2H9VA

Structural basis for induced-fit binding of rho-kinase to the inhibitor y27632
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
393
structure length
383
Chain Sequence
SRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDKYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIKQHPFFKNDQWNWDNIRETAAPVVPELSSDIDSSNFDDIEIPKAFVGNQLPFIGFTYYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-associated protein kinase 2
publication title Structural basis for induced-fit binding of Rho-kinase to the inhibitor Y-27632
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 116
structure length 383
sequence length 393
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2h9vA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2h9vA01
2XMYA 4DFUA 1GNGA 2YACA 3GC9A 1ZMUA 3VF8A 4GT3A 3M42A 4NM5A 4O0SA 3WE4A 2WO6A 3VHEA 4C38A 5LVPA 2R4BA 1Z9XA 3T9IA 2V62A 3VBWA 4TTHB 3Q60A 2C6KA 3MJ1A 4V05A 3TNWA 3CY2A 4QTCA 5IKWA 3QYZA 2PK9A 4IVBA 4IEBA 4IJPA 4W8EA 4DFZE 4E4XA 5HU9A 5CSVA 5AP5A 1YHWA 3ITZA 4YC3A 5BYLA 5BVKA 5IQFA 4PRJA 3GU7A 4M84A 4WNMA 4HVSA 4EOSA 1CMKE 3NUPA 5AP7A 4UMPA 5JFSA 3N51A 3RTPA 4E73A 2R3NA 5HTIA 3HV5A 3UTOA 2HOGA 2NO3A 2OK1A 3ZLYA 2VX1A 5AR3A 3MFUA 3RKBA 3VW6A 5LMKA 5E4HA 3C4FA 5KMKA 5FLFA 5CEMA 5JGDA 3KXGA 3UYTA 2JDVA 4XUFA 4G34A 5FG8A 4CTCA 1WBWA 2H6DA 3SDJA 3ALOA 4I4EA 2VO7A 5HIEA 3R6XA 3FLSA 4KABA 4BDEA 2O64A 2R3JA 2UW5A 4DGGA 1LUFA 1H8FA 4I6QA 2UVYA 3VWAA 4EOIA 3QX4A 3NYVA 1M7QA 1H1PA 4Y5HA 3ZC5A 4CV8A 3D7TA 2C3IB 3SXSA 3T9TA 4D28A 5AA8A 4ZAUA 3E87A 5DT4A 4LUDA 3F88A 4V0GA 3BU6A 5FRIA 2G2FA 4F6WA 4K11A 3R1SA 3DJ7A 2VN9A 2BRNA 3FI3A 4RVKA 3ROYA 4YO4A 4HYSA 3FDNA 4J7BA 4QMNA 1G5SA 1M17A 3A4PA 5GZ9A 3CKWA 2VO0A 2X6EA 3MVLA 4QMUA 4ALVA 1UA2A 2QG7A 3CGOA 4NIFB 4ZXTA 1BKXA 5M55A 2GMXA 3QGWA 4QYEA 4EQUA 3R28A 5DPVA 4FSMA 2JKOA 5B2KA 3UE4A 3OXTA 1Y91A 1S9IA 2RKUA 4QP4A 4A4OA 4G6NA 3A8WA 5AX9A 1IRKA 4FKRA 4M7IA 4FV3A 3QAME 4DN5A 2W05A 4EWQA 3TWJA 2A1AB 3KQ7A 3G0EA 3U6IA 1PHKA 4X2NA 2ERZE 2QR7A 4XX9A 4UN0C 5I5ZA 4FL2A 1W8CA 3A7GA 5EHYA 5IMEA 2X1NA 4R5SA 4YGAA 1H07A 4LOQA 3UO5A 1O6YA 4YLLA 3PE1A 4QMTA 4QTEA 3GCUA 3FE3A 2XM9A 3FC2A 1L8TA 1OPLA 2WTIA 4IB1A 2FO0A 1XH7A 2WQNA 2YWPA 4LV8A 2QI8A 2YCRA 3EN4A 4MQ1A 4S33A 3U54A 5M53A 3FL4A 3FV8A 4FE2A 2F7ZE 1BUHA 3ZONA 3II5A 3ZZWA 4JRVA 2ZV9A 3WILA 1GOLA 3P86A 4MNEA 4XBUA 5HO8A 3V8TA 2G01A 3MPMA 4CD0A 3G90X 4I6FA 4BCOA 4Z16A 4AW5A 4BWKA 4IVCA 4J95A 4A9TA 3F2RA 2WTDA 3PXKA 4FV5A 4ITJA 1LPUA 1OUYA 5M06A 5BYZA 3EN6A 2R3HA 5C8NA 4IMYA 1WAKA 3R8PA 4FGBA 4XG8A 4C4IA 4FKGA 4FTJA 4TWOA 4LFIA 3WZKA 2QOCA 3LXPA 4DEBA 5K4IA 2IPXA 3GI3A 3CD3A 2QOLA 4WUAA 4GT5A 5HNBA 1I09A 5L6OA 2WMBA 3COIA 4A7CA 3ETAA 4EH2A 5HG7A 2DS1A 1JAMA 2YM6A 2ZV2A 3P5KA 4U43A 2QOOA 2UZOA 4RZWA 3RPRA 2DQ7X 3BYOA 3MGYA 3ZUTA 4EKKA 3ODYX 3JS2A 4JAJA 5GZ8A 4L3JA 5LVOA 3C7QA 5AUXA 4DFNA 4FICA 4C59A 5I9YA 1KE7A 4MXCA 5EM6A 1PY5A 3BX5A 4AGWA 2CGUA 4FT3A 4EOOA 2HZ0A 2Z60A 4OAUC 5IA3A 4AZTA 3ZO1A 4GSBA 2FSTX 2QVSE 3PJ3A 4FSRA 2YIQA 4M68A 3MTLA 4OBOA 3TNPC 2W96B 2EXCX 4FV2A 4EUTA 5A4TA 5CU0A 4MD8E 3UQFA 3QTWA 4GVJA 1MQ4A 2QOKA 2XM8A 4JDHA 4WOVA 5EYDA 4D5HA 3M2WA 3VRYA 4QP6A 1SVEA 4GU9A 4L3LA 4EOPA 1O9UA 3R8VA 3EB0A 4IQ6A 2QOFA 3TZ9A 4U41A 2EB2A 2JFMA 4L8MA 3P1AA 4QYHA 5IPJA 2WZJA 2BTRA 4H58A 5L2TA 4NCTC 2BMCA 1Y6AA 2VX3A 3U9NA 4DFYA 5AA9A 3IDCA 3QQLA 4JXFA 4EK5A 5HVYA 5JFXA 4RIYB 4PTEA 1ND4A 3BHUA 1VYWA 2ITNA 4IAYA 4KIQA 4C36A 4GG5A 5K0XA 1P5EA 5CENA 4M0YA 2QCSA 2DYLA 1GIIA 2VTHA 4ZZMA 3ZEWA 2I6LA 4NK9A 3F69A 5HX8A 3QZIA 4YJPA 4F9YA 2C5YA 4C62A 3E3PA 2XYNA 3NNWA 3DKCA 3EN9A 4Q5EA 3VULA 5AUZA 4AT3A 4X21A 4B4LA 4XS2A 3HAVA 5GHVA 4X7QA 1M2RA 2ZMCA 1W7HA 4XOYA 3RINA 5J79A 2WMTA 5CTPA 3PIYA 2HELA 5IQAA 5J1WA 3BQRA 4L67A 4NTTA 4BBEA 4D1XA 2YDIA 3LFAA 4BDKA 3OS3A 4X2JA 2BIKB 2OO8X 3VS0A 4WSYA 1ZOHA 4G17A 4UBAA 3CXWA 2ONLA 5DEYA 5KO1A 2QQ7A 5DWRA 1FVRA 1J1BA 3JY0A 4JBQA 4CFMA 1Y6BA 4FTOA 5LOHA 2UW7A 1FMKA 4YC6A 4E4MA 4EHVA 2ERKA 4FTRA 5CX9A 4CT2A 3DKGA 3EFKA 4AW1A 3HNGA 4IB3A 2Y6MA 4DH8A 4MXOA 3LLAA 4FTTA 2ZVAA 4E6CA 5IEXA 4AOIA 3DBEA 3AC2A 4IBMA 2ZB1A 1PMUA 4LG4A 5CU4A 2C5NA 4XMOA 4RPVA 2YM8A 4L52A 1YW2A 2CKPA 2B54A 4II5A 4ONAA 5KHWA 2W9ZB 3D5VA 2C6LA 3AD6A 3CC6A 4QTBA 3QX2A 2X8DA 5FBOA 2ZDUA 4WSQA 2EU9A 4KUJA 4QP9A 4QMSA 5HBEA 3MYGA 3IECA 5AP3A 4EOLA 4GKIA 3ZRKA 4DH1A 4BCNA 3RAKA 3FMDA 4B0GA 4ASDA 4BGHA 2YISA 4GYIA 2RIOA 3OTVA 4KIPA 4O0RA 4TWNA 1XHAA 4L9IA 3BWFA 4LMUA 5AV4A 2WEIA 3GU6A 2ITWA 2VTPA 3CR0A 3RPVA 4YTIA 4J97A 5HKMA 4E7WA 4FMQA 3NAXA 4P5QA 1YXVA 4ZLYA 4WBOA 2JAMA 4YZCA 3UVPA 3H9RA 3MA6A 4UYAA 4PUZA 4FV1A 4KRDA 5LVMA 5CVHA 3LLTA 1ZLTA 3DNEA 5A4EA 5H8GA 4UWYA 2JD5A 1JLUE 2RFEA 4RJ6A 4USEA 3D15A 2I0VA 3EMGA 4KINA 4Y83A 4FV6A 5I3OA 2R0IA 4NU1A 4U8ZA 2WKMA 2XEYA 5D11A 3G33A 2E9UA 4OTGA 5KMNA 2CN8A 2H34A 4W4YA 2W4JA 3FZPA 4ZSJA 3NX8A 3TEIA 3WI6A 2XS0A 5DR6A 3IS5A 4YBJA 3PXRA 3UYSA 3QWKA 5HG5A 4ACMA 3PPKA 4DGMA 4IX6A 4DLJA 1U54B 4BDDA 1FGKA 3B8RA 3LE6A 3NNUA 3A7IA 4UMTA 4QPMA 3WBLA 4YJNA 1OKYA 3R9OA 5IF1A 3QRKA 3LAUA 3ZSGA 3WZEA 4FSTA 4KAOA 1T46A 5FDXA 4GFMA 2BAJA 3SAYA 4BI0A 4ITHA 2PE2A 2W1EA 2R3MA 2YERA 3BKBA 4NKAA 1OL5A 4FVQA 5E8YA 1V0BA 2WOUA 1Q97A 3ZXZA 4ZTMA 1XWSA 3OC1A 4KBKA 2QLQA 3HUCA 3HX4A 3ZUUA 4A9YA 1NT2A 3MB7A 5TF9A 3TN8A 1JSVA 4E5BA 5DRBA 3RPOA 3NR9A 3PFQA 2Q0BA 4O1PA 1PMEA 3OCGA 1NA7A 3SXRA 2JGZA 3DJ5A 3QYWA 2GSFA 3PPZA 3QXOA 4FTQA 4G1WA 3SW4A 1FINA 4XG7A 4N6ZA 4XP0A 2X8IA 4O83A 3EJ1A 2WTWA 3QQJA 3R22A 4J96A 4JNWA 3MH3A 2B9HA 3UIUA 4CZYB 3ATSA 4Y46A 3WF6A 4B8LA 1J7UA 4JIKA 3AT4A 5LMAA 2R5TA 4I4FA 3C50A 3PY0A 2I0YA 3NRMA 5ETCA 1GY3A 5CF4A 3PZEA 2J7TA 1ZYLA 3ZFXA 2J0LA 3IGOA 3D5UA 4WHZA 3KVWA 2I0HA 2PZRA 5EH0A 4ZSEA 4L00A 2WELA 3DFCB 4HGTA 4ZTSA 3FQEA 4S2ZA 2V7AA 4DT9A 5A6NA 3DU8A 2GTNA 1OITA 3F3ZA 4OR5A 4FX3A 4QNAA 2W5BA 4EH4A 2V5QA 3MFTA 1BL7A 4JG8A 2R3GA 2UZTA 4GFOA 4MQ2A 4RVLA 3RK9A 5IDPA 5J95A 2FSOX 3HMNA 2B1PA 2YJRA 5DA3A 2F9GA 2PVMA 2QOBA 5FEEA 3A61A 3PY3A 2V55A 1FBNA 2X7FA 4OTQA 1Z5MA 2WMAA 5HO6A 4L6QA 5KMJA 3F3VA 4HVGA 3DBDA 4ALUA 4GJ3A 3VN9A 3CY3A 3I79A 4GFGA 2GS2A 4BTMA 3I7CA 4EK3A 2QG5A 3LIJA 4FG9A 4TYIA 3NW6A 1Y8YA 3FZSA 2XIXA 1Y57A 2Y4IC 2C1BA 3R1NA 4KKGA 4DF3A 3LFCA 4O86A 2X39A 2ITOA 1OBGA 1OL7A 3E8EA 4ANNA 4N70A 2BRGA 3NCGA 5C27A 1H25A 4IWPA 1BX6A 4Y85A 4DH7A 4AN2A 2XZSA 4X3FB 1NVQA 4O27B 4LM5A 4A9UA 2Z7SA 2OLCA 3WF8A 5JH6A 3HZTA 3AOXA 2YJSA 4IZYA 3WE8A 4IM2A 4DG3E 1KUTA 2Y9QA 2ITPA 4FIEA 2OI4X 4FK6A 1ZOEA 1W98A 5D7AA 4EK4A 2Z7RA 5K3YA 5CY3A 3FHRA 2V22A 4BCQA 4D0WA 5GINE 3DOGA 1U4DA 2X2KA 1OM1A 4R3RA 2CNQA 4RQKA 4BB4A 3GC8A 4GV1A 4YHJA 3KK9A 5FTGA 3FMMA 3ZOSA 3MPAA 3QALE 1Q99A 3F6XA 5FTQA 1U5RA 2VX0A 4I0TA 3RBWA 4Q9ZA 1PMVA 1Q4LA 3HDNA 4IX4A 3VHKA 3FXZA 3C4ZA 1GIHA 1NXKA 2ITTA 4OBQA 4WNOA 3VS3A 5DMZA 1Q8ZA 1MUOA 3QQHA 3FZTA 4AGCA 2B0QA 2P2IA 2R0UA 4XLIA 3TT0A 4TL0A 1HCLA 4I21A 3VBXA 4UWBA 3DQXA 4EL9A 5HNGA 4CFWA 3I0OA 4CZUA 3ZDIA 3ZSIA 4M69B 4E6DA 3IOPA 4FSWA 4RX9A 4V01A 3UO6A 2CGXA 5HE1A 4ALWA 1DM2A 4QMQA 4C02A 1XH4A 3T3UA 3HP5A 3F82A 2HY81 3M1SA 1IASA 3H9FA 3DXQA 3TUBA 2J2IB 4O0VA 2F57A 4ZOGA 4C4EA 1H1SA 5JRSA 3HMOA 3KXXA 3ATTA 4DE4A 1ZAOA 2XB7A 3LFFA 3EQHA 2YLFA 4MXAA 4KIKB 3S3IA 3GT8A 4MBJA 3ZCLA 2FGIA 3VUIA 4AXAA 5CEPA 2YAAA 3R7YA 2YM3A 4E6AA 4FEUA 1JPAA 2RFSA 3EQPA 2R2PA 5DN3A 4L46A 4TNDA 2B4SB 2QO7A 3RHKA 4AZFA 2X2LA 3UJGA 4C4FA 4DBNA 3KN5A 2JITA 4BWXA 3HUBA 3LQ3A 2OW3A 2KULA 5FQDC 3DBQA 3ZUVA 2CLQA 2EVAA 2YM4A 3PJ1A 3Q2MA 3RMFA 3C5UA 3OWKA 2IZUA 2IZRA 4TYEA 3L9PA 3UZPA 3RAWA 3V01A 4JOAA 3UVRA 4F0IA 5HO7A 3EFJA 1UV5A 4AE9A 4FEXA 3QRIA 1ZMVA 4L68A 3FEGA 3GP0A 3QFVA 4OTPA 3OBGA 4W9XA 4CNHA 2CCHA 2FVDA 3R9DA 3LPBA 3WZUA 5HVKA 3IQ7A 3HECA 3F66A 4G3CA 3MFRA 3QA8A 4FYNA 5FDPA 2UZVA 5KX8A 4LOOA 5HD7A 2QU5A 3BRBA 4XEYA 4F9CA 4OLIA 3LQ5A 1NVSA 1T45A 4N6YA 3NVKI 4YPSA 3F3TA 2R3LA 1H4LA 2XYUA 5J87A 1QPEA 2OJJA 5C4LA 2XA4A 3VQUA 2C47A 1F3MC 1Q61A 3DBCA 3QD4A 4P90A 4H3BA 4U97A 5TKDA 5DGZA 3ZEPA 5FBNC 4NM0A 5KBRA 4FTUA 2BCJA 5LVNA 4AGDA 4C8BA 4DTKA 4AZEA 2CHLA 3QUDA 4D4YA 4I6BA 5L2QA 2YABA 5CSPA 2VTLA 3F3WA 4UEUA 5EW9A 2PE0A 5B7VA 3PTGA 4I24A 3OW4A 5D1JA 3CGFA 5AR5A 3R8LA 4BYJA 5M08A 1OZ1A 1U5QA 1RDQE 1Q5KA 2C69A 2WMRA 3ALNA 3K3JA 4X3JA 5AV2A 1AD5A 3KMWA 1YHSA 4DEGA 2J50A 4O2ZA 4F9BA 2QR8A 4PPAA 2BZJA 3DKOA 3P7BA 3W2OA 4I6HA 1H01A 5K0KA 4L7FA 1H24A 4XNEA 4HGSA 3V3VA 1JBPE 2CPKE 3ZBFA 2XCKA 5C8KA 4CSVA 5JSMA 4PTGA 4FK3A 3BHYA 4GIIA 5ANJA 5BVFA 2IVTA 2J6MA 2XIYA 4GK3A 2CGVA 2UVZA 5J9ZA 2XP2A 1XH5A 3FSFA 3FYJX 4FSUA 1PRYA 2BR1A 1OMWA 4BCHA 2X0GA 3ORIA 4HW7A 4Y8DA 4G5PA 4ANBA 1BLXA 1ATPE 3G5DA 1FOTA 4LGDA 4J98A 2XKFA 5EHOA 4C33A 2Y7JA 2UZEA 4EQCA 3UPZA 5CSXA 3CSVA 4DT8A 3REPA 4E5AX 3NEWA 4JBOA 2WEVA 3MB6A 5I0BA 2IVUA 4F08A 5E1SA 4AZVA 4FV7A 5IQDA 4HGEA 4BI2A 2R3QA 4FGRA 4PX6A 1DAWA 1B6CB 4GYGA 3I7BA 4JDJA 4RIWA 4BFMA 5HTCA 2R3PA 4FR4A 4M67A 3QXPA 2VWVA 3D5WA 1KV1A 2HY0A 2XVDA 3ZS5A 4NZWB 4RLLA 3QF9A 5CU3A 3SRVB 2HAKA 2OICA 3NVMB 3ERKA 3AD5A 4YTHA 3O8UA 1WCCA 4FBXA 5IQGA 4RJ8A 3ODZX 3Q53A 4G3EA 4RRVA 5DR9A 3R8MA 4ZTNA 5LQFA 1R0EA 3FMEA 4XP3A 5EYKA 2PUPA 3NNVA 3TZMA 1QCFA 5JFWA 4UY9A 2Z02A 4F0FA 4FTMA 5AR4A 2QONA 1S9JA 4EOMA 2WQBA 3EL8A 4GRBA 4PDPA 4PDSA 5FP5A 5JMSA 4FG8A 5ETIA 2W1IA 2Z2WA 4GK2A 3EYGA 4BTJA 3LFEA 3QCSA 4D5KA 3GFWA 3NWWA 3ENMA 3NNXA 3W55A 1FGIA 4P5ZA 5HG8A 3UG2A 4NH1A 3ORKA 1UKHA 4O0YA 4X2GA 4AGUA 3NS9A 4C58A 4F70A 5J9LA 2C3LA 2ZJWA 5ACBC 2IN6A 4NJDA 4BCPA 4AA0A 2VNYA 3D2IA 3SVVA 4RJ7A 2B53A 3CJFA 2X4ZA 3I5NA 5TE0A 3PLSA 1OKWA 4QP7A 4RIOA 4QYYA 3QQKA 3CS9A 4HVHA 2IVSA 4OT6A 4P4CA 2VUWA 4RSSA 3U87A 4XRLA 1WMKA 4ANOA 2WQMA 3FLWA 3GXLA 4FEVA 5IA0A 3MH2A 4UMQA 5IQIA 4WO5A 3EHAA 1ZYJA 4CLIA 3HV4A 3LCTA 2RG5A 4A9SA 5JN2A 4NM3A 4O96A 4M15A 3A7FA 4YP8A 2BHHA 3P79A 5D9HA 3R83A 4ASEA 4ASZA 4EOJA 5IH6A 2YWVA 4O6EA 3KXNA 4YZ9A 4O81A 1QPDA 5JQ8A 5FM2A 5H9BA 4KBCA 3DFAA 3NW5A 4IFCA 4RX5A 4DEAA 1PKDA 5T68A 3I4BA 4D55A 5CAVA 4FF8A 3G9LX 5EW8A 1GZ8A 3U8WA 1R78A 3LZBA 2VTJA 4M12A 3RVGA 2ITYA 5I9VA 1H0VA 2EB3A 5AIKA 4FEWA 3TG1A 3QC4A 5CVFA 3DPKA 3NUYA 1DI8A 2XNNA 4EJNA 3VIDA 2JKKA 4TWCA 5CEQA 2RSVA 2ZM3A 3AD4A 3ANQA 4CXAA 4F7LA 2CSNA 3EKNA 4EYJA 4JS8A 4XBRA 3TL8A 3EFWA 4IHPA 2PUIA 4OT5A 4UXLA 2CKOA 5E91A 5ETFA 1RJBA 3V51A 4XJ0A 4UMRA 4ZZNA 3O17A 3FZRA 1Q8TA 5HOAA 5DRDA 3PRFA 4WA9A 4YLKA 2XEZA 2QOIA 3GB2A 4JL9A 4TWPA 2OIBA 4AF3A 4NT4A 2HENA 4QMVA 3E7VA 3AXWA 4AG8A 4F1TA 4I5CA 2CGWA 4CMUA 3FQSA 5AUYA 3DT1A 2BFYA 3L9LA 4C7TA 4M0ZA 1PXKA 4N0SA 4QO9A 4FNYA 2VNWA 1KE9A 4USFA 4L3PA 3Q9YA 2HCKA 4V0GB 2GNHA 4FI1A 3FPMA 5DVRA 5ANDA 3ZMMA 3NMUF 1JSUA 4UMUA 1GZNA 1XQZA 3LFQA 4Y72A 4BIEA 3D7ZA 3MIAA 3U6HA 4HVDA 3VC4A 4BF2A 3O8TA 4U3ZA 3G2FA 3NZ0A 1XH6A 5CAPA 4R1YA 5AP0A 4NTSA 4PP9A 4LL5A 1OL1A 3RCDA 4Y73A 4YJSA 3QQGA 1H08A 1I44A 1YXTA 5EOBA 1BI7A 2YEXA 4D2PA 3H4JA 4FZFB 5ANOA 4OUCA 1XO2B 1HCKA 2PMNX 4N4SA 5CF5A 5C26A 4FG7A 4JG6A 3MBLA 5BUJA 2OBJA 5ETAA 3EQBA 3W2RA 2AUHA 2GU8A 4U7ZA 3TKIA 2GS7A 3NPCA 4LL0A 3A62A 4ZSGA 3FPQA 4EHZA 2VTOA 3DS6A 4DYMA 5KUPA 1UWJA 3LQ8A 1OBDA 2VTAA 5BVDA 2WTVA 4BTFA 4JR3A 2IJMA 2GNLA 2CJMA 2HWOA 2P2HA 3PVWA 3FYKX 3K5UA 4AFJA 3R01A 3A7HA 3AC3A 1M7NA 3R2YA 5BMSA 5I9XA 4UWCA 2PZ5A 3V5QA 4CMOA 2JEDA 5CLPA 4QP1A 3RWPA 3W16A 1UNHA 3CIKA 3GCPA 5CS6A 4EZ3A 3O8PA 4I1ZA 4RFYA 2AC5A 3UIBA 3EQIA 2RL5A 4ZZOA 4BGQA 4NKSA 3FZ1A 3A99A 1YI6A 2B9IA 3KRJA 4MNEB 4MWHA 3E3BX 4I3ZA 3BV3A 4IM3A 3CJGA 4G9RA 3PA4A 3PVBA 4I0RA 3V5TA 3CTJA 5KE0A 3LKMA 5K5NA 2OXXA 1CKJA 4S32A 1OL6A 2VTTA 5DNRA 3DKFA 4GIHA 3W2PA 3AMAA 3BLHA 3PXQA 4AW2A 3Q4CA 2XNOA 1ZYCA 2C5XA 2J0IA 4HNIA 3WZDA 5F20A 4AZSA 4WRSA 4X6RA 3UZTA 2VWZA 4IZAA 2IW8A 5HLWA 2NRUA 3ELJA 3P08A 3OF0A 3HV3A 4ZJVA 2V7OA 5DEWA 4OGRA 4IX5A 3TJCA 1A9UA 3HRCA 3ZZEA 4CYJA 5CEKA 3BE2A 3HV7A 4WG5A 3KL8A 3EWHA 4FTIA 3EN7A 5J9YA 5J1VA 5DYJA 3CQUA 1SNXA 4FOBA 3GQIA 2JDTA 2QKRA 5IZFA 3GFEA 1UWHA 3O23A 4AQCA 4B9DA 4NSTA 3MSSA 2BRHA 3FY0A 4BIBA 4Z55A 4DG0E 3C4CA 2PVLA 3F5GA 1UU7A 4YHFA 4RZVA 4AN9A 2HXQA 4R3CA 4X2FA 5CZHA 1UU8A 2PPQA 4Y5QA 1KOAA 4E4NA 3GVUA 2EXEA 3KB7A 2GHGA 4PMTA 5EQYA 5E8SA 4HNFA 5CT7A 4IAIA 4GVAA 1WVYA 3TUDA 3BIZA 4FTKA 4ENYA 4RWIA 5HZNA 3QL8A 3S00A 2XNPA 1L3RE 4FTLA 2PWLA 3ANRA 3I1AA 4FKOA 3VUHA 1CDKA 3EZRA 1WFCA 5K9IA 3MY1A 4JRNA 5DR2A 4G2FA 3KN6A 2CCIA 4LGHA 4DINA 2C6MA 4BZNA 3IDBA 3OXIA 3W18A 5CF6A 3LMGA 4C2WA 1R39A 5IA1A 1ZRZA 4GUBA 1YWRA 2C0IA 3RZBA 4E93A 4C4HA 5ANKA 4IAKA 3Q5IA 1OL2A 4A9RA 4BCMA 3AMBA 1GIJA 2C6TA 2XIRA 4FODA 4RVMA 3ORZA 3S0OA 1WBPA 3HMIA 3S95A 1MRVA 4ZMEA 5FP6A 4AN3A 4JDKA 4PNKA 3UO4A 1M2QA 2BALA 2IWIA 3EOCA 3AC5A 4YJVA 5AUTA 4IVDA 4UZHA 3PXYA 4F1MA 4G3DA 4BCIA 2OSCA 1VZOA 2Y0AA 4EH8A 5H3QA 3VS4A 3TM0A 4RQVA 4U9AA 4JX3A 2F7EE 5EKOA 3G6HA 5C1QB 4O7VA 3OUNB 4EOQA 4FZAB 4E5WA 2VWWA 4ZK5A 4UXQA 2GNJA 2ITXA 4DEHA 4X3FC 3OOMA 1YVJA 4UB7A 3UQGA 3RM7A 4XCUA 3EQCA 4QPAA 2E9PA 4KS8A 2PTKA 3RK7A 3DXPA 2ZM4A 4JX7A 4FT9A 2O5KA 3KCFA 4HCVA 1MQBA 4IADA 3QKLA 5IQBA 3F2AA 5HORA 3KK8A 1AGWA 2CDZA 3NAYA 3QCYA 4HCUA 3V5WA 2E9OA 2OG8A 4F9AA 4YC8A 2UZNA 1XR1A 5HLPA 5AP2A 4KD1A 5BPYA 5F1ZA 4CVAA 2QD9A 3PLAE 4E1ZA 3RWQA 2F49A 1OECA 4GW8A 3HMPA 4Q5HA 3UBDA 5CU6A 2C6OA 5BMMA 2I0EA 2VGOA 4BTKA 2YITA 3AC1A 5ICPA 4G6OA 5M09A 4UV0A 5DHJA 3PJ2A 2QO9A 4D0XA 4D2RA 1V1KA 3NYOA 2X81A 3KGAA 4BDCA 4O2PA 3V5JA 3ZXTA 1JKKA 4PPCA 3CCNA 4DEEA 1KE6A 1XH9A 1ERKA 2VWIA 3ORMA 4H1JA 4QMPA 4PPBA 3MY0A 4IANA 4O0WA 4IC8A 4ZY5A 4H3PA 2WAJA 3PWDA 3R7UA 3C4EA 2W06A 2YN8A 4B99A 4C3RA 2CKQA 5JK3A 4TT7A 3RGFA 4CCUA 3EIDA 5ANIA 4IDTA 5HX6A 4QPSA 2X4FA 2X6DA 4CFXA 4F6UA 5CU2A 3DY7A 4XHKB 4EBVA 4LV5A 4AW0A 3Q6UA 4FV0A 4MXXA 3OWLA 4W4WA 4DH5A 2OJFE 4JQ7A 4QYGA 4YJRA 5J8IA 2JKMA 3ULIA 3LCSA 4J1RA 1J3HA 3ORLA 3CTQA 4KSQA 5B0XA 2KTYA 4FL1A 4I5MA 3VF9A 3BELA 5KKRB 3C4XA 1PJKA 3CPCA 3QD2B 4BZOA 1G8AA 1PMNA 2WXVA 5I9UA 2PY3A 2X7OA 1J7IA 3QHWA 4ZY6A 2QU6A 4E26A 5DLSA 2J51A 5FD2A 3TTIA 4H3QA 3LW0A 3QQUA 1R3CA 3Q4TA 4BR3A 2GQRA 2E2BA 2IW9A 2JIUA 3P0MA 4JIAA 5HCZA 5KCVA 4IAAA 2WQOA 5DT3A 4NFNA 2X8EA 3I81A 2VWXA 4W4VA 1P4OA 2RFNA 4D1ZA 2WTKC 3HMMA 3IW4A 2P4IA 5KMLA 5IQCA 3QRTA 5CNNA 4YZMA 3TKHA 3TACA 1UNGA 2OJ9A 3LCOA 2C6DA 4NM7A 4RVTA 3QZGA 5HCYA 3E7OA 5HEZA 3EN5A 5TR6A 5HU3A 1K3AA 3O2MA 3ORTA 3PVGA 4P2KA 4C0TA 4C34A 5HLNA 3PWYA 3BEAA 2JIVA 3AMYA 3DCVA 5IEVA 1IG1A 1G3NA 3GGFA 1QPCA 4FKQA 3VUKA 2I1MA 2W1GA 4LMNA 3FQHA 2WD1A 4K8AA 3HP2A 1PYEA 4PMMA 4J52A 2F7XE 5AUUA 4ARKA 3LCDA 4EYMA 4G16A 5EQEA 3SLSA 4YTFA 3C51A 5CXHA 1YXUA 1ZXEA 2JBOA 4I22A 3RZFA 4QMWA 3PJCA 1ZYDA 5A14A 2OIDA 4FNZA 3SA0A 3SG8A 3MFSA 2QO2A 5FGKA 4FV9A 5DT0A 3MI9A 5HE3A 4WUNA 3RNYA 1JNKA 2EUFB 2NP8A 4X6QC 3NUXA 4AACA 1TVOA 3SXFA 3VUMA 1KWPA 2VTNA 4NCTA 2PUUA 3N4UA 4TYGA 3SW7A 5ANGA 1YOJA 3KMMA 3C0HA 2YM5A 4LRJA 1WBSA 5DOSA 3R63A 3VVHA 3RAHA 2ZOQA 4MBIA 3A8XA 4CFNA 2J5FA 4AX8A 5BVOA 3V6RA 4PMPA 3VS6A 5HIDA 3GC0A 5CASA 3Q32A 3FMLA 3D2KA 4QTDA 2PUNA 1YDSE 2WGJA 3O50A 5A3XA 2BILB 3GU4A 1OKZA 3FKLA 2ITQA 1E9HA 3R8ZA 3DTCA 3Q6WA 4HGLA 3TZ8A 5CALA 4QMMA 4TN6A 1A06A 3R0TA 4BDJA 4H1MA 2BRBA 3UNJA 4XG4A 4QOXA 3HYHA 4IWOA 4BGGA 1QMZA 2YIRA 4V04A 3RI1A 2HW6A 4O7WA 4WKQA 1BI8A 4E20A 4FNXA 3MWUA 5FXSA 4X2KA 2XKCA 3GNIB 4D9UA 5AX3A 3WOWA 3FY2A 3KU2A 2A0CX 1H26A 2C0OA 4HVIA 5JKGA 3N4VA 3C4WA 1OVEA 2OIQA 4L01A 4CZTA 5G6VA 4F64A 3D4QA 3W2QA 4L44A 2B9JA 2XJ1A 1IA8A 2YDJA 3C13A 4QMLA 4XV2A 3VUGA 4FKIA 4NYEA 4GH2A 3E64A 3ZYAA 4FZ7A 4CKJA 3UMXA 1ZARA 4IFGA 4C35A 3EFLA 4ID7A 4AA5A 2J0JA 5I3RA 4EZ7A 3KRWA 3CBLA 3GCVA 4MXZA 3L9MA 3IDPA 3LXKA 5HI2A 2QLUA 3F5UA 3GUBA 1E1XA 1WBOA 3CQEA 3OTUA 4WNPA 5FM3A 4ZJJA 3W33A 3W2CA 4C57A 3UOKA 1F5QA 1E1VA 3AQVA 4U80A 1UU9A 4JI9A 4O0TA 3ZU7A 5CAOA 3Q2JA 2OF2A 3EL7A 4J71A 4FT5A 3CKXA 4MCVA 3WYYA 4ACGA 4F09A 4YLJA 3UNKA 2G9XA 1JWHA 4YJQA 4ORKA 2P55A 2XNGA 2UVXA 4IACA 5TO8A 3KF4A 3R21A 4OTWA 4ERWA 2X9EA 4BBMA 2YM7A 2OKRA 3A60A 4YJUA 4FOCA 5E9EA 2B52A 2WMUA 3QGYA 3RCJA 4MK0A 3WARA 4EI4A 3TDVA 3QHRA 2OZAB 2JDRA 1PKGA 4M14A 5EI2A 2H8HA 4RWLA 3MW1A 2VAGA 3MTFA 4AT4A 3OEZA 2W99B 1Q41A 3R7IA 2JFLA 3JPVA 3KF7A 4TXCA 3BWJA 5AP4A 4UZDA 4X0MA 3BV2A 5CF8A 3SV0A 3ZO3A 2ZMDA 2WMSA 3LFNA 2W1CA 4WG4A 3V8SA 2BKKA 5C4KA 4KWPA 3CLYA 4RFMA 2XCHA 2PVYA 2W17A 1LR4A 3R02A 4WBBB 3UIMA 2XBAA 2XK6A 5DH3A 3VS5A 3OW3A 2WHBA 3SG9A 3H30A 4I93A 1ZZLA 2YFXA 5EG3A 5HE0A 3HV6A 1SVGA 3NW7A 3AT2A 3E62A 2QNJA 4OBPA 4JR7A 2E9VA 5D12A 2FUMA 3F5XA 3PE2A 3OP5A 3K5VA 5HNIX 2WTKB 5CQUA 4HYUA 1VJYA 4ZLOA 5IISA 1O6KA 4EH9A 3R1YA 3PG1A 4GMYA 4PNIA 5M57A 4A07A 2PVRA 5LMKC 3UODA 4FC0A 1FVVA 3D14A 2SRCA 4ENXA 4QQ5A 4YNOA 5LWMA 2YA9A 2VTSA 3FJQE 3UDBA 1STCE 3CTHA 3P78A 4FUXA 5EW3A 3VW8A 4G5JA 2BHEA 3NYNA 2ZV7A 4K9YA 4JQ8A 3ORNA 2ETMA 3JUHA 3NYXA 3MDYA 3PJ8A 2YHVA 3TNHA 5AEPA 4IVAA 5I9ZA 1YI4A 3G15A 5L2SA 3MA3A 1SYKA 5E8VA 3MN3A 3Q4ZA 3DGKA 4QQTA 2O3PA 3IONA 1SNUA 5D7VA 2WPAA 2YLEA 3AG9A 3KXHA 3ORPA 3DK3A 4C3PA 4FKJA 5J5TA 3N9XA 3FBVA 4OTRA 1QPJA 2A27A 4QNYA 3WF5A 4BIDA 1FMOE 3BZ3A 4IM0A 3EQDA 3WYXA 2BAQA 4E8AA 5L8LA 2PULA 3MVJA 4MEDA 3QKKA 4FSQA 4O22A 5DBXA 1R1WA 5M4IA 3B2TA 3RPYA 4O7NA 4G31A 2R3KA 5KZ0A 3AT3A 3KULA 3LM5A 4APCA 2VV9A 3FSKA 3UC4A 3ZFYA 2QHMA 4RJ4A 3ZH8A 2XNMA 3SD0A 3UPXA 4U40A 1W0XC 5ITAA 3IW6A 1PXNA 4DC2A 2B9FA 3H3CA 2XRWA 2OF4A 1OI9A 4D4SA 1TQPA 3D9VA 5I9WA 3BEGA 5JT2A 3LJ2A 3Q96A 3ZTXA 4F65A 4Z9LA 3UP2A 4EORA 2HZIA 4YNEA 4ZY4A 4RIXA 3NIEA 2GDOA 2J4ZA 2JIIA 3QLGA 4KIOA 4RA5A 4I23A 2GNIA 2OWBA 4USDA 2J0KA 3DV3A 2BZHB 2W4KA 3SOCA 3VQHA 3VS1A 4BKJA 1OUKA 2PYWA 3MESA 4ZSAA 1GJOA 1FPUA 1WBTA 4PMSA 5G1XA 3LFSA 5K5XA 5E8UA 3HA8A 4KB8A 2ZAZA 4KKHA 1OPJA 4FTNA 3SHEA 3ENHA 4CRLA 1P14A 4R6VA 5EYCA 4RIWB 3BBTB 3Q9ZA 2JDSA 4O38A 1XBBA 5JFVA 2O0UA 1J7LA 5DI1A 3JVSA 5HBJA 3NUSA 4TYHA 3OY3A 3QTSA 1VR2A 3DB8A 3IKAA 4U6RA 3NSZA 3KRXA 1W84A 2CLXA 3H0ZA 2UW3A 5AWMA 1YI3A 3U6JA 2RGPA 5H8BA 4L43A 4DHFA 4W4XA 4F6SA 1V0PA 2OZOA 2WMVA 3RALA 2Q83A 4C2VA 2IVVA 5L4QA 4IDVA 4C4GA 4TW9A 4ZTRA 5EOLA 3Q4UA 4DH3A 4BWPA 4FSYA 2C6EA 3FXWA 3NCZA 4U81A 5IA5A 3V6SA 2BPMA 3U51A 3KRRA 4AOTA 3BU5A 2GHLA 2FSMX 4GS6A 3KKVA 4FL3A 1OKVA 2VD5A 3MH0A 4RC2A 4D1SA 4O7YA 5BNJA 3W32A 4FZDB 5IUHA 2EXMA 2BIYA 3FLYA 4XG3A 4YPDA 4RA4A 3G6GA 4QMXA 4U79A 2C5VA 4M97A 3VBQA 1OIQA 3ULZA 4QMZA 4AP7A 4F7NA 2YDKA 5CZIA 4QP2A 2YZLA 1JKTA 3OT8A 5M56A 4EHEA 4DTAA 4NW5A 3V5LA 2ETRA 3KC3A 5HQ0A 3KCKA 4KBAA 2RF9A 4S30A 2A19B 2UW6A 5JQ5A 2G15A 4ERKA 5AR7A 4I0SA 3O7LB 5E8ZA 5B2MA 3JY9A 5T3QA 3R7EA 4EONA 5FXRA 3HVCA 2VGPA 4J99A 3SGCA 3VBTA 3ZDUA 1A48A 4JAIA 4DGOA 3UOJA 4MBLA 1BMKA 3ROCA 3WF9A 2R3IA 4IWQA 4H05A 5FEQA 1YWVA 2UW0A 1YXSA 3F7WA 5AUVA 2PVJA 5AFVA 3OXZA 4OTIA 2WMXA 4JG7A 4O21A 4LQMA 4D58A 3UZRA 4QMOA 5GJFA 4ASXA 4XV1A 4IAZA 3IGGA 4FA2A 3LM0A 4XYFA 5K4JA 1J1CA 1Q3DA 3PSBA 3NIZA 2XKDA 3PZHA 5F94A 3OUKA 3ZLSA 2JBPA 2HZ4A 2R3FA 2W1DA 2GFSA 3F7ZA 3PA3A 4ZLZA 4DGLC 4RC3A 5AP6A 3SOAA 1PW2A 2AC3A 4BRXA 2W7XA 4K33A 4GCJA 4KSPA 3FHIA 2XNEA 5AR2A 4O84A 1PYXA 3PUPA 5AR8A 3BHHA 3P7AA 4O1OA 5EM7A 3EQGA 4DG2E 4ANLA 3EQFA 4AAAA 3D0EA 4JJRA 3QC9A 3U55A 3F2NA 3GBZA 4XLVA 2H96A 2PVHA 2QKWB 2VO3A 4FT7A 1P2AA 5FUTA 3PP1A 3Q5ZA 2ONLC 1W83A 1YHVA 3D7TB 3DAKA 2UZBA 5A9UA 1IA9A 3TI1A 3UVQA 5BUIA 3DB6A 5CXZA 3FI2A 3BE9A 2IO6A 3LFBA 4ZS0A 4XG9A 5BX0A 4N57A 2ZV8A 2BDWA 4IC7A 5HG9A 2I40A 4AT5A 3R9HA 3BLQA 3DXNA 3POOA 1HOWA 4DTBA 4ANQA 2R7IA 3PY1A 2JDOA 3R9RA 3T8OA 4IAFA 1DI9A 2FH9A 2OH0E 2J9MA 2YAKA 4FUYA 1KE5A 4Z7GA 5LVLA 4NL0A 4FTCA 2WNTA 5M4FA 4NUSA 3TNQB 3DLSA 4OTFA 4XOZA 1VEBA 5KNJA 4M8TA 4R3PA 3G0FA 3SC1A 4EH3A 4NIFA 1JQHA 1CKPA 1NY3A 4FSNA 3U4UA 2R3OA 4XH6A 1Y8GA 3RM6A 2WB8A 2QODA 4L7SA 3A4OX 5AV1A 3OCBA 1JSTA 4DFBA 4CYIA 5IUIA 1SZMA 4L45A 4TYJA 2PVFA 3AGMA 3K2LA 4IZ7A 2NPQA 4CMTA 1H00A 3DZOA 4AZWA 3O7LD 4U45A 3S2PA 3L8XA 2Z8CA 3WZJA 4DFLA 3K54A 5J7BA 2BTSA 3COMA 1U59A 3B8QA 3AC8A 3DDQA 3F5PA 4GT4A 1UNLA 1XBCA 5DG5A 1H1QA 4JQEA 5AV3A 4E3CA 2RFDA 4EC8A 2IW6A 3PXZA 4MD7E 1SMHA 3FWQA 3FKNA 3PDTA 3QTXA 4G6LA 5KBQA 1FQ1B 2C3KA 3CQWA 3OBJA 4YSJA 4LRMA 3IK3A 3QKMA 5C9CA 4GK4A 5L2IA 5IEYA 4Y95A 4ZJIA 4IJ9A 2F2CB 4J8NA 4W9WA 4B8MA 3QU0A 1APME 4R1VA 4CEGA 4WRGA 4IE9A 2HXLA 1WZYA 4IW0A 3LXLA 3MVMA 4RBLA 4D4RA 4MKCA 4F0GA 5LJJA 5EI6A 3CP9A 4YZBA 5KKRC 4J8MA 2XRUA 4RLKA 4YJTA 1Q3WA 4S31A 4DAWA 4EWHA 4WD5A 3EYHA 4BDIA 5IA4A 3OY1A 2IZSA 4YURA 3QCXA 3FMKA 3ID6C 4BC6A 1REJA 3LFDA 2GTMA 3BCEA 3I0QA 3DDPA 2BDJA 4PTCA 1UVRA 1XJDA 2VRXA 3O51A 4IB5A 4IXPA 4Z7HA 4XP2A 2REIA 2IG7A 5AIRA 4IZ5A 4PV0A 4GJ2A 3VJNA 4HPTE 4R78A 4GL9A 3E88A 3S1HA 1YDTE 1OB3A 3I6WA 3C9WA 4GU6A 4YJOA 1H1WA 1V0OA 2YZAA 3RJCA 3TV4A 5IH4A 4D2SA 4FKPA 3JR1A 1SVHA 3ZLXA 4HOKA 4OTHA 4FT0A 2OXDA 1M52A 4JT3A 4AUAA 2HYYA 1PF8A 2ITZA 2FB8A 1U46A 5TOZA 3MY5A 4QQCA 1GAGA 3ACKA 3EZVA 3ZRMA 1BYGA 4D2WA 5A46A 4A4XA 2PU8A 4OW8A 4PQNA 2UUEA 2W1FA 5HCXA 3QRUA 4A4LA 1RE8A 2F2UA 2WOTA 5CI6A 5EDQA 3C0IA 4A06A 5HTBA 4MWIA 3F3UA 4OTDA 3VBYA 4HYHA 4EBWA 3R30A 2ZM1A 2WMWA 3KVXA 2W5AA 4YHTA 2JAVA 4FKLA 3Q9WA 5CI7A 2ZYBA 4K18A 2G2IA 3DTWA 4O0XA 1OPKA 2Y8OA 4O7SA 1Q8WA 1LP4A 4E4LA 1OIRA 4BHZA 2V0DA 4AE6A 4EH6A 4BDFA 4BYIA 4RIYA 3ACJA 4LI5A 2GQSA 5JGAA 2ESMA 2HZNA 2ZB0A 4MH7A 5CQWA 2B55A 2Y6OA 3BYMA 5JZNA 3QBNA 3QD0A 3R7VA 5M4CA 4QQJA 2ACXA 2EWAA 3FL5A 4F63A 1KV2A 4PL5A 4F1OA 4PF4A 2HWPA 3PVUA 2J0MB 3AC4A 3CD8A 5BVWA 3UNZA 2VO6A 3T3VA 3I5ZA 2C5OA 4WNKA 2GNGA 3QCQA 4RMZA 4DFXE 3CPBA 3ZO4A 3PRIA 3LJ1A 3R8UA 4TKSA 4FKSA 3ZM4A 2XK3A 2ITVA 3UC3A 4MYGA 1O6LA 5C8MA 3QUEA 3P4KA 5BUEA 3OMVA 1PXIA 3NGAA 3P7CA 3UOHA 2C30A 5T6KA 2ITUA 3IG7A 4K77A 4HCTA 3LVPA 2X2MA 4XV3A 3ZO2A 4NFMA 5L3AA 3HGKA 3NUNA 1KSWA 5IMXA 2A4LA 3WIKA 2VU3A 4EH5A 3I6UA 1AQ1A 1UKIA 2O2UA 4K6ZA 5L6WL 4XG2A 1FVTA 3FKOA 5HVJA 4ZP5A 3TXOA 3ZHPC 1CM8A 2WU7A 1IAHA 3MPTA 4ANSA 5CYIA 1IR3A 3TUCA 2H9VA 4UX9A 2UZLA 2C6IA 4PL4A 2WTJA 2P33A 4CFFA 1KOBA 3OHTA 3QTZA 4K2RA 4YZNA 5AAEA 3BBWA 2YIYA 3NUUA 4DCEA 5JGBA 2BZKB 3OD6X 2G2HA 3UGCA 5E8WA 5AV0A 3E93A 4EK6A 5IQHA 5KMOA 5LCJA 4CG9A 4RJ3A 3GCQA 4G9CA 4BHNA 1ZYSA 4QTAA 3BYUA 2WIPA 1QL6A 5EDRA 3TDWA 4BCGA 1WBVA 3DK6A 4L53A 3DK7A 3TKUA 2Z7QA 4LRKA 3ORXA 4DBXA 5LMBA 4FNWA 1H27A 4TRLA 2Y4PA 2DWBA 3D5XA 3B2WA 3OZ6A 2VTIA 3DAEA 1ZY5A 3JXWA 4W8DA 5EYMA 2LGCA 4I92A 3ZBXA 4BVUA 5BQ0A 5CEIA 2IZTA 5JEBA 4IWDA 1URCA 3DNDA 3QWJA 5CVGA 2XF0A 1YQJA 4RWKA 4LGGA 5IA2A 1IAJA 3KXZA 4I20A 5AJQA 2J5EA 1PXLA 2Z7LA 2W1ZA 3L9NA 5GZAA 3DA6A 3F61A 5DE2A 4XV9A 3RP9A 4BBFA 5B2LA 3GQLA 3QUPA 3W8QA 4BDBA 5L6PA 5A6OA 4YZDA 4CLJA 5F4NA 4QYFA 4BCJA 2CMWA 3QTUA 2OJIA 1XKKA 2XIKA 3DBFA 3KA0A 5CT0A 4JVGA 5C01A 3OCSA 5HGIA 2OXYA 5E8TA 4R7HA 4S34A 3KREA 2WIHA 4NJ3A 4YTCA 1UU3A 4CRSA 4PDYA 5L2WA 2ZDTA 4CCBA 4BL1A 5A4QA 3NDMA 3Q04A 2HW7A 3IO7A 4FV4A 5EM5A 3ZC6A 4MF1A 3W2SA 2PZPA 1B39A 4C37A 4C3FA 4CFVA 3LMIA 3ZLWA 4L42A 1YKRA 2BDFA 4ACCA 4AOJA 3MJ2A 4O91A 5AADA 5AAGA 3QZHA 3VAPA 4RT7A 5IUGA 5E7RA 3C1XA 1PXPA 5HESA 3VRZA 3DAJA 1DAYA 2FA2A 2P0CA 4PL3A 4YMJA 1REKA 1TKIA 4CGAA 4MVFA 5HIBA 3PYYA 4KNBA 4M66A 3V04A 5GIOE 3E8DA 2CNUA 4MAOA 4BDAA 5JRQA 5HD4A 2JC6A 2QOHA 5HICA 4O7RA 4E6QA 1U54A 4RGJA 5KMIA 3N4TA 4JBVA 3PSDA 5EI8A 3BI6A 2BRMA 3H9OA 4G3GA 1MRUA 4FKVA 4MNFA 2W4OA 4RX7A 3L8SA 3JVRA 2GNFA 5CWZA 5E1EA 5HHWA 3U4WA 4XG6A 4AA4A 2JKQA 4EKLA 3ZM9A 4YO6A 5M51A 3UG1A 4TZRA 3BU3A 4DLIA 1CTPE 4EK8A 3FC1X 4MTAA 1CSNA 5J5SA 2XKEA 5A4CA 2OU7A 3HAMA 3SKCA 3IPHA 4K1BA 2E9NA 4KS7A 2YCSA 5GJGA 4QD6A 4ITIA 3C5IA 4AFEA 1WVWA 3BPRA 4D2TA 4GKHA 3HRBA 5CANA 1NW1A 3LJ0A 3GCSA 4EC9A 4HZSA 4LUEA 4UALA 5DFPA 3TTJA 4APPA 1YOLA 4MX9A 4BKYA 1LEZA 1OIUA 4U3YA 5EKNA 2RG6A 4F99A 1ZMWA 3FMNA 4HYIA 4JBPA 3MV5A 5FWKK 3CE3A 1M14A 2R3RA 3O71A 3P23A 1OGUA 4Q9SA 3E92A 5JZJA 1R0PA 3ET7A 1WVXA 1OIYA 2R9SA 3RAIA 2C0TA 3TZ7A 3IW8A 4MXYA 4PY1A 4CTBA 2YCQA 2PMOX 3R7OA 3FI8A 3HEGA 3SX9A 2XK8A 5EM8A 3R00A 4D9TA 3MS9A 2PL0A 4FYOA 3G51A 3DZQA 3VS2A 4YU2A 3UOLA 1JKLA 2PMIA 2FSLX 4M13A 5FEDA 1X8BA 3FZOA 4ZS4A 4F7JA 3HL7A 5FTOA 4MF0A 2BROA 4F4PA 4FIHA 4ACDA 3HA6A 3HRFA 4ZTHA 4FIIA 2UW8A 5EFQA 3R04A 4BDGA 3UQCA 1TQMA 2WFYA 3L1SA 5IDNA 1RW8A 2I7QA 4WIHA 5GJDA 4BN1A 3FAAA 3PP0A 1YOMA 5AMNA 2NRYA 3GEQA 3KRLA 5L8JA 4HJOA 4X3FA 4YR8A 2CNVA 2VZ6A 3SQQA 4RFZA 2AYPA 1Q24A 4KRCA 4FTAA 2PHKA 4WT6A 5IQEA 1K2PA 2W5HA 3FUPA 2OFUA 3QA0A 2XIZA 3W8LA 4O7TA 4ZEGA 1GZOA 2X7GA 4FIGA 4EJ7A 4ACHA 4ANMA 3DLZA 2OGVA 3L8PA 3RNIA 2YIXA 4AU8A 3KMUA 5KMMA 5E92A 3BHTA 4BI1A 5E8XA 5GIPE 1BL6A 2OJGA 3OOGA 4MHAA 4U44A 4IB0A 2PMLX 2UW4A 3RK5A 2G1TA 3UIXA 4R5YA 3PSCA 2P3GX 3KXMA 1YXXA 4PWNA 5CNOA 3DJ6A 4KA3A 5AM6A 4LOPA 3HLLA 2QHNA 3QRJA 3VUDA 4EH7A 4RG0A 5FXQA 4B6LA 4DCAA 4IX3A 2B7AA 3GOPA 4R77A 4BKZA 4CQEA 4R8QA 3TIZA 4D4VA 3VBVA 2C1AA 4FZ6A 5EK7A 1ZY4A 5L8KA 4CFUA 4EZ5A 3Q52A 4M69A 4I41A 4NW6A 5ACKA 4O82A 4CKRA 2C4GA 2PE1A 4K0YA 5HE2A 3V5PA 3IW7A 5CEOA 2VWYA 2OZAA 4CQGA 2PZIA 1KE8A 3F9NA 2F4JA 1M2PA 4XRJA 3BLRA 2BKZA 2ETKA 3OT3A 5AUWA 4BY9E 2OFVA 4DA5A 3FLNC 3MH1A 4KIKA 3A2CA 4BZDA 2CN5A 2XUUA 2WU6A 4PP7A 3TCPA 3PA5A 4ZMFA 5EDPA 3EH9A 3LOKA 2QOQA 3D83A 3H0YA 4I5HA 3V8WA 3GU8A 3PPJA 3QTQA 4H39A 5C03A 3R71A 4GUEA 3TV6A 1JVPP 5EHLA 4M3QA 3LCKA 4BCKA 4DITA 3DQWA 3FXXA 5KZIA 3RHXA 4FVPA 1SM2A 2XJ0A 4YUQA 3KFAA 3ZSHA 1K9AA 5LCKA 1Q8UA 2W9FB 4IH8A 4RX8A 3E8NA 3PXFA 1CKIA 1URWA 3R2BA 5LWNA 5F9EA 5BYYA 3H10A 3K3IA 3LHJA 5H8EA 4ZIMA 1XBAA 3BHVA 3KEXA 4HZRA 3M11A 3RPSA 3C0GA 4KKEA 3QZFA 2PVNA 3VUTA 2WTCA 5ANEA 4DEIA 3R7GA 2HIWA 3FMJA 1PXJA 2DUVA 4EUUA 4FKTA 2FYSA 3GENA 4GG7A 3W1FA 5CSHA 3R9NA 4RJ5A 4QMYA 1W82A 4ZSLA 1MP8A 4O7ZA 3LXNA 1WBNA 3L8VA 2BUJA 3NLBA 4D2VA 3HDMA 4BCFA 2WQEA 2BVAA 3BYVA 4HPUE 4CV9A 5D10A 1H0WA 3LMHA 4TY1A 5LARA 3WF7A 3OVVA 4CKIA 1YRPA 1PXOA 5CAUA 2BZIB 3GU5A 4FKWA 1YWNA 4LYNA 2XJ2A 1H1RA 2Q0NA 3QTRA 5EQPA 3PIZA 4FIFA 5GNKA 3MIYA 5KHXA 3D94A 2BAKA 3BGPA 3VNTA 3VS7A 1XH8A 2PSQA 3KULB 3COHA 4I94A 3O0GA 4QP8A 3COKA 2UZDA 5M44A 4I5PA 4PDOA 5AP1A 5BVEA 3S4QA 4R7BA 2JLDA 3GOKA 2O8YA 4JLCA 3BGQA 1LEWA 2YIWA 3KY2A 2A2AA 4G3FA 3U9CA 1H28A 4YSMA 4CG8A 3E63A 3JYAA 4EOKA 1PXMA 3EQRA 1B38A 4YBKA 4R7IA 3I60A 5I4NA 2UV2A 3OFMA 4RIXB 5M4UA 2XK9A 2OH4A 4FSZA 2GHMA 2VWUA 4BDHA 5M07A 4TNBA 4ZTQA 2CKEA 3OCTA 3NUAA 2W1HA 3FLQA 3FLZA 1JOWB 4U42A 5D41A 3A7JA 1P4FA 2VTQA 2UZWE 3PG3A 4WG3A 4C4JA 4C61A 4QT1A 3TNIA 1JKSA 3UP7A 4FIJA 3WIGA 3UMWA 1ZWSA 4MD9E 5J7HA 5TT7A 4O0UA 4OAVB 2VWBA 2Y4IB 3QQFA 4AS0A 4FEQA 5HBHA 1ZZ2A 5BVNA 2X9FA 3OROA 3BQCA 4IIRA 4B7TA 3O96A 5A4LA 2UW9A 4JDIA 4QRCA 2UZUE 1J91A 5AM7A 3QD3A 1Q62A 4NEUA 3HKOA 4TYHB 3VJOA 2W0JA 3CEKA 4ZTLA 5E90A 3AGLA 2O63A 2XK7A 4AWIA 4EEVA 1F0QA 3SRVA 5CAQA 3ZFMA 4FVRA 3BGZA 4EQMA 4O7LA 1RQQA 2YCFA 3IOKA 3EKKA 3VO3A 5IG1A 3QTIA 5LXMA 1DS5A 3OG7A 2J90A 3P9JA 4U5JA 4TPTA 3FI4A 4O6LA 3TIYA 1YDRE 4DGNA 4UYNA 4QP3A 2R7BA 1Q8YA 4RWJA 2GQGA 3TJDA 4BICA 3POZA 2VTMA 2XBJA 2NNWB 3G9NA 4H36A 1TQIA 2GFCA 3OWJA 5DIAA 1EH4A 2LAVA 3W10A 4EHGA 1ZOGA 2WMQA 3ZRLA 4J53A 4NWMA 3FMHA 5IU2A 3BYSA 1G8SA 2R64A 4DEDA 3OWPA 2C3JA 1IEPA 2HK5A 2O65A 2GCDA 2C68A 2BFXA 5IH5A 1GZKA 4CT1A 4GEOA 3IW5A 4FKUA 4Q2AA 5CSWA 3THBA 1Z57A 3OEFX 2XK4A 3E5AA 2GS6A 2VTRA 3E8CA 3MVHA 3QLFA 3R1QA 4Z3VA 5A54A 5AAFA 3Q9XA 2PZYA 3GC7A 4P7EA 4F7SA 4F9WA 5F95A 3TV7A 1VYZA 3R73A 2PVKA 4RC4A 2XNBA 1MRYA 3PIXA 4FV8A 3Q3BA 1NVRA 2QURA 2XH5A 5H2UA 4U0IA 2GPHA 2QC6A
chains in the Genus database with same CATH superfamily
2XMYA 4DFUA 1GNGA 2YACA 3GC9A 1ZMUA 3VF8A 4GT3A 3M42A 4NM5A 4O0SA 3WE4A 2WO6A 3VHEA 4C38A 5LVPA 2R4BA 1Z9XA 3T9IA 2V62A 3VBWA 4TTHB 3Q60A 2C6KA 3MJ1A 4V05A 3TNWA 3CY2A 4QTCA 5IKWA 3QYZA 2PK9A 4IVBA 4IEBA 4IJPA 4W8EA 4DFZE 4E4XA 5HU9A 5CSVA 5AP5A 1YHWA 3ITZA 4YC3A 5BYLA 4F78A 5BVKA 5IQFA 4PRJA 3GU7A 4M84A 4WNMA 4HVSA 4EOSA 1CMKE 3NUPA 5AP7A 4UMPA 5JFSA 3N51A 3RTPA 4E73A 2R3NA 5HTIA 3HV5A 3UTOA 2HOGA 2NO3A 2OK1A 3ZLYA 2VX1A 5AR3A 3MFUA 3RKBA 3VW6A 5LMKA 5E4HA 3C4FA 5KMKA 5FLFA 5CEMA 5JGDA 3KXGA 3UYTA 2JDVA 4XUFA 4G34A 2IF8A 5FG8A 4CTCA 1WBWA 2H6DA 3SDJA 3ALOA 4I4EA 2VO7A 5HIEA 3R6XA 3FLSA 4KABA 4BDEA 2O64A 2R3JA 2UW5A 4DGGA 1LUFA 1H8FA 4I6QA 2UVYA 3VWAA 4EOIA 3QX4A 3NYVA 1M7QA 1H1PA 4Y5HA 3ZC5A 4CV8A 3D7TA 2C3IB 3SXSA 3T9TA 4D28A 5AA8A 4ZAUA 3E87A 5DT4A 4LUDA 3F88A 4V0GA 3BU6A 5FRIA 2G2FA 4F6WA 4K11A 3R1SA 3DJ7A 2VN9A 2BRNA 3FI3A 4RVKA 3ROYA 4YO4A 4HYSA 3FDNA 4J7BA 4QMNA 1G5SA 1M17A 3A4PA 5GZ9A 3CKWA 4AAYA 2VO0A 2X6EA 3MVLA 4QMUA 4ALVA 1UA2A 2QG7A 3CGOA 4NIFB 4ZXTA 1BKXA 5M55A 2GMXA 3QGWA 4QYEA 4EQUA 3R28A 5DPVA 4FSMA 2JKOA 5B2KA 3UE4A 3OXTA 1Y91A 1S9IA 2RKUA 4QP4A 4A4OA 4G6NA 3A8WA 5AX9A 1IRKA 4FKRA 4M7IA 4FV3A 3QAME 4DN5A 2W05A 4EWQA 3TWJA 2A1AB 3KQ7A 3G0EA 3U6IA 1PHKA 4X2NA 2ERZE 2QR7A 4XX9A 4UN0C 5I5ZA 4FL2A 1W8CA 3A7GA 5EHYA 5IMEA 2X1NA 4R5SA 4YGAA 1H07A 4LOQA 3UO5A 1O6YA 4YLLA 3PE1A 4QMTA 4QTEA 3GCUA 3FE3A 2XM9A 3FC2A 1L8TA 1OPLA 2WTIA 4IB1A 2FO0A 1XH7A 2WQNA 2YWPA 4LV8A 2QI8A 2YCRA 3EN4A 4MQ1A 4S33A 3U54A 5M53A 3FL4A 3FV8A 4FE2A 2F7ZE 1BUHA 3ZONA 3II5A 3ZZWA 4JRVA 2ZV9A 3WILA 1GOLA 3P86A 4MNEA 4XBUA 5HO8A 3V8TA 2G01A 3MPMA 4CD0A 3G90X 4I6FA 4BCOA 4Z16A 4AW5A 4BWKA 4IVCA 4J95A 4A9TA 3F2RA 2WTDA 3PXKA 4FV5A 4ITJA 1LPUA 1OUYA 5M06A 5BYZA 3EN6A 2R3HA 5C8NA 4IMYA 1WAKA 3R8PA 4FGBA 4XG8A 4C4IA 4FKGA 4FTJA 4TWOA 4LFIA 3WZKA 2QOCA 3LXPA 4DEBA 5K4IA 2IPXA 3GI3A 3CD3A 2QOLA 4WUAA 4GT5A 5HNBA 1I09A 5L6OA 2WMBA 3COIA 4A7CA 3ETAA 1W2CA 4EH2A 5HG7A 2DS1A 1JAMA 2YM6A 2ZV2A 3P5KA 4U43A 2QOOA 2UZOA 4RZWA 3RPRA 2DQ7X 3BYOA 3MGYA 3ZUTA 4EKKA 3ODYX 3JS2A 4JAJA 5GZ8A 4L3JA 5LVOA 3C7QA 5AUXA 4DFNA 4FICA 4C59A 5I9YA 1KE7A 4MXCA 5EM6A 1PY5A 3BX5A 4AGWA 2CGUA 4FT3A 4EOOA 2HZ0A 2Z60A 4OAUC 5IA3A 4AZTA 3ZO1A 4GSBA 2FSTX 2QVSE 3PJ3A 4FSRA 2YIQA 4M68A 3MTLA 4OBOA 3TNPC 2W96B 2EXCX 4FV2A 4EUTA 5A4TA 5CU0A 4MD8E 3UQFA 3QTWA 4GVJA 1MQ4A 2QOKA 2XM8A 4JDHA 4WOVA 5EYDA 4D5HA 3M2WA 1OGYA 3VRYA 4QP6A 1SVEA 4GU9A 4L3LA 4EOPA 1O9UA 3R8VA 3EB0A 4IQ6A 2QOFA 3TZ9A 4U41A 2EB2A 2JFMA 4L8MA 3P1AA 4QYHA 5IPJA 4QEBA 2WZJA 2BTRA 4H58A 5L2TA 4NCTC 2BMCA 1Y6AA 2VX3A 3U9NA 4DFYA 5AA9A 3IDCA 3QQLA 4JXFA 4EK5A 5HVYA 5JFXA 4RIYB 4PTEA 1ND4A 3BHUA 1VYWA 2ITNA 4IAYA 4KIQA 4C36A 4GG5A 5K0XA 1P5EA 5CENA 4M0YA 2QCSA 2DYLA 1GIIA 2VTHA 4ZZMA 3ZEWA 2I6LA 4NK9A 3F69A 5HX8A 3QZIA 4YJPA 4F9YA 2C5YA 4C62A 3E3PA 2XYNA 3NNWA 3DKCA 3EN9A 4Q5EA 3VULA 5AUZA 4AT3A 4X21A 4B4LA 4XS2A 3HAVA 5GHVA 4X7QA 1M2RA 2ZMCA 1W7HA 4XOYA 3RINA 5J79A 2WMTA 5CTPA 3PIYA 2HELA 5IQAA 5J1WA 3BQRA 4L67A 4NTTA 4BBEA 4D1XA 2YDIA 3LFAA 4BDKA 3OS3A 4FJVA 4X2JA 2BIKB 2OO8X 3VS0A 4WSYA 1ZOHA 4G17A 4UBAA 3CXWA 2ONLA 5DEYA 5KO1A 2QQ7A 5DWRA 1FVRA 1J1BA 3JY0A 4JBQA 4CFMA 1Y6BA 4FTOA 5LOHA 2UW7A 1FMKA 4YC6A 4E4MA 4EHVA 2ERKA 4FTRA 5CX9A 4CT2A 3DKGA 3VONA 3EFKA 4AW1A 3HNGA 4IB3A 2Y6MA 4DH8A 4MXOA 3LLAA 4FTTA 2ZVAA 4E6CA 5IEXA 4AOIA 3DBEA 3AC2A 4IBMA 2ZB1A 1PMUA 4LG4A 5CU4A 2C5NA 4XMOA 4RPVA 2YM8A 4L52A 1YW2A 2CKPA 2B54A 4II5A 4ONAA 5KHWA 2W9ZB 3D5VA 2C6LA 3AD6A 3CC6A 4O4DA 4QTBA 3QX2A 2X8DA 5FBOA 2ZDUA 4WSQA 2EU9A 4KUJA 4QP9A 4QMSA 5HBEA 3MYGA 3IECA 5AP3A 4EOLA 4GKIA 3ZRKA 4DH1A 4BCNA 3RAKA 3FMDA 4B0GA 4ASDA 4BGHA 2YISA 4GYIA 2RIOA 3OTVA 4KIPA 4O0RA 4TWNA 1XHAA 4L9IA 3BWFA 4LMUA 5AV4A 2WEIA 3GU6A 2ITWA 2VTPA 3CR0A 3RPVA 4YTIA 4J97A 5HKMA 4E7WA 3BL9A 4FMQA 3NAXA 4P5QA 1YXVA 4ZLYA 4WBOA 2JAMA 4YZCA 3UVPA 3H9RA 3MA6A 4UYAA 4PUZA 4FV1A 4KRDA 5LVMA 5CVHA 3LLTA 1ZLTA 3DNEA 5A4EA 5H8GA 4UWYA 2JD5A 1JLUE 2RFEA 4RJ6A 4USEA 3D15A 2I0VA 3EMGA 4KINA 4Y83A 4FV6A 5I3OA 2R0IA 4NU1A 4U8ZA 2WKMA 2XEYA 5D11A 3G33A 2E9UA 4OTGA 5KMNA 2CN8A 2H34A 4W4YA 2W4JA 3FZPA 4ZSJA 3NX8A 3TEIA 3WI6A 2XS0A 5DR6A 3IS5A 4YBJA 3PXRA 3UYSA 4AXDA 3QWKA 5HG5A 4ACMA 3PPKA 4DGMA 4IX6A 4DLJA 1U54B 4BDDA 1FGKA 3B8RA 3LE6A 3NNUA 3A7IA 4UMTA 4QPMA 3WBLA 4YJNA 1OKYA 3R9OA 5IF1A 3QRKA 3LAUA 3ZSGA 3WZEA 4FSTA 4KAOA 1T46A 5FDXA 4GFMA 2BAJA 3SAYA 4BI0A 4ITHA 2PE2A 2W1EA 2R3MA 2YERA 3BKBA 4NKAA 1OL5A 4FVQA 5E8YA 1V0BA 2WOUA 1Q97A 3ZXZA 4ZTMA 1XWSA 3OC1A 4KBKA 2QLQA 3HUCA 3HX4A 3ZUUA 4A9YA 1NT2A 3MB7A 5TF9A 3TN8A 1JSVA 4E5BA 5DRBA 3RPOA 3NR9A 3PFQA 2Q0BA 4O1PA 1PMEA 3OCGA 1NA7A 3SXRA 2JGZA 3DJ5A 3QYWA 2GSFA 3PPZA 3QXOA 4FTQA 4G1WA 3SW4A 1FINA 4XG7A 4N6ZA 4XP0A 3W0NA 2X8IA 4O83A 3EJ1A 2WTWA 3QQJA 3R22A 4J96A 4JNWA 3MH3A 2B9HA 3UIUA 4CZYB 3ATSA 4Y46A 3WF6A 4B8LA 1J7UA 4JIKA 3AT4A 5LMAA 2R5TA 4I4FA 3C50A 3PY0A 2I0YA 3NRMA 5ETCA 1GY3A 5CF4A 3PZEA 2J7TA 1ZYLA 3ZFXA 2J0LA 3IGOA 3D5UA 4WHZA 3KVWA 2I0HA 2PZRA 5EH0A 4ZSEA 4L00A 2WELA 3DFCB 4HGTA 4ZTSA 3FQEA 4S2ZA 2V7AA 4DT9A 5A6NA 3DU8A 2GTNA 1OITA 3F3ZA 4OR5A 4FX3A 4QNAA 2W5BA 4EH4A 2V5QA 3MFTA 1BL7A 4JG8A 2R3GA 2UZTA 4GFOA 4MQ2A 4RVLA 3RK9A 5IDPA 5J95A 2FSOX 3HMNA 2B1PA 2YJRA 5DA3A 2F9GA 2PVMA 2QOBA 5FEEA 3A61A 3PY3A 2V55A 1FBNA 2X7FA 4OTQA 1Z5MA 2WMAA 5HO6A 4L6QA 5KMJA 3F3VA 4HVGA 1G8JA 3DBDA 4ALUA 4GJ3A 3VN9A 3CY3A 3I79A 4GFGA 2GS2A 4BTMA 3I7CA 4EK3A 2QG5A 3LIJA 4FG9A 4TYIA 3NW6A 1Y8YA 3FZSA 2XIXA 1Y57A 2Y4IC 2C1BA 3R1NA 4KKGA 4DF3A 3LFCA 4O86A 2X39A 2ITOA 1OBGA 1OL7A 3E8EA 4ANNA 4N70A 2BRGA 3NCGA 5C27A 1H25A 4IWPA 1BX6A 4Y85A 4DH7A 4AN2A 2XZSA 4X3FB 1NVQA 4O27B 4LM5A 4A9UA 2Z7SA 2OLCA 3WF8A 5JH6A 3HZTA 3AOXA 2YJSA 4IZYA 3WE8A 4IM2A 4DG3E 1KUTA 2Y9QA 2ITPA 4FIEA 2OI4X 4FK6A 1ZOEA 1W98A 5D7AA 4EK4A 2Z7RA 5K3YA 5CY3A 3FHRA 2V22A 4BCQA 4D0WA 5GINE 3DOGA 1U4DA 2X2KA 1OM1A 3PFYA 4R3RA 2CNQA 4RQKA 4BB4A 3GC8A 4GV1A 4YHJA 3KK9A 5FTGA 3FMMA 3ZOSA 3MPAA 3QALE 1Q99A 3F6XA 5FTQA 1U5RA 2VX0A 4LV7A 4BJJA 4I0TA 3RBWA 4Q9ZA 1PMVA 1Q4LA 3HDNA 4IX4A 3VHKA 3FXZA 3C4ZA 1GIHA 1NXKA 2ITTA 4OBQA 4WNOA 3VS3A 5DMZA 1Q8ZA 1MUOA 3QQHA 3FZTA 4AGCA 2B0QA 2P2IA 2R0UA 4XLIA 3TT0A 4TL0A 1HCLA 4I21A 3VBXA 4UWBA 3DQXA 4EL9A 5HNGA 4CFWA 3I0OA 4CZUA 3ZDIA 3ZSIA 3NFGB 4M69B 4E6DA 3IOPA 4FSWA 4RX9A 4V01A 3UO6A 2CGXA 5HE1A 4ALWA 1DM2A 4QMQA 4C02A 1XH4A 3T3UA 3HP5A 3F82A 2HY81 3M1SA 1IASA 3H9FA 3DXQA 3TUBA 2J2IB 4O0VA 2F57A 4ZOGA 4C4EA 1H1SA 5JRSA 3HMOA 3KXXA 3ATTA 4DE4A 1ZAOA 2XB7A 3LFFA 3EQHA 2YLFA 4MXAA 4KIKB 3S3IA 3GT8A 4MBJA 3ZCLA 2FGIA 3VUIA 4AXAA 5CEPA 2YAAA 3R7YA 2YM3A 4E6AA 4FEUA 1JPAA 2RFSA 3EQPA 2R2PA 5DN3A 4L46A 4TNDA 2B4SB 2QO7A 3RHKA 4AZFA 2X2LA 3UJGA 4C4FA 4DBNA 3KN5A 2JITA 4BWXA 3HUBA 3LQ3A 2OW3A 2KULA 5FQDC 3DBQA 3ZUVA 2CLQA 2EVAA 2YM4A 3PJ1A 3Q2MA 3RMFA 3C5UA 3OWKA 2IZUA 2IZRA 4TYEA 3L9PA 3UZPA 3RAWA 3V01A 4JOAA 3UVRA 4F0IA 5HO7A 3EFJA 1UV5A 4AE9A 4FEXA 3QRIA 1ZMVA 4L68A 3FEGA 3GP0A 3QFVA 4OTPA 3OBGA 4W9XA 4CNHA 2CCHA 2FVDA 3R9DA 3LPBA 3WZUA 4DHIB 5HVKA 3IQ7A 3HECA 3F66A 4G3CA 3MFRA 3QA8A 4FYNA 5FDPA 2UZVA 5KX8A 4LOOA 5HD7A 2QU5A 3BRBA 4XEYA 4F9CA 4OLIA 3LQ5A 1NVSA 3P5JC 1T45A 4N6YA 3NVKI 4YPSA 3F3TA 2R3LA 1H4LA 2XYUA 5J87A 1QPEA 2OJJA 5C4LA 2XA4A 3VQUA 2C47A 1F3MC 1Q61A 3DBCA 3QD4A 4P90A 4H3BA 4U97A 5TKDA 5DGZA 3ZEPA 5FBNC 4NM0A 5KBRA 4FTUA 2BCJA 5LVNA 4AGDA 4C8BA 4DTKA 4AZEA 2CHLA 3QUDA 4D4YA 4I6BA 5L2QA 2YABA 5CSPA 2VTLA 3F3WA 4UEUA 5EW9A 2PE0A 5B7VA 3PTGA 4I24A 3OW4A 5D1JA 3CGFA 5AR5A 3R8LA 4BYJA 5M08A 1OZ1A 1U5QA 1RDQE 1Q5KA 2C69A 2WMRA 3ALNA 3K3JA 4X3JA 5AV2A 1AD5A 3KMWA 1YHSA 4DEGA 2J50A 4O2ZA 4F9BA 2QR8A 4PPAA 2BZJA 3DKOA 3P7BA 3W2OA 4I6HA 1H01A 5K0KA 4L7FA 1H24A 3TYKA 4XNEA 4HGSA 3V3VA 1JBPE 2CPKE 3ZBFA 2XCKA 5C8KA 4CSVA 5JSMA 4PTGA 4FK3A 3BHYA 4GIIA 5ANJA 5BVFA 2IVTA 2J6MA 2XIYA 4GK3A 2CGVA 2UVZA 5J9ZA 2XP2A 1XH5A 3FSFA 3FYJX 4FSUA 1PRYA 2BR1A 1OMWA 4BCHA 2X0GA 3ORIA 4HW7A 4Y8DA 4G5PA 4ANBA 1BLXA 1ATPE 3G5DA 1FOTA 4LGDA 4J98A 2XKFA 5EHOA 4C33A 2Y7JA 2UZEA 4EQCA 3UPZA 5CSXA 3CSVA 4DT8A 3REPA 4E5AX 1W2FA 3NEWA 2WEVA 3MB6A 4JBOA 5I0BA 2IVUA 4F08A 5E1SA 4AZVA 4FV7A 5IQDA 4HGEA 4BI2A 2R3QA 4FGRA 4PX6A 1DAWA 1B6CB 4GYGA 3I7BA 4JDJA 4RIWA 3NFFB 4BFMA 5HTCA 2R3PA 4FR4A 4M67A 3QXPA 2VWVA 3D5WA 1KV1A 2HY0A 2XVDA 3ZS5A 4NZWB 4RLLA 3QF9A 5CU3A 3SRVB 2HAKA 2OICA 3NVMB 3ERKA 3AD5A 4YTHA 3O8UA 1WCCA 4FBXA 5IQGA 4RJ8A 3ODZX 3Q53A 4G3EA 4RRVA 5DR9A 3R8MA 4ZTNA 5LQFA 1R0EA 3FMEA 4XP3A 5EYKA 2PUPA 3NNVA 3TZMA 1QCFA 5JFWA 4UY9A 2Z02A 4F0FA 4FTMA 5AR4A 2QONA 1S9JA 4EOMA 2WQBA 3EL8A 4GRBA 4PDPA 4PDSA 5FP5A 5JMSA 4FG8A 5ETIA 2W1IA 2Z2WA 4GK2A 3EYGA 4BTJA 3LFEA 3QCSA 4D5KA 3GFWA 3NWWA 3ENMA 3NNXA 3W55A 1FGIA 4P5ZA 5HG8A 3UG2A 4NH1A 3ORKA 1UKHA 4O0YA 4X2GA 4AGUA 3NS9A 4C58A 4F70A 5J9LA 2C3LA 2ZJWA 5ACBC 2IN6A 4NJDA 4BCPA 4AA0A 2VNYA 3D2IA 3SVVA 4RJ7A 2B53A 3CJFA 2X4ZA 3I5NA 5TE0A 3PLSA 1OKWA 4QP7A 4RIOA 4QYYA 3QQKA 3CS9A 4HVHA 2IVSA 4OT6A 4P4CA 2VUWA 4RSSA 3U87A 4XRLA 1WMKA 4ANOA 2WQMA 3FLWA 3GXLA 4FEVA 5IA0A 3MH2A 4UMQA 5IQIA 4WO5A 3EHAA 1ZYJA 4CLIA 3HV4A 3LCTA 2RG5A 4A9SA 5JN2A 3O5AA 4NM3A 4O96A 4M15A 3A7FA 4YP8A 2BHHA 3P79A 5D9HA 3R83A 4ASEA 4ASZA 4EOJA 5IH6A 2YWVA 4O6EA 3KXNA 4YZ9A 4O81A 1QPDA 5JQ8A 5FM2A 5H9BA 4KBCA 3DFAA 3NW5A 4IFCA 4RX5A 2ZFYA 4DDGA 4DEAA 1PKDA 5T68A 3I4BA 4D55A 5CAVA 4FF8A 3G9LX 5EW8A 1GZ8A 3U8WA 1R78A 3LZBA 2VTJA 4M12A 3RVGA 2ITYA 5I9VA 1H0VA 2EB3A 5AIKA 4FEWA 3TG1A 3QC4A 5CVFA 3DPKA 3NUYA 1DI8A 2XNNA 4EJNA 3VIDA 2JKKA 4TWCA 5CEQA 2RSVA 2ZM3A 3AD4A 3ANQA 4CXAA 4F7LA 2CSNA 3EKNA 4EYJA 4JS8A 4XBRA 3TL8A 3EFWA 4IHPA 2PUIA 4OT5A 4UXLA 2CKOA 5E91A 5ETFA 1RJBA 3V51A 4XJ0A 4UMRA 4ZZNA 3O17A 3FZRA 1Q8TA 5HOAA 5DRDA 3PRFA 4WA9A 4YLKA 2XEZA 2QOIA 3GB2A 4JL9A 4TWPA 2OIBA 4AF3A 4NT4A 2HENA 4QMVA 3E7VA 3AXWA 4AG8A 4F1TA 4I5CA 2CGWA 4CMUA 3FQSA 5AUYA 3DT1A 2BFYA 3L9LA 4C7TA 4M0ZA 1PXKA 4N0SA 4QO9A 4FNYA 2VNWA 1KE9A 4USFA 4L3PA 3Q9YA 2HCKA 4V0GB 2GNHA 4FI1A 3FPMA 5DVRA 5ANDA 3ZMMA 3NMUF 1JSUA 4UMUA 1GZNA 3W0SA 1XQZA 3LFQA 4Y72A 4BIEA 3D7ZA 3MIAA 3U6HA 4HVDA 3VC4A 4BF2A 3O8TA 4U3ZA 3G2FA 3NZ0A 1XH6A 5CAPA 4R1YA 5AP0A 4NTSA 4PP9A 4LL5A 1OL1A 3RCDA 4Y73A 4YJSA 3QQGA 1H08A 1I44A 1YXTA 5EOBA 1BI7A 2YEXA 4D2PA 3H4JA 4FZFB 5ANOA 4OUCA 1XO2B 1HCKA 2PMNX 4N4SA 5CF5A 5C26A 4FG7A 4JG6A 3MBLA 5BUJA 2OBJA 5ETAA 3EQBA 3W2RA 2AUHA 2GU8A 4U7ZA 3TKIA 2GS7A 3NPCA 4LL0A 3A62A 4ZSGA 3FPQA 4EHZA 2VTOA 3DS6A 4DYMA 5KUPA 1UWJA 3LQ8A 1OBDA 2VTAA 5BVDA 2WTVA 4BTFA 4JR3A 2IJMA 2GNLA 2CJMA 2HWOA 2P2HA 3PVWA 3FYKX 3K5UA 4AFJA 3R01A 3A7HA 3AC3A 1M7NA 3R2YA 5BMSA 5I9XA 4UWCA 2PZ5A 3V5QA 4CMOA 2JEDA 5CLPA 4QP1A 3RWPA 3W16A 1UNHA 3CIKA 3GCPA 5CS6A 4EZ3A 3O8PA 4I1ZA 4RFYA 2AC5A 3UIBA 3EQIA 2RL5A 4ZZOA 4BGQA 4NKSA 1ST4A 3FZ1A 3A99A 1YI6A 2B9IA 3KRJA 4MNEB 4MWHA 4LDTA 3E3BX 4I3ZA 3BV3A 4IM3A 3CJGA 4G9RA 3PA4A 3PVBA 4I0RA 3V5TA 3CTJA 5KE0A 3LKMA 5K5NA 2OXXA 1CKJA 4S32A 1OL6A 2VTTA 5DNRA 3DKFA 4GIHA 3W2PA 3AMAA 3BLHA 3PXQA 4AW2A 3W0QA 3Q4CA 2XNOA 1ZYCA 2C5XA 2J0IA 4HNIA 3WZDA 5F20A 4AZSA 3KIOC 4WRSA 4X6RA 3UZTA 2VWZA 4IZAA 2IW8A 5HLWA 2NRUA 3ELJA 3P08A 3OF0A 3HV3A 4ZJVA 2V7OA 5DEWA 4OGRA 4IX5A 3TJCA 1A9UA 3HRCA 3ZZEA 4CYJA 5CEKA 3BE2A 3HV7A 4WG5A 3KL8A 3EWHA 4FTIA 3EN7A 5J9YA 5J1VA 5DYJA 3CQUA 1SNXA 4MUQA 4FOBA 3GQIA 2JDTA 2QKRA 4AXFA 5IZFA 3GFEA 1UWHA 3O23A 4AQCA 4B9DA 4NSTA 3MSSA 2BRHA 3AKLA 3FY0A 4BIBA 4Z55A 4DG0E 3C4CA 2PVLA 3F5GA 1UU7A 4YHFA 4RZVA 4AN9A 2HXQA 4R3CA 4X2FA 5CZHA 4I6LA 1UU8A 2PPQA 4Y5QA 1KOAA 4E4NA 3GVUA 2EXEA 3KB7A 2GHGA 4PMTA 5EQYA 5E8SA 4HNFA 5CT7A 4IAIA 4GVAA 1WVYA 3TUDA 3BIZA 4FTKA 4ENYA 4RWIA 5HZNA 3QL8A 3S00A 2XNPA 1L3RE 4FTLA 2PWLA 3ANRA 3I1AA 4FKOA 3VUHA 1CDKA 3EZRA 1WFCA 5K9IA 3MY1A 4JRNA 5DR2A 4G2FA 3KN6A 2CCIA 4LGHA 4DINA 2C6MA 4BZNA 3IDBA 3OXIA 3W18A 5CF6A 3LMGA 4C2WA 1R39A 5IA1A 1ZRZA 4GUBA 1YWRA 2C0IA 3RZBA 4E93A 4C4HA 5ANKA 4IAKA 3Q5IA 1OL2A 4A9RA 4BCMA 3AMBA 1GIJA 2C6TA 2XIRA 4FODA 4RVMA 3ORZA 3S0OA 1WBPA 3HMIA 3S95A 1MRVA 4ZMEA 5FP6A 4AN3A 4JDKA 4PNKA 3UO4A 4FRFA 1M2QA 2BALA 2IWIA 3EOCA 3AC5A 4YJVA 5AUTA 4IVDA 4UZHA 3PXYA 4F1MA 4G3DA 4BCIA 2OSCA 1VZOA 2Y0AA 4EH8A 5H3QA 3VS4A 3TM0A 4RQVA 4U9AA 4JX3A 2F7EE 5EKOA 3G6HA 5C1QB 4O7VA 3OUNB 4EOQA 4FZAB 4E5WA 2VWWA 4ZK5A 4UXQA 2GNJA 2ITXA 4DEHA 4X3FC 3OOMA 1YVJA 4UB7A 3UQGA 3RM7A 4XCUA 3EQCA 4QPAA 2E9PA 4KS8A 2PTKA 3RK7A 3DXPA 2ZM4A 4JX7A 4FT9A 2O5KA 3KCFA 4HCVA 1MQBA 4IADA 3QKLA 5IQBA 3F2AA 5HORA 3KK8A 1AGWA 2CDZA 3NAYA 3QCYA 4HCUA 3V5WA 2E9OA 2OG8A 4F9AA 4YC8A 2UZNA 1XR1A 5HLPA 5AP2A 4KD1A 5BPYA 5F1ZA 4CVAA 2QD9A 3PLAE 4E1ZA 3RWQA 2F49A 1OECA 4GW8A 3HMPA 4Q5HA 3UBDA 5CU6A 2C6OA 5BMMA 2I0EA 2VGOA 4BTKA 2YITA 3AC1A 5ICPA 4G6OA 5M09A 4UV0A 5DHJA 3PJ2A 2QO9A 4D0XA 4D2RA 1V1KA 3NYOA 2X81A 3KGAA 4BDCA 4O2PA 3V5JA 3ZXTA 1JKKA 4PPCA 3CCNA 4DEEA 1KE6A 1XH9A 1ERKA 2VWIA 3ORMA 4H1JA 4QMPA 4PPBA 3MY0A 4IANA 4O0WA 5BV3A 4IC8A 4ZY5A 4H3PA 2WAJA 3PWDA 3R7UA 3C4EA 2W06A 2YN8A 4B99A 4C3RA 2CKQA 5JK3A 4TT7A 3RGFA 4CCUA 3EIDA 5ANIA 4IDTA 5HX6A 4QPSA 2X4FA 2X6DA 4CFXA 4F6UA 5CU2A 3DY7A 4XHKB 4EBVA 4LV5A 4AW0A 3Q6UA 4FV0A 4MXXA 3OWLA 4W4WA 4DH5A 2OJFE 4JQ7A 4QYGA 4YJRA 5J8IA 2JKMA 3ULIA 3LCSA 4J1RA 1J3HA 3ORLA 3CTQA 4KSQA 5B0XA 2KTYA 4FL1A 4I5MA 3VF9A 3BELA 5KKRB 3C4XA 1PJKA 3CPCA 3QD2B 4BZOA 1G8AA 1PMNA 2WXVA 5I9UA 2PY3A 2X7OA 1J7IA 3QHWA 4ZY6A 2QU6A 4E26A 5DLSA 2J51A 5FD2A 3TTIA 4H3QA 3LW0A 3QQUA 1R3CA 3Q4TA 4BR3A 2GQRA 2E2BA 2IW9A 2JIUA 3P0MA 4JIAA 5HCZA 5KCVA 4IAAA 2WQOA 5DT3A 2XARA 4NFNA 2X8EA 3I81A 2VWXA 4W4VA 1P4OA 2RFNA 4D1ZA 2WTKC 3HMMA 3IW4A 2P4IA 5KMLA 5IQCA 3QRTA 5CNNA 4YZMA 3TKHA 1W2DA 3TACA 1UNGA 2OJ9A 3LCOA 2C6DA 4NM7A 4RVTA 3QZGA 5HCYA 3E7OA 5HEZA 3EN5A 5TR6A 5HU3A 1K3AA 3O2MA 3ORTA 3PVGA 4P2KA