4QP4A

Crystal structure of erk2 in complex with n-cyclohexyl-9h-purin-6-amine
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
345
structure length
337
Chain Sequence
MVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title Fragment-based discovery of potent ERK2 pyrrolopyrazine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 337
sequence length 345
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qp4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qp4A01
1UU3A 4Q9SA 4U45A 3GEQA 3VBYA 4EH4A 1JSTA 3NVKI 1OL7A 4QMYA 2AYPA 5EK7A 5IPJA 3AXWA 2OFVA 1JSUA 1YXXA 4X21A 3ALNA 4YHTA 2GCDA 2HOGA 4C3FA 4DT8A 1H08A 3A60A 2WMSA 4RWLA 2VTOA 4AOIA 2CMWA 5L2IA 1UNGA 3I6UA 3UGCA 1JAMA 2ZYBA 3NUSA 4RX8A 4P5ZA 1MQ4A 3D9VA 3QTXA 2C4GA 3NW6A 3IO7A 4RFMA 3ZSGA 3E8EA 3K5VA 1ZYCA 5EW3A 3E3PA 1CMKE 3CLYA 3BKBA 5G1XA 5HE1A 4TYEA 3Q5ZA 4ENYA 4BDKA 5BMMA 3HAVA 4R1YA 2C6OA 5D9HA 4GK2A 3QYWA 2OI4X 3OG7A 4K33A 2PPQA 4EHZA 2UZOA 3I60A 3GU4A 3OUNB 4D58A 4YO4A 3P86A 1H1RA 4FTTA 2R3JA 3F5GA 3ROYA 4B6LA 4JQEA 3Q60A 5L8KA 5FDXA 1IRKA 2W99B 3OT3A 2VTQA 4RZWA 3R7UA 3B2WA 3O51A 2J0KA 4IEBA 3IQ7A 3LJ0A 5BNJA 1YXTA 3CS9A 1Q24A 1W83A 5E1EA 4NM0A 4EOKA 2VTAA 3F69A 3R1SA 2HCKA 4BDBA 2XIZA 3WIGA 2AC5A 3QRIA 4CTBA 4K1BA 4DEHA 4FICA 2R3QA 2WTDA 3MN3A 4DEEA 2Y4IC 3CEKA 5C01A 3VVHA 3R7OA 1J3HA 2O2UA 3ETAA 4APPA 3I0OA 3VF8A 2I0HA 4A9UA 4CLIA 1H0VA 1OM1A 2VWVA 2YM6A 2W9FB 5AJQA 3PG3A 4B9DA 2OF2A 2YIWA 3ACJA 3CQWA 5M4FA 3R7IA 4FF8A 3KXMA 4E4XA 4KIKA 5LOHA 1FVTA 3VS7A 5DT4A 3HNGA 1M17A 1I44A 1GNGA 4JX7A 4JDIA 3S2PA 4MEDA 3WE4A 4Z7HA 4O7SA 3ZCLA 5BUJA 5A4TA 2YWVA 4UYNA 4IFCA 3A61A 2UW4A 3QALE 1WAKA 3FXZA 4BYIA 3NYOA 4FTCA 3OUKA 3NNWA 4RJ7A 1ZYJA 1NXKA 4ZK5A 3LCDA 3PXYA 5H8BA 4AU8A 5A4CA 3FHIA 5HLNA 3MH3A 4KD1A 1IAJA 3SD0A 2J0LA 2PUPA 4MCVA 4ZY4A 3TWJA 3A4OX 4L3JA 2XK7A 3EKKA 3PVGA 4FSNA 5JQ5A 5IQHA 1GZ8A 1V0PA 3QLFA 4U42A 4HYHA 4UMPA 2UW0A 2P55A 3U54A 2GFSA 4LGDA 3CC6A 2PZPA 4G6LA 4YBKA 3C0IA 2A27A 2WOUA 4ANSA 1Q8TA 4ZAUA 3PVBA 3P5KA 3GQLA 1FVRA 2XKDA 1UNHA 4TXCA 4AN2A 2DWBA 4QTCA 3IDPA 3ZLWA 4G3EA 5EH0A 5AR8A 3KXZA 3DBQA 3FLNC 4FL3A 4OAVB 2DQ7X 4RT7A 1ZZ2A 2QNJA 3Q4UA 3KRRA 5AAEA 2Z8CA 4MF0A 3E8CA 3GVUA 5I9WA 5IEYA 1QPJA 4EOPA 4XP2A 3OT8A 3E8NA 3EZVA 4G3GA 4ZSGA 3R9OA 3BI6A 5HE2A 5ICPA 2CNQA 3V6SA 3HV4A 5B2KA 3COIA 5CS6A 3NPCA 4DGNA 1GY3A 1GZOA 1I09A 2IVTA 3MW1A 3QBNA 4JI9A 4U7ZA 4D9UA 3RPYA 1TQPA 2YJSA 2ZB0A 4PDPA 3QTIA 4ACDA 3UIUA 4WSQA 4ONAA 4Z9LA 1JNKA 2HXLA 2VNYA 1J7IA 4PMPA 3QQGA 4IB1A 3GOKA 4FV6A 4ITJA 4E4LA 5CAUA 4NIFA 4CT2A 5AV0A 4N0SA 3JVSA 3QZGA 4QMQA 4ZTQA 1BL7A 4IANA 2OO8X 3PPKA 4F0FA 1G8SA 3NCGA 3VBQA 3DV3A 3BWJA 2J9MA 3FXWA 3BLHA 5EDQA 3RZBA 1VEBA 2V62A 4JL9A 5GJFA 4O86A 4HW7A 4HGEA 2BAJA 4FSQA 1PRYA 5JT2A 5M57A 4YJSA 1GIJA 3MA6A 3KMMA 1IG1A 3QTSA 5FD2A 1P5EA 3NW5A 5EM7A 4HVHA 2RG5A 3MY0A 4RJ6A 2HAKA 3AMBA 5I3OA 4WOVA 3K2LA 2PWLA 5M07A 1AD5A 2AUHA 4CKRA 4CZYB 4IW0A 3VNTA 4HPTE 1DI8A 3AG9A 5H9BA 3R73A 3F3ZA 3FMJA 3U87A 4X6RA 2W17A 2YCFA 4W4YA 5IH4A 3TT0A 2J51A 2GS2A 2A0CX 5FQDC 4Y85A 3FSKA 3FUPA 3G9NA 4U8ZA 1WBWA 4D5HA 4TYHB 2HYYA 4IWOA 1R1WA 4XNEA 4FSYA 1H28A 5E8UA 4CCBA 3LLAA 3FLWA 3KVXA 2GQGA 4AZTA 4RVLA 1PMNA 3QTWA 3SRVB 3RHKA 4FV8A 4BDDA 3MPMA 4ERKA 5F4NA 1Z9XA 4EH2A 4YTCA 1KSWA 4X2NA 4IZAA 4XG4A 3TNQB 3HLLA 4K9YA 1H8FA 3VN9A 1LPUA 1ZY4A 3WF8A 2B1PA 4KKEA 4EOLA 1JKLA 3DZQA 3PXQA 5EOLA 4EZ7A 2VWBA 4BDHA 4H1JA 2PMLX 3MVLA 3A99A 3CBLA 4PTGA 2WEIA 3DKGA 4FKRA 4HGTA 4ANMA 4UALA 3VUTA 4QMPA 4AN9A 3CD3A 1RQQA 4CFVA 3I5NA 4ZY6A 4IX3A 2GSFA 3VS0A 3FQHA 1BYGA 3R1NA 3VS2A 4DN5A 2Z7QA 4EH5A 5BVNA 5HEZA 1WBSA 2JD5A 1BX6A 1KV1A 1R0PA 3I79A 3QD2B 4EK5A 3TNIA 4DGMA 4C61A 5IA4A 2C0IA 3QHRA 3BGZA 2X7OA 5JEBA 1ZYDA 1B39A 3DS6A 3VUDA 3QCSA 4FZAB 4JBPA 2GTNA 3UE4A 2YCSA 2X0GA 4EZ5A 1XBCA 4KSPA 2W4KA 3FY0A 3LVPA 3QUPA 2XVDA 5AV3A 2QQ7A 4CVAA 2EB3A 3LJ1A 3C51A 4I6BA 4R7HA 4LL5A 5F9EA 1OPKA 2WMAA 4HCUA 2YERA 3KCFA 1Q97A 4GK3A 3L9LA 1PJKA 2C5VA 2IW6A 2WMUA 2YN8A 4A7CA 1SNXA 2C47A 4PX6A 2BPMA 4FL2A 3FKLA 4B0GA 4RGJA 5AWMA 3Q3BA 4XG3A 3D5VA 4QMXA 2WGJA 4X7QA 4MK0A 3PFQA 3WF6A 1Q61A 3VBVA 2PMNX 2WAJA 2QOQA 5HE3A 4RIXB 3FMMA 3UBDA 2J4ZA 3GCPA 2H34A 1DAWA 2C6EA 3QTZA 4USEA 5FBNC 4BB4A 2YM4A 4PTEA 4KIPA 2XUUA 1XJDA 2RFDA 3OY3A 1VR2A 3D7ZA 4JNWA 4TZRA 1YQJA 4BWKA 2XK6A 3ANRA 5BPYA 2E9OA 5FXRA 3DBFA 4QRCA 2Y9QA 5ETIA 5EYKA 1M52A 2VTTA 1QPCA 4CFNA 5AP0A 3PY0A 3KRWA 3MFSA 4R7BA 3R8LA 4BRXA 3FI4A 3FY2A 3QCQA 2BRGA 3RK9A 4DEBA 2WELA 3PJ2A 3AC5A 4EI4A 4F09A 4DTBA 2EWAA 4DH5A 2OZOA 3RVGA 3NWWA 3NW7A 3VIDA 4DAWA 4K18A 2XA4A 3NR9A 3TNPC 4A06A 1KE8A 4YTIA 1Q8UA 4BBMA 3OHTA 3PIYA 5KMMA 3SHEA 2VWUA 5E8WA 5JZNA 4FIGA 3QA0A 4QOXA 1CTPE 1OECA 3E88A 1JSVA 2O5KA 4G3FA 3VS1A 4AT4A 3LCOA 3ZTXA 4FV5A 4AF3A 2OIDA 3DB6A 4MD9E 3BGPA 5BYZA 4I3ZA 4R7IA 3RI1A 5JQ8A 3KQ7A 3UIXA 4EOIA 3V04A 2F2UA 3GUBA 3IGOA 3UG1A 5HVJA 3KFAA 1NVSA 4EUTA 1ZLTA 2HY81 5LMKA 1Z57A 3AT4A 1F3MC 1YWNA 4FKPA 5E9EA 4DG0E 4BC6A 4YJRA 3CQUA 4O7NA 2RGPA 2QOKA 1MQBA 4W8DA 5CQUA 5FGKA 4QYGA 1M2RA 2GS7A 3R0TA 4XG9A 5CI7A 4YLLA 4EZ3A 1V1KA 2ITWA 2JKKA 2PVFA 3D5XA 3KRXA 2EU9A 3PP1A 3ORIA 3HMMA 1CSNA 4LRJA 5E8YA 2XB7A 3ZO2A 4F7NA 1MRUA 2AC3A 4EHVA 2ZV2A 4U9AA 5DHJA 4Y46A 5LARA 4RLLA 1S9JA 2C6TA 2RFSA 4GJ2A 5TO8A 5HLWA 2C3IB 2OJFE 4RWJA 3KULB 3BYMA 4GG5A 4EK8A 5FTGA 3MV5A 2REIA 4MD7E 4V04A 2PZYA 3V01A 2C6DA 1WBVA 4KBAA 3PJCA 2OJIA 4JX3A 3KY2A 3MH2A 4BCKA 5ACKA 3GP0A 2H6DA 4L68A 3NLBA 4NTTA 4AZEA 4LI5A 4S32A 4QTBA 5CVFA 4FSRA 5DYJA 2HK5A 4FTOA 4WG4A 4GVAA 5CSVA 4FT0A 4MNEB 5IDPA 4RQKA 3LZBA 4M67A 4QT1A 4PUZA 4F7SA 3DY7A 5LXMA 3UG2A 4ZTLA 4C02A 4PL3A 2VWZA 3RJCA 2V55A 4GJ3A 3IOPA 1R39A 4PY1A 2ZM4A 2WMTA 5FEQA 4MVFA 4RVTA 2ETKA 4CG8A 4BWXA 4UMTA 2QG5A 1ZWSA 2F7XE 2F9GA 3Q04A 3UMXA 4PP7A 4QMTA 3OCSA 3CGFA 4G5JA 2WXVA 4G1WA 4GU9A 5CAVA 4YZNA 3HDNA 3ALOA 4ZTNA 5HIEA 5EHLA 3VRYA 3LPBA 1Q41A 2IZTA 3R8UA 5EI8A 3ZFYA 4FKGA 5CF6A 3EN5A 3V6RA 2A2AA 1A9UA 4LV8A 2XZSA 4J71A 3C4XA 2VN9A 4BCQA 3VS4A 2UZDA 3UC3A 4F6UA 2QLQA 4S2ZA 4AFJA 4R1VA 4XP0A 4IC7A 4ACMA 3OW4A 3FXXA 4UV0A 1JLUE 3E64A 3S3IA 5LWNA 2A19B 3ZYAA 4G16A 5T68A 4U79A 3LXPA 4ANNA 4BTFA 1IR3A 3JVRA 3F3VA 3OCGA 4DFLA 5CU0A 2GQRA 4E73A 5IISA 3DNEA 4U5JA 3O8PA 2P2HA 1FOTA 1Q5KA 4UMUA 1XBBA 1E1VA 4RC2A 3PJ3A 3CPBA 1JKKA 2PHKA 5EDRA 1JVPP 5AA8A 1JOWB 4XS2A 1PYEA 3G0EA 2QODA 3C5IA 2VWWA 4AS0A 3OCTA 5JFXA 4OBQA 3W2PA 2BROA 3TNHA 3Q6UA 1Q62A 4YJVA 3R8VA 5D10A 4XP3A 1H0WA 3I6WA 3KRLA 3OEFX 4ZS4A 3OBGA 4C33A 1XKKA 2VGPA 3GU5A 5AP1A 4AW2A 3VJOA 3JY0A 4DHFA 1YWVA 2ITOA 4NWMA 5HTIA 4RQVA 3ODYX 3HUCA 1CKPA 3G2FA 4FV0A 2VX0A 2XIRA 2XK8A 3F2AA 3BQCA 3QTUA 3UP2A 4PMTA 2YDJA 4MBIA 4JRNA 4TL0A 5JRSA 2CDZA 3BYSA 4GVJA 4WBOA 4BBEA 3O23A 2FYSA 4G3DA 3G51A 4PL4A 3NEWA 4I0TA 5ANIA 5FM2A 5JGDA 4GT3A 4JIKA 4BVUA 2IPXA 2QG7A 4ERWA 2XEZA 4KRDA 4QPAA 3HV7A 5JGAA 2WFYA 2UW9A 2W1GA 1OPLA 3IDBA 3RPSA 4F9CA 1AGWA 1J7UA 4IQ6A 5CT0A 3RK7A 4L6QA 3W1FA 2H96A 3LFEA 4FG9A 4P5QA 3BE2A 3TZ7A 3QAME 4UXLA 4CCUA 2V5QA 3G15A 1ZARA 3AD6A 5HX8A 4FSUA 3C13A 3LFSA 2RG6A 4I24A 5J9LA 2E9UA 4ASEA 4JQ7A 4FT7A 4R3PA 4F63A 4O21A 3QFVA 4LUDA 1OIUA 1IA8A 1PYXA 3AC2A 4X2FA 4FT3A 1FPUA 4FOBA 5CSHA 4ZLZA 5FM3A 3NVMB 5CENA 3CE3A 3SXSA 1KWPA 4PDYA 5E4HA 1L8TA 4FGRA 4DFBA 3GGFA 3ZSIA 2E2BA 3U6HA 4BF2A 4F1TA 4AE6A 4C58A 4WNMA 3EWHA 3FLQA 3FMDA 4AZFA 3DGKA 4TYJA 4L45A 5G6VA 3WZEA 2BRNA 1Y8YA 3IOKA 4K77A 3BU5A 3EN6A 4C35A 3BQRA 3FKOA 3FQSA 1QL6A 3PSCA 4HOKA 5CEMA 2QC6A 3R1QA 5IDNA 3HX4A 4ORKA 3HRFA 2WMBA 2XRWA 2YCQA 3H3CA 2BTSA 2XNOA 4BDJA 1FBNA 2W9ZB 4ZTSA 5IKWA 4DITA 4EKKA 3PXFA 4ASZA 3ZM9A 4J95A 3EHAA 4L7FA 2FSTX 3K3JA 4YNOA 3UIBA 3D94A 2O63A 3EH9A 3I7BA 4QYFA 4UWCA 5IQEA 4KBKA 2YM3A 4I41A 5J7BA 1W7HA 4NM5A 4O2PA 4FTUA 4QO9A 1K2PA 4FZ6A 3A62A 3CY2A 3QRTA 3O17A 5JMSA 3OD6X 4PTCA 2UW6A 5M56A 1XH4A 3DKFA 5AR4A 3MFUA 3OC1A 2QKWB 1F5QA 4PF4A 4DEGA 1PHKA 1T45A 4HPUE 4L46A 4O38A 4BCFA 2FVDA 2Y6OA 4WT6A 3ZZWA 4E4NA 2XKFA 3SVVA 3GC0A 4FV7A 1PXOA 3PXKA 4D1XA 4GYGA 5H8GA 3WARA 2GTMA 5CU6A 5E8SA 4EK6A 3ATSA 4TN6A 3R1YA 2ZM3A 4HJOA 1XH7A 1ZMUA 3TZ9A 2OH4A 3FC1X 1XH6A 2QVSE 5ETFA 5FRIA 2HELA 2PVYA 3VBXA 4JT3A 3E3BX 3LOKA 2OIBA 5EOBA 1H4LA 4FV9A 4PNIA 3RK5A 2I0VA 4BCJA 4OAUC 3GCUA 3RM6A 4O7WA 3WF7A 2PVHA 2UVXA 4EC8A 2CLQA 3NNUA 4IVAA 2ONLA 5HG5A 4IAFA 3GFEA 1BUHA 1FMOE 3MGYA 5C26A 5FBOA 2ZB1A 2Y4IB 3PZHA 2QOOA 4EKLA 2BDWA 4FBXA 2P33A 2WPAA 3MBLA 1LR4A 4GL9A 2PZRA 5HU3A 2O0UA 4EJNA 1H1SA 5LWMA 2W96B 2WQMA 3SQQA 3BCEA 4RA5A 1H24A 3EYHA 5DR6A 3UNZA 2RF9A 2VTIA 4FKSA 4IH8A 2CGXA 3FZRA 3P7BA 4CFMA 3DNDA 2PMOX 3GU7A 4HCVA 1SVEA 4V05A 4EEVA 5HORA 1IAHA 5C8KA 4P2KA 1DI9A 4YP8A 1SM2A 4RFZA 4AT5A 3L9PA 3HAMA 5M51A 2XEYA 4O0TA 4JG6A 3ZEPA 3LXNA 3V8WA 3FSFA 2GNFA 2QR8A 2OJ9A 4ARKA 3QHWA 2FUMA 3Q9WA 3KXHA 5AUXA 2HZ0A 3BYOA 2IO6A 3RAWA 4DTAA 2BCJA 3QKMA 1OIQA 3OFMA 2LAVA 3OF0A 5HG9A 4D4RA 4ZLYA 4Y83A 1YI4A 4BR3A 3KXGA 4QP8A 5J95A 4D2RA 3KF4A 4FEUA 3PVWA 2PVMA 3TV6A 4FT5A 4QP9A 3IG7A 2GNHA 4WKQA 2W7XA 3W8LA 3ENHA 4YSJA 2B52A 3H9FA 4XOYA 4IB0A 5F95A 4B8LA 5L4QA 4LRKA 4OW8A 4D2WA 4ZJIA 4AA4A 4WA9A 4C4GA 5M06A 5M08A 4CTCA 4E93A 2BUJA 3FDNA 2G2HA 3IW7A 3FZSA 5FDPA 1J1BA 3CCNA 1FGIA 3C1XA 2XBAA 3ODZX 4JDHA 4RIWA 4AN3A 5DMZA 5L8LA 3Q32A 4A4OA 4O7ZA 2CGWA 4UZHA 4F70A 2XIXA 4IAIA 4IZ5A 3DXPA 2XNEA 2R3IA 4FKOA 3VAPA 1OZ1A 1NW1A 4BCIA 4QMMA 2HY0A 3NRMA 4Z7GA 2ZVAA 4LG4A 2ZV9A 4E5WA 3KREA 5KMLA 3Q6WA 4IAYA 3IW5A 2JKQA 5HICA 5HOAA 2CN8A 3BEAA 4DEIA 4BDFA 2XK9A 5I5ZA 2G15A 4FTRA 4JR3A 3F3TA 2LGCA 3EQFA 3P78A 1Y6AA 3CD8A 3CP9A 2ZDUA 4I93A 4L67A 2QU6A 3PE2A 1OBDA 2IW9A 3ID6C 4BDGA 2PVKA 3NMUF 2BKZA 4CG9A 5DLSA 2FGIA 4UMRA 5M4UA 1VYWA 4ZSLA 3DB8A 3W33A 2PUIA 5FXQA 3F5PA 5JK3A 4I21A 2PULA 3AC3A 5CEKA 1LUFA 4JIAA 3OROA 5JKGA 5AUVA 4GFOA 4I0RA 2C0OA 2X7GA 3L1SA 4YHJA 5LMAA 4IWPA 4LRMA 3V5JA 3C50A 2Y6MA 3IPHA 4GT5A 5EKNA 5I4NA 3QWKA 1LEZA 4AFEA 2CNUA 2HIWA 4I6HA 3BIZA 3BPRA 5BYLA 4IXPA 2UVYA 1KV2A 3IW8A 4O27B 3SA0A 4FIIA 1JWHA 3E7VA 3BRBA 4IDVA 5C8MA 1G3NA 2W4JA 3OXTA 5J9YA 4J97A 2OH0E 1H1PA 3PA4A 3QGWA 4M68A 4MXAA 4EH7A 4BY9E 1OKVA 4E5BA 3EFLA 3HA6A 4BCGA 3PRIA 2X1NA 1CM8A 4DGGA 3DQWA 3GOPA 4V0GB 2Q83A 4R5SA 4FV4A 5D12A 4OR5A 5DH3A 3C4CA 2VTLA 3ZH8A 4AGDA 1Q3WA 2CHLA 4BTJA 1YXVA 4IM0A 2WKMA 4U97A 4EC9A 3HP5A 1ZY5A 3PIXA 4QMWA 5EKOA 4LFIA 4FTAA 4CRSA 4D55A 3U55A 3I81A 3NAYA 3U6JA 3EQCA 5KBRA 2ZV8A 4IE9A 2ITVA 5AP2A 3UIMA 4NEUA 4O0XA 4OTPA 5FEEA 4RJ4A 3R04A 4O0VA 4Y5HA 3F61A 5CF8A 4DYMA 3ZMMA 4YC8A 3NUYA 2YHVA 3I1AA 3VC4A 4NCTC 2VTRA 3HKOA 2J5FA 2QOBA 3QC4A 3V3VA 4MHAA 4EUUA 2C3KA 3ANQA 3TJCA 2OZAA 4L7SA 4RBLA 3LKMA 1GAGA 5HBEA 1U5RA 2GHLA 3NX8A 2BMCA 2GDOA 4BIEA 5J5SA 3FEGA 5IQDA 4D4YA 1PXLA 4AW5A 2JDTA 3R7EA 1PKDA 3MS9A 4O6LA 3UO4A 2YJRA 3MIYA 5IH6A 2HZ4A 2QR7A 4M69A 4QTAA 4BICA 2B0QA 2Z02A 4PPAA 3OTUA 1KE5A 5AADA 1W98A 3DT1A 5CSWA 5IQAA 5DI1A 4RX5A 4FZ7A 1PF8A 4MX9A 4RJ3A 3NYVA 4F0GA 4Y72A 4ZEGA 3EQGA 5KHWA 4RC3A 3N4VA 4H36A 5AP7A 3A7GA 1NVQA 4Q2AA 2IVVA 4EBWA 4EOOA 2B53A 3A8WA 5E7RA 4BHNA 5J1VA 1XQZA 3R9DA 1DAYA 2XP2A 1NA7A 4L9IA 3T3VA 4E6AA 4PWNA 5LVOA 4FTIA 2PL0A 5B2MA 4H3PA 4YUQA 2QU5A 2R3MA 4EH8A 3IW4A 2QO9A 4AX8A 2WTWA 5DE2A 4YJTA 4N57A 2E9PA 3DJ5A 4QMOA 5CWZA 4QQCA 1A48A 4L3PA 5HVKA 3K3IA 1J7LA 3RCJA 3D0EA 3ORZA 4BDCA 1EH4A 3DBEA 4BFMA 2OXDA 4N70A 3TKIA 3OXIA 1APME 4EOQA 4A4LA 1Q8WA 4KS7A 2V0DA 3ATTA 3R8ZA 3O7LB 4EYMA 4LUEA 4FKWA 3D7TA 1OIRA 4AA0A 4O22A 4OTIA 3FAAA 4OTDA 1W84A 2GU8A 3B8QA 5EYMA 3VRZA 5JRQA 4PNKA 2O64A 3CR0A 2ITPA 2C5XA 2ZMCA 3SXFA 3Q4CA 4L44A 3FC2A 4QP1A 2FH9A 2WB8A 4J99A 2BILB 2BZKB 4OTQA 4G2FA 4ZXTA 4ANOA 4E4MA 4FKQA 4Y73A 5IUHA 3OZ6A 4X2GA 2UZWE 3QX4A 4AAAA 4EOMA 1Q8YA 5E8ZA 4XLIA 3BYUA 2YITA 2YM7A 3F7ZA 5JH6A 2G1TA 4DG2E 2P3GX 4HNIA 2OSCA 4MD8E 1QMZA 5BVOA 3UZTA 3SW7A 2QCSA 4C62A 4PPCA 3D4QA 4LMUA 4E26A 2PUNA 3KEXA 4U81A 5AAFA 4ZP5A 5IEVA 4NYEA 5DOSA 2Q0BA 4JG8A 3LFBA 4EHGA 2OK1A 5BX0A 5J9ZA 2WQNA 2WEVA 2OKRA 5EYCA 2XNBA 3VS6A 1XWSA 2C6LA 2UZUE 4GH2A 4N6YA 3LQ5A 2R9SA 2R3OA 2ZV7A 3NIEA 3P7CA 1ZOHA 3GFWA 3TTJA 4AZWA 4BCNA 1H26A 3NSZA 4P90A 5M44A 4CXAA 2CNVA 4EHEA 3LLTA 4UB7A 2CSNA 3DK3A 4KAOA 2PYWA 5CI6A 1OL2A 2NO3A 3HV3A 3MY1A 1Y57A 3B8RA 5KMKA 1W82A 4YTFA 4Y95A 4AGCA 5J8IA 1U54B 5IQIA 4WSYA 1OMWA 2VRXA 1UA2A 2BZIB 4EJ7A 4CFUA 3VO3A 5JN2A 3RALA 4FL1A 4U0IA 1RE8A 3WZJA 4ZIMA 3OEZA 5A9UA 5HX6A 2GHMA 4GIHA 4UXQA 4WRGA 5JGBA 5EQPA 3TZ8A 3AOXA 3RNYA 1W8CA 2W1ZA 4FSWA 5CAQA 3R63A 4KKGA 4M14A 3HRBA 2YABA 3JS2A 1XH9A 3LAUA 4FTMA 5AR5A 3RAIA 4ZMEA 3FZTA 2V7OA 3UYSA 3R7YA 4HVIA 4IWDA 5AUYA 3WOWA 3FZPA 5EM8A 4ALVA 3MIAA 4UWBA 4YZDA 5HNGA 5CF5A 5KKRB 4MBJA 2NP8A 3DBCA 3IGGA 3P4KA 4QNYA 4HYUA 4BDIA 4F1MA 5LJJA 4H05A 3RTPA 3SV0A 1ZMWA 3HUBA 3RZFA 2B54A 3QUEA 3OOGA 4R8QA 4DEAA 4NM3A 5EDPA 3W16A 2FSOX 4BZOA 5HCYA 1S9IA 3DKCA 1PY5A 5KZIA 5DR2A 5K4IA 2QHMA 2YIXA 2YM5A 3FLYA 4V01A 2ESMA 5AR7A 5J79A 5AR2A 2CKEA 3EFKA 4MH7A 5ANKA 3ELJA 5L8JA 5AAGA 4F7LA 4Y5QA 1ZYSA 4QP6A 3BWFA 1M7QA 4QYEA 4MXXA 4W4XA 2ZM1A 4R3RA 4NW5A 4MF1A 3UDBA 4OBPA 1UKHA 4FV1A 4R5YA 4JBQA 4CFWA 1FVVA 1AQ1A 3MFTA 3V5TA 2UV2A 5KX8A 5CX9A 1Y91A 5L3AA 4NL0A 4FA2A 5HG7A 5LVLA 5CZIA 4KINA 4D2SA 3W18A 2UZBA 4TWNA 3QU0A 1YI3A 2BDJA 2JFLA 4XG8A 2J0IA 2RFEA 3UOKA 4FE2A 1ZZLA 4TWOA 1BLXA 2F57A 3DK6A 3H10A 3HMNA 3PLSA 4P7EA 4U3ZA 4FZFB 4DG3E 2WIPA 4FEXA 1HCKA 2UZVA 3K5UA 5HU9A 5KO1A 3NUXA 1GIIA 4YZCA 1CKIA 3FMLA 3LIJA 3MPAA 2FB8A 3AD5A 4KIKB 3T9TA 2VWYA 4BCHA 4BI1A 4C4HA 4OTRA 5HZNA 2EXEA 3CTQA 4HZRA 4QQJA 4UWYA 1URCA 4D9TA 3LCSA 2YZLA 3MTLA 3D2IA 2YDIA 2B9HA 4IHPA 3R83A 1LEWA 3TKUA 3JR1A 5ETAA 2ITNA 3F82A 4LV5A 5ANJA 2W06A 2GMXA 1OGUA 4F08A 4PDOA 3EIDA 2YEXA 4FEWA 4NSTA 3C5UA 3GXLA 5HO6A 2W1FA 2W1EA 1TQMA 2EVAA 5BQ0A 5AV4A 3G9LX 2WNTA 3O2MA 4XLVA 5EG3A 5AFVA 4ID7A 1UNLA 4NFNA 1BL6A 3EFWA 3FZOA 3C9WA 2YDKA 3QWJA 3Q9ZA 4BIBA 3TJDA 2BVAA 3NUUA 4RIOA 4CV9A 1O9UA 1PMVA 2BTRA 3JXWA 2Z2WA 5ACBC 3PY1A 4L43A 1YHSA 2QLUA 1H00A 4RIYA 4X3FA 4XG7A 5EM5A 3U4WA 4FTNA 3WZDA 5CQWA 3MI9A 4Z55A 5GINE 3HECA 4ZS0A 4M0ZA 3U8WA 5CXZA 1Y8GA 3PJ8A 4JLCA 5CASA 4C8BA 3KGAA 2R3NA 2YIYA 4ZOGA 5M55A 3RAHA 1YHWA 5HTBA 5TE0A 1OKZA 2X2KA 5L2SA 5BVFA 4TWPA 3UPZA 2JDSA 4GT4A 1HOWA 4CEGA 4BGHA 3V8TA 1PXJA 2YWPA 2X9FA 4ANBA 3HMOA 3ZLXA 4FK6A 5LVNA 1U59A 3E62A 3DAEA 2G9XA 4IX6A 4II5A 5A4QA 4YR8A 3NUPA 2HXQA 4O96A 3UOJA 2X8IA 3FMHA 2X8EA 4GKHA 4JJRA 3E7OA 4DCAA 3HV5A 3U9CA 5KKRC 2XYUA 3F2RA 3BZ3A 3R22A 4IIRA 4NIFB 1GJOA 5DT3A 3MFRA 3PP0A 4BGQA 3GU8A 4AZVA 3QQLA 2HENA 3EZRA 3MH1A 5DT0A 2QI8A 3FPMA 4GFMA 5I0BA 2BRMA 2PSQA 4O91A 4WIHA 4QTEA 2CN5A 4NK9A 3V5WA 1A06A 4KKHA 2IWIA 2ZOQA 3F66A 4ZZNA 4QP4A 4KB8A 2JDVA 4I23A 3HEGA 4MYGA 4BDAA 3DQXA 1O6YA 2B9IA 2R3FA 3FBVA 3Q53A 2V7AA 3FQEA 4KABA 2B55A 4M0YA 5KHXA 4G3CA 4BCMA 4FUYA 2OIQA 3P7AA 4MQ1A 3R71A 3TN8A 2IW8A 4C2VA 3LQ3A 2BDFA 2VNWA 2XNMA 5A54A 4YO6A 4Q5HA 2RFNA 4ZZMA 4H3QA 3UVQA 4E6DA 2V22A 3FI2A 3QC9A 3G5DA 3FV8A 1RDQE 4O1OA 2Z7RA 4ITHA 3RPRA 1FGKA 2J90A 3U51A 4GUBA 5KCVA 5AP4A 4NUSA 3PG1A 1YDTE 4X3JA 5AM6A 3UVPA 3P9JA 5DRBA 2OFUA 3EQDA 1ZMVA 2BAQA 3PA3A 5E8XA 4DE4A 2XCHA 1UU7A 4I5HA 4ALWA 2XK4A 5JFVA 4GU6A 3CPCA 4G6OA 2SRCA 2WOTA 3PPJA 4HGLA 4TNDA 1QCFA 3FLSA 5CXHA 4DC2A 3QF9A 4M15A 2R3RA 5KMOA 4BI0A 3EKNA 2IZSA 3NNVA 4IB5A 5AP5A 4R77A 4Q9ZA 4H1MA 4ZZOA 1STCE 3FMNA 4AGUA 3II5A 5AX9A 3QTQA 3FYJX 4FIJA 4L00A 3TEIA 2XM8A 3RWQA 4NH1A 4BGGA 1FINA 4YU2A 4D1ZA 2ETMA 4M8TA 3AC1A 3NYNA 5GHVA 2PK9A 3RMFA 2QURA 3TL8A 4CGAA 2HWPA 3F88A 4HCTA 2PUUA 2R0IA 4AWIA 1XHAA 4DFNA 5IMXA 3HGKA 1PMEA 1U5QA 4XRLA 4JAIA 1XH8A 2QD9A 3PY3A 4DFXE 3EN7A 4OTGA 5E8TA 1VJYA 1ZOEA 2JFMA 4A9RA 3RAKA 2H8HA 3GI3A 3ZLSA 3BLRA 4GW8A 5HCZA 1BI8A 2C3JA 3F2NA 5KBQA 3P79A 2RKUA 4RWKA 4ACHA 1K9AA 4O81A 3BHUA 4DTKA 2GFCA 2WTKC 1OBGA 3WZUA 4N6ZA 4AW1A 2H9VA 3DCVA 4GFGA 5DBXA 3ZU7A 3L9NA 4CQGA 3AMYA 2JGZA 4ZSEA 4FNWA 4EK3A 5B2LA 4YHFA 2UZLA 1KOBA 4K0YA 3O71A 5CU4A 5CYIA 2R64A 3L8XA 3DAKA 2VTSA 4ANQA 1OI9A 1FQ1B 2IVSA 4TNBA 5K5XA 1W0XC 1WCCA 2B9JA 3R00A 4WHZA 2CKPA 3ZRLA 1YRPA 3E8DA 3P0MA 4O1PA 5IUIA 4O0UA 3TG1A 3O7LD 5LVPA 5HTCA 3PJ1A 2QO7A 3R2BA 4UZDA 5F94A 4YMJA 4ZY5A 2C1AA 1QPDA 3QXOA 5CLPA 2ITQA 4E8AA 4EH9A 1G5SA 2JIUA 3VQHA 3DTWA 3VHKA 4CYJA 1PW2A 1OKWA 2XYNA 3UZPA 3V5PA 5DPVA 5CEQA 3UQCA 3QRUA 4PV0A 1TKIA 4ENXA 4O7LA 1BMKA 1PXMA 4JBVA 3DJ7A 4M13A 4MNFA 4AA5A 4F99A 2WIHA 5M09A 2B7AA 5GIOE 3E87A 4GG7A 1V0OA 2I0EA 5BYYA 2BRBA 2I6LA 2UVZA 2WMVA 4QMSA 2PMIA 4BBFA 5KMIA 3S00A 2FSLX 3QA8A 3EYGA 4DGOA 1SMHA 3W2OA 5IZFA 3QXPA 2UZNA 4FVPA 4FIFA 3PE1A 4BZNA 4EONA 4IBMA 3WILA 5HIBA 2R3HA 1Q3DA 3C4WA 4QP7A 4DT9A 2I40A 2WTIA 1M7NA 1M2QA 4OGRA 3ZEWA 3BLQA 1SNUA 4FOCA 4G5PA 4QNAA 3G90X 1OKYA 2GNIA 2VX3A 3LFDA 3F7WA 4R6VA 4YBJA 4F65A 5IG1A 3GC7A 4DINA 3LM5A 4C3RA 3ZXTA 4E6QA 4JAJA 4QYHA 5CF4A 3ZRMA 5K5NA 3TUDA 3TIYA 3PXRA 4RRVA 5BVKA 2W4OA 3FWQA 2X81A 4O0WA 4DH8A 5E8VA 2WTVA 3WBLA 4TYIA 2ZDTA 3E63A 5L6OA 2WQBA 4KA3A 1DM2A 3IS5A 3VS5A 3LFAA 3BE9A 4KIOA 4D2VA 5TKDA 4D0WA 4CKJA 1PKGA 2C3LA 1GIHA 2P4IA 2JAMA 3DXNA 3G0FA 3NNXA 3QQFA 4FR4A 2J0MB 1UWHA 2YIRA 3H0YA 4L3LA 4XH6A 3QQHA 3HL7A 1O6LA 3ZO1A 2BIYA 2R3PA 2YIQA 4IC8A 5CVHA 5CY3A 5I9XA 5ITAA 5FUTA 4FSZA 4FC0A 3FJQE 4JR7A 5GJGA 5GZAA 2YFXA 5H3QA 3UPXA 3RPVA 5IQFA 4C0TA 3MVMA 3N4TA 3IDCA 5DNRA 3D15A 3MB6A 3PYYA 2QOIA 4C2WA 3NGAA 2WU6A 4CSVA 4XBUA 3FI8A 4BYJA 3UP7A 3MYGA 4CRLA 4DH3A 5DR9A 4K11A 4X3FB 3BU6A 3RCDA 4EH6A 5EQEA 4I6QA 4OTHA 3Q52A 3SAYA 2R4BA 4OTWA 4TPTA 3ORPA 2CKQA 4JS8A 2UZTA 4L8MA 3MSSA 4FG7A 4XHKB 3DBDA 4IJPA 4NFMA 2JKMA 4UEUA 5C9CA 5E92A 3EQRA 4S34A 3N51A 3GQIA 1SYKA 2WMRA 3AC4A 4NJDA 4XRJA 4BKZA 3NIZA 4MAOA 1ZOGA 3RP9A 3NUAA 5DEWA 2VWIA 4R78A 5AM7A 2W5BA 1H1QA 3LCKA 4H3BA 3MWUA 5ANGA 2UW5A 3HYHA 2CKOA 1YOLA 3F3WA 4F6WA 1O6KA 3MVHA 4MXOA 3WYXA 3ULZA 5AEPA 5BMSA 2CCHA 4I4EA 5AP6A 3IK3A 4QMLA 3VUMA 3R8MA 3GBZA 3LFFA 3QTRA 4Z3VA 4UBAA 2XH5A 3KF7A 4WG5A 3TIZA 2PVRA 4O6EA 1ERKA 2JLDA 2VTHA 4PDSA 4TYHA 4ZJVA 5I3RA 5J5TA 4O0SA 1SVGA 4W4VA 2XS0A 2QO2A 4XV9A 3SRVA 4KSQA 4BTKA 4IJ9A 3QD4A 2XKEA 4YLJA 3LJ2A 2EXCX 4M7IA 5IA5A 3SX9A 5B0XA 4F9YA 2PE0A 2P0CA 3MY5A 4C7TA 4JDKA 4WUAA 4IZ7A 3FHRA 3ZONA 3ACKA 4XEYA 2RL5A 2QHNA 3ZUTA 2C1BA 5IA1A 4E3CA 3UVRA 4ALUA 4FKVA 3QKLA 2XK3A 2C5YA 3MB7A 4FODA 3RBWA 3ZC6A 4TWCA 2VTPA 1KE6A 2XJ2A 3BELA 3ORKA 3SDJA 2R2PA 5DN3A 4ZSJA 3DFCB 4WNKA 3N9XA 3LE6A 4QPSA 3R9NA 3A4PA 5A46A 2BIKB 4M66A 3NDMA 4QYYA 4XOZA 2JDOA 4B99A 3QL8A 3ZXZA 1OL1A 1E1XA 3WF9A 4F7JA 2BKKA 1R78A 3NYXA 3RPOA 4B8MA 3LW0A 4RX9A 3UC4A 4M12A 4FKUA 3VJNA 4EOSA 1YOMA 4HYSA 3H9OA 5K9IA 1ZAOA 5HI2A 4C4IA 1OUYA 4CMOA 2OU7A 2PVJA 3AMAA 3OWJA 5HVYA 3BHHA 3TZMA 3VQUA 4D1SA 1E9HA 2GQSA 1WVXA 2ACXA 2UUEA 4ITIA 5AR3A 3H0ZA 3TV4A 1OITA 3BBTB 3LM0A 4JXFA 4X2KA 2B4SB 4FT9A 4KUJA 4IM2A 4ZSAA 1H27A 3DZOA 4I22A 3UQFA 1OL6A 4O84A 3O0GA 3A7IA 3LMHA 1YI6A 4E20A 2IN6A 3GC9A 4YPDA 4XG2A 5EFQA 5LMKC 2HWOA 5E91A 1WBPA 3M1SA 3Q4TA 2HW7A 1PXIA 2C69A 2CJMA 3AT3A 3EMGA 4MXZA 4U40A 5F20A 5I9ZA 3BYVA 3EOCA 4D28A 5C03A 3BV3A 3OY1A 4RIXA 3VHEA 5K4JA 4F9AA 1X8BA 3M2WA 3POZA 4LQMA 3IW6A 3F9NA 3QLGA 3MVJA 2HZIA 2R3GA 3CXWA 1Z5MA 4IB3A 5AP3A 4BCPA 3S95A 2WO6A 2C5OA 3O8TA 5C1QB 2RSVA 4I5PA 2NPQA 3DDQA 4MWIA 3S4QA 2DUVA 2YZAA 3QQKA 2I0YA 4X3FC 2X39A 4GSBA 3G33A 4C4EA 5L6PA 5CSPA 4YSMA 2HW6A 3D2KA 4G34A 3HV6A 3DTCA 4YJPA 2XNGA 3W55A 4CQEA 1H07A 5HCXA 4JQ8A 2IVUA 5BVEA 5CAOA 3SGCA 4HGSA 3SG8A 4IADA 5IA0A 4C3PA 4IMYA 3IONA 3QGYA 3SW4A 4NT4A 1B6CB 4U80A 1R3CA 4AACA 4LOQA 3PDTA 2F2CB 4CT1A 2XMYA 4YC3A 5C4KA 3OWLA 4BKYA 1ATPE 3BHTA 4U6RA 4IZYA 4K2RA 3R9HA 2ZAZA 4LOOA 2HZNA 3PTGA 3ORLA 3W8QA 4JRVA 1KE7A 5AUZA 5IA2A 1CKJA 1GZKA 2PTKA 3EJ1A 4XCUA 2WD1A 3QYZA 4DBNA 4UN0C 3H30A 3BGQA 4L53A 4KBCA 4RSSA 4O7TA 3KMUA 3PPZA 2ITUA 3ZS5A 1G8AA 5IQBA 3F3UA 4J7BA 3MH0A 2YAKA 5FP5A 2BAKA 2JBOA 3Q9XA 4FG8A 4K8AA 3AC8A 4FV3A 4EK4A 3R21A 3UQGA 4I1ZA 4FK3A 5DFPA 3RKBA 3ZC5A 3GU6A 1UWJA 4QD6A 4F9WA 3L8VA 4FEQA 3EQHA 3EN4A 2JAVA 4RJ8A 5I9UA 5BUEA 3E5AA 5AV1A 4PMSA 4GMYA 3KC3A 3ZOSA 3LFNA 4WRSA 1J91A 2J50A 4XMOA 3QD0A 3CTJA 3ORTA 3S1HA 1IASA 4DF3A 4G6NA 2EB2A 2WU7A 3O8UA 3REPA 4CZTA 1UKIA 4GS6A 3HRCA 4ASXA 2QOLA 3I0QA 5T6KA 3UYTA 3LMIA 4TYGA 4PMMA 2OW3A 3KULA 3H9RA 4M3QA 4BDEA 1JKTA 3QZFA 5IUGA 1NVRA 4E1ZA 3PRFA 5ANDA 4F4PA 4JOAA 4KS8A 3RWPA 2VTJA 5CZHA 4IWQA 4D0XA 4AW0A 3P1AA 2FSMX 3UODA 3Q2JA 2OJJA 3F5UA 3R2YA 3L8PA 1J1CA 2F4JA 4OLIA 4XX9A 4BIDA 4I92A 5A14A 1P4OA 2XM9A 3OMVA 4FYNA 4TRLA 3QRKA 5FWKK 4ACCA 3ZRKA 2YM8A 5JSMA 4YGAA 1M14A 3QKKA 4RC4A 2WZJA 3AT2A 2Z7LA 4FTKA 4MTAA 3SOAA 4MNEA 1YVJA 4X2JA 4RZVA 5CSXA 3SLSA 2R3KA 3HZTA 3VBTA 3E92A 2CGVA 2Y7JA 3TDVA 3Q5IA 1JQHA 3GCQA 1YDSE 4MXYA 4YJUA 1M2PA 5A3XA 3TXOA 3Q96A 5DIAA 3DK7A 2QOHA 3C0GA 3MTFA 4FV2A 3VF9A 4ACGA 3HA8A 1REJA 3UNKA 3ROCA 1RW8A 4C34A 5E1SA 4GKIA 4DFUA 4BHZA 2BR1A 2BHHA 2CPKE 2QKRA 1P2AA 2OLCA 4QMZA 5AX3A 4FVRA 1SVHA 4MKCA 4FGBA 5FEDA 4O7YA 1Q99A 4FNXA 3V8SA 2J2IB 5HO8A 3DFAA 4CZUA 3H4JA 3V5LA 1GZNA 4O7RA 3ZDIA 2NNWB 2YISA 5HD4A 3MPTA 3EFJA 3Q9YA 4FSTA 4IM3A 1YKRA 4PPBA 4RG0A 2R5TA 3ZO4A 1CDKA 4NW6A 2YACA 3ZUUA 2J6MA 3C7QA 5KMNA 1REKA 3E93A 1MUOA 2A4LA 3MA3A 3CJFA 1MRVA 2C30A 1OB3A 2VO3A 4FIHA 4BZDA 3ET7A 3G6GA 1LP4A 3KL8A 3R7VA 1KOAA 4D4VA 3PWYA 4GUEA 4M84A 4QPMA 2OJGA 1TVOA 2NRYA 5DRDA 2VV9A 3W2CA 2JEDA 4EQUA 3ZFMA 3HMPA 4U3YA 1XR1A 3OOMA 5CNOA 4C4JA 4PQNA 4BCOA 4Z16A 4W9XA 4Y8DA 3ULIA 4CV8A 3WI6A 4QP3A 3VUKA 3ZZEA 4NM7A 4YURA 3PWDA 2BZHB 3P08A 5T3QA 2I1MA 3WE8A 4YJNA 4TKSA 3ZSHA 1BI7A 4S30A 5LCJA 2FO0A 1OIYA 3BBWA 3D5UA 2ITXA 2EUFB 2WTCA 4RIWB 3PZEA 5KUPA 2W1HA 3QRJA 4FSMA 3VUGA 2X7FA 2VD5A 4IACA 2C5NA 5C27A 5I9YA 1K3AA 2GNLA 1L3RE 4YPSA 5FXSA 3SOCA 4HVGA 3TDWA 3POOA 3V5QA 2WTJA 2X4ZA 2YA9A 4IDTA 3ERKA 3LXKA 4I5MA 5FG8A 3KCKA 2Z7SA 3UO6A 2R7IA 2VUWA 2BHEA 4CNHA 3WZKA 4AG8A 5L2TA 2J0JA 5FTOA 1OPJA 4L42A 4EL9A 2DYLA 1H01A 2Y0AA 4G31A 1IA9A 3LQ8A 4NTSA 5LVMA 1P14A 4RX7A 5EHOA 3OWPA 5D7AA 3OS3A 2C6IA 2OG8A 2G01A 3MDYA 4FTJA 4J52A 3VBWA 4ANLA 4USFA 4RPVA 3PLAE 4C38A 4PP9A 4RFYA 3ORXA 1WBOA 2CLXA 3UZRA 3I7CA 4J8MA 2XKCA 3KMWA 5H8EA 4XUFA 2X6EA 5A6NA 2XF0A 2W1IA 4EYJA 5L2WA 3R01A 1XBAA 4BI2A 2IJMA 5HD7A 4W4WA 3AGMA 4KWPA 3T3UA 4YJOA 1WBTA 1YW2A 1WVYA 2JBPA 2Z60A 2X4FA 3KXNA 4A9YA 4ZMFA 3U9NA 3KRJA 4BL1A 2ONLC 5CALA 5FP6A 2GS6A 2YLEA 3HMIA 5ETCA 3ZM4A 3R9RA 5JFWA 2Y8OA 3COMA 1R0EA 5CNNA 2E9VA 2XIKA 2GNJA 4IAZA 2QOCA 3PIZA 3KA0A 5HG8A 3VUIA 4GCJA 5JFSA 5F1ZA 3DAJA 4EBVA 3LXLA 5BUIA 3QCXA 5CAPA 5KMJA 4WO5A 4L01A 5BVWA 3AQVA 3GT8A 1RJBA 4B4LA 4XYFA 3NUNA 4DLJA 4RVKA 1UU8A 3OCBA 4I5CA 4RWIA 3KB7A 5GZ8A 5HBJA 4WD5A 5CANA 3DOGA 3U6IA 3DLSA 4U41A 4L52A 4N4SA 2VTMA 2X6DA 3ZBXA 2JIIA 2W5HA 3S0OA 5J7HA 3O96A 4WUNA 3FE3A 1MRYA 4GIIA 3N4UA 4D2PA 3BV2A 1B38A 2NRUA 2JIVA 3I5ZA 4P4CA 4QMNA 4FTLA 4FKLA 4CMTA 4IAKA 4NKAA 4E6CA 4ASDA 2VTNA 2RIOA 3A8XA 1NT2A 4EORA 2PZ5A 1ZXEA 3ENMA 3F6XA 2OZAB 4GK4A 4FIEA 4K6ZA 5DGZA 3T9IA 4IVCA 4D4SA 3BU3A 4TTHB 5AA9A 1YWRA 4YZBA 3HP2A 5FTQA 5LCKA 4AE9A 2WTKB 4ZTRA 2B9FA 3SXRA 2BALA 2XNPA 4X6QC 3RNIA 4CD0A 4DFZE 4FEVA 3V51A 5TOZA 2X9EA 2GHGA 4J53A 5I9VA 4Q5EA 4M69B 1FMKA 5A6OA 4HNFA 2PVLA 4I0SA 4RVMA 3PSDA 4G9CA 4CMUA 2OBJA 1JPAA 3JPVA 4FTQA 2JITA 3AD4A 2OICA 1H25A 2BZJA 2YLFA 3Q2MA 4A4XA 2O65A 2VX1A 3KK8A 2WMQA 5L2QA 4KRCA 3GB2A 5CU2A 2OXYA 3OP5A 3G6HA 1JBPE 3VW8A 1TQIA 2YAAA 2O8YA 4AOJA 4WNOA 4O0YA 4EWQA 2QONA 3IKAA 2XIYA 4H39A 5TT7A 3D83A 3GNIB 2F7ZE 4DLIA 3QZIA 3OTVA 1KE9A 3VW6A 3DPKA 4LL0A 3QD3A 3PUPA 2R7BA 4IVBA 4BTMA 3FKNA 4CFFA 3QZHA 5AUTA 5D1JA 3TUCA 1IEPA 4YLKA 5EHYA 5TF9A 4TW9A 3PXZA 1ZYLA 4CKIA 4XBRA 1SZMA 5DEYA 2F7EE 4AT3A 4EH3A 4JVGA 4OUCA 3PVUA 4PRJA 2J5EA 4LM5A 1NY3A 4GRBA 4G17A 3VS3A 5EI2A 3BX5A 4UMQA 3DU8A 4YZMA 2XBJA 4RMZA 4MBLA 1OVEA 3TACA 4B7TA 3W10A 4NCTA 5J1WA 3DJ6A 4FUXA 4I20A 1WVWA 4E5AX 3D7TB 1PXPA 2C6KA 1URWA 3LFCA 4XV1A 4EQCA 1YOJA 5IU2A 4OT5A 4AZSA 2ITYA 4O83A 5IQGA 5HBHA 5AIKA 5CVGA 4AGWA 4DCEA 4EQMA 3KK9A 3UOHA 5IH5A 3F5XA 2PU8A 1VYZA 3C4ZA 4FYOA 5E90A 2CCIA 3DXQA 3EQBA 4J8NA 4USDA 4EWHA 2JC6A 3C4FA 5BVDA 5GZ9A 5CEOA 4G9RA 4ZJJA 4CYIA 5HQ0A 2O3PA 3FMKA 5HHWA 3UOLA 5C8NA 2IZUA 5CTPA 3DA6A 5K0KA 4BKJA 1U4DA 2UW7A 5AMNA 5B7VA 4CFXA 2ITTA 2WMXA 4LGHA 5HNBA 4OBOA 3JY9A 3OVVA 2W1CA 1YXUA 4F9BA 3K54A 3P23A 4A07A 3FZ1A 3QQJA 3KXXA 2VZ6A 4QQTA 2VO7A 4EOJA 3ORNA 4MQ2A 3WIKA 3W2RA 3OBJA 5TR6A 5DA3A 3ZHPC 3FYKX 5IEXA 4I94A 4DH7A 4KNBA 2ZMDA 1JKSA 3CIKA 3WYYA 2W05A 2C6MA 2PVNA 3BHYA 3R30A 4FKTA 5D11A 4NKSA 4HVSA 3RM7A 2IZRA 4HYIA 4R3CA 5IA3A 2XJ0A 1WMKA 3M11A 1MP8A 5KZ0A 4A9SA 5H2UA 4I4FA 4IAAA 5LMBA 2A1AB 2X2LA 1BKXA 2P2IA 3SC1A 1WFCA 3KKVA 3TCPA 2OF4A 2W5AA 3CKWA 3A7FA 3UO5A 4O7VA 4J96A 4DBXA 3A7JA 4TT7A 4XJ0A 5AV2A 4HVDA 4TY1A 5DWRA 2ZJWA 4DFYA 3OXZA 5IQCA 3R28A 4J1RA 3UMWA 3CKXA 5EQYA 4FZDB 3ZLYA 3ZBFA 3PA5A 4S33A 3GCSA 4MXCA 3NZ0A 5CU3A 5A4EA 4NU1A 3B2TA 2W0JA 4JDJA 3QCYA 3R6XA 3L8SA 5EI6A 4IFGA 2C0TA 5HIDA 2KTYA 4A9TA 4E7WA 3EB0A 3TV7A 4GYIA 4O2ZA 3I4BA 4FKJA 2KULA 3R02A 3LHJA 4ZTHA 3TI1A 4F0IA 3CTHA 4V0GA 2WQEA 1PMUA 4FVQA 4FNZA 1YXSA 2G2IA 4WBBB 2JDRA 3RHXA 2PE1A 3OW3A 3SG9A 1OUKA 4WNPA 4C57A 5ANOA 4AQCA 5K0XA 1VZOA 2G2FA 4YTHA 4D2TA 4APCA 2BFYA 3W2SA 4RJ5A 4QMUA 4X0MA 4U43A 4M97A 3ZUVA 3FMEA 1PXNA 4RLKA 5EW9A 5AIRA 5HE0A 3KU2A 5CEIA 2WQOA 4IX4A 5FLFA 3NAXA 3TTIA 5IMEA 3T8OA 3KVWA 4NJ3A 2EXMA 2X8DA 4C36A 5AUWA 3A7HA 5M4IA 1GOLA 3RGFA 3TUBA 3EQPA 2VO0A 3UNJA 4C37A 1HCLA 2R3LA 3GENA 4JBOA 3CJGA 4LYNA 5CT7A 4O0RA 4S31A 5D41A 1KUTA 3JUHA 5M4CA 4LOPA 1WBNA 3NCZA 3GCVA 4RA4A 4D5KA 1DS5A 2YCRA 4XV3A 5K3YA 2OGVA 3BHVA 3TKHA 2Q0NA 3VUHA 4H58A 4NZWB 3OWKA 2VWXA 4GEOA 1T46A 3ZO3A 4DGLC 3QUDA 3UJGA 5HGIA 2XCKA 2CGUA 2VU3A 3ORMA 4OT6A 2BRHA 2JKOA 3LMGA 3ITZA 1UU9A 1XH5A 2VO6A 4DEDA 3C0HA 1ND4A 4U44A 4AXAA 2I7QA 4GV1A 3D5WA 5KNJA 3A2CA 4IX5A 5JZJA 4BWPA 1Y6BA 3VWAA 4ZLOA 4LMNA 4QMVA 3CGOA 2R0UA 5L6WL 3ZDUA 2Y4PA 3EQIA 2QOFA 3JYAA 5GNKA 3LFQA 2X2MA 2DS1A 3U4UA 2XJ1A 3DKOA 4IVDA 3C4EA 4W9WA 5HESA 3THBA 2UW3A 3M42A 3R7GA 5AUUA 4RIYB 4I6FA 4J98A 4UX9A 2ERZE 4FI1A 4W8EA 4AOTA 2J7TA 5EW8A 4XG6A 2BFXA 2XRUA 4DH1A 3TM0A 3EN9A 3UTOA 4UYAA 2ETRA 2W1DA 3L9MA 3CY3A 3FI3A 5KE0A 3PSBA 3NS9A 3D14A 4KIQA 4XV2A 5J87A 3WF5A 5GIPE 3GC8A 3EL7A 3FL4A 4FMQA 4AUAA 3HVCA 4QTDA 2FA2A 5IF1A 1UVRA 3IECA 5HLPA 3R8PA 2PE2A 3SKCA 4YJQA 2IG7A 4F1OA 3MESA 3KN5A 4QQ5A 2VGOA 3QQUA 4MWHA 4DA5A 5DG5A 4UY9A 5HNIX 3HDMA 4C59A 3W2QA 1U46A 3TNWA 1YHVA 5A4LA 4PL5A 1Q4LA 4AP7A 4FKIA 3CSVA 3W32A 2F49A 3COKA 5C4LA 2ITZA 3KN6A 4FNYA 1V0BA 3LCTA 5EYDA 1P4FA 3BEGA 1ZRZA 3CQEA 3FLZA 2GPHA 5EM6A 4C4FA 2WHBA 2E9NA 1H1WA 3MJ2A 4YNEA 5LQFA 4F6SA 5HKMA 5M53A 3COHA 4QP2A 3FPQA 1XO2B 2OXXA 1PXKA 2UZEA 2ERKA 4BN1A 3QX2A 4ZTMA 5DVRA 3Q4ZA 4LGGA 4YC6A 3FL5A 1F0QA 2PZIA 2XNNA 4WG3A 4OTFA 5ANEA 1Q8ZA 2GNGA 2OWBA 2UW8A 3DDPA 3EL8A 2VAGA 5D7VA 5CEPA 2PY3A 3MJ1A 1WZYA 3O50A 4FX3A 4O82A 3VULA 2WMWA 3AGLA 1OL5A 1QPEA 1YDRE 3DLZA 4YZ9A 4CLJA 2C68A 5HO7A 1U54A 1UV5A 4HZSA 4JG7A 3ZFXA 4F64A 3RINA 5GJDA
chains in the Genus database with same CATH superfamily
1UU3A 4Q9SA 4U45A 3GEQA 3VBYA 4EH4A 1JSTA 3NVKI 1OL7A 4QMYA 2AYPA 5EK7A 4BJJA 5IPJA 3AXWA 2OFVA 1JSUA 1YXXA 4X21A 3ALNA 4YHTA 2GCDA 2HOGA 4C3FA 4DT8A 1H08A 3A60A 2WMSA 4RWLA 2VTOA 4AOIA 2CMWA 5L2IA 1UNGA 3I6UA 3UGCA 1JAMA 2ZYBA 3NUSA 4RX8A 4P5ZA 1MQ4A 3D9VA 3QTXA 2C4GA 3NW6A 3IO7A 4RFMA 3ZSGA 3E8EA 3K5VA 1ZYCA 5EW3A 3E3PA 1CMKE 3CLYA 3BKBA 5G1XA 5HE1A 4TYEA 3Q5ZA 4ENYA 4BDKA 5BMMA 3HAVA 4R1YA 2C6OA 5D9HA 4GK2A 3QYWA 2OI4X 3OG7A 4K33A 2PPQA 4EHZA 2UZOA 3I60A 3GU4A 3OUNB 4D58A 4YO4A 3NFFB 3P86A 1H1RA 4FTTA 2R3JA 3F5GA 3ROYA 4B6LA 4JQEA 3Q60A 5L8KA 5FDXA 1IRKA 2W99B 3OT3A 2VTQA 4RZWA 3R7UA 3B2WA 3O51A 2J0KA 4IEBA 3IQ7A 3LJ0A 5BNJA 1YXTA 3CS9A 1Q24A 1W83A 5E1EA 4NM0A 4EOKA 2VTAA 3F69A 3R1SA 2HCKA 4BDBA 2XIZA 3WIGA 2AC5A 3QRIA 1XMLA 4CTBA 4K1BA 4DEHA 4FICA 2R3QA 2WTDA 3MN3A 4DEEA 2Y4IC 3CEKA 5C01A 3VVHA 3R7OA 1J3HA 2O2UA 3ETAA 4APPA 3I0OA 3VF8A 2I0HA 4A9UA 4CLIA 1H0VA 1OM1A 2VWVA 2YM6A 2W9FB 5AJQA 3PG3A 4B9DA 2OF2A 2YIWA 3ACJA 3CQWA 4DHJA 5M4FA 3R7IA 4FF8A 3KXMA 4E4XA 4KIKA 5LOHA 1FVTA 3VS7A 5DT4A 3HNGA 1M17A 1I44A 1GNGA 5BV3A 4JX7A 4JDIA 3S2PA 4MEDA 3WE4A 4Z7HA 4O7SA 3ZCLA 5BUJA 5A4TA 2YWVA 4UYNA 4IFCA 3A61A 2UW4A 3QALE 1WAKA 3FXZA 4BYIA 3NYOA 4FTCA 3OUKA 3NNWA 4RJ7A 1ZYJA 1NXKA 4ZK5A 3LCDA 3PXYA 5H8BA 4AU8A 5A4CA 3FHIA 5HLNA 2XANA 3MH3A 4KD1A 1IAJA 3SD0A 2J0LA 2PUPA 4MCVA 4ZY4A 3TWJA 3A4OX 4L3JA 2XK7A 3EKKA 3PVGA 4FSNA 5JQ5A 5IQHA 1GZ8A 1V0PA 3QLFA 4U42A 4HYHA 4UMPA 2IF8A 2UW0A 2P55A 3U54A 2GFSA 4LGDA 3CC6A 2PZPA 4G6LA 4YBKA 3C0IA 2A27A 2WOUA 4ANSA 1Q8TA 4ZAUA 3PVBA 3P5KA 3GQLA 1FVRA 2XKDA 1UNHA 4TXCA 4AN2A 2DWBA 4QTCA 3IDPA 3ZLWA 4G3EA 5EH0A 1W2DA 3KXZA 5AR8A 3DBQA 3FLNC 4FL3A 4OAVB 2DQ7X 4RT7A 1ZZ2A 2QNJA 3Q4UA 3KRRA 5AAEA 3W0SA 2Z8CA 4MF0A 3E8CA 3GVUA 5I9WA 5IEYA 1QPJA 4EOPA 4XP2A 3OT8A 3E8NA 3EZVA 4G3GA 4ZSGA 3R9OA 3BI6A 5HE2A 5ICPA 2CNQA 3V6SA 3HV4A 5B2KA 3COIA 5CS6A 3NPCA 4DGNA 1GY3A 1GZOA 1I09A 2IVTA 3MW1A 3QBNA 4JI9A 4U7ZA 4D9UA 3RPYA 1TQPA 2YJSA 2ZB0A 4PDPA 3QTIA 4ACDA 3UIUA 4WSQA 4ONAA 4Z9LA 1JNKA 2HXLA 2VNYA 1J7IA 4PMPA 3QQGA 4IB1A 3GOKA 4FV6A 4ITJA 4E4LA 5CAUA 4NIFA 1G8KA 4CT2A 5AV0A 4N0SA 3JVSA 3QZGA 4QMQA 4ZTQA 1BL7A 4IANA 2OO8X 3PPKA 4F0FA 1G8SA 3NCGA 3VBQA 3DV3A 3BWJA 2J9MA 3FXWA 3BLHA 5EDQA 3RZBA 1VEBA 2V62A 4JL9A 5GJFA 4O86A 4HW7A 4HGEA 2BAJA 4FSQA 1PRYA 5JT2A 5M57A 4YJSA 1GIJA 3MA6A 3KMMA 1IG1A 3QTSA 5FD2A 1P5EA 3NW5A 5EM7A 4HVHA 2RG5A 3MY0A 4RJ6A 2HAKA 3AMBA 5I3OA 4WOVA 3K2LA 2PWLA 5M07A 1AD5A 2AUHA 4CKRA 4CZYB 4IW0A 3VNTA 4HPTE 1DI8A 3AG9A 5H9BA 3R73A 3F3ZA 3FMJA 3U87A 4X6RA 2W17A 2YCFA 4W4YA 5IH4A 3TT0A 2J51A 2GS2A 2A0CX 5FQDC 4Y85A 3FSKA 3FUPA 3G9NA 4U8ZA 1WBWA 4D5HA 4TYHB 2HYYA 4IWOA 1R1WA 4XNEA 4FSYA 1H28A 5E8UA 4CCBA 3LLAA 3FLWA 3KVXA 2GQGA 4AZTA 4RVLA 1PMNA 3QTWA 3SRVB 3RHKA 4FV8A 4BDDA 3MPMA 4ERKA 5F4NA 1Z9XA 4EH2A 4YTCA 1KSWA 4X2NA 4IZAA 4XG4A 3TNQB 3HLLA 4K9YA 1H8FA 3VN9A 1LPUA 1ZY4A 3WF8A 2B1PA 4KKEA 4EOLA 1JKLA 3DZQA 3PXQA 5EOLA 4EZ7A 2VWBA 4BDHA 4H1JA 2PMLX 3MVLA 3A99A 3CBLA 4PTGA 2WEIA 3DKGA 4FKRA 4HGTA 4ANMA 4UALA 3VUTA 4QMPA 4AN9A 3CD3A 1RQQA 4CFVA 3I5NA 4ZY6A 4IX3A 2GSFA 3VS0A 3FQHA 1BYGA 3R1NA 3VS2A 4DN5A 2Z7QA 4EH5A 5BVNA 5HEZA 1WBSA 2JD5A 1BX6A 1KV1A 1R0PA 3I79A 3QD2B 4EK5A 2XALA 3TNIA 4DGMA 4C61A 5IA4A 2C0IA 3QHRA 3BGZA 2X7OA 5JEBA 1ZYDA 1B39A 3DS6A 3VUDA 3QCSA 4FZAB 4JBPA 2GTNA 3UE4A 2YCSA 2X0GA 4EZ5A 1XBCA 4KSPA 2W4KA 3FY0A 3LVPA 3QUPA 3AKJA 2XVDA 5AV3A 2QQ7A 4CVAA 2EB3A 3LJ1A 3C51A 4I6BA 4R7HA 4LL5A 5F9EA 1OPKA 2WMAA 4HCUA 2YERA 3KCFA 1Q97A 4GK3A 3L9LA 1PJKA 2C5VA 2IW6A 2WMUA 2YN8A 4A7CA 1SNXA 2C47A 4PX6A 2BPMA 4FL2A 3W0RA 3FKLA 4B0GA 4RGJA 5AWMA 3Q3BA 4XG3A 3D5VA 4QMXA 2WGJA 4X7QA 4MK0A 3PFQA 3WF6A 1Q61A 3VBVA 2PMNX 2WAJA 2QOQA 4I6LA 5HE3A 4RIXB 3FMMA 3UBDA 2J4ZA 3GCPA 2H34A 1DAWA 2C6EA 3QTZA 4USEA 5FBNC 4BB4A 2YM4A 4PTEA 4KIPA 2XUUA 1XJDA 2RFDA 3OY3A 1VR2A 3D7ZA 4JNWA 4TZRA 1YQJA 4BWKA 2XK6A 3ANRA 5BPYA 2E9OA 5FXRA 3DBFA 4QRCA 2Y9QA 5ETIA 5EYKA 1M52A 2VTTA 1QPCA 4CFNA 5AP0A 3PY0A 3KRWA 3MFSA 4R7BA 3R8LA 4BRXA 3FI4A 3FY2A 3QCQA 2BRGA 3RK9A 4DEBA 2WELA 3PJ2A 3AC5A 4EI4A 4F09A 4DTBA 2EWAA 4DH5A 2X0OA 2OZOA 3RVGA 3NWWA 3NW7A 3VIDA 4DAWA 4K18A 2XA4A 3NR9A 3TNPC 4A06A 1KE8A 4YTIA 1Q8UA 4BBMA 3OHTA 3PIYA 5KMMA 3SHEA 2VWUA 5E8WA 5JZNA 4FIGA 3QA0A 4QOXA 1CTPE 1OECA 3E88A 1JSVA 2O5KA 4G3FA 3VS1A 4AT4A 3LCOA 3ZTXA 4FV5A 4AF3A 2OIDA 3DB6A 4MD9E 3BGPA 5BYZA 4I3ZA 4R7IA 3RI1A 5JQ8A 3KQ7A 3UIXA 4EOIA 3V04A 2F2UA 3GUBA 3IGOA 3UG1A 5HVJA 3KFAA 1NVSA 4EUTA 1ZLTA 2HY81 5LMKA 1Z57A 3AT4A 1F3MC 1YWNA 4FKPA 5E9EA 4DG0E 4BC6A 4YJRA 3CQUA 4O7NA 2RGPA 2QOKA 1MQBA 4W8DA 5CQUA 5FGKA 4QYGA 3ML1A 1M2RA 2GS7A 3R0TA 4XG9A 5CI7A 4YLLA 4EZ3A 1V1KA 2ITWA 2JKKA 2PVFA 3D5XA 3KRXA 2EU9A 3PP1A 3ORIA 3HMMA 1CSNA 4LRJA 5E8YA 2XB7A 3ZO2A 4F7NA 1MRUA 2AC3A 4EHVA 2ZV2A 4U9AA 5DHJA 4Y46A 5LARA 4RLLA 1S9JA 2C6TA 2RFSA 4GJ2A 5TO8A 5HLWA 2C3IB 2OJFE 4RWJA 3KULB 3BYMA 4GG5A 4EK8A 5FTGA 3MV5A 2REIA 4MD7E 4V04A 2PZYA 3V01A 2C6DA 1WBVA 4KBAA 3PJCA 2OJIA 4JX3A 3KY2A 3MH2A 4BCKA 5ACKA 3GP0A 2H6DA 4L68A 3NLBA 4NTTA 4AZEA 4LI5A 4S32A 4QTBA 5CVFA 4FSRA 5DYJA 2HK5A 4FTOA 4WG4A 4GVAA 5CSVA 4FT0A 4MNEB 5IDPA 4RQKA 3LZBA 4M67A 4QT1A 4PUZA 4F7SA 3DY7A 5LXMA 3UG2A 4ZTLA 4C02A 4PL3A 2VWZA 3RJCA 2V55A 4GJ3A 3IOPA 1R39A 4PY1A 2ZM4A 2WMTA 5FEQA 4MVFA 4RVTA 2ETKA 4CG8A 4BWXA 4UMTA 2QG5A 1ZWSA 2F7XE 2F9GA 3Q04A 3UMXA 4PP7A 4QMTA 3OCSA 3CGFA 4G5JA 2WXVA 4G1WA 4GU9A 5CAVA 4YZNA 3HDNA 3ALOA 4ZTNA 5HIEA 5EHLA 3VRYA 3LPBA 1Q41A 2IZTA 3R8UA 5EI8A 3ZFYA 4FKGA 5CF6A 3EN5A 3V6RA 2A2AA 1A9UA 4LV8A 2XZSA 4J71A 3C4XA 2VN9A 4BCQA 3VS4A 2UZDA 3UC3A 4F6UA 2QLQA 4S2ZA 4AFJA 4R1VA 4XP0A 4IC7A 4ACMA 3OW4A 3FXXA 4UV0A 1JLUE 3E64A 3S3IA 5LWNA 2A19B 3ZYAA 4G16A 5T68A 4U79A 3LXPA 4ANNA 4BTFA 1IR3A 3JVRA 3F3VA 3OCGA 4DFLA 5CU0A 2GQRA 4E73A 5IISA 3DNEA 4U5JA 3O8PA 2P2HA 1FOTA 1Q5KA 4QDEA 4UMUA 3UDSA 1XBBA 1E1VA 4RC2A 3PJ3A 3CPBA 1JKKA 2PHKA 5EDRA 1JVPP 5AA8A 1JOWB 4XS2A 1PYEA 2ZFYA 3G0EA 2QODA 3C5IA 2VWWA 4AS0A 3OCTA 5JFXA 4OBQA 3W2PA 2BROA 3TNHA 3Q6UA 1Q62A 4YJVA 3R8VA 5D10A 4XP3A 1H0WA 3I6WA 3KRLA 3OEFX 4ZS4A 3OBGA 4C33A 1XKKA 2VGPA 3GU5A 5AP1A 4AW2A 3VJOA 3JY0A 4DHFA 1YWVA 2ITOA 4NWMA 5HTIA 4RQVA 3ODYX 3HUCA 1CKPA 3G2FA 4FV0A 2VX0A 2XIRA 2XK8A 3F2AA 3BQCA 3QTUA 3UP2A 4PMTA 2YDJA 4MBIA 4JRNA 4TL0A 5JRSA 2CDZA 3BYSA 4GVJA 4WBOA 4BBEA 3O23A 2FYSA 4G3DA 3G51A 4PL4A 3NEWA 4I0TA 5ANIA 5FM2A 5JGDA 4GT3A 4JIKA 4BVUA 2IPXA 2QG7A 4ERWA 2XEZA 4KRDA 4QPAA 3HV7A 5JGAA 2WFYA 2UW9A 2W1GA 1OPLA 3IDBA 3RPSA 4F9CA 1AGWA 1J7UA 4IQ6A 4LV7A 5CT0A 3RK7A 4L6QA 3W1FA 3W0PA 1TZDA 2H96A 3LFEA 4FG9A 4P5QA 3BE2A 3TZ7A 3QAME 4UXLA 4CCUA 2V5QA 3G15A 1ZARA 3AD6A 5HX8A 3PFYA 4FSUA 4QEBA 3C13A 3LFSA 2RG6A 4I24A 5J9LA 2E9UA 4ASEA 4JQ7A 4FT7A 4R3PA 4F63A 4O21A 3QFVA 4LUDA 1OIUA 1IA8A 1PYXA 3AC2A 4X2FA 4FT3A 1FPUA 4FOBA 5CSHA 4ZLZA 5FM3A 3NVMB 5CENA 3CE3A 3SXSA 1KWPA 4PDYA 5E4HA 1L8TA 4FGRA 4DFBA 3GGFA 3ZSIA 2E2BA 3U6HA 4BF2A 3UDTA 4F1TA 4AE6A 4C58A 4WNMA 3EWHA 3FLQA 3FMDA 4AZFA 3DGKA 4TYJA 4L45A 5G6VA 3WZEA 3PUFC 2BRNA 1Y8YA 3IOKA 4K77A 3BU5A 3EN6A 4AXFA 4C35A 3BQRA 3FKOA 3FQSA 1QL6A 3PSCA 4HOKA 5CEMA 2QC6A 3R1QA 5IDNA 3HX4A 4ORKA 3HRFA 2WMBA 2XRWA 2YCQA 3H3CA 2BTSA 2XNOA 4BDJA 1FBNA 2W9ZB 4ZTSA 5IKWA 4DITA 4EKKA 3PXFA 4ASZA 3ZM9A 4J95A 2X0QA 3EHAA 4L7FA 2FSTX 3K3JA 4YNOA 3UIBA 3D94A 2O63A 3EH9A 3I7BA 4QYFA 4UWCA 5IQEA 4KBKA 2YM3A 4I41A 5J7BA 1W7HA 4NM5A 4O2PA 4FTUA 4QO9A 1K2PA 4FZ6A 3A62A 3CY2A 3QRTA 3O17A 5JMSA 3OD6X 4PTCA 2UW6A 5M56A 1XH4A 3DKFA 5AR4A 3MFUA 3OC1A 2QKWB 1F5QA 4PF4A 4DEGA 1PHKA 1T45A 4HPUE 4L46A 4O38A 4BCFA 2FVDA 2Y6OA 4WT6A 3ZZWA 4E4NA 2XKFA 3SVVA 3GC0A 4FV7A 1PXOA 3PXKA 4D1XA 4GYGA 5H8GA 3WARA 2GTMA 5CU6A 5E8SA 4EK6A 3ATSA 4TN6A 3R1YA 2ZM3A 4HJOA 1XH7A 1ZMUA 3TZ9A 2OH4A 3FC1X 1XH6A 2QVSE 5ETFA 5FRIA 2HELA 2PVYA 3VBXA 4JT3A 3E3BX 3LOKA 2OIBA 5EOBA 1H4LA 4FV9A 4PNIA 3RK5A 2I0VA 4BCJA 4OAUC 3GCUA 3RM6A 4O7WA 3WF7A 2PVHA 2UVXA 4EC8A 2CLQA 3NNUA 4IVAA 2ONLA 5HG5A 4IAFA 3GFEA 1BUHA 1FMOE 3MGYA 5C26A 5FBOA 4AAYA 2ZB1A 2Y4IB 3PZHA 2QOOA 4EKLA 2BDWA 4FBXA 2P33A 2WPAA 3MBLA 1LR4A 4GL9A 2PZRA 5HU3A 2O0UA 4EJNA 1H1SA 5LWMA 2W96B 2WQMA 3SQQA 3BCEA 4RA5A 1H24A 3EYHA 5DR6A 3W0QA 3UNZA 2RF9A 2VTIA 4FKSA 4IH8A 2CGXA 3FZRA 3P7BA 4CFMA 3DNDA 2PMOX 3GU7A 4HCVA 1SVEA 4V05A 4EEVA 5HORA 1IAHA 5C8KA 4P2KA 1DI9A 4YP8A 1SM2A 4RFZA 4AT5A 3L9PA 3HAMA 5M51A 2XEYA 4O0TA 4JG6A 3ZEPA 3LXNA 3V8WA 3FSFA 2GNFA 2QR8A 2OJ9A 4ARKA 3QHWA 2FUMA 3Q9WA 3KXHA 5AUXA 2HZ0A 3BYOA 2IO6A 3RAWA 4DTAA 2BCJA 3QKMA 1OIQA 3OFMA 2LAVA 3OF0A 5HG9A 4D4RA 4ZLYA 4Y83A 4DDGA 1YI4A 3TMOA 3KXGA 4BR3A 4QP8A 5J95A 4D2RA 3KF4A 4FEUA 3PVWA 2PVMA 3TV6A 4FT5A 4QP9A 3IG7A 2GNHA 4WKQA 2W7XA 3W8LA 3ENHA 4YSJA 2B52A 3H9FA 4XOYA 4IB0A 5F95A 4B8LA 5L4QA 4LRKA 4OW8A 4D2WA 4ZJIA 4AA4A 4WA9A 4C4GA 5M06A 5M08A 4CTCA 4E93A 2BUJA 3FDNA 2G2HA 3IW7A 3FZSA 5FDPA 1J1BA 3CCNA 1FGIA 3C1XA 2XBAA 3ODZX 4JDHA 4RIWA 4AN3A 5DMZA 5L8LA 3Q32A 4A4OA 4O7ZA 2CGWA 4UZHA 4F70A 2XIXA 4IAIA 4IZ5A 3DXPA 2XNEA 2R3IA 4FKOA 3VAPA 1OZ1A 1NW1A 4BCIA 4QMMA 2HY0A 3NRMA 4Z7GA 2ZVAA 4LG4A 2ZV9A 4E5WA 3KREA 5KMLA 3Q6WA 4IAYA 3IW5A 2JKQA 5HICA 5HOAA 2CN8A 3BEAA 4DEIA 3AKLA 4BDFA 2XK9A 5I5ZA 2G15A 4FTRA 4JR3A 3F3TA 2LGCA 3EQFA 3P78A 1Y6AA 3CD8A 3CP9A 2ZDUA 4I93A 4L67A 2QU6A 3PE2A 1OBDA 2IW9A 3ID6C 4BDGA 2PVKA 3NMUF 2BKZA 4CG9A 5DLSA 2FGIA 4UMRA 5M4UA 1VYWA 4ZSLA 3DB8A 3W33A 2PUIA 5FXQA 3F5PA 5JK3A 4I21A 2PULA 3AC3A 5CEKA 1LUFA 4JIAA 3OROA 5JKGA 5AUVA 4GFOA 4I0RA 2C0OA 2X7GA 3L1SA 4YHJA 5LMAA 4IWPA 4LRMA 3V5JA 3C50A 2Y6MA 3IPHA 4GT5A 5EKNA 5I4NA 3QWKA 1LEZA 4AFEA 2CNUA 2HIWA 4I6HA 3BIZA 3BPRA 5BYLA 4IXPA 2UVYA 1KV2A 3IW8A 4O27B 3SA0A 4FIIA 1JWHA 3E7VA 3BRBA 4IDVA 5C8MA 1G3NA 2W4JA 3OXTA 5J9YA 4J97A 2OH0E 3TYKA 1H1PA 3PA4A 1TFFA 3QGWA 4M68A 4MXAA 4EH7A 4BY9E 1OKVA 4E5BA 3EFLA 3HA6A 4BCGA 3PRIA 2X1NA 1CM8A 4DGGA 3DQWA 3GOPA 4V0GB 2Q83A 4R5SA 4FV4A 5D12A 2XARA 4OR5A 5DH3A 3C4CA 2VTLA 3ZH8A 4AGDA 1Q3WA 2CHLA 4BTJA 1YXVA 4IM0A 2WKMA 4U97A 4EC9A 3HP5A 1ZY5A 3PIXA 4QMWA 5EKOA 4LFIA 4FTAA 4CRSA 4D55A 3U55A 3I81A 3NAYA 3U6JA 3EQCA 5KBRA 2ZV8A 2NYAA 4IE9A 2ITVA 5AP2A 3UIMA 4NEUA 4O0XA 4OTPA 5FEEA 3BLAA 4RJ4A 3R04A 4O0VA 4Y5HA 3F61A 5CF8A 4DYMA 3ZMMA 4YC8A 3NUYA 2YHVA 3I1AA 3VC4A 4NCTC 2VTRA 3HKOA 2J5FA 2QOBA 3QC4A 3V3VA 4MHAA 4EUUA 2C3KA 3ANQA 3TJCA 2OZAA 4L7SA 4RBLA 3LKMA 1GAGA 5HBEA 1U5RA 2GHLA 3NX8A 2BMCA 2GDOA 4BIEA 5J5SA 3FEGA 5IQDA 4D4YA 1PXLA 4AW5A 2JDTA 3R7EA 1PKDA 3MS9A 4O6LA 3UO4A 2YJRA 3MIYA 5IH6A 2HZ4A 2QR7A 4M69A 4QTAA 4BICA 2B0QA 2Z02A 4PPAA 3OTUA 1KE5A 5AADA 1W98A 3DT1A 5CSWA 5IQAA 5DI1A 4RX5A 4FZ7A 1PF8A 4MX9A 4RJ3A 3NYVA 4F0GA 4Y72A 4ZEGA 3EQGA 5KHWA 4RC3A 3N4VA 4H36A 5AP7A 3A7GA 1NVQA 4Q2AA 2IVVA 4EBWA 4EOOA 2B53A 3A8WA 5E7RA 4BHNA 5J1VA 1XQZA 3R9DA 1DAYA 2XP2A 1NA7A 4L9IA 3T3VA 4E6AA 4PWNA 5LVOA 4FTIA 2PL0A 5B2MA 4H3PA 4YUQA 2QU5A 2R3MA 4EH8A 3IW4A 2QO9A 4AX8A 2WTWA 5DE2A 4YJTA 2XAMA 2E9PA 4N57A 3DJ5A 4QMOA 5CWZA 4QQCA 1A48A 4L3PA 5HVKA 3K3IA 1J7LA 3RCJA 3D0EA 3ORZA 4BDCA 1EH4A 3DBEA 4BFMA 2OXDA 4N70A 3TKIA 3OXIA 1APME 4EOQA 4A4LA 1Q8WA 4KS7A 2V0DA 3ATTA 3R8ZA 3O7LB 4EYMA 4LUEA 4FKWA 3D7TA 1OIRA 4AA0A 4O22A 4OTIA 3FAAA 4OTDA 1W84A 2GU8A 3B8QA 5EYMA 3VRZA 5JRQA 4PNKA 2O64A 3CR0A 2ITPA 2C5XA 2ZMCA 3SXFA 3Q4CA 4L44A 3FC2A 4QP1A 2FH9A 2WB8A 4J99A 2BILB 2BZKB 4OTQA 4G2FA 4ZXTA 4ANOA 4E4MA 4FKQA 4Y73A 5IUHA 3OZ6A 4X2GA 2UZWE 3QX4A 4AAAA 4EOMA 1Q8YA 5E8ZA 4XLIA 3W0MA 3BYUA 2YITA 2YM7A 3F7ZA 5JH6A 2G1TA 4DG2E 2P3GX 4HNIA 2OSCA 4MD8E 1QMZA 5BVOA 3UZTA 3SW7A 2QCSA 4C62A 4PPCA 3D4QA 4LMUA 4E26A 2PUNA 3KEXA 4U81A 5AAFA 4ZP5A 5IEVA 4NYEA 5DOSA 2Q0BA 4JG8A 3LFBA 4EHGA 2OK1A 5BX0A 5J9ZA 2WQNA 2WEVA 2OKRA 5EYCA 2XNBA 3VS6A 1XWSA 2C6LA 2UZUE 4GH2A 4N6YA 3LQ5A 2R9SA 2R3OA 2ZV7A 3NIEA 3P7CA 1ZOHA 3GFWA 3TTJA 4AZWA 4BCNA 1H26A 3NSZA 4P90A 5M44A 4CXAA 2CNVA 4EHEA 3LLTA 4UB7A 2CSNA 3DK3A 4KAOA 2PYWA 5CI6A 1OL2A 2NO3A 3HV3A 3MY1A 1Y57A 3B8RA 5KMKA 1W82A 4YTFA 4Y95A 4AGCA 5J8IA 1U54B 5IQIA 4WSYA 1OMWA 2VRXA 1UA2A 2BZIB 4EJ7A 4CFUA 3VO3A 5JN2A 3RALA 4FL1A 4U0IA 4BJJB 1RE8A 3WZJA 4DHIB 4ZIMA 3OEZA 5A9UA 5HX6A 2GHMA 4GIHA 4UXQA 4WRGA 5JGBA 5EQPA 3TZ8A 3AOXA 3RNYA 1W8CA 2W1ZA 4FSWA 5CAQA 3R63A 4KKGA 4M14A 3HRBA 2YABA 3JS2A 1XH9A 3LAUA 4FTMA 5AR5A 3RAIA 4ZMEA 3FZTA 2V7OA 3UYSA 3R7YA 4HVIA 4IWDA 5AUYA 3WOWA 3FZPA 5EM8A 4ALVA 3MIAA 4UWBA 4YZDA 5HNGA 5CF5A 5KKRB 4MBJA 2NP8A 3DBCA 3IGGA 3P4KA 4QNYA 4HYUA 4BDIA 4F1MA 5LJJA 4H05A 3RTPA 3SV0A 1ZMWA 3HUBA 3RZFA 2B54A 3QUEA 3OOGA 4R8QA 4DEAA 4NM3A 5EDPA 3W16A 2FSOX 4BZOA 5HCYA 1S9IA 3DKCA 1PY5A 5KZIA 5DR2A 5K4IA 2QHMA 2YIXA 2YM5A 3FLYA 4V01A 2ESMA 5AR7A 5J79A 5AR2A 2CKEA 3EFKA 4MH7A 5ANKA 3ELJA 5L8JA 5AAGA 4F7LA 4Y5QA 1ZYSA 4QP6A 3BWFA 1M7QA 4QYEA 4MXXA 4W4XA 2ZM1A 4R3RA 4NW5A 4MF1A 3UDBA 4OBPA 1UKHA 4FV1A 4R5YA 4JBQA 4CFWA 1FVVA 1AQ1A 3MFTA 3V5TA 2UV2A 5KX8A 5CX9A 1Y91A 5L3AA 4NL0A 4FA2A 5HG7A 5LVLA 5CZIA 4KINA 4D2SA 3W18A 2UZBA 4TWNA 3QU0A 1YI3A 2BDJA 2JFLA 4XG8A 4F78A 2J0IA 2RFEA 3UOKA 4FE2A 1ZZLA 4TWOA 1BLXA 2F57A 3DK6A 3H10A 3HMNA 3PLSA 4P7EA 4U3ZA 4FRFA 4FZFB 4DG3E 2WIPA 4FEXA 4O4DA 1HCKA 2UZVA 3K5UA 5HU9A 5KO1A 3NUXA 1GIIA 4YZCA 1CKIA 3FMLA 3LIJA 3MPAA 2FB8A 3AD5A 4KIKB 3T9TA 2VWYA 4BCHA 4BI1A 4C4HA 4OTRA 5HZNA 2EXEA 3CTQA 4HZRA 4QQJA 4UWYA 3VONA 1URCA 2A98A 4D9TA 3LCSA 2YZLA 3MTLA 3D2IA 2YDIA 2B9HA 4IHPA 3R83A 1LEWA 3TKUA 3JR1A 5ETAA 2ITNA 3F82A 4LV5A 5ANJA 2W06A 2GMXA 1OGUA 4F08A 4PDOA 3EIDA 2YEXA 4FEWA 4NSTA 3C5UA 3GXLA 5HO6A 2W1FA 2W1EA 1TQMA 2EVAA 5BQ0A 5AV4A 3G9LX 2WNTA 3O2MA 4XLVA 5EG3A 5AFVA 4ID7A 1UNLA 4NFNA 1BL6A 3EFWA 3FZOA 3C9WA 2YDKA 3QWJA 3Q9ZA 4BIBA 3TJDA 2BVAA 3NUUA 4RIOA 4CV9A 1O9UA 1PMVA 2BTRA 3JXWA 2Z2WA 5ACBC