4N70A 3WYXA 2HCKA 4CRSA 4FK3A 4EHGA 1V0OA 4W4VA 4RWLA 3VS0A 4PTCA 4D1SA 4TWNA 4OTGA 3T3VA 5FP6A 3O8UA 4C34A 3SA0A 1Q62A 2QQ7A 4H1JA 4DEEA 4R1YA 2CNVA 3FHIA 3MB6A 4I1ZA 4FC0A 4MEDA 5BX0A 3FLZA 3D7TB 3EYHA 5DBXA 4DITA 1Q8TA 4W9WA 2WQNA 4QT1A 3WZUA 3FPMA 3BE2A 2PE0A 3UVQA 4PNKA 3VNTA 3DOGA 1L3RE 3VUMA 4FEVA 1S9IA 4KBKA 5AR4A 4QRCA 5HHWA 3EQHA 5EYDA 4BI2A 2OKRA 1XKKA 1WZYA 3MFRA 4M12A 4LI5A 2XJ1A 3NSZA 3C13A 3RBWA 4FTLA 3F88A 3COHA 4IZ5A 3GCVA 3TZMA 5CXHA 4D1XA 3R28A 2CLXA 2UZBA 3KKVA 4IJ9A 2EWAA 1YQJA 2X8EA 3UGCA 5AR2A 3PSCA 4Y72A 5A6OA 5IA1A 4AOIA 2VX0A 4FKLA 5I3RA 3FYKX 1OL2A 4A7CA 2CNUA 1TQPA 4YJNA 1W98A 3LCDA 2R3OA 4JG8A 1R78A 2B55A 4QO9A 4M68A 1YRPA 4FV5A 4PMTA 4CQEA 3AC1A 3IONA 4BDAA 2GNGA 3COKA 4I23A 3ZS5A 3DAEA 3ZDUA 3LM0A 2UZDA 5CF8A 3VUDA 4UXQA 4WG4A 5K5NA 3D5WA 4V01A 2WTJA 3R71A 4EH4A 5EYKA 5EDQA 5BVEA 5KCVA 3TT0A 5AP1A 2B0QA 2OZOA 2IVSA 4EHEA 5KHWA 2GFCA 5C27A 2BCJA 4JDIA 5AUVA 2PZRA 4OTIA 3AMAA 3U87A 5HIDA 4TNBA 4D5HA 4HVIA 1SYKA 1OKVA 4NWMA 4IWDA 2Y4IC 2WFYA 3KY2A 4BDBA 5C26A 2ZJWA 2R7IA 3GFWA 3KRRA 4I5MA 2P55A 3VUKA 4W8DA 3BU6A 4FTMA 3GQIA 1R3CA 5AM7A 4U81A 4BTFA 4X2FA 2A19B 5LVLA 4USFA 1U54A 2SRCA 4A4OA 4F7LA 4J71A 3OVVA 2JBPA 1TKIA 3LLAA 2YA9A 4JX7A 5DFPA 2PVHA 3KGAA 1AQ1A 1M17A 2I1MA 4JDKA 4MXXA 3ZU7A 3HAVA 4RJ4A 3FZPA 2W0JA 4GK4A 5CEKA 5HU3A 4JL9A 3VHKA 4G3GA 3LFQA 1NA7A 3TN8A 2B4SB 1ZZLA 3F5UA 1O6KA 3TNPC 4G9CA 3PUPA 3HA6A 1PF8A 2QC6A 2VAGA 4D4SA 5JMSA 5E9EA 3R00A 1IASA 3VRZA 3CKXA 5HTIA 2IVTA 2X9FA 3Q60A 4L3LA 3TTJA 3AT2A 4TKSA 4AP7A 1MUOA 2E9PA 3DQXA 1EH4A 3SDJA 4F70A 1FMOE 2OXDA 3KCKA 5AUZA 2ESMA 4ASEA 4BDKA 2VWXA 5C9CA 5T6KA 3FQHA 3GEQA 1OMWA 4CSVA 3ATSA 5HE1A 5HE0A 2B1PA 4E20A 3QQLA 3IS5A 1YDTE 4LOQA 4K0YA 3ROYA 4M69B 1IEPA 1OECA 2JKKA 2PMIA 4JAIA 4QMSA 2I0EA 4ZTSA 3VQHA 2XRWA 4YZ9A 5IH6A 2JIIA 3R7VA 5FP5A 2HWPA 3NZ0A 3IO7A 2J5EA 3LW0A 3NRMA 2ZV8A 4IADA 3HMOA 3OOMA 5D7AA 4NFNA 5LWMA 3MH1A 2QOOA 4I4EA 4DEGA 4XG6A 1BX6A 2PMNX 4E6CA 2GTMA 1OZ1A 3W33A 5DOSA 3FI8A 3FMMA 4UMRA 4XV3A 2OIQA 2VTSA 2XJ2A 2ZV9A 3MV5A 4YP8A 3PA4A 2G2FA 2W06A 4C36A 1VYWA 4B6LA 4O7RA 2NP8A 2O5KA 5M09A 2QG5A 3OBGA 1JQHA 4ZZNA 2Y6OA 2EXEA 4XS2A 3SXSA 1H00A 3DBQA 3HYHA 4ZMEA 3BGZA 3KF4A 2NO3A 4FUXA 3ZHPC 2XP2A 4ACDA 3V5JA 5HVYA 3ZEWA 2PZ5A 3HL7A 4BDEA 2X7OA 3C9WA 4G5JA 3KB7A 3W2OA 4N57A 4BN1A 3F2NA 1YI4A 3K5UA 4ID7A 1URCA 1H1RA 3FMKA 3DKGA 4KKGA 4PPCA 4ZXTA 2ONLA 3ZONA 2RIOA 5HVJA 4DF3A 3HX4A 2X2KA 4D4RA 3QD4A 4K18A 5AEPA 4P7EA 2X4ZA 3A2CA 2G15A 2V22A 3DXPA 4M3QA 1PMVA 1YXTA 3LXLA 4E5AX 2BIKB 3PJ1A 4JQEA 5EI8A 3ZMMA 5AAGA 3L9LA 5KE0A 4ZY4A 2BMCA 4DGLC 3F3TA 1PMUA 3L1SA 4U41A 1ZLTA 1OPJA 5BVOA 2F7EE 4GFOA 4JLCA 3UZRA 4YJSA 4I3ZA 2QKWB 3NNXA 4DBNA 3PLSA 1KV2A 4P4CA 4YO6A 4MXAA 5AR5A 1SM2A 3NCGA 4EH7A 4P5ZA 3QZIA 5JFXA 3UODA 3CTJA 3OY3A 5J5SA 2W9FB 5CI7A 4D58A 3VBWA 3MJ1A 3QA0A 5I9YA 5JGAA 3C7QA 3QQFA 3COMA 4ZTLA 3SC1A 4ENXA 2W1GA 4MAOA 4C3RA 3ZTXA 5FGKA 3TJDA 3FMNA 3E87A 1JAMA 1L8TA 3KXXA 2JDTA 1WFCA 4AG8A 2PPQA 4XRLA 4XOZA 4WRSA 3QX2A 5ANDA 5HTCA 1Q5KA 3ITZA 5JEBA 5J5TA 4IW0A 2W1IA 5E8TA 3FMDA 3PVWA 2WTKB 4O6EA 2UZVA 4BCJA 3CPCA 3E63A 5HBJA 4Y83A 1ZYJA 2WO6A 3P5KA 4TYHA 5E8WA 2BFXA 3PSBA 2UW5A 4ONAA 3H30A 3QU0A 2YM8A 4F1OA 4F9AA 5IQEA 1Z57A 4I21A 4Q9SA 2G1TA 5I9XA 4ZMFA 4RZWA 2YHVA 2WQMA 4KA3A 4J98A 2E2BA 3A4PA 4CKJA 3MB7A 5E8SA 3VO3A 4WUAA 3A7HA 3FJQE 4O7ZA 2R3MA 4GV1A 2J0JA 2CMWA 5M4IA 4RWJA 4QTBA 3EN4A 3HGKA 4UZDA 1UU3A 2JBOA 4D5KA 4EHVA 4W4WA 3WZJA 4JR3A 2ITYA 3FKOA 3NUUA 3ALOA 2CSNA 3EIDA 5AV2A 3SXFA 5F9EA 5KMLA 2BDJA 2QOHA 3POZA 4GCJA 4C2VA 1J1BA 5H8BA 5JRQA 3F3WA 4DH5A 2XJ0A 4WRGA 3RPYA 4PY1A 4EWQA 4IZYA 4FEXA 2VTMA 1SZMA 3SG9A 2C5XA 2HY0A 4WSQA 3ELJA 3WF8A 5DMZA 3DFAA 3MW1A 4ERWA 3GFEA 2REIA 4D2VA 2PVKA 4EQCA 1PHKA 2PWLA 4ZZOA 2C3IB 5H8GA 4EEVA 5BUEA 2Y7JA 1YDSE 1Q99A 5IQHA 4Y95A 2FO0A 3PZEA 4K33A 5AM6A 4QMVA 2LGCA 2B9JA 4FTKA 2GNHA 1FGIA 1M2PA 3NGAA 2YCFA 5CEMA 4BGQA 4PQNA 2OZAA 1DI9A 2C3KA 3ORIA 4IWOA 4TYIA 4D9UA 1H07A 4BCHA 2CJMA 4HYIA 2UW0A 3OC1A 5IUHA 5IG1A 2A4LA 2GSFA 3N9XA 4N6ZA 1BI8A 2HXLA 4OTWA 4LFIA 1UNLA 3ACJA 5HU9A 3BHYA 1FGKA 4D28A 2Q83A 4DC2A 3MVHA 2X4FA 4HPUE 5A54A 2VO0A 3QHRA 3R9HA 4CCBA 4USEA 1VJYA 2CNQA 2CDZA 1ZYLA 3VULA 4YR8A 2X8IA 2YDJA 3UZTA 2RF9A 3WF6A 3ZM4A 2ITNA 4R3RA 5EW9A 5IDNA 3C5UA 4GKHA 3R2YA 3VUGA 1DAWA 2WB8A 2X7GA 3PVUA 1P4OA 4ACGA 3UO6A 3DK6A 4I4FA 5HI2A 3ACKA 3WIGA 3AD4A 4FT7A 1ZARA 4RSSA 2F2CB 2WTWA 3LVPA 4IZAA 3EZVA 3NWWA 4Y73A 5CEPA 2R3IA 4IMYA 3FBVA 4CV9A 2VWUA 3P7AA 4FE2A 2B9HA 2YAAA 2UW7A 5D11A 3QLGA 3OCGA 3KREA 4ZSEA 4X3JA 3CBLA 5EI6A 4ALVA 3UQGA 4ZZMA 2ZAZA 2GS7A 4IQ6A 4EC9A 2C6EA 5J9ZA 5B2KA 4KB8A 4QP1A 2R3KA 1V1KA 3KXNA 4JVGA 4C38A 4ZTNA 4LRKA 3EN6A 2XCKA 3QF9A 1YOLA 1MQBA 3FYJX 2UZNA 5EK7A 3RCJA 4EOIA 3RJCA 4YHFA 1E9HA 4JG6A 4YHJA 4W4YA 4O7TA 1JKTA 3Q5IA 2WMVA 3OP5A 3QRKA 5CQWA 1SVEA 3EHAA 3HA8A 5L2WA 4IX6A 4DFLA 2VRXA 5AV4A 4MD7E 5CSVA 5EYMA 3QRTA 1JPAA 4LOPA 4HGSA 3FLNC 4LL0A 5ETCA 4D4VA 1Q97A 1HCLA 3VBXA 2JIUA 4HVDA 3C51A 3EB0A 2OJJA 1TVOA 4FTAA 1YXXA 3PPKA 3FZOA 2H9VA 3MFTA 4FSMA 3AMYA 4O7WA 3BE9A 2IW6A 5DA3A 4EK8A 3RPSA 5C8KA 2X2MA 3KRWA 3UP7A 2XIYA 4EK3A 2Z60A 4U7ZA 4HJOA 1NT2A 4AT5A 3EQRA 1DM2A 2VTPA 2BDFA 5HICA 3R7UA 4GK3A 1YHVA 3BEAA 4WG5A 4DFUA 4BTJA 5CU0A 4QP9A 4CYJA 5CAOA 5M56A 3R7OA 1UU8A 4MBJA 4XG4A 1H4LA 2FVDA 3TI1A 4HVSA 3EH9A 2OXYA 4BDIA 1FBNA 4BZOA 4UV0A 3QQKA 5C8MA 4CMTA 4MD8E 4G1WA 5F1ZA 4CG9A 3PXKA 1OIQA 4L52A 2W1CA 4FIGA 5HIBA 5AFVA 5CEIA 4H3PA 4H1MA 3COIA 2EU9A 1ND4A 3S2PA 2JC6A 4NT4A 5B2LA 3LCSA 3NAXA 4M13A 3VBQA 4BBEA 4CLJA 2IZTA 1IR3A 2IVVA 2R2PA 3OWLA 4XHKB 2PZIA 4OUCA 4HYUA 4O96A 4X6QC 4FTNA 5EM5A 4DEDA 4NU1A 4HGLA 2XNBA 2OJIA 3DZOA 4RX5A 2WZJA 5CVHA 4L45A 3ORKA 4IZ7A 1ATPE 2OJ9A 2ITZA 1V0PA 4BHZA 1XBCA 2EVAA 4FTJA 3WZEA 3VUHA 4JIKA 2WMQA 4FV1A 1PMNA 2BUJA 3UMXA 4RG0A 1LEZA 5LARA 4RC2A 2OO8X 4ZOGA 3VS2A 3LFEA 1YWRA 4QNYA 3A7JA 3DK7A 4ZAUA 5L2IA 1YOMA 2ZDTA 4ASZA 2NRUA 3ZUVA 4AZWA 4RT7A 3FLWA 3FL4A 1UVRA 2PVFA 3G33A 3KVWA 5D41A 1YHSA 4IDTA 5TO8A 3PFQA 3FXWA 4QPMA 3RK5A 2Z02A 2R3PA 3CP9A 5DWRA 5EHLA 4XBRA 2YIYA 4L53A 3W18A 4DFYA 4ORKA 3I60A 2XK9A 3UIMA 4F08A 2JLDA 4HZRA 5H2UA 3O51A 5KMKA 3DJ5A 5HBEA 4AGUA 4FNYA 3GCQA 4BDDA 3ZRKA 4DT8A 4GW8A 4UMQA 4R78A 3QKKA 1UWJA 1WBNA 5KBRA 2ERKA 5HQ0A 4AE9A 2OH4A 4OTPA 2XNEA 4BC6A 3N4VA 4E5WA 5DT0A 1CMKE 2QLQA 3FXXA 1OIUA 3OY1A 3PIXA 4RA5A 3GU4A 3RZFA 1GOLA 3TV4A 4ZY6A 3UPZA 4KIOA 3UIUA 3QKMA 4ZJIA 2H96A 1K9AA 2W1EA 4CD0A 4FEWA 3DKFA 1REJA 5EI2A 3HKOA 2PMLX 2VTNA 2VWZA 1PXIA 4YUQA 5LMAA 2OW3A 2XKFA 3KA0A 4IVCA 1PJKA 4KKHA 1YKRA 4ZLZA 1WVYA 3PP0A 3WE8A 1LUFA 3K5VA 5J7HA 3OS3A 4RWKA 4GUEA 4R3PA 3T3UA 4OBOA 5EW3A 5J9YA 2OIDA 5C4KA 2UVXA 4J99A 4JDJA 4N0SA 5AP0A 3EQCA 3GUBA 3NNUA 1H1PA 4CT1A 4QP6A 2OH0E 3EQGA 2XB7A 2XVDA 1OVEA 3A7IA 3BBWA 5K0XA 4NUSA 3LXPA 3EFJA 4IX4A 4XYFA 4QMZA 2Y4IB 4EHZA 3DA6A 4RJ7A 2ITPA 5HBHA 3F6XA 5M55A 3LFBA 3HV3A 3OW4A 4U0IA 4N6YA 4EOMA 3DDPA 5EDRA 5TKDA 4AE6A 4C33A 1K3AA 4FKQA 2R3RA 5LCKA 2PUNA 3CSVA 5CU3A 4L3JA 2W1FA 3O7LB 5HG7A 2FUMA 4UB7A 4DLIA 4R7BA 3TTIA 5AUTA 4HVHA 3H0YA 3QYWA 2R7BA 4K1BA 5AV0A 5HO6A 4C4JA 3D83A 3IOKA 5B2MA 4LUEA 3ZLYA 2OGVA 3RHKA 3TIZA 3CQEA 2AYPA 3FLYA 5JRSA 4E4NA 2CKQA 4LGGA 4D2SA 3CD3A 2AUHA 4NM3A 5DEYA 3MY1A 3VQUA 4WO5A 3TNHA 2VO6A 3I7BA 4L68A 1OITA 3NYXA 3QRUA 1KUTA 4DEIA 3QBNA 3RAKA 4FTOA 2PVJA 3DJ7A 4TYEA 5TF9A 3UOHA 3V8SA 5BVWA 4O7SA 4ZS0A 4F9WA 3FI2A 2WELA 3MESA 1PY5A 3DXNA 3LCTA 5IA5A 3ULZA 4AZVA 3GU8A 3EL8A 2UZEA 3F3VA 4F0IA 4DGOA 2J5FA 4LGDA 5H9BA 3TG1A 3PPJA 5CF6A 2GNLA 4I0RA 4MK0A 4D2WA 4FNZA 2A2AA 2EXCX 1VR2A 4F63A 3JVSA 3RHXA 2HW7A 3P9JA 5GZ8A 3VW6A 3CGOA 3HAMA 3HMPA 1IRKA 4GSBA 4S31A 4ANOA 4TYHB 1O9UA 3QTQA 5FTQA 1KOBA 3AC4A 5IUIA 1GAGA 4BWPA 1XHAA 4WD5A 3G5DA 1U5QA 2B9IA 5FEDA 3U6HA 4RC4A 3U6JA 3I1AA 1OL1A 5FXRA 4FV0A 4J96A 4S33A 4C4IA 3LMGA 4HYSA 5DT3A 4FG8A 4IFCA 1XJDA 4UYAA 1I44A 4I24A 4NSTA 3ID6C 2ZB0A 3R7EA 3ZFMA 4CG8A 2QI8A 2QVSE 1XO2B 5EM6A 1QPEA 2R3GA 1YWVA 5DEWA 2P2IA 3D7ZA 4YBKA 2DS1A 4RFYA 5GZ9A 3MTFA 5JQ8A 4DN5A 4R77A 2GHLA 4R3CA 2IVUA 3QTIA 5A3XA 4O0TA 4EC8A 5B7VA 4M14A 4RFMA 4OTDA 3DBCA 4IXPA 3IDBA 3NS9A 2PK9A 5FUTA 1A06A 1K2PA 3R1SA 4MD9E 4DHFA 2XNGA 3UO4A 2BDWA 4OTQA 3E64A 5HIEA 2QR8A 3OCTA 4FSYA 5DRBA 1A48A 4TRLA 1GZKA 3KMUA 4NIFB 4QPAA 5EOLA 3TKIA 2DYLA 2VTJA 2X6DA 2YIRA 3R04A 3T9TA 1F3MC 3RKBA 1RQQA 3C0HA 2QCSA 3AC8A 3NNVA 3OCBA 2ITVA 2XH5A 3P7CA 5CNNA 4UY9A 3RI1A 5KHXA 2RG5A 5LXMA 2EB3A 4W4XA 5CX9A 4L67A 5CASA 2GMXA 3RWPA 4UN0C 5CLPA 3BQRA 2Y0AA 4I0TA 3UQCA 3R02A 1KSWA 1H1WA 2OZAB 3HMIA 2J6MA 4G3DA 2C47A 2X6EA 4AFEA 3DLZA 4XLVA 2IN6A 4AX8A 1OIRA 3LOKA 3EYGA 4PL5A 4ZIMA 1P14A 5HE3A 4FSQA 4HCVA 4EOJA 2JIVA 3R9OA 2R5TA 1YXSA 5TOZA 4EI4A 5DN3A 3OCSA 3ZUUA 3FAAA 3K2LA 4OR5A 3ZEPA 4C8BA 2WQOA 1XBAA 3UP2A 4XG9A 2WNTA 3C1XA 5AR3A 3K3IA 4X3FC 5F20A 5J1WA 3SOAA 4H3QA 3QTSA 4AW0A 2WQBA 4LMUA 2YM4A 3QLFA 2YABA 4ZP5A 3DBDA 3RM6A 3NW7A 1ZMWA 2X9EA 4FTTA 3BYOA 4O0YA 2WPAA 2VTAA 3ZO4A 3U6IA 4FV3A 4CZYB 2IPXA 4OW8A 4X0MA 1WAKA 1OL7A 4JT3A 4Z9LA 1B39A 1WMKA 2RSVA 3AXWA 3W55A 3WYYA 4ANQA 5DR9A 2C0IA 3GP0A 4O38A 3VS5A 3RCDA 5GHVA 4BF2A 2GTNA 3SAYA 2QD9A 5KBQA 3ZYAA 2ITTA 5DPVA 4QYHA 5ETAA 5CAUA 4I5CA 2I6LA 3MPTA 3SQQA 1E1VA 4Z3VA 4AFJA 1FVRA 4JI9A 4UWBA 2VTLA 1YXVA 2YJRA 4EH2A 2X7FA 3EKNA 3NUAA 1H24A 2HENA 2XBAA 1DAYA 5CY3A 4GJ2A 3G6HA 5HG8A 3MY5A 2GNIA 3G0EA 2BAJA 4U42A 3V5LA 4PV0A 2XNMA 3CQUA 5G1XA 1KV1A 2AC3A 2CKOA 2W4JA 4RGJA 1ZZ2A 2XNPA 2FA2A 2IWIA 2XCHA 3KRJA 4GIIA 1M14A 4M15A 4R7IA 2YISA 4FT5A 2C6KA 2CPKE 3FQEA 4XG3A 4PP9A 3R8VA 2ZM4A 4NYEA 4GIHA 4WOVA 4AAAA 3OWPA 4BDJA 4DH8A 3FI4A 2X81A 1Q8UA 1XH8A 4XP0A 3PLAE 4E4LA 1KE8A 4K9YA 3QFVA 4YO4A 3UIBA 3E8EA 3ZOSA 4E6AA 4F99A 3EFLA 2Y4PA 3UYSA 3QCXA 3RP9A 5JKGA 1SNXA 3PVGA 4AZSA 4ZSJA 3Q4CA 4FKGA 3D2KA 4AOTA 4I20A 4BWKA 3QD0A 4O7VA 3H9FA 4P90A 5HO7A 3ZBXA 2KULA 4FTRA 5J79A 1H08A 3FKLA 5CEOA 1CKPA 3FZRA 5JFWA 1XH9A 2WMTA 2YJSA 3PIZA 3NAYA 1YHWA 4TL0A 3OG7A 2OI4X 2JDSA 4MBIA 3G0FA 4HZSA 2XKEA 5ACBC 2W99B 2XMYA 3H3CA 4U8ZA 3ZFYA 3FEGA 2WU7A 2ETRA 2C6IA 2UW4A 3ETAA 3D94A 1RDQE 4U44A 3QUPA 2XK7A 4LGHA 4XRJA 5AIKA 1BYGA 2XIZA 3O7LD 4FNXA 3WZKA 2QLUA 4CNHA 3MI9A 4FI1A 4JRNA 3R9DA 4CMUA 5HLWA 3U51A 2OU7A 4GH2A 3RK7A 4DFNA 4F6UA 1NVSA 3UVRA 1UKIA 1GZNA 3I81A 3QTXA 4TT7A 5HVKA 2JDOA 3A8WA 4KNBA 4ENYA 3ERKA 3ZC6A 1MRYA 3HUCA 4YMJA 1OPLA 1QCFA 4KAOA 4QMLA 3B2TA 1Y91A 5EQEA 5KKRC 4Q5HA 4C4GA 3KK9A 3O2MA 4GVAA 4NTSA 4YPDA 4NEUA 5D1JA 2R0UA 3BHHA 5I3OA 5C4LA 4FA2A 1KWPA 4E4MA 1PXMA 1J7UA 3PE1A 1NVRA 4FIIA 3HMMA 3CJGA 2GNJA 3R7YA 2C4GA 3NW6A 3LFSA 3PSDA 2GS6A 3QZGA 2VX3A 4OT6A 5ETIA 2QOLA 2GHMA 3ENMA 2ITQA 4FKPA 4QTCA 4FKUA 3ZXZA 3GC9A 3BBTB 3C0IA 5BYYA 4FV9A 3RTPA 5DVRA 2G2HA 3RAWA 3FZSA 3ORTA 2BTRA 4X6RA 3ZLWA 3OWKA 4MYGA 2XUUA 4ITIA 3S1HA 3QGWA 4O84A 4JJRA 4XP2A 3Q5ZA 4JXFA 5KZ0A 4ZS4A 1Z5MA 3AGLA 4FZ6A 3FI3A 2W05A 3OT8A 4NKSA 3QC9A 4PPAA 5FD2A 4FGBA 4KABA 4PNIA 5KO1A 4FVRA 4J53A 4JIAA 2QNJA 2WMBA 3E8CA 4WIHA 2VWIA 4QYFA 5CF5A 2CLQA 3OWJA 5K0KA 4Y5HA 1JBPE 1KE6A 4C35A 3R8UA 3GT8A 3KRLA 4XLIA 2VTHA 4AGDA 5M08A 4BYIA 2VX1A 3PDTA 1OI9A 5D12A 4RFZA 2R0IA 3R21A 4B8MA 2PMOX 5JK3A 4E26A 4FSRA 3QL8A 2QOCA 3HV4A 4AN9A 4YTFA 4U3ZA 3ZO3A 4EOOA 5HNIX 3RINA 4QMNA 4AA0A 4EONA 2BZKB 4I94A 3II5A 4W8EA 3NVMB 3F5PA 3HRFA 3QA8A 4G3FA 4JX3A 3P79A 3H9RA 3O71A 5FM3A 5HESA 5HOAA 3ZO2A 3CE3A 3NCZA 1UWHA 4DGGA 3OTUA 2OF4A 2E9NA 3KXGA 3ZBFA 3Q2JA 1P4FA 3HRBA 3FZ1A 3NMUF 4QPSA 3S00A 1PXPA 2BAKA 2X0GA 4IH8A 2C69A 2VO3A 4R8QA 1DI8A 3G9NA 4F7JA 4O0VA 4XEYA 4RJ8A 3B8RA 5JZJA 3WARA 4E93A 2VV9A 4NM5A 2FSOX 3C4ZA 1YW2A 4QP8A 3UTOA 5M53A 3ATTA 3DQWA 3FMEA 3HP5A 4XX9A 4YLLA 5F4NA 3NEWA 4QMTA 3BYUA 3R9NA 2C6MA 3LFFA 2OG8A 1CM8A 5J8IA 4C37A 3GC7A 3PXYA 4MTAA 3MH2A 5E92A 3VN9A 3Q6UA 4IACA 3PG1A 3R22A 2QHNA 4AGWA 2EXMA 4H39A 4CZTA 2W1DA 1IG1A 4L00A 5CS6A 4MKCA 2QOQA 4NM0A 4DFXE 2I7QA 2PVRA 4I6HA 4X2JA 5F94A 5HGIA 5I5ZA 4DBXA 3EL7A 4QTDA 4IC8A 4YLJA 4YURA 3I79A 1JVPP 4D1ZA 3E93A 3P08A 3I0QA 2CKPA 1CTPE 2VNWA 2XBJA 3Q52A 3QXPA 4JBPA 1PW2A 4M0YA 4NIFA 4O0WA 4C57A 4JQ7A 3PRIA 4FKTA 4FK6A 3DBEA 2OWBA 4QMMA 2X2LA 3WILA 2C3LA 4JRVA 1OKWA 4GG5A 4WSYA 4BHNA 3PJ2A 4F0GA 5AP4A 3JXWA 2FYSA 2HOGA 4RVKA 4FEQA 5E4HA 1PKGA 2I0YA 1R1WA 3Q9WA 5A6NA 3JPVA 4FEUA 3GI3A 1IA9A 4J8NA 5IEVA 1QL6A 3QD2B 3OD6X 2IZRA 3WZDA 4MQ1A 2PL0A 5HZNA 5M07A 3WIKA 4L44A 5FM2A 4GT5A 2WKMA 4YNEA 5IEYA 3UG1A 5GJFA 4XBUA 3MIYA 4K11A 4ALWA 1BI7A 5CU6A 4YPSA 1CDKA 2V0DA 3R0TA 4FL1A 5EHOA 3MVMA 5TT7A 4ITHA 4BCNA 4J7BA 5I0BA 4NJDA 3T8OA 2R4BA 3JY0A 5AR7A 3IDCA 3SRVA 2OJFE 2ZV7A 4TNDA 5L8LA 4RA4A 4JBVA 4D55A 3C4WA 2WMRA 2G2IA 4DCAA 3E5AA 2ACXA 2YM5A 2WHBA 2YZAA 3CLYA 3E7VA 4NZWB 5J95A 2DUVA 4YTHA 1Q3DA 1GY3A 3GOPA 1PKDA 4HGEA 2QG7A 4EJ7A 5GIOE 3IECA 3OXZA 3OBJA 3UJGA 4BICA 5IQFA 2NRYA 4H58A 4PDPA 2BRNA 2HW6A 3ORZA 2I0VA 1JKKA 1OKYA 3L9PA 3Q6WA 1YI6A 1W82A 4IB3A 4MF1A 5DG5A 3UC4A 3GCSA 5HD4A 2WIHA 4O0SA 4YJPA 1MQ4A 1F0QA 3ORLA 3UNJA 3WF9A 4RMZA 4NFMA 3THBA 3MVLA 3OTVA 5AUXA 5BQ0A 4JOAA 4KIKB 2XK6A 3AD6A 4J1RA 3W32A 1FINA 3JR1A 3HMNA 5CNOA 1BKXA 4GS6A 4YC8A 2BIYA 4CFXA 5HLNA 3HRCA 5FDXA 3B8QA 3R83A 3D15A 3M2WA 2XNOA 3EFWA 3LPBA 3PWDA 3QZHA 2QOIA 4Q5EA 3LQ8A 4J8MA 4BVUA 4HOKA 4XNEA 4XV1A 5I9VA 3PJ3A 3Q4ZA 1ZMUA 2X8DA 2CKEA 2JGZA 4WUNA 3GCUA 4I6QA 2YIWA 3MJ2A 5AP2A 4F9CA 1JLUE 2B52A 4CVAA 5HCZA 4FZAB 3ZXTA 4FF8A 2RKUA 2VWVA 3LZBA 4G16A 2JFMA 2WTDA 3SXRA 5DLSA 3VF9A 4L7FA 2C6LA 3FDNA 1XH7A 5HKMA 3G90X 4AXAA 4D2TA 4W9XA 3HVCA 5IH5A 1LR4A 5FEQA 3CY3A 3JVRA 5G6VA 5B0XA 1BLXA 3OUKA 4RX8A 1S9JA 5HLPA 2YAKA 3ZUTA 3LFDA 3IDPA 1LP4A 3IG7A 2BKKA 4UMPA 2VTQA 1XR1A 4O22A 3EQDA 3GVUA 1OL6A 4I5HA 4IB0A 4BY9E 3FMHA 3CXWA 4DINA 3SGCA 2ZV2A 3UO5A 3PY0A 4ANLA 1W8CA 4RIYB 4BDFA 4O7NA 1OL5A 4R6VA 4L6QA 4U9AA 5L3AA 3DS6A 3EQFA 5LMKC 4AW1A 4O1OA 2BROA 5EYCA 4XUFA 3W8LA 3REPA 1PXOA 5BUJA 5IQDA 3UOJA 2WTCA 4DGNA 4QNAA 4U43A 5CSHA 5A4CA 4IVAA 3DB6A 2OSCA 4UALA 5CENA 4BFMA 4A9RA 4FTCA 2I40A 5A4QA 2J4ZA 2ITOA 3BU3A 4ZSAA 5IA4A 2ZYBA 4QMWA 2AC5A 3PJ8A 3U9NA 1FVTA 3NYVA 4EWHA 4IM2A 5ANKA 2XM8A 5IH4A 3F61A 3ROCA 3V04A 2VWYA 3QC4A 1PYXA 2JKQA 2B7AA 4M84A 5AUUA 3F3UA 4JG7A 5DR2A 4BDGA 2RFDA 3U54A 2W1ZA 4EL9A 2C5VA 5LJJA 1QMZA 1XH6A 4MBLA 4ZTMA 3PJCA 2WEIA 4FGRA 2Y6MA 3OF0A 1QPCA 2C68A 3MVJA 3RPVA 3O23A 4CQGA 1KE7A 5IKWA 5KMJA 4FKSA 4OGRA 4UMUA 3KL8A 3ET7A 3BYMA 4PMSA 4M8TA 3Q4TA 3PY3A 4FG9A 4F65A 4RLKA 5I9ZA 3Q53A 3BWJA 3GGFA 4GT3A 1OBDA 2ZOQA 2UUEA 4BZDA 3EN7A 2WMSA 3CS9A 2J7TA 2ITXA 5C1QB 2W17A 4OAVB 4BTMA 2XK3A 5AV3A 4CFVA 4ITJA 5LMBA 4CV8A 1ZAOA 5AR8A 5ANJA 2R3QA 4L8MA 4YC3A 5LWNA 3KVXA 2YM6A 4E5BA 3VBVA 3SKCA 5K3YA 3QCYA 3QQUA 4FKJA 2X1NA 4GUBA 1OUYA 3LIJA 2C6DA 2P0CA 4FIHA 3FY0A 4FNWA 4TYJA 2JAMA 2PVYA 4OT5A 2XEZA 4BIEA 4CFUA 5AUWA 2P2HA 2VTOA 4V0GB 3VC4A 2J90A 3QTRA 3AT3A 4BZNA 1JOWB 4A4XA 4HYHA 5CEQA 3DY7A 4I0SA 3OHTA 4WG3A 4E8AA 4EOLA 1MP8A 2H8HA 4FG7A 2HYYA 5HCXA 2YDIA 2FSLX 3IW7A 3KCFA 4BGHA 1R0PA 1PXKA 3GU5A 3WF5A 1GJOA 3LAUA 3L9MA 3ORNA 5A9UA 3KQ7A 4ZTHA 4CCUA 4DE4A 2QO9A 3D4QA 4IJPA 1GZ8A 5DYJA 1PXNA 1U59A 3AC3A 3WE4A 2CCIA 3BPRA 5J87A 3BU5A 3A8XA 3E88A 4X3FB 3S95A 4AF3A 4EK5A 4FL3A 4Q9ZA 5AA9A 5M4CA 2EUFB 4AZFA 3DFCB 3HV6A 2JITA 5DNRA 5H3QA 3TNIA 4GK2A 4NTTA 1OGUA 2QONA 5M57A 3EKKA 4TPTA 4ZSGA 3CR0A 2VN9A 5HNBA 2J0MB 3NUPA 4XJ0A 1U5RA 1YVJA 3QRJA 3R01A 4YTCA 3LHJA 1ZWSA 3MA3A 5HG9A 4KWPA 3A60A 4JBOA 5ANIA 5IDPA 1VZOA 4IVBA 3KMWA 4GL9A 2VTIA 3HZTA 3O0GA 4UMTA 5HEZA 5FTOA 4PMPA 3CTQA 4O0RA 5CSWA 2IZUA 4OTRA 3Q9XA 4FTIA 4O0XA 3TEIA 2Q0NA 4DTKA 4RJ5A 4ACMA 5JQ5A 3ALNA 4KRCA 4L7SA 3G15A 4KS7A 4DH7A 3A4OX 2ZDUA 4MCVA 1DS5A 2RFSA 2C5YA 2JDRA 3LCKA 2CGWA 2YN8A 3IQ7A 3QZFA 4FYOA 4KINA 4RIOA 3V5WA 2P3GX 4X2GA 4GMYA 5CU4A 5HX8A 2JKOA 4LYNA 4N4SA 1UNHA 3RMFA 5FDPA 5I9UA 1LEWA 4PDYA 4GFGA 3TNQB 4DH3A 2W96B 4AQCA 3GU6A 1Y57A 1GIJA 4L46A 4I5PA 4PDSA 2OIBA 3EMGA 4QOXA 4AW2A 3L8XA 3ULIA 5AJQA 4KIPA 4YJTA 2GDOA 4LUDA 5H8EA 4FKWA 1JSTA 4B99A 5T68A 4LV8A 1ZXEA 3GQLA 3R1NA 4K77A 5J1VA 3DPKA 1WBOA 2O2UA 3FV8A 4C4HA 2XZSA 5AADA 3KN5A 4J97A 3BIZA 3I5NA 4U80A 3OXIA 2QOFA 4G17A 2PVNA 4UWYA 4KRDA 5A14A 5IISA 3D5UA 5CSXA 3SVVA 3I6UA 4XMOA 4F0FA 2V55A 2BALA 3ANRA 4AZTA 1UA2A 5I9WA 3FLSA 1GIHA 4MQ2A 3B2WA 3PY1A 3RNYA 1H01A 2CHLA 3AC2A 3P1AA 2P4IA 3K54A 4IAFA 3Q4UA 4S32A 5EM8A 3UMWA 5E8ZA 5I4NA 4KSQA 4CFFA 3NW5A 4IC7A 4CFWA 4A07A 1J7IA 1M7QA 1X8BA 4OBPA 3GCPA 3UYTA 4FX3A 2PZPA 4TYGA 2VZ6A 5AP7A 2H34A 2BILB 1ZYCA 4IB1A 3RWQA 4AT3A 2GCDA 3RNIA 5AA8A 2V7AA 5CQUA 3A61A 2XRUA 2Z7LA 5TR6A 5IUGA 4P5QA 4ANBA 5FXSA 5FQDC 3HECA 5M4UA 2O63A 3RM7A 2YFXA 3POOA 2O0UA 4IEBA 4ZTQA 4O86A 4PPBA 4EOKA 5LQFA 3TUDA 5E8UA 4RIXB 2ETKA 4YSMA 4G2FA 4DGMA 5M44A 2GHGA 5KKRB 5M4FA 2WAJA 4OAUC 4QMUA 4QP2A 3W2QA 4DFZE 1WBVA 4OTHA 5IZFA 1RJBA 5EH0A 3Q9YA 4KIKA 3U9CA 4EK4A 3CTHA 3FMLA 2WTVA 2GQGA 2ITWA 4ZSLA 1Q24A 2XYUA 1WVWA 4XP3A 4V05A 3VF8A 2GFSA 2YM7A 2NNWB 1B38A 5CALA 3U8WA 3EN5A 4BIBA 1W0XC 4YZMA 1B6CB 4H3BA 3TZ9A 4EOPA 1Q41A 3PG3A 4APPA 4B4LA 4IX5A 3TCPA 4DYMA 4EOSA 1IAHA 1GIIA 3VUIA 2QO2A 4FIFA 4FODA 1AGWA 3LE6A 5CT0A 3V6SA 4B8LA 2OFUA 5IMXA 3DBFA 5DRDA 2O8YA 2Z7SA 4PUZA 1JKLA 1P5EA 3TV7A 4A4LA 1CSNA 4EJNA 5CANA 3BELA 4EYJA 1ZOGA 5KMNA 2XIKA 2ZMDA 3PVBA 4EZ5A 2XNNA 3R6XA 3MGYA 2Y8OA 4IIRA 5IF1A 3ZZWA 4O2ZA 4Y46A 3CGFA 2RG6A 1J1CA 4AS0A 4IAAA 2V7OA 2I0HA 3F3ZA 4IM3A 2YCSA 4O83A 5BNJA 4YSJA 3ZH8A 3EQPA 3KRXA 1Y8GA 2XKDA 4AOJA 2R3HA 4LOOA 3SD0A 4FVQA 4ACCA 2LAVA 3O96A 4JAJA 4NCTC 4R5SA 4Z7GA 3MWUA 4RIYA 4ASXA 2W4OA 3AD5A 4UX9A 4XOYA 1H1QA 3MFUA 2W4KA 4G3EA 3SRVB 3Q2MA 4QQTA 4FSWA 4GU9A 4G3CA 3RK9A 1PXJA 4A9YA 3D14A 4AU8A 4BGGA 3EWHA 3GNIB 2OK1A 3CQWA 4EQMA 2DQ7X 5IA2A 4O82A 5M06A 4DTBA 4K8AA 2BVAA 3TDWA 4O21A 4CT2A 1T46A 3C50A 5AAFA 4DG2E 3IPHA 1IAJA 5IQBA 5EKNA 2HIWA 4FMQA 3UNZA 3H10A 2UZOA 4MX9A 4RVLA 3ORXA 3SX9A 1PYEA 3L8VA 4HNFA 4E6QA 4CLIA 4HNIA 2C0OA 3H9OA 3IK3A 3TZ8A 4FUYA 2ERZE 3FSKA 4LV5A 3BRBA 5D10A 3U4UA 4RBLA 3PIYA 3IKAA 4RQKA 4C4EA 3R30A 1QPJA 4AN2A 4WNOA 4PF4A 2BTSA 4UYNA 4BKYA 1CKJA 3RAIA 5GJGA 5DIAA 3LXNA 4D4YA 2VTRA 4UBAA 3LCOA 3ZSIA 3TWJA 2OXXA 3ZRLA 3QCSA 2PY3A 3C4EA 5CU2A 4Z16A 3DB8A 4C62A 3LQ5A 5FTGA 3Q96A 4QMQA 2R3JA 1XBBA 5E91A 3BYSA 4EUUA 2BZJA 4JR7A 5FG8A 2PZYA 2QOKA 2BR1A 2XS0A 3F82A 3CEKA 3ODZX 1H1SA 4YJUA 1Y8YA 4I41A 3F9NA 4BWXA 5BVNA 4IM0A 4NW6A 1U46A 3QX4A 4KKEA 3DLSA 2F7XE 2J0KA 4LL5A 4U5JA 1H0VA 1KE5A 1ZY4A 3FXZA 4QP7A 1NVQA 4FICA 4ANSA 4BDCA 1BUHA 4QTAA 4A06A 1Q8ZA 3O8PA 1UKHA 2NPQA 2W5HA 3EZRA 3LFAA 1YWNA 5L2SA 1XH4A 3GC0A 4V0GA 2C1AA 4CRLA 2IZSA 4FSZA 4PRJA 4FV8A 2ONLC 3CCNA 2PVLA 4IX3A 3MFSA 5CI6A 4C2WA 4NCTA 3MPMA 1J91A 3UOKA 3EQBA 2YDKA 3LJ0A 2VWWA 3PXRA 4D9TA
chains in the Genus database with same CATH superfamily
3TJCA 4NH1A 3PWYA 1WBTA 4RIWA 4CFMA 5KUPA 2HWOA 2JDVA 4EH9A 3F5GA 4FKOA 5IQAA 3F66A 4YJOA 3ZO1A 1QPDA 4IDVA 4JNWA 5JFSA 3TMOA 4X3FA 4RVMA 2PHKA 3RVGA 5HORA 2WTIA 2WMXA 3AOXA 3P78A 5IQIA 4YLKA 3SV0A 4GEOA 3FQSA 4G6LA 3LQ3A 2UVYA 3KK8A 3DGKA 1LPUA 2J0LA 4Y85A 1UV5A 2C30A 3QHWA 4YJQA 5AWMA 4ZK5A 4F6SA 3S0OA 5FRIA 1Q3WA 4PL3A 4U40A 3E3PA 1A9UA 3PA3A 3MH3A 4G5PA 3TDVA 4DA5A 4FIJA 3EN9A 4G34A 1H25A 5EG3A 2YLEA 3HUBA 4LM5A 1Z9XA 3NNWA 4FR4A 3KULB 4NK9A 4WNMA 5AX3A 3V51A 4EKKA 4EBWA 4KIQA 3UQFA 3DU8A 2QKRA 4UWCA 4B7TA 4BCQA 4WNKA 4CXAA 4BKJA 3UC3A 3KC3A 5E1SA 4C61A 3BGPA 3FKNA 2ZMCA 4ZJJA 3Q9ZA 4MNEB 4USDA 1V0BA 3FWQA 3W2RA 1T45A 2HZ4A 2VWBA 3F7WA 3LFNA 4S2ZA 2FSTX 4F6WA 3UDZA 2W9ZB 4FV4A 2WD1A 4BCGA 4EUTA 2ITUA 4FSUA 5E1EA 2YEXA 4D2PA 2R3FA 2QO7A 3SW7A 3NUNA 3IW4A 5HE2A 5CSPA 2ZM1A 4ZTRA 4CZUA 3PYYA 1FQ1B 1PMEA 3DTCA 5AP5A 4EKLA 5DGZA 4LRJA 4BI0A 1UNGA 1FOTA 4GU6A 3W10A 2ZM3A 2IO6A 3ZSGA 2OJGA 3C4FA 3I7CA 3GENA 5EKOA 5C8NA 2ZVAA 3NUXA 1SMHA 4IVDA 3WI6A 4BYJA 5E7RA 3WF7A 2BRBA 4HGTA 4MXYA 5E8VA 5ANGA 3TZ7A 4MF0A 2V62A 5CZIA 2UZUE 4AZEA 2A0CX 3M11A 2WGJA 4C58A 3NIEA 4LRMA 4O0UA 4D2RA 2F9GA 2OFVA 4E7WA 4LQMA 2R64A 2BZIB 3BGQA 4AUAA 5JGDA 2AQXA 3NR9A 5FEEA 3OMVA 2JKMA 4O6LA 5BVDA 4U6RA 3D9VA 3VWAA 3BYVA 4O81A 2W5AA 3DT1A 5BUIA 2W7XA 3CD8A 3HDNA 4M0ZA 3JY9A 5ANEA 5LVPA 2YM3A 2C0TA 3BX5A 2WU6A 5ACKA 4C7TA 4U79A 3KXZA 4IWQA 4M66A 2QU6A 5L4QA 4BRXA 4BTKA 2PVMA 4FL2A 3ZLSA 5DE2A 3BV3A 4DEHA 3VBTA 4UZHA 4RQVA 2WOUA 2R3NA 5FLFA 3D5VA 3OEZA 4F1MA 2ZB1A 3UVPA 2E9OA 1Q61A 3E92A 3O8TA 3PXQA 4YBJA 3UG2A 3N4TA 1GZOA 4II5A 2C6TA 4MH7A 4RX9A 1JSUA 3W0OA 3Q04A 3BLQA 2GPHA 2UZTA 4TWPA 1JSVA 4RIXA 3JUHA 4D0WA 3BHTA 3ORMA 3E8NA 1BL6A 4MVFA 3BWFA 3V5PA 4FV6A 4JS8A 3TACA 4J95A 4A9TA 2BFYA 3LMIA 4CTBA 2R9SA 3PTGA 4DDIA 2C5NA 3RPRA 4A9UA 3D2IA 1OUKA 3KU2A 2XIXA 1PXLA 3R8ZA 1FVVA 3A7FA 4O27B 2PE2A 4HPTE 4FOBA 1OB3A 3BLHA 2J50A 1ZRZA 4L42A 5KZIA 5JN2A 1ZY5A 3D5XA 5BVFA 5DT4A 2RGPA 3UIXA 4DEAA 4FKVA 4QQJA 3TUBA 3W1FA 3AT4A 4L01A 2J51A 3FE3A 2OICA 3BZ3A 3QWKA 4X21A 5AV1A 3V8TA 3VJOA 4C3FA 3JYAA 1XMMA 3AQVA 3F7ZA 2IW8A 3NVKI 4HCUA 3HV5A 4TN6A 3LJ1A 3R8MA 5AMNA 4CKIA 2GQRA 4UXLA 2HAKA 3Q3BA 4CEGA 3DNDA 3ODYX 4IAKA 4S30A 2W1HA 2P33A 3GOKA 4IB5A 4G6NA 4ANMA 1G8KA 5DI1A 1YXUA 4DFBA 3V6RA 3BQCA 4DT9A 1STCE 2RL5A 3ANQA 4GG7A 5L8KA 4AA4A 5JSMA 3IGGA 1H0WA 3BCEA 5CYIA 2PULA 4EH5A 4YU2A 2F2UA 4WNPA 4BCPA 2BKZA 2JD5A 5CF4A 1WVXA 4ALUA 2WMWA 3LKMA 3UDBA 3SHEA 3DJ6A 3MYGA 4IWPA 1NY3A 3ZLXA 4AGCA 3BEGA 1VYZA 3OROA 4FIEA 3I4BA 4C02A 2A27A 1GNGA 3PFYA 2HXQA 3L9NA 4OLIA 1YOJA 4U45A 1RW8A 3A7GA 2PSQA 4E6DA 1HCKA 4XV2A 5EQPA 4O7YA 3EFKA 3DDQA 3T9IA 3MTLA 3CY2A 3MIAA 4F9BA 2IW9A 3ZCLA 5JFVA 1CKIA 4H36A 3SG8A 4IAZA 4F64A 4EOQA 2FB8A 5IA3A 5IQGA 3P4KA 3DV3A 2C5OA 2JEDA 3C5IA 4YJVA 1FPUA 3RAHA 4KBCA 1IA8A 4IFGA 1NXKA 5HX6A 3M42A 4Q2AA 2YWPA 1WBWA 4F4PA 3QKLA 2V5QA 3D7TA 4RJ3A 3W2PA 4RRVA 3KMMA 2QOBA 3QUDA 4X7QA 3ZZEA 4M67A 1R0EA 4K6ZA 3TNWA 1KE9A 3G51A 1H28A 5IPJA 1G3NA 3GU7A 4RZVA 3BLRA 3MDYA 5IEXA 5IMEA 4ERKA 5F95A 1M52A 4ZEGA 4MWHA 4J52A 4EZ7A 2A1AB 3R2BA 1JNKA 2BAQA 2BZHB 3EJ1A 4FV2A 2QODA 4YZDA 3CIKA 5J7BA 3DNEA 1WBSA 2FGIA 2XK4A 3NDMA 4B9DA 3FHRA 4DAWA 4EBVA 2J2IB 3E7OA 4R1VA 3E3BX 2B53A 3GBZA 4NJ3A 4BCOA 1MRVA 3QAME 5EHYA 3FL5A 3E8DA 1MRUA 1AD5A 3LLTA 4PTEA 2JFLA 3DZQA 4IBMA 5E8YA 1OGYA 4FT9A 1URWA 3QWJA 4IANA 4PP7A 2HY81 3AC5A 3MN3A 4YNOA 3QRIA 5M51A 2J0IA 4WA9A 2PYWA 4LMNA 4EORA 4DLJA 5JZNA 3V5QA 1U4DA 3C4CA 4BBFA 5BPYA 4QYEA 1W2DA 3AMBA 2QU5A 4BI1A 1OIYA 4C4FA 4I92A 3WOWA 4BB4A 5A4EA 5K4JA 4MUQA 4ZY5A 1O6LA 2UW3A 3R63A 2OBJA 3VUTA 4ZLOA 3L8SA 1ZYDA 4G31A 1I09A 3H0ZA 1XH5A 2X0QA 3QTZA 4FZ7A 1W7HA 4P2KA 4AWIA 3G2FA 1SVHA 4KS8A 5JGBA 4GJ3A 3QD3A 4FRFA 4FT3A 4AN3A 3NPCA 3R7GA 3ZM9A 2HZ0A 4IHPA 2O3PA 4PDOA 4E73A 3FC1X 3L8PA 4R7HA 4S34A 5L6WL 5CAQA 3NYOA 2OF2A 4CYIA 1BL7A 2CGUA 4FOCA 4RVTA 4PX6A 1J7LA 3LM5A 2PUUA 5GINE 4WHZA 2QURA 5GNKA 3ZDIA 2YIXA 5LCJA 3VIDA 4QMYA 4MHAA 2C6OA 2BPMA 1WCCA 3LJ2A 2Z7QA 5TE0A 3W2SA 4FKIA 1P2AA 3UNKA 4KBAA 5BYZA 4MWIA 3W0PA 3R8PA 3CJFA 1ZOHA 2HK5A 3FMJA 3QQGA 3TM0A 4YZBA 5EFQA 3NUYA 5A4TA 4ASDA 4GKIA 4O7LA 3NLBA 5HTBA 4NL0A 2BHHA 3OOGA 1R39A 4H05A 3OW3A 4KD1A 2WMUA 3MSSA 5C01A 2VTTA 4K2RA 4QMPA 2YCRA 4RWIA 3QGYA 4QTEA 3DKCA 4CGAA 1TQIA 4GVJA 2E9UA 4FTUA 4QD6A 4E1ZA 3CC6A 4F09A 5K9IA 3FSFA 4XCUA 5CVGA 3UBDA 3PPZA 4EQUA 3KULA 4YZCA 5BMMA 4CFNA 3BHUA 4JMQA 5AIRA 3KXMA 1O6YA 4FV7A 4M69A 4RJ6A 4AW5A 3OZ6A 2BRMA 5ICPA 3OEFX 4F1TA 4MNEA 3W16A 3OFMA 2WTKC 5BVKA 4M97A 4KUJA 2XEYA 1NW1A 3VBYA 3O50A 4JQ8A 3R1QA 5HG5A 3MH0A 3NYNA 5FWKK 1W83A 5EDPA 3VHEA 3P7BA 3I6WA 1H27A 4Y5QA 1WBPA 4XG8A 5L6PA 4U3YA 5AX9A 3PXFA 4TXCA 5L2TA 3GB2A 4EH3A 3DK3A 4ARKA 3I5ZA 5LOHA 4O2PA 2PUPA 4EYMA 4FTQA 4BDHA 2HELA 5KMOA 5IQCA 2IJMA 3RGFA 3MBLA 2J9MA 1FMKA 1Y6BA 3OUNB 3RPOA 4BCKA 4DTAA 2PUIA 2AEGA 2DWBA 5ANOA 3G6GA 1M2RA 4QMOA 2WQEA 3QUEA 4QQCA 5FXQA 5JH6A 3HV7A 4NKAA 4JDHA 5DH3A 4ZLYA 4EZ3A 3F5XA 3GC8A 4LG4A 2VO7A 4HVGA 4CKRA 4FBXA 3VAPA 3NX8A 4FYNA 2WOTA 4GYGA 3VS3A 4C0TA 2BHEA 3UZPA 4FZDB 4Z55A 5KNJA 3OT3A 5D7VA 4PTGA 4AACA 2UV2A 4CMOA 4FKRA 3QYZA 2YACA 5FBNC 3VW8A 3DKOA 5FBOA 3FPQA 4RIWB 5A4LA 1U54B 3KFAA 3QTUA 3TIYA 3VS7A 5LMKA 5CVFA 4APCA 4XV9A 2VGOA 3JS2A 3TKUA 5GJDA 3E62A 4L9IA 2PE1A 3LMHA 3DTWA 2XF0A 3QQJA 4RX7A 4C3PA 4E4XA 3PE2A 4BIDA 1OM1A 2YCQA 3UOLA 4IE9A 2RFEA 2VNYA 3BV2A 5GIPE 4DH1A 4FSTA 1XQZA 2GU8A 2GQSA 2UW9A 4FZFB 1UU9A 5BMSA 4KSPA 3V3VA 3IW8A 3EQIA 3W2CA 3A99A 2R3LA 1RE8A 5L8JA 2B54A 2GNFA 5AUYA 4X2KA 2CGXA 2H6DA 2VUWA 3PP1A 4QYYA 5HD7A 4YHTA 4ANNA 4RLLA 4WBBB 4AA5A 4RPVA 4B0GA 2VU3A 4TWCA 1JWHA 4YTIA 1OKZA 3C4XA 3DXQA 3AGMA 4I6BA 4R5YA 4AT4A 5CAPA 2ETMA 5EOBA 2C3JA 2O65A 3SOCA 4QDVA 3V8WA 3RZBA 5AAEA 3R73A 4TW9A 3PXZA 5LVOA 3R8LA 1SVGA 2Z7RA 3DAKA 2Y9QA 2BRHA 4IAYA 1YI3A 1Q8WA 3U55A 2WEVA 3DAJA 3IOPA 3V01A 4HCTA 4F9YA 3F69A 4ACHA 5K5XA 5CT7A 1XWSA 5HCYA 5D9HA 3TKHA 4DG0E 2Z8CA 3KXHA 1OPKA 1M2QA 2Z2WA 3N51A 3ORPA 4XG2A 5T3QA 3S4QA 1BMKA 5CZHA 3OXTA 4DEBA 3W8QA 5E8XA 4PMMA 5KMIA 1W84A 4NM7A 5ITAA 4U97A 2RFNA 4BCMA 5KMMA 3ZFXA 3R1YA 4UEUA 5C03A 1H26A 5A46A 5K4IA 5IU2A 2KTYA 3VVHA 4QYGA 3ZSHA 4HW7A 2UZWE 3F2AA 4GYIA 4TY1A 1UU7A 3WBLA 2F4JA 5GZAA 5L6OA 1E1XA 3H4JA 3K3JA 2XKCA 4I22A 1F5QA 4YC6A 4BKZA 3PZHA 3MA6A 3ENHA 3R9RA 3CKWA 2VD5A 1G5SA 4TTHB 4M7IA 5LVNA 5KX8A 4ZJVA 2XA4A 3ZC5A 2QHMA 2PU8A 4DG3E 4QP4A 4Z7HA 3I0OA 2UVZA 3KN6A 4TWOA 5CTPA 5L2QA 3F2RA 4IAIA 2F57A 3PA5A 4QMXA 5DR6A 4L3PA 5JT2A 5E90A 3P0MA 4FT0A 3SW4A 3VRYA 5HO8A 2BRGA 3DCVA 4DCEA 5J9LA 2OLCA 2W5BA 2WMAA 2G9XA 3W0SA 2YLFA 1JKSA 2YITA 3BHVA 2WIPA 4JBQA 4QQ5A 1Q8YA 5ETFA 2CGVA 4XG7A 2HZNA 3Q32A 4PL4A 4GFMA 4O1PA 2B9FA 3BI6A 4L43A 4OTFA 2O64A 4WBOA 3D0EA 3FZTA 5CWZA 3TXOA 4A9SA 3HNGA 4F7NA 3IGOA 2E9VA 3FLQA 5LVMA 1PRYA 5DHJA 2F7ZE 4EK6A 3W0NA 1KOAA 4GRBA 5AP3A 4MXOA 1H8FA 4D0XA 3EOCA 3U4WA 2CN5A 2G01A 4G6OA 3V5TA 2XK8A 3GXLA 3BKBA 3QCQA 2CCHA 2WXVA 4Y8DA 1VEBA 2VGPA 1ZOEA 3LXKA 4BCFA 4C59A 4O91A 3PRFA 4YGAA 4WKQA 3P86A 1Y6AA 4TZRA 3R7IA 2UW8A 2CN8A 4MNFA 1ZYSA 3TUCA 2HZIA 4RC3A 3QALE 5CAVA 3SLSA 3AG9A 5EW8A 5IA0A 3MPAA 3P23A 2YIQA 5EQYA 3MY0A 1G8SA 4BBMA 4BR3A 4GT4A 2X39A 3QQHA 1J3HA 3FC2A 1YDRE 3HLLA 2YERA 3KF7A 5AP6A 5BYLA 1APME 3NIZA 2YZLA 2EB2A 3HEGA 4PWNA 4FSNA 2UZLA 2JAVA 4EH6A 4QP3A 2F49A 3VS1A 3S3IA 2XIRA 2XYNA 3FUPA 5CXZA 4E3CA 4EH8A 3TV6A 4F7SA 3QXOA 2GS2A 4X2NA 3O17A 3IW5A 3TL8A 3VS6A 2Q0BA 2YWVA 5EM7A 1OBGA 1ZMVA 2UW6A 2IG7A 3HDMA 2FH9A 3NUSA 1Q4LA 3RALA 1TQMA 2FSMX 2C1BA 2XM9A 1M7NA 2QR7A 4WT6A 3VS4A 3QTWA 3KEXA 2PTKA 4I93A 3VJNA 4YJRA 4BL1A 3N4UA 5HNGA 4XH6A 4NW5A 4V04A 3C0GA 1ERKA 4YZNA 3CPBA 4CTCA 4G9RA 3FY2A 3HP2A 3UE4A 1G8AA 4FVPA 3A62A 3ZRMA 4MXZA 4LDTA 3G9LX 1HOWA 4MXCA 4OBQA 3MS9A 4I6FA 3UPXA 4BCIA 1SNUA 1REKA 3IW6A 3LFCA 3M1SA 4N70A 3WYXA 2HCKA 4CRSA 4FK3A 4EHGA 1V0OA 4W4VA 4RWLA 3VS0A 4PTCA 4D1SA 4TWNA 4OTGA 3T3VA 5FP6A 3O8UA 4C34A 3SA0A 1Q62A 2QQ7A 4H1JA 4DEEA 4R1YA 2CNVA 3FHIA 3MB6A 4I1ZA 4FC0A 4MEDA 5BX0A 3FLZA 3D7TB 3EYHA 5DBXA 4DITA 1Q8TA 4W9WA 2WQNA 4QT1A 3WZUA 3FPMA 3BE2A 2PE0A 3UVQA 4PNKA 3VNTA 5HD4A 3DOGA 1L3RE 3VUMA 4FEVA 1S9IA 4KBKA 5AR4A 4QRCA 5HHWA 3EQHA 5EYDA 4BI2A 2OKRA 1XKKA 1WZYA 3MFRA 4M12A 4LI5A 2XJ1A 3NSZA 3C13A 3RBWA 4FTLA 3F88A 3COHA 4IZ5A 3GCVA 3TZMA 5CXHA 4D1XA 3R28A 2CLXA 2UZBA 3KKVA 4IJ9A 2EWAA 3TYKA 1YQJA 2X8EA 3UGCA 5AR2A 3PSCA 4Y72A 5A6OA 5IA1A 4AOIA 2VX0A 4FKLA 5I3RA 3FYKX 1OL2A 4A7CA 3KIOC 4DHZA 2CNUA 1TQPA 4YJNA 1W98A 3LCDA 2R3OA 4JG8A 1R78A 2B55A 4QO9A 4M68A 1YRPA 4FV5A 4PMTA 4CQEA 3AC1A 3IONA 4BDAA 2GNGA 3COKA 4I23A 2X0OA 3ZS5A 3DAEA 3ZDUA 3LM0A 2UZDA 5CF8A 3VUDA 4UXQA 4WG4A 5K5NA 3D5WA 4V01A 2WTJA 3R71A 4EH4A 5EYKA 5EDQA 5BVEA 5KCVA 3TT0A 5AP1A 2B0QA 2OZOA 2IVSA 4EHEA 5KHWA 2GFCA 5C27A 2BCJA 4JDIA 2IF8A 5AUVA 2PZRA 4OTIA 3AMAA 3U87A 5HIDA 4TNBA 4D5HA 4HVIA 1SYKA 1OKVA 4NWMA 4IWDA 2Y4IC 2WFYA 3KY2A 4BDBA 5C26A 2ZJWA 2R7IA 3GFWA 3KRRA 4I5MA 2P55A 3VUKA 4W8DA 3BU6A 4FTMA 3GQIA 1R3CA 5AM7A 4U81A 4BTFA 4X2FA 2A19B 5LVLA 4USFA 1U54A 2IEWA 2SRCA 4A4OA 4F7LA 4J71A 3OVVA 2JBPA 1TKIA 3LLAA 2YA9A 4JX7A 5DFPA 2PVHA 3KGAA 1AQ1A 1M17A 2I1MA 4JDKA 4MXXA 3ZU7A 3HAVA 4RJ4A 3FZPA 2W0JA 4GK4A 5CEKA 5HU3A 4JL9A 3VHKA 4G3GA 3LFQA 1NA7A 3TN8A 2B4SB 1ZZLA 3F5UA 1O6KA 3TNPC 4G9CA 3PUPA 3HA6A 1PF8A 2QC6A 2VAGA 4D4SA 5JMSA 5E9EA 3R00A 1IASA 3VRZA 3CKXA 5HTIA 2IVTA 2X9FA 3Q60A 4L3LA 3TTJA 3AT2A 4TKSA 4AP7A 1MUOA 2E9PA 3DQXA 1EH4A 3SDJA 4F70A 1FMOE 2OXDA 3KCKA 5AUZA 2ESMA 4ASEA 4BDKA 2VWXA 5C9CA 5T6KA 3FQHA 3GEQA 1OMWA 4CSVA 3ATSA 5HE1A 5HE0A 2B1PA 4E20A 3QQLA 3IS5A 1YDTE 4LOQA 4K0YA 3ROYA 4M69B 1IEPA 1OECA 2JKKA 2PMIA 4JAIA 4QMSA 2I0EA 4ZTSA 3VQHA 2XRWA 4YZ9A 5IH6A 2JIIA 3R7VA 5FP5A 2HWPA 3NZ0A 3IO7A 2J5EA 3LW0A 3NRMA 2ZV8A 4IADA 4O4DA 3HMOA 3OOMA 5D7AA 4NFNA 5LWMA 3MH1A 2QOOA 4I4EA 4DEGA 4XG6A 2XAMA 1BX6A 2PMNX 4E6CA 2GTMA 1OZ1A 3W33A 5DOSA 3FI8A 3FMMA 4UMRA 4XV3A 2OIQA 2VTSA 2XJ2A 2ZV9A 3MV5A 4YP8A 3PA4A 2G2FA 2W06A 4C36A 1VYWA 4B6LA 4O7RA 2NP8A 2O5KA 3AKJA 5M09A 2QG5A 3OBGA 1JQHA 4ZZNA 2Y6OA 2EXEA 4XS2A 3SXSA 1H00A 3DBQA 3HYHA 4ZMEA 3BGZA 3KF4A 2NO3A 4FUXA 3ZHPC 2XP2A 4ACDA 3V5JA 5HVYA 3ZEWA 2PZ5A 3HL7A 4BDEA 2X7OA 3C9WA 4G5JA 3KB7A 3W2OA 4N57A 4BN1A 3F2NA 1YI4A 3K5UA 4ID7A 1URCA 1H1RA 3FMKA 3DKGA 4KKGA 4PPCA 4ZXTA 2ONLA 3ZONA 2RIOA 5HVJA 4DF3A 3HX4A 2X2KA 4D4RA 3QD4A 4K18A 5AEPA 4P7EA 2X4ZA 3A2CA 2G15A 2V22A 3DXPA 4M3QA 1PMVA 1YXTA 3LXLA 4E5AX 2BIKB 3PJ1A 4JQEA 5EI8A 3ZMMA 5AAGA 3L9LA 5KE0A 4ZY4A 2BMCA 4DGLC 3F3TA 1PMUA 3L1SA 4U41A 1ZLTA 1OPJA 5BVOA 2F7EE 4GFOA 4JLCA 3UZRA 4YJSA 4I3ZA 2QKWB 3NNXA 4DBNA 3PLSA 1KV2A 4P4CA 4YO6A 4MXAA 5AR5A 1SM2A 3NCGA 4EH7A 4P5ZA 3QZIA 5JFXA 3UODA 3CTJA 3OY3A 5J5SA 2W9FB 5CI7A 4D58A 3VBWA 3MJ1A 3QA0A 5I9YA 5JGAA 3C7QA 3QQFA 3COMA 4ZTLA 3SC1A 4ENXA 2W1GA 4MAOA 4C3RA 3ZTXA 5FGKA 3TJDA 3FMNA 3E87A 1JAMA 1L8TA 3KXXA 2JDTA 1WFCA 4AG8A 2PPQA 4XRLA 4XOZA 4WRSA 3QX2A 5ANDA 5HTCA 1Q5KA 3ITZA 5JEBA 5J5TA 4IW0A 2W1IA 5E8TA 3FMDA 3PVWA 2WTKB 4O6EA 2UZVA 4BCJA 3CPCA 3E63A 5HBJA 4Y83A 1ZYJA 2WO6A 3P5KA 4TYHA 5E8WA 2BFXA 3PSBA 2UW5A 4ONAA 3H30A 3QU0A 2YM8A 4F1OA 4F9AA 5IQEA 1Z57A 4I21A 4Q9SA 2G1TA 5I9XA 4ZMFA 4RZWA 2YHVA 2WQMA 4KA3A 4J98A 2E2BA 3A4PA 4CKJA 3MB7A 5E8SA 3VO3A 4WUAA 3A7HA 3FJQE 4O7ZA 2R3MA 4GV1A 2J0JA 2CMWA 5M4IA 4RWJA 4QTBA 3EN4A 3HGKA 4UZDA 1UU3A 2JBOA 4D5KA 4EHVA 4W4WA 3WZJA 4JR3A 2ITYA 3FKOA 3NUUA 3ALOA 2CSNA 3EIDA 5AV2A 3SXFA 5F9EA 5KMLA 3NFFB 2XARA 2BDJA 2QOHA 3POZA 4GCJA 4C2VA 1J1BA 5H8BA 5JRQA 3F3WA 4DH5A 2XJ0A 4WRGA 3RPYA 4PY1A 4EWQA 4IZYA 4FEXA 2VTMA 1SZMA 3SG9A 2C5XA 2HY0A 4WSQA 3ELJA 3WF8A 5DMZA 3DFAA 3MW1A 4ERWA 3GFEA 2REIA 4D2VA 2PVKA 4EQCA 1PHKA 2PWLA 4ZZOA 2C3IB 5H8GA 4EEVA 5BUEA 2Y7JA 1YDSE 1Q99A 5IQHA 4Y95A 2FO0A 3PZEA 4K33A 5AM6A 4QMVA 2LGCA 2B9JA 4FTKA 2GNHA 1FGIA 1M2PA 3NGAA 2YCFA 5CEMA 4BGQA 4PQNA 2OZAA 1DI9A 2C3KA 3ORIA 4IWOA 4TYIA 4D9UA 1H07A 4BCHA 2CJMA 4HYIA 2UW0A 3OC1A 5IUHA 5IG1A 2A4LA 2GSFA 3N9XA 4N6ZA 1BI8A 2HXLA 4OTWA 4LFIA 1UNLA 3ACJA 5HU9A 3BHYA 1FGKA 4D28A 2Q83A 4DC2A 3MVHA 2X4FA 4HPUE 5A54A 2VO0A 3QHRA 3R9HA 4CCBA 4USEA 1VJYA 2CNQA 2CDZA 1ZYLA 3VULA 4YR8A 2X8IA 2YDJA 3UZTA 2RF9A 3WF6A 3ZM4A 2ITNA 4R3RA 5EW9A 5IDNA 3C5UA 4GKHA 3R2YA 3VUGA 1DAWA 2WB8A 2X7GA 3PVUA 1P4OA 4ACGA 3UO6A 3DK6A 4I4FA 5HI2A 3ACKA 3WIGA 3AD4A 4FT7A 1ZARA 4RSSA 2F2CB 2WTWA 3LVPA 4IZAA 5BV3A 3EZVA 3NWWA 4Y73A 5CEPA 2R3IA 4IMYA 3FBVA 4CV9A 2VWUA 3P7AA 4FE2A 2B9HA 2YAAA 2UW7A 5D11A 3QLGA 3OCGA 3KREA 4ZSEA 4X3JA 3CBLA 5EI6A 4ALVA 3UQGA 4ZZMA 2ZAZA 2GS7A 4IQ6A 4EC9A 2C6EA 5J9ZA 5B2KA 4KB8A 4QP1A 2R3KA 1V1KA 3KXNA 3W0RA 4JVGA 4C38A 4ZTNA 4LRKA 3EN6A 2XCKA 3QF9A 1YOLA 1MQBA 3FYJX 2UZNA 5EK7A 3RCJA 4EOIA 3BL9A 3RJCA 4YHFA 1E9HA 4JG6A 4YHJA 4W4YA 4O7TA 1JKTA 3Q5IA 2WMVA 3OP5A 3QRKA 5CQWA 1SVEA 3EHAA 4FJVA 3HA8A 5L2WA 4IX6A 4DFLA 2VRXA 5AV4A 4MD7E 5CSVA 5EYMA 3QRTA 1JPAA 4LOPA 4HGSA 3FLNC 4LL0A 5ETCA 4D4VA 1Q97A 1HCLA 3VBXA 2JIUA 4HVDA 3C51A 3EB0A 2OJJA 1TVOA 4FTAA 1YXXA 3PPKA 3FZOA 2H9VA 3MFTA 4FSMA 3AMYA 4O7WA 3BE9A 2IW6A 5DA3A 4EK8A 3RPSA 5C8KA 2X2MA 3KRWA 3UP7A 2XIYA 4EK3A 2Z60A 4U7ZA 4HJOA 1NT2A 4AT5A 3EQRA 1DM2A 2VTPA 2BDFA 5HICA 3R7UA 4GK3A 1YHVA 3BEAA 4WG5A 4DFUA 4BTJA 5CU0A 4QP9A 4CYJA 5CAOA 5M56A 3R7OA 1UU8A 4MBJA 4XG4A 1H4LA 2FVDA 3TI1A 4HVSA 3EH9A 2OXYA 4BDIA 1FBNA 4BZOA 4UV0A 3QQKA 5C8MA 4CMTA 4MD8E 4G1WA 5F1ZA 4CG9A 3PXKA 1OIQA 4L52A 2W1CA 4FIGA 5HIBA 5AFVA 5CEIA 4H3PA 4H1MA 3COIA 2EU9A 1ND4A 3S2PA 2JC6A 4NT4A 5B2LA 3LCSA 3NAXA 4M13A 3VBQA 4BBEA 4CLJA 2IZTA 1ST0A 1IR3A 2IVVA 2R2PA 3OWLA 4XHKB 2PZIA 4OUCA 4HYUA 4O96A 4X6QC 4FTNA 5EM5A 4DEDA 4NU1A 4HGLA 2XNBA 2OJIA 3DZOA 4RX5A 2WZJA 5CVHA 4L45A 3ORKA 4IZ7A 1ATPE