2W5BA

Human nek2 kinase atpgammas-bound
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
277
structure length
271
Chain Sequence
SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title Insights Into the Conformational Variability and Regulation of Human Nek2 Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 271
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2w5bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2w5bA01
1Q99A 2HY81 4BHNA 4G5JA 4CFUA 1T45A 4BDGA 3NLBA 4KSPA 4B9DA 4YUQA 4EH3A 3MTFA 4U3YA 1PXNA 2WU6A 3HV6A 2BDWA 4JDKA 4YTHA 1YWNA 4M66A 2PMNX 3ZUVA 3S00A 3FHIA 4IX4A 5LARA 2A27A 2GU8A 5BVFA 3BGZA 3W32A 3Q9ZA 5ACKA 3DB6A 2BTSA 1OECA 3FC2A 2YM5A 1Y6AA 3RPSA 4C3FA 4CFWA 1PW2A 4R5SA 4DC2A 1WFCA 3O7LB 3HZTA 4XOYA 4ZSJA 3LMIA 4L01A 2W1DA 3UOLA 4U7ZA 5BMMA 3NWWA 2C47A 4DAWA 4NJDA 5HU9A 1FGIA 2FA2A 2WOUA 5H3QA 2IW8A 2ZV7A 4CCBA 1UNLA 4C61A 1JWHA 4ENYA 1KUTA 4IQ6A 4ASZA 1PMEA 3O17A 2IVSA 4ZLYA 5IPJA 5M06A 3UC3A 4ZEGA 2WMSA 4F4PA 3KVXA 4ZTMA 2W06A 4FOCA 5TOZA 4QMNA 4FEXA 4KIKB 3AT2A 4BDJA 3G0EA 2WMXA 1W84A 1M7NA 4YZ9A 3WZDA 3WI6A 2J90A 2HELA 3BHUA 3D15A 2I1MA 4DH5A 4HCTA 3QX4A 4GU6A 3FYJX 5H9BA 3OOGA 2PUNA 4NYEA 5IQIA 3RCJA 4DGNA 4YLJA 4I22A 2JDSA 5BVWA 2QQ7A 4FSNA 2OBJA 2W05A 4MD8E 4AGCA 4BIBA 4CTCA 2PPQA 5FM3A 1XH4A 2Y9QA 1VJYA 4MXYA 4RVLA 2WIHA 3AC1A 3FLNC 4BYIA 4KINA 3DK3A 4FIFA 2GQSA 3GVUA 2WTDA 4XEYA 4C57A 4ZAUA 4BIEA 5KCVA 5FLFA 2W1IA 3CTQA 3AMAA 5AUUA 4X7QA 3F3WA 5HTBA 3AQVA 4IX3A 5LCKA 4E73A 4RLLA 4PTGA 3SC1A 4CFXA 4CZUA 3CY2A 3OROA 2ZDUA 4FTQA 4WO5A 1H1QA 3U9CA 4D1ZA 3W2QA 5G1XA 2FSMX 4AGDA 3G6HA 5DRBA 3LCTA 3RPYA 4E5BA 2UZVA 2YM7A 2QG7A 3LKMA 4WNOA 4C3PA 5J1VA 4ZMEA 4N4SA 3CY3A 2A1AB 2HAKA 4GSBA 4OR5A 4LL5A 4TPTA 4ACDA 5CU0A 4UX9A 2VTRA 3CTHA 5IQEA 3UIXA 5CEIA 3K5UA 4E93A 2OZOA 3IKAA 4EL9A 3FI8A 4YJPA 3E63A 3R00A 2ITQA 5IEYA 2HXLA 4BGGA 2GHLA 2P0CA 3IGGA 3PDTA 2A4LA 3GFWA 4DFUA 3WF9A 4AGWA 3PXFA 4XP0A 2PE2A 4FTAA 5EDRA 2Z7QA 4F7SA 2IVTA 5DT4A 5AUWA 5CNOA 5C03A 3QYZA 5T68A 3NSZA 1HCLA 2WQBA 3G2FA 4HOKA 4EHZA 4E5WA 3EYGA 3W55A 4BKJA 2GS6A 2IZTA 4MCVA 5KX8A 1H07A 1A9UA 3QTQA 5FDPA 5I4NA 2B0QA 4UXQA 3TV4A 2R3PA 1YQJA 5BYLA 1Q8WA 3BI6A 3QBNA 4ACCA 2JDVA 4GG7A 4JQ7A 5E92A 2BHEA 3POOA 3GU6A 4HPTE 2JIVA 3MV5A 3UNZA 1KE5A 3EQPA 5AP2A 4C4JA 4Z7HA 4YZBA 3AC8A 4HNFA 4A06A 2SRCA 3P4KA 2GHGA 3U4WA 3VS3A 5IUGA 4DHFA 4Z9LA 4N6ZA 3GGFA 2XS0A 4IB1A 2Q0NA 5CF6A 3PPZA 4BVUA 3R9OA 4OGRA 5IQHA 5K0KA 4K2RA 3H0YA 2ZAZA 3F2NA 2H34A 3DLZA 3TUBA 4I20A 3RVGA 4QP2A 4FKTA 4KS8A 5L8KA 3QXPA 1O9UA 4FSQA 4E6AA 4MWHA 2J0KA 4DFBA 4ZSGA 5CSVA 4IDTA 5CSXA 3BQCA 3V5TA 1H08A 2XCHA 4TZRA 3ORXA 3NUYA 1CMKE 3ROYA 5J9ZA 4BDAA 3AOXA 1E1VA 2YCFA 4U81A 1QMZA 4F70A 3PJCA 4C58A 3AD4A 3UYTA 2JEDA 2WU7A 4QTBA 3OW4A 5ITAA 4MXCA 4CT1A 5I3OA 2ESMA 4O7VA 2V55A 3KRRA 4PP9A 5DBXA 5DEWA 4CCUA 1GY3A 5FXQA 4RMZA 2QOQA 3SG8A 4B4LA 4F6WA 2GPHA 3SOAA 4FSUA 3LMHA 3FHRA 3DXPA 2UW4A 4OTGA 3ZS5A 1YXXA 2C6DA 3A4PA 3COMA 3MWUA 4MQ2A 2ITVA 2C3LA 2C69A 3HYHA 3PXKA 4GT4A 3TNPC 3QCQA 1V1KA 3DGKA 3DZOA 3LHJA 5AEPA 3KXHA 4AN3A 4F6SA 5IH4A 4DFXE 2OWBA 5M44A 3DAKA 4LOOA 2QC6A 3KEXA 3QKLA 3ALNA 4JBPA 5HG7A 3IO7A 3H3CA 3RNIA 3ZO4A 4ZZOA 4FUYA 5M57A 4K33A 1CKJA 4O91A 5TF9A 4BI1A 5I0BA 3SXSA 1Q8YA 4ASDA 1Q8TA 4YP8A 3TL8A 2VTJA 2PWLA 2VX0A 4LUDA 4TYGA 5L6OA 1SNXA 1UNGA 2OIBA 5E8WA 3Q5IA 5KBRA 3FMKA 4PRJA 4BCKA 2VTPA 4WD5A 5C4KA 3OCBA 4YTCA 4G31A 3C13A 4KBKA 2EXCX 4B8LA 4X3FB 1OBDA 1WVYA 1ZXEA 3NS9A 3NW5A 5LMAA 2Y8OA 3VBTA 5J7BA 3IPHA 4MD7E 4JR3A 4CYIA 5E9EA 5HCXA 3IW5A 4QMQA 3NYNA 3F3ZA 2BRMA 4JAJA 4EUTA 1YI6A 3R7UA 4UN0C 4AWIA 2NRUA 3RHKA 4M13A 4XV1A 2G01A 3AD5A 3G9NA 4KIOA 4OBPA 3ZHPC 2UW0A 3DTWA 1OB3A 3PY0A 4IH8A 3SLSA 2Y4IC 4OTIA 4QMSA 2PVFA 3D14A 3D4QA 5C9CA 4I5MA 1R0EA 5EHYA 4DBNA 2XNEA 4BDBA 4FG8A 3ZDIA 4UWYA 3UNJA 2RSVA 4XLIA 3TZ7A 4CLIA 2HIWA 2ITOA 5CZIA 2YIWA 3U51A 3KC3A 4MHAA 2WMRA 4ZSLA 3JVSA 2XJ2A 2CLQA 4RQKA 5E91A 4FZAB 4PTCA 4RZWA 3PIYA 3MJ1A 2KTYA 3QTWA 3HVCA 4ANLA 3DBEA 2PZIA 3DY7A 3MVJA 4O7YA 2XIRA 5KMJA 3QRTA 1UA2A 2W4OA 5I5ZA 1E9HA 3DOGA 4W9XA 5H2UA 3TT0A 2A19B 3TKUA 1GZKA 2UZTA 4FX3A 3W1FA 2JFLA 4P7EA 5E8YA 1R39A 4M0YA 4FL1A 3M11A 3A4OX 5M4CA 3BYVA 1FOTA 2GNIA 3LLTA 3P7AA 2P33A 3ORMA 2C6LA 4FTKA 3LJ1A 4QMLA 4ZJVA 3D5UA 4U6RA 1ATPE 5HQ0A 3Q2JA 3KA0A 4I0SA 2WELA 1V0PA 2O0UA 1ZYJA 3NGAA 1XH7A 5AP6A 3VW8A 3KN6A 4KRCA 2CNUA 2OW3A 1GNGA 2QOLA 3GC0A 3PTGA 1FBNA 5GINE 4TYHB 4USFA 3NUPA 3QQUA 4WBBB 2B52A 4AA4A 2RGPA 2A0CX 3PE1A 3GQIA 3GFEA 4GFOA 4PX6A 4AZFA 4CEGA 4DEDA 5EKNA 5LVOA 4D2VA 4DT9A 4S30A 3OY3A 1AQ1A 5AX3A 3EQRA 2VWUA 3A60A 3TNQB 3FMDA 4Q2AA 5HICA 3W8QA 5LXMA 3WE8A 4O0TA 5F20A 4L9IA 2Z7LA 3DKCA 3HMPA 2JBOA 3R9NA 3GENA 2W1HA 3LPBA 4DH1A 4O0YA 3GCVA 5DWRA 5KZ0A 1UNHA 3R1YA 4M97A 3I0OA 4GFMA 3EJ1A 4QTAA 2V7OA 3O2MA 4EK3A 4HGEA 1BKXA 2XRUA 4RA4A 4O7SA 1SVGA 2OU7A 4IHPA 1ZWSA 3MDYA 3ITZA 4GW8A 4QMXA 4EQCA 5CEOA 4CFVA 3TTIA 3E3BX 1WBOA 3E8DA 5CEMA 2UW6A 3IDBA 1JKTA 4RJ3A 5KHWA 1JPAA 3VUDA 4O81A 3OCGA 2Z8CA 3C4EA 1URCA 1NA7A 3VJNA 3ZYAA 1U5QA 3FY2A 2XNNA 4FKQA 3QZIA 4HYIA 5BYZA 5EW9A 3EKKA 3THBA 1FVTA 3UZRA 4YZDA 3COKA 3FSKA 3MVMA 3L8SA 5JZNA 2UZNA 3RHXA 4EOKA 3IDCA 3BRBA 5CY3A 4AZEA 2R5TA 4YJSA 5ANIA 5EDPA 4CMUA 2PUPA 5BVKA 2VAGA 4EK8A 3UZTA 5KBQA 1RDQE 4GK2A 4S31A 5IF1A 4H1MA 3VS2A 1X8BA 5BQ0A 5AJQA 3OTUA 1VYZA 4ID7A 1RQQA 4IFGA 4ZK5A 3RPRA 4RFMA 1GIHA 3TUCA 1MRVA 4WSQA 3HA6A 4EHVA 5I9XA 3EN9A 5ETIA 4CYJA 2G9XA 3MY0A 4CKJA 3PUPA 3NUAA 4LGDA 3VUTA 1J7LA 1S9JA 3R8PA 4DBXA 5JMSA 4I24A 4EZ7A 5F1ZA 1QPJA 4I92A 4IXPA 4DH3A 4DCEA 5D10A 5E4HA 4WRSA 1Z5MA 3R6XA 3WE4A 3N4VA 1OPKA 2PVRA 3QF9A 2YJRA 1MRUA 4EOIA 3P0MA 3PY3A 3EYHA 3KF7A 4BRXA 2X7OA 4BICA 3SAYA 2J6MA 2R3MA 3QWJA 5HLNA 2HY0A 4O7LA 3CCNA 2GCDA 1T46A 3N9XA 4G3DA 4OTRA 3R9DA 5C8NA 2JAMA 4C33A 5JQ8A 3FI2A 3O0GA 5DRDA 2LGCA 3ZM4A 4E6DA 3EQGA 3Q2MA 3NVKI 3DQWA 3QCYA 2VWVA 4QP7A 4TW9A 4O96A 3W16A 2ERZE 3PJ3A 4TKSA 2JKMA 4BR3A 5HNIX 1JKLA 4YURA 5LMBA 3R8MA 3S2PA 4EORA 2NNWB 1O6LA 4RWLA 5BMSA 3I60A 4TWOA 5HG5A 4MBJA 1YXSA 4L3LA 4R7HA 2XZSA 2CNQA 5DR2A 5A46A 1JVPP 2OZAB 1IAJA 4ZMFA 4EK4A 4NFNA 2R3HA 1SNUA 4NM5A 3GC7A 5AV4A 2C1BA 3NPCA 4XBUA 3WBLA 4F65A 2BROA 4BWPA 1PF8A 2F57A 3W2CA 2RFSA 3ZFYA 3KXZA 2UZDA 4DEGA 3R7OA 5EHOA 5H8GA 3PJ1A 3SDJA 5L2TA 4LGHA 4LRKA 4W4VA 5IA4A 4MBIA 3WF8A 3MYGA 4I21A 3DDPA 4DGMA 3TI1A 3AC3A 2P3GX 1Q4LA 2WD1A 3P7BA 3QD4A 5FWKK 4QP6A 5AADA 5D9HA 4DFNA 4RVTA 4F6UA 1GZNA 3RM7A 1R1WA 3ZSHA 4MNEB 4FSYA 3R7VA 2BR1A 3A99A 4U44A 2XBJA 3W18A 4JG6A 4RG0A 4CZTA 3ORNA 4HYSA 4WUAA 3Q6WA 5D7AA 4EQUA 5CSHA 4FTMA 1XWSA 3BV2A 3DKOA 2CGVA 3W10A 4TWNA 4E3CA 4O22A 3Q3BA 5M51A 5K3YA 5EQYA 4DH7A 3PSDA 2J0IA 5CWZA 3EQCA 3AC2A 4IZAA 3BYUA 1YHVA 3N4TA 2XBAA 3A8WA 5EI6A 4CRLA 4GH2A 4FKUA 4H3BA 4FVQA 4AOTA 3NCGA 3PJ8A 4OTFA 3GC9A 3QQGA 3UODA 3V5WA 3ZO3A 3IONA 1G8SA 2QU6A 3EKNA 2PUIA 4YC8A 3DNDA 3LFNA 4J1RA 4ITJA 3JUHA 1XBCA 3CP9A 3O51A 4MF1A 4U80A 3D7TA 3HUCA 2R2PA 2ZV9A 3DBDA 3T9TA 5K0XA 5JGAA 3RWPA 3BHYA 2CLXA 4IWOA 1MQBA 4CMOA 3P1AA 5HD7A 4DF3A 5EI2A 4X2NA 5DNRA 3IDPA 3QD2B 5A3XA 4FTNA 1L8TA 1LP4A 2BDJA 3ORZA 2X39A 3VUHA 5E8XA 4IC7A 3FI4A 3LLAA 4FT5A 4NL0A 1SM2A 4FYNA 3RNYA 3N51A 1PY5A 1WAKA 2I0VA 3GI3A 5HCYA 3ULIA 3ET7A 3QC4A 2HYYA 5IMEA 2QO7A 5L3AA 4JAIA 4EOOA 3DB8A 4O0RA 2YABA 4RX7A 1CM8A 4CFFA 4E4XA 3L8VA 4USEA 5L2QA 4BWXA 5FP6A 5J7HA 3K5VA 2IN6A 4G3FA 3VBVA 3DT1A 4A9RA 2HCKA 2XK9A 3BYMA 3MPTA 2WEIA 4NW5A 4FL3A 3JS2A 3V8SA 1J1CA 2H9VA 3E92A 2WMVA 2VTTA 3KULB 4O0UA 4FNYA 3V5QA 1W0XC 4GK3A 1UWHA 4M15A 3QQJA 2X9EA 5AM7A 2BKKA 4BCNA 2VWWA 2GNJA 3BU3A 3LW0A 3QTUA 2BFXA 3GCSA 4ARKA 2I0HA 5IUIA 5AUVA 3KY2A 1REKA 4FR4A 4CQGA 5I3RA 3TTJA 4ANQA 3QZGA 1V0OA 4WOVA 4ANSA 2C5VA 2WTVA 3LM5A 2OFVA 4CFMA 4AN2A 1OPLA 2VRXA 4QTDA 4BN1A 4W8EA 1ERKA 3FKLA 1A06A 5AUYA 1OL2A 4IVBA 3QALE 3U9NA 2VO7A 5D11A 4YPDA 4I23A 3TV6A 3DU8A 2FUMA 4O86A 2WGJA 3RCDA 3ZFMA 4D2PA 2YM6A 3W2RA 3SG9A 2WQOA 1LPUA 2HK5A 2ZMCA 3HV5A 4X2FA 1J7IA 4QMVA 2WIPA 3HV3A 3NVMB 3OEFX 5GJGA 3UMWA 3NNUA 5LVNA 5BUJA 5DG5A 1XR1A 3L8XA 4FUXA 4M3QA 4FV8A 4DLIA 2PYWA 3F5GA 3HRCA 3ZO1A 4AA5A 4E8AA 3FPMA 2H96A 3VC4A 3ZOSA 5IISA 2UW5A 2GS2A 4C7TA 5IG1A 4Q5EA 3HMIA 2VTSA 2GNGA 2YDIA 3BZ3A 4JDIA 2HWOA 4CKRA 4MF0A 4FIJA 3RAWA 5CVHA 3U4UA 4Y73A 2PVHA 2XF0A 3QAME 5GNKA 4O84A 2G15A 1ZMWA 3HP2A 2X8IA 4U97A 2C1AA 3WF7A 3F3TA 2OKRA 4BDIA 3BYOA 4FKSA 4WA9A 3ZMMA 4II5A 3UVQA 3LCOA 1U5RA 3V5JA 3AT4A 4EK5A 2H8HA 2OLCA 1MUOA 2QOIA 4G9CA 3FC1X 4BKZA 5F9EA 4DFYA 3FI3A 2CKEA 3RZFA 5L4QA 2UW8A 4IWQA 4U45A 5M55A 3UZPA 3EQHA 4UB7A 4GUEA 1LEWA 4Y95A 3K3IA 2X4ZA 3A62A 4L44A 4PL5A 2QI8A 5ETFA 2UW7A 3RK7A 3FXWA 4Y83A 4GIIA 5AWMA 3JY0A 2VO6A 1H25A 3I5NA 1FVVA 4DFLA 4D4RA 4IB0A 5A4TA 3BU6A 4W8DA 4FIIA 4UMRA 3LFBA 4ZTLA 3R22A 3N4UA 4FKJA 4K8AA 4FYOA 5CTPA 2ZV8A 3OCTA 4JRNA 2PE1A 4CQEA 3RAKA 4CT2A 5C4LA 4B99A 5J87A 4FSZA 1JQHA 4TTHB 4NJ3A 1PMVA 3MH2A 3QZFA 3VQHA 5ANEA 4EHEA 4RJ8A 2GS7A 1H8FA 4ZS0A 2J0JA 4V0GB 4JRVA 2W1ZA 3CGFA 3IGOA 2P2IA 4J8NA 4RIYA 3DZQA 5JH6A 1QPDA 2X2KA 4YBKA 3Q96A 2VZ6A 4ZP5A 5M08A 3QU0A 3F2RA 1W82A 4D4YA 4I5HA 2GNFA 2YITA 3OT8A 5AUTA 1YXVA 3UOHA 1GIJA 1R0PA 1UWJA 5AR7A 3FLYA 3RPOA 4A4XA 4FKVA 3HMNA 4OLIA 4CMTA 3PWDA 4GMYA 2W5BA 4QPAA 1OVEA 4M67A 1I44A 4I6FA 2X9FA 3HKOA 3HP5A 4UWBA 3RP9A 2X4FA 4JIAA 3CTJA 4E20A 3RMFA 3CGOA 3FMHA 3UG2A 4PNKA 5IA0A 3R7EA 3QQLA 4KRDA 1XH9A 5FGKA 2X6EA 4YMJA 1APME 3ORTA 2VO3A 5HG9A 5B2KA 5HE3A 4CGAA 4IAYA 2YDKA 3VW6A 2PVYA 4ZIMA 1Q24A 4BWKA 4BCQA 2HW7A 4TNDA 5KNJA 3FV8A 2BRNA 4PMMA 3GP0A 4DTBA 2FGIA 4NIFA 3VBXA 2W0JA 3VS4A 3NR9A 2OJFE 3NYVA 4G34A 4P90A 4RFYA 5E1SA 4ACHA 4OAUC 4AOIA 3L9LA 3NNXA 1QPEA 3LFAA 4U79A 3U55A 1BYGA 4XG6A 3TIZA 3EB0A 4IWDA 4Y8DA 4UXLA 4FTCA 3BLQA 4ZY5A 3M1SA 3PZHA 4H3QA 5CI6A 2R64A 4J7BA 4EOSA 2QOBA 3L9NA 3CEKA 1AD5A 3R9RA 4IAFA 3FL4A 2OIDA 5HO7A 5A6NA 3LJ0A 4F9AA 3L1SA 2VTOA 3KGAA 3BGQA 3OD6X 4LUEA 3FKOA 4BHZA 2OO8X 4DN5A 2EXMA 3ACKA 3LOKA 2XMYA 3R30A 3PVWA 4KBCA 1FMOE 4BZDA 3ZDUA 3KVWA 4YLKA 3DPKA 4DT8A 4FGBA 1U46A 4MQ1A 4NEUA 5EK7A 3WF5A 4AE9A 4G16A 3DK6A 1FPUA 4FZFB 2VGOA 4PV0A 1ZOGA 2XKFA 2B9IA 5GIOE 1DS5A 5CSWA 5K9IA 3V8WA 3GNIB 2R3JA 3V5LA 2BAQA 4HYHA 4ZTNA 1J1BA 3ZFXA 3UDBA 4G3GA 3ZSIA 2BILB 4BTJA 5J5TA 2PMOX 4N57A 4BB4A 2PVLA 3QD3A 4D0XA 3CS9A 3WIGA 3KF4A 5HEZA 3CPCA 3EN7A 1UU8A 3Q4CA 3R7GA 4OTPA 4PDOA 4C36A 4E5AX 3ZBXA 3QRKA 2XNMA 4CG9A 4AA0A 1H00A 5EDQA 4DG0E 3CSVA 4GT3A 3PXYA 2JIIA 4E4MA 4R5YA 3SHEA 3LFFA 3PXRA 2ITZA 3BWJA 4GJ2A 2Z60A 3ZEWA 1OKWA 4NZWB 5FBNC 5IQDA 1GOLA 2DQ7X 4AXAA 5IMXA 3V3VA 3HLLA 4ZY6A 4NIFB 5CS6A 4K6ZA 4RVKA 4CNHA 4M69A 2XNBA 4QTEA 3ZLXA 4AW5A 4PDPA 4ZLOA 2Q0BA 3P78A 1P14A 4BCIA 4O21A 1LR4A 4Y5QA 3W2SA 2R3FA 2PZPA 2J9MA 2JDTA 5E8TA 4HYUA 1DI8A 4ASEA 2I6LA 4DEHA 1PXKA 1Q3DA 3DQXA 4J52A 4QPSA 3R8ZA 4ACMA 5M07A 1YOLA 2J0LA 3C0IA 4EYJA 1ZAOA 4U40A 1CKPA 3AD6A 4GG5A 3F66A 3QZHA 3BHVA 3QLGA 5DR9A 5LMKC 1K9AA 2XYNA 2Z2WA 1IASA 3QGWA 2V7AA 4RIXA 4XHKB 4YC6A 2AUHA 2YIXA 4PPBA 5FXSA 3RK5A 4DH8A 3A61A 1PXOA 2R3IA 3BQRA 4QP8A 2Y6MA 4F99A 5KZIA 1NVRA 4EWQA 5HIDA 1G8AA 4DEIA 3OUNB 5HLWA 2HWPA 3EQBA 3R01A 4FMQA 3OWJA 5CYIA 3DFAA 5AP4A 2NRYA 2J51A 2BFYA 4IDVA 2WQNA 2EB2A 4GFGA 4HZSA 4S32A 5BVEA 2NPQA 3MFSA 4Z16A 1HCKA 4BCPA 5DFPA 4FTUA 1KE6A 4RPVA 5CQUA 1JOWB 2GTMA 2NP8A 3DAEA 3OS3A 4WNKA 4C3RA 3DFCB 4AACA 2YWVA 5CU3A 2P55A 3PVUA 3NRMA 4ZJJA 3IECA 3GU4A 3OT3A 5HOAA 1W83A 4RQVA 3EQFA 4EBVA 4LM5A 4X21A 2OF2A 1M7QA 2QKRA 3OWPA 4YGAA 4D55A 4N6YA 5KUPA 2GQGA 4M7IA 3RALA 2YACA 5EM7A 3LFDA 5D1JA 4B0GA 4EZ3A 4AP7A 4MVFA 4ZTSA 2XB7A 3F7WA 3R02A 4FT9A 4LYNA 4DYMA 2VTNA 3Q52A 2UUEA 2JDRA 4TNBA 4YNEA 4C59A 2R0UA 3AMBA 5CSPA 3PWYA 2KULA 4I5PA 3Q4UA 4XCUA 4YJOA 2E9UA 3SRVA 4L7SA 5GZ8A 4O7TA 3GXLA 1V0BA 2YIRA 4TWPA 4L52A 5IA5A 3I4BA 3ZEPA 2F7XE 3PA3A 4XS2A 2G2HA 3P86A 3DDQA 2JFMA 4NCTA 5HORA 1M52A 3R8UA 3VS1A 4LOQA 4NWMA 4AOJA 5CAPA 3NEWA 1RJBA 5C8MA 2PTKA 4ERWA 3MH1A 5DA3A 4BL1A 1AGWA 3CBLA 5C27A 3TJDA 2QO2A 4ZTRA 2YM8A 3Q9XA 3VRZA 2F9GA 4DTAA 3VS6A 3CLYA 2RG5A 4KNBA 4RJ7A 5AP0A 1YDTE 4IB5A 5T3QA 2FSTX 4GRBA 3PP1A 5CF4A 2YM3A 4RIWA 3PVGA 2X6DA 3FZSA 1SVEA 5IDPA 4JXFA 3QHWA 4F9WA 3KMMA 4YO4A 4LV8A 4RFZA 5EI8A 1P4OA 1REJA 3KN5A 5CLPA 4UALA 1Q41A 3B2TA 4Z55A 1LUFA 4FOBA 3EZVA 5M4UA 2O64A 3O7LD 1YOJA 2QKWB 4RC2A 4EOLA 3QTRA 2WTJA 4BDKA 4NM7A 4AFJA 3MY5A 3F5XA 3NUNA 3VUIA 4GVJA 3RTPA 1O6KA 2CCIA 3LCSA 2LAVA 5M09A 3DNEA 3KCFA 2ITNA 4C4HA 3OFMA 5IA3A 2YWPA 3NMUF 3MFUA 1H1WA 4ZSAA 3QQHA 4FNXA 4GT5A 4GKIA 3VO3A 3U6IA 2E9NA 4O82A 3UO5A 4O6EA 4FKLA 2F2CB 5AR4A 3BV3A 3PG3A 3AG9A 4FV5A 5JFXA 4K1BA 3ZLSA 4XBRA 3LQ8A 4H05A 4FG7A 2FVDA 4XNEA 4F1OA 1M2RA 2C6KA 2PK9A 4NK9A 1S9IA 3TEIA 3LQ5A 1IA8A 3P23A 4P2KA 3GCUA 3SRVB 3G51A 3ANQA 4DEEA 4FNWA 2AYPA 5DGZA 3PIZA 5DLSA 1TQIA 2C0OA 5GHVA 3R8LA 3UE4A 2PMLX 3VUKA 4C37A 2EB3A 4E6CA 5HIBA 5LMKA 2RKUA 3NCZA 4I0RA 4TL0A 4EZ5A 4GV1A 1A48A 4ZOGA 2CNVA 3OWLA 4I6QA 3UGCA 5E7RA 3L9MA 4K9YA 3EWHA 5ANOA 4Q9ZA 4YZMA 1MP8A 5H8EA 3JPVA 4GK4A 4DEAA 4FTJA 3ORKA 1M17A 4OW8A 4IAZA 2WQEA 2YCQA 2F4JA 2PVMA 5AIKA 3D2IA 4PPAA 2R3OA 4BTKA 4YSJA 1H4LA 3R1QA 4QMPA 4OT6A 3NYOA 2Y0AA 3EL7A 4B7TA 4QMYA 2JD5A 1NVSA 2XNOA 1MQ4A 3UPXA 4D2WA 4XG4A 2E9PA 3VVHA 3BU5A 4CSVA 5B2MA 5AR3A 4XG7A 1OKYA 2FB8A 4YBJA 4BGQA 2VO0A 4FKWA 4FK6A 4H3PA 4L3JA 1OKZA 5AP1A 2UV2A 2BUJA 4FZ6A 4H58A 3S0OA 5AP7A 3Q9YA 3TNWA 4RJ5A 3F2AA 3H4JA 2OK1A 4RWJA 1OM1A 3KMWA 3C5IA 5BPYA 2WXVA 4FV2A 3JR1A 4F9BA 5B2LA 2B54A 5HVJA 2CHLA 2V62A 4MTAA 3OZ6A 1XH8A 3FQHA 4EWHA 3PA5A 3EN6A 4LRJA 5JKGA 4HCUA 1ZOEA 1O6YA 4YU2A 2IVVA 2UVXA 2BZIB 3SW4A 5K5XA 2CGXA 4G5PA 4IW0A 4DTKA 2W4JA 4GIHA 2QR7A 1XH6A 4H36A 3ZRMA 1ZYLA 5HO8A 2C68A 4LV5A 3H9OA 1DAWA 4FEWA 3PYYA 4JVGA 4XG2A 3AGMA 2CGUA 3PA4A 3QXOA 3R28A 4QO9A 3ENMA 3FLZA 4DA5A 4BCGA 4E4LA 3F7ZA 4KUJA 1KE8A 2WKMA 4Y85A 5EHLA 3ZONA 3QUPA 4FKRA 4OTQA 4HVGA 2X7GA 3AXWA 3DXQA 1J7UA 5BX0A 3TKHA 3PE2A 4L42A 5C01A 4TY1A 5AR5A 2C6TA 2OG8A 5L8JA 3FXZA 3MTLA 5DYJA 2PE0A 2VX3A 3GOKA 3K2LA 5FD2A 3VIDA 4LRMA 5ANGA 2J5EA 4I4FA 4CG8A 3CQUA 3PSCA 3HX4A 5EYKA 4L3PA 4BTMA 5L2WA 4UV0A 4EJ7A 3ENHA 3FMNA 3NUSA 4JQ8A 4EC8A 3R04A 3R21A 3WOWA 1DM2A 2R7BA 4BI0A 4MH7A 3VS5A 5HIEA 5FG8A 5ANJA 2RFDA 3RZBA 3GUBA 5EOLA 4FSWA 3COIA 4S34A 4OTHA 4ZTHA 2IPXA 4XV3A 1BL6A 5CZHA 1M2QA 5GJFA 1IG1A 2BAJA 4QNAA 1G5SA 2JITA 2CKOA 1WBPA 3HUBA 4GS6A 3QLFA 2CSNA 4I5CA 4FF8A 3WZUA 3FQSA 2PMIA 4HPUE 1H1PA 3FPQA 3UJGA 4Z3VA 3V01A 3KXMA 4I1ZA 4QMUA 5LQFA 3QYWA 4EH7A 3FLQA 3PXZA 3I6UA 2J50A 5M4FA 5IQCA 4GL9A 1Q97A 3R8VA 5IA2A 5LVPA 2PU8A 4QPMA 4KKEA 2W5AA 4EI4A 2R7IA 3RAIA 3V6SA 3QX2A 1B38A 2Z7SA 4I0TA 4ZSEA 2FSLX 4WRGA 3VRYA 3R1NA 2JAVA 3G15A 3RK9A 3VS0A 2QR8A 3HV7A 2PSQA 2PHKA 3BEAA 3LFQA 4JLCA 4RA5A 3ZCLA 3LXKA 5F94A 4YZNA 3IW7A 3ZU7A 4JG7A 2V5QA 3MY1A 4XJ0A 4K77A 4EH6A 3BX5A 4IZYA 4PMPA 5TKDA 5JFVA 1XO2B 3OTVA 4O83A 4NT4A 4CFNA 5BYYA 4LFIA 2XJ1A 3QD0A 2QG5A 4GKHA 4GYIA 3VWAA 3PZEA 2ZM4A 4AF3A 4KSQA 4IMYA 4JX7A 5DT3A 4GCJA 3P79A 4RBLA 1YDSE 3VUMA 4FBXA 2VTQA 4TWCA 4YHTA 5I9WA 3COHA 4MXAA 3DCVA 4EEVA 2IW9A 2CN8A 3LAUA 4QOXA 4UZHA 4XG3A 5CF8A 2R3LA 2HW6A 3E64A 5AIRA 4AU8A 4ANBA 3A7FA 4R6VA 4QYGA 4WHZA 2RG6A 3C1XA 2Y4IB 2Z7RA 3LFSA 5IUHA 4DCAA 3KRJA 5LVLA 5K4JA 5KO1A 1XKKA 4U42A 2XA4A 3KL8A 4AT3A 3QQKA 3C0HA 1Q8UA 1R3CA 1BLXA 3FUPA 3H0ZA 4O2PA 5CQWA 3NX8A 3OBGA 2C30A 2IO6A 4HGSA 4R3CA 1H26A 4MNFA 4QMWA 3FAAA 4WIHA 3SOCA 5JFSA 2VN9A 4U5JA 4C4GA 4E26A 3QHRA 3ERKA 3ODZX 1WZYA 3R2YA 2QNJA 5EOBA 4UYNA 5JQ5A 3I1AA 2PVNA 4C2VA 1ZOHA 3UP7A 3BLRA 2E2BA 3I0QA 3FKNA 4A07A 3ID6C 1XH5A 2PZ5A 3ZUTA 5IH6A 3JVRA 3MH3A 1H1RA 3OHTA 3VHKA 1SMHA 3OVVA 5CALA 2BKZA 2XP2A 3TNHA 3MESA 1CDKA 4YJUA 3SV0A 1PKDA 1KWPA 3I6WA 3KK8A 4L45A 2EWAA 3VBYA 3E8EA 3OG7A 4P5ZA 4EH8A 5AV0A 3ZRKA 5BNJA 3UYSA 4D28A 4FG9A 4DITA 1KSWA 4PL4A 3KXGA 4B8MA 1WBWA 3LFCA 2WMTA 3C5UA 1OIYA 2OJIA 4FKIA 4I6BA 2BTRA 3DS6A 3H9RA 1OUKA 3G6GA 4MBLA 2X7FA 3KK9A 3AC5A 1JSTA 5LVMA 3ETAA 3OXTA 3EFJA 4R1VA 3JXWA 5M53A 5KMNA 1XBAA 2C5OA 2QOFA 5LOHA 3SW7A 1GAGA 4KABA 1E1XA 4C62A 4JDJA 4PMSA 3LE6A 5E90A 4HVIA 4UMTA 5JEBA 1QPCA 1Y8YA 4AN9A 3BWFA 5DR6A 1PXIA 3ANRA 4FA2A 4CLJA 1CSNA 1YOMA 4QQ5A 3ZH8A 5B0XA 2ZVAA 5FTQA 3DJ5A 1JNKA 5EH0A 3VBWA 3C4XA 3KU2A 2C6EA 4FT0A 4R3RA 4CXAA 4AGUA 3E8NA 3UVPA 5CANA 5M56A 5IQFA 4D5HA 2WEVA 3ELJA 3EZRA 3W33A 1ZZ2A 3EQDA 1OGUA 2UVZA 3R0TA 1Q5KA 3E3PA 4IJPA 4PMTA 3MB6A 3EMGA 3FMJA 1H0VA 1ZLTA 1WMKA 5CT0A 2W1FA 5CX9A 5JN2A 2JKOA 3A7GA 3CC6A 5J8IA 3MGYA 1TKIA 4OTDA 4XP3A 4IVDA 2R3KA 4MKCA 3D7TB 4A9TA 1CTPE 1JBPE 3FZTA 2IWIA 3PG1A 4OBQA 3GB2A 5JGDA 1Y8GA 4J99A 1Q61A 1ZYSA 4XX9A 4J96A 3PY1A 2BDFA 3GCQA 4V01A 3MSSA 4A4OA 3QA8A 4IBMA 4UYAA 4BCFA 4O6LA 3F5PA 4D0WA 2OXXA 3F69A 4KBAA 1PRYA 1BUHA 4RJ6A 4UMPA 4RC4A 4ERKA 4F9CA 4J95A 4PDSA 2QHNA 3QQFA 4FTOA 3UO4A 4AG8A 3ZUUA 1ZZLA 3IQ7A 1NXKA 3O8UA 4K18A 4N70A 2C5XA 4M12A 4BF2A 2W4KA 2B53A 3MS9A 1UU9A 2XUUA 2BZKB 3O96A 4CD0A 2JGZA 3PXQA 1U4DA 2OJGA 4FK3A 3D94A 2PL0A 3LXNA 4L67A 3SD0A 4BBMA 2YFXA 3WF6A 3FBVA 4BKYA 3ACJA 4QT1A 3I81A 4FI1A 5L6WL 2HZNA 4YJVA 4BDDA 1FVRA 5JRQA 3U54A 3C4CA 3FEGA 1U54A 2GNHA 4FZDB 4YJRA 3VUGA 3M2WA 4XYFA 5K5NA 3EFKA 2VX1A 3T3VA 2BPMA 3V51A 3FSFA 4G3EA 5IQGA 4PPCA 2J7TA 3ORLA 3ZTXA 4EOJA 3E93A 4FKOA 3Q4ZA 3E5AA 4YC3A 5F4NA 3MW1A 5CU6A 4BBEA 5AA8A 5A4EA 3ZM9A 2VNWA 3QA0A 2CDZA 3WILA 4FEUA 2XK4A 3QRIA 2OXDA 4NUSA 3D5WA 2UVYA 3QRUA 3UC4A 4ZZNA 2YLFA 4FIHA 1GZ8A 5IZFA 4AZTA 3GOPA 3E7OA 2OH0E 1XBBA 2YA9A 3DTCA 5AAFA 5F95A 5B7VA 2G2IA 1Y91A 5IU2A 4EKKA 4PDYA 1YRPA 2XK8A 5IA1A 1PMUA 3Q60A 3VF9A 2QVSE 4I4EA 5EYCA 3E88A 4A9UA 1BI8A 2OGVA 2J4ZA 5TE0A 1KE7A 1NY3A 4ORKA 4NTTA 5BUIA 2ZV2A 4R77A 1WBSA 2WZJA 5E8VA 2QOKA 5AM6A 5EKOA 2WTWA 4M84A 4IFCA 3I5ZA 1CKIA 4EH2A 3FE3A 5E8SA 1XHAA 2F49A 2YIQA 4KIKA 5HVYA 1YXTA 1R78A 3Q04A 5AAEA 2ITTA 4FTTA 3ZRLA 2IVUA 4HGLA 4JL9A 4JOAA 3IW8A 4EBWA 3BE9A 3QUEA 3S1HA 3DKFA 1Q8ZA 3K3JA 3PRIA 4FTIA 4IX5A 5GJDA 1KE9A 2C3IB 5CEKA 1JSUA 5HU3A 5IQAA 2O5KA 1KOBA 2RIOA 3F5UA 5ANKA 3UG1A 1ZYDA 4QYHA 3F9NA 2WHBA 4EHGA 3BKBA 4JT3A 2BRBA 3BLHA 2GSFA 2WTKC 2XKEA 4G17A 4D2RA 1P5EA 3A2CA 4ALWA 4IADA 5HNGA 4L6QA 3BHTA 4U3ZA 3ZBFA 1WBVA 2IZRA 3TWJA 1OL6A 4U8ZA 4GJ3A 4AZSA 4X3FC 4ZZMA 5CAOA 3PFQA 3DA6A 2PUUA 2YAKA 3ATSA 4FV4A 3P7CA 4NU1A 2XYUA 3O50A 3L9PA 4S33A 4FE2A 4QTCA 2B7AA 2F7ZE 4F0IA 3TG1A 3BCEA 4EQMA 4O0SA 4JG8A 4AUAA 4XLVA 4GEOA 4J53A 3OW3A 2OF4A 4ZXTA 4ZLZA 2WMAA 4J8MA 1BMKA 2C0IA 1PHKA 3TN8A 2HENA 2VUWA 4AW0A 4U0IA 4NCTC 3O23A 2XK7A 4F7LA 2C4GA 2JC6A 3H30A 3MPMA 3PSBA 2ITPA 2FYSA 3B8RA 4RIYB 1KOAA 4IAAA 3C50A 2BMCA 4LMNA 3GU5A 2B9HA 4WNPA 5D41A 2CJMA 2R9SA 3Q5ZA 4RVMA 2YCRA 4HVHA 3RJCA 4S2ZA 3WIKA 2XRWA 4RWKA 4KKHA 3AMYA 5L2SA 1PYEA 3LCKA 2XCKA 3RAHA 1RW8A 1H24A 3SKCA 3HV4A 1H01A 3OCSA 2I0YA 1L3RE 1URWA 1UU3A 3GU7A 4JDHA 5FTOA 5FRIA 3V8TA 4DGLC 4HJOA 3NUXA 3UPZA 4ONAA 2O8YA 4APCA 3TUDA 4BC6A 4EUUA 4TXCA 4BYJA 2JLDA 2R3QA 3PLSA 4NSTA 3CPBA 3R7YA 4F64A 2C5YA 3FJQE 5IQBA 1FINA 2ZB0A 4FSTA 3UMXA 1BX6A 3QTXA 1F3MC 2ETMA 2AC3A 2IZUA 5L6PA 3Q4TA 1YWRA 3D5XA 3IW6A 3MA3A 4O38A 5A4CA 3LVPA 5EFQA 5AUXA 2WMWA 2QU5A 1BL7A 3CD3A 5HO6A 5ETAA 4HZRA 2FO0A 5A14A 3NYXA 4GYGA 4LQMA 4P4CA 4C0TA 2R3RA 3TZ9A 5A4LA 3G9LX 4L68A 1ZY4A 2ITXA 4I41A 1J91A 4R3PA 5AV2A 1PMNA 5A4QA 4EC9A 2VWZA 2ACXA 2WMQA 4RWIA 4A9YA 5CAUA 5FEDA 4ZTQA 4RIOA 2ZJWA 2R0IA 4FSMA 2UZOA 4BFMA 4R7BA 4KB8A 4UY9A 2HZ0A 2R4BA 3HECA 5HCZA 3REPA 4O1OA 5BVNA 1OI9A 2GFSA 5JT2A 5I9UA 4O1PA 2B9FA 4FZ7A 2OXYA 2EVAA 4HGTA 4LG4A 5FQDC 1P4FA 4ANMA 1YDRE 1M2PA 3ZZEA 3ROCA 4GVAA 3C7QA 2ZMDA 3W8LA 4LGGA 3C4WA 1KV1A 4WG5A 2ZM1A 4EH9A 5DPVA 4DG2E 2GFCA 5HBEA 2OI4X 3VN9A 3BE2A 3K54A 4OUCA 1GZOA 4JNWA 4FKPA 5J9YA 4LMUA 4EK6A 4M14A 3KFAA 5DH3A 4TRLA 4X3FA 1FQ1B 2VV9A 4IVAA 5EQPA 1OBGA 3NNWA 4L53A 5E8UA 3V6RA 1OIRA 1PJKA 3C0GA 2JIUA 5AV3A 1WBTA 4QRCA 5HBHA 1IRKA 3MA6A 3NUUA 2ONLC 1GJOA 4C35A 5LCJA 3GQLA 5HX8A 2CKQA 4BCHA 4LL0A 4X2GA 5E1EA 5HI2A 4V05A 3EFLA 4IEBA 4M69B 1H27A 5I9ZA 3IOKA 1SYKA 2B4SB 2VTMA 3EH9A 5J79A 4JI9A 3TDWA 1F5QA 3ATTA 3NNVA 4DGGA 5A54A 2QOCA 4E6QA 4IE9A 5EW8A 3OMVA 1Y57A 3BBTB 3HDNA 4BGHA 4OAVB 4LI5A 3HNGA 4RC3A 5DHJA 4CTBA 2VTLA 1XJDA 1H28A 1Q62A 2G1TA 4MX9A 3E8CA 4EOQA 5KMIA 2QURA 3W2OA 4FNZA 3NW6A 4YLLA 3C4FA 5EM6A 4QQJA 1YHWA 1H0WA 1VEBA 5IKWA 2XJ0A 4RIXB 5JSMA 5FP5A 5D7VA 3ZC6A 1OL7A 4I93A 4IVCA 3RBWA 2X0GA 5HKMA 5AMNA 3CE3A 4YJQA 1VR2A 4AAAA 5HZNA 3M42A 4ENXA 3UQFA 4DLJA 2X8EA 3DJ7A 3ORIA 5AP5A 5KMMA 2IZSA 1NT2A 4BZOA 1H1SA 2B9JA 4IANA 4B6LA 4I3ZA 2RFEA 2YHVA 3D83A 4O0VA 4TT7A 1DAYA 4KAOA 5FUTA 3SGCA 1Z57A 5EM8A 4DG3E 3FZ1A 2HZIA 5DMZA 5M4IA 4D4SA 2IG7A 4AX8A 4IZ7A 4YJTA 4BY9E 2PY3A 4PUZA 4WKQA 5FM2A 2V0DA 3EQIA 4RLKA 4TYHA 2RFNA 3VHEA 5AFVA 5TO8A 2WTKB 5IDNA 5ICPA 2Z02A 3CR0A 2W5HA 4F0FA 3F61A 4ZJIA 3SXRA 1YVJA 2UZLA 2UZWE 3QL8A 4XMOA 3A7IA 3ZXTA 1F0QA 3LXLA 4PWNA 1OMWA 1ZRZA 2XK6A 3WARA 4W9WA 3TV7A 4IZ5A 3HL7A 4A9SA 4D9TA 3S3IA 4YSMA 3OP5A 4WBOA 2WMUA 4FV0A 3GU8A 2VWYA 4FV9A 3CKWA 1UKHA 3QGYA 2YAAA 3R2BA 4L8MA 1JKSA 2ERKA 3RINA 2EXEA 5AA9A 5HE0A 4I6HA 4RT7A 5LWMA 4FC0A 3UNKA 3EL8A 1K2PA 1OL1A 4C4IA 3VBQA 4IM3A 3WZJA 5CAQA 3AGLA 3QCSA 5G6VA 5KE0A 5FEQA 4APPA 5BUEA 2Q83A 3D5VA 2VTIA 3KKVA 4QYFA 5AR8A 4F9YA 5AR2A 5HX6A 2C3KA 2YM4A 1ZMUA 3DKGA 3EN4A 4L7FA 4Q9SA 4WNMA 2YIYA 3WZKA 4MXZA 3ULZA 5FXRA 3T8OA 4BCOA 4X3JA 1UV5A 1W8CA 1ZMVA 3CJGA 2CKPA 1PXJA 3LFEA 4J98A 4QNYA 3OXIA 3V5PA 4D2SA 4R1YA 2BAKA 3EFWA 2XKCA 1PXPA 2CCHA 3QTSA 2QHMA 4FEQA 3TZ8A 4EOMA 3CQEA 3NIEA 5EM5A 3UOJA 4RIWB 5J9LA 2QLQA 2GQRA 2BCJA 5KMKA 2J0MB 2E9VA 5CI7A 3I79A 2VD5A 4Y5HA 5T6KA 3PPKA 4XUFA 3LXPA 3QFVA 2XEZA 4A4LA 4HW7A 4FODA 4F63A 5DOSA 2VWXA 2YCSA 4OTWA 1XQZA 2IJMA 4KS7A 4R7IA 4O2ZA 2W99B 4U41A 4MD9E 4MXOA 4JS8A 4UZDA 4W4YA 4JBVA 3UP2A 1PXMA 2GTNA 4QP3A 3LJ2A 5LWNA 3KMUA 5CU2A 4YO6A 3QUDA 3U6HA 3VJOA 4XG8A 5AAGA 5KKRC 2P4IA 3TNIA 3SA0A 2FSOX 2WTIA 5KHXA 4DEBA 2ONLA 3FL5A 1DI9A 4M68A 5TT7A 4C8BA 4XG9A 3E62A 3BEGA 2XIYA 1I09A 3U87A 5BVDA 2Y4PA 4KD1A 5DT0A 1OL5A 4PL3A 3TZMA 3HAMA 4XP2A 4NKSA 4CV8A 4ZS4A 3KCKA 1IAHA 1M14A 3BHHA 2C6OA 3VS7A 3R7IA 5HNBA 2XIZA 4QMOA 2OH4A 4CV9A 3F82A 4UMUA 5H8BA 2GHMA 4Y46A 1JAMA 5CU4A 3B8QA 1WVXA 2A2AA 2XM9A 3MPAA 3R1SA 3R71A 2ZM3A 1OKVA 1J3HA 2XIKA 3LMGA 4FVPA 1FMKA 3H10A 3QKMA 4IAIA 2XNPA 4AS0A 3R9HA 3MIAA 3UOKA 5CAVA 2B55A 2ZB1A 5LJJA 1YHSA 2QD9A 4IX6A 4RX5A 5IH5A 4TYEA 4XOZA 5HBJA 1VYWA 3TKIA 4X6RA 1B6CB 2I7QA 3E87A 4O7RA 4G6LA 2ETKA 4D9UA 4EJNA 2XNGA 2C6MA 4FL2A 4FV3A 3T3UA 4BBFA 4BIDA 4IM2A 3MVLA 4QMZA 3ZLYA 1WVWA 3Q32A 5JRSA 4K0YA 4TYIA 4G9RA 5DN3A 2UZBA 5ANDA 4C2WA 2OIQA 2OZAA 5J5SA 3BBWA 2YJSA 5HHWA 3CQWA 4JR7A 2WO6A 2I0EA 2YERA 3B2WA 4EONA 3ZLWA 1Q3WA 2QOOA 3QCXA 3QKKA 3ORPA 3SXFA 2XK3A 3PPJA 3MIYA 2RF9A 1WBNA 3L8PA 4XV9A 2ETRA 5HESA 5L8LA 2AC5A 3UTOA 5HTCA 3G5DA 4RRVA 3JY9A 3FMEA 1SZMA 4YNOA 5KMLA 3EIDA 1JKKA 4WG3A 4D5KA 2BVAA 4IB3A 2BIYA 2WTCA 4HCVA 4R8QA 3DBFA 5ETCA 3S4QA 3VF8A 4BTFA 4C4EA 4FKGA 4AW2A 4X2KA 5CENA 2C3JA 5CASA 2VWBA 4X2JA 1IEPA 3CIKA 4OBOA 4F1MA 2HOGA 3FXXA 3KRXA 3F3UA 4JQEA 4MNEA 4D1XA 1JLUE 1KV2A 4QP9A 2EUFB 2V22A 5HG8A 3GBZA 4UMQA 4JBQA 5L2IA 3PRFA 3LIJA 5A9UA 3DK7A 1OIUA 2YZAA 5HD4A 2WQMA 3EOCA 4R78A 3E7VA 2QCSA 4J71A 4UWCA 4BDHA 5JK3A 2C0TA 3VNTA 4F7NA 4EH4A 2QOHA 1NVQA 2CPKE 4EOPA 4PQNA 4WSYA 3DBQA 2ITWA 3U6JA 3A7JA 4RX8A 4BZNA 4NH1A 2R3GA 3GT8A 2VTAA 4QMMA 2OJJA 4QP4A 3WZEA 2ZOQA 4H39A 3I7BA 5HE1A 4AQCA 4E7WA 4MK0A 2ITYA 2W96B 5HTIA 2BRHA 3R83A 3OY1A 3D9VA 3KRWA 3MFTA 2VNYA 4U9AA 2REIA 3SX9A 5C26A 2W1EA 3FDNA 4NFMA 5CXZA 4PTEA 4RZVA 3QC9A 3HRFA 3TJCA 2W9FB 2YLEA 3CD8A 3F88A 3FLWA 3R73A 4X6QC 3RM6A 5J1WA 3IOPA 5AX9A 3HMOA 2PVJA 3KB7A 2OJ9A 4CZYB 4NM0A 1ZYCA 4USDA 2WAJA 4Z7GA 3KREA 3OOMA 5K4IA 1Y6BA 5HGIA 4F7JA 1NW1A 1FGKA 4HNIA 3UQCA 2UW3A 3UBDA 4RJ4A 2GNLA 3CXWA 5EYMA 1YWVA 3RI1A 4FICA 2XH5A 4BCMA 3QTIA 2H6DA 5GZ9A 3UQGA 3NW7A 3P9JA 4FT7A 4FGRA 3RPVA 3P5KA 2OICA 1OUYA 4QQCA 3KRLA 4D4VA 2CN5A 3KULA 4MYGA 4EKLA 4IAKA 3FYKX 4RSSA 5ACBC 3TIYA 4C4FA 2GMXA 4HVSA 1SVHA 4AT4A 4GUBA 3P08A 4C02A 2ZDTA 5AP3A 5BVOA 2DWBA 2EU9A 3OF0A 3FMMA 4KKGA 5TR6A 2J2IB 4KA3A 2X2LA 2JDOA 3EN5A 2IW6A 4G3CA 4QQTA 1RE8A 4YTIA 1JSVA 4ITHA 2XVDA 2F2UA 5IEVA 2OFUA 3T9IA 4C34A 3LQ3A 4L43A 3VAPA 2VWIA 5KMOA 3DAJA 1OITA 4ALUA 3VULA 3ZSGA 3FZRA 3OWKA 4YJNA 2FH9A 2W1CA 1WCCA 3G90X 1UKIA 4O0XA 4QYYA 4IC8A 2O2UA 2UZUE 3QTZA 4ANNA 3PJ2A 5CEPA 3PP0A 1OIQA 5EQEA 2VU3A 5EYDA 1PXLA 3EHAA 3OUKA 3UIBA 3RWQA 2ITUA 4KWPA 4FV1A 2YN8A 4NM3A 3RGFA 4F09A 3DLSA 5JZJA 2O3PA 2QODA 3Q6UA 4IJ9A 4BCJA 1TVOA 5IEXA 2QONA 4AT5A 2OSCA 5J95A 3SVVA 4ITIA 4MWIA 2J5FA 4G2FA 4W4XA 2WMBA 3ALOA 3PLAE 4FIEA 4KIQA 5FEEA 4IACA 3G33A 4AE6A 1MRYA 1VZOA 2YISA 4FTRA 4WG4A 4L46A 3ZZWA 5DIAA 5AV1A 1K3AA 3SQQA 5FTGA 2PZRA 3MI9A 5DEYA 4E1ZA 5C1QB 4N0SA 2XM8A 3G0FA 3W2PA 3QRJA 5C8KA 2P2HA 4ZY4A 4O0WA 5HLPA 4ASXA 4CRSA 2R3NA 1ND4A 3II5A 4YHJA 4IWPA 4NKAA 3IW4A 1QCFA 5AUZA 1LEZA 3IK3A 5KKRB 3C51A 4O7NA 3NDMA 5EW3A 2O65A 2YDJA 3KXNA 3C4ZA 4FSRA 4F08A 3TCPA 4O27B 4YHFA 3IG7A 2VTHA 3ODYX 4YPSA 2HXQA 2W17A 2WB8A 4TN6A 4PF4A 3HDMA 3ZXZA 1UU7A 3FZPA 4NTSA 5JFWA 4FT3A 2XKDA 3ZC5A 4K11A 3TXOA 4XRLA 4ALVA 5DVRA 2CGWA 1Z9XA 2E9OA 2JKKA 3BPRA 4XH6A 2W7XA 4OT5A 2X2MA 3TDVA 2WPAA 1YI3A 4UBAA 3ZO2A 3OC1A 5CNNA 3H9FA 4JJRA 2JBPA 1BI7A 3NAXA 1EH4A 3FQEA 4DE4A 3MH0A 3I7CA 2W9ZB 4PNIA 3PVBA 4QD6A 2BHHA 3HMMA 2DS1A 3S95A 1P2AA 3MBLA 1G3NA 4CVAA 5I9VA 3QWKA 3O8PA 3OXZA 3LZBA 2WOTA 1ZY5A 4PY1A 4HVDA 2C5NA 3R63A 4X0MA 4PP7A 4G6NA 2O63A 3CKXA 3HGKA 5EG3A 4D1SA 3MFRA 4I94A 2I40A 4AFEA 3LCDA 4V0GA 3GC8A 5FDXA 4FVRA 4JBOA 4F1TA 1B39A 2GDOA 4G1WA 4FIGA 2RL5A 2Y7JA 1U59A 4FV7A 5E8ZA 3HAVA 4JIKA 1TQMA 4C38A 5GZAA 2QLUA 3POZA 4GU9A 3D0EA 2QO9A 3KXXA 4BDCA 4M0ZA 5CXHA 3WYYA 2PULA 3UIMA 2X1NA 3BYSA 3BELA 1QL6A 3RKBA 3UO6A 1OPJA 1UVRA 2BZJA 1YI4A 3GCPA 2BALA 4XV2A 3BGPA 4Y72A 4ANOA 3VQUA 1IA9A 2Y6OA 4O7WA 4P5QA 4MXXA 3Q53A 1PKGA 4BDEA 4AZWA 4E4NA 2UZEA 3WYXA 4DINA 5CF5A 1YKRA 2W1GA 3D7ZA 4J97A 5I9YA 4JX3A 4WT6A 3TM0A 4AZVA 4BDFA 3LM0A 3DV3A 5D12A 2NO3A 3JYAA 4AW1A 1YW2A 3UIUA 4RGJA 5DI1A 4MEDA 4FEVA 5JGBA 4YTFA 3MN3A 4L00A 2ZYBA 4D2TA 3FMLA 2JKQA 3IS5A 3OEZA 4QP1A 4W4WA 2BIKB 2XEYA 1HOWA 4U43A 5CT7A 4D58A 2CMWA 3FWQA 3O71A 3Q9WA 5CVGA 2DYLA 5FBOA 3DXNA 5DE2A 4M8TA 4RX9A 4EH5A 4YR8A 4NW6A 4QMTA 4Q5HA 4O7ZA 4IM0A 3HA8A 3MB7A 2WNTA 4DFZE 4EYMA 4MAOA 2X8DA 2YZLA 1YXUA 2DUVA 4WUNA 3F6XA 5HE2A 3UVRA 3DJ6A 3C9WA 5CEQA 2UW9A 5GIPE 5HVKA 4V04A 1W7HA 3NZ0A 1GIIA 2X81A 3KQ7A 4ACGA 3DBCA 4FV6A 3MVHA 2WFYA 1ZARA 4LOPA 4YZCA 1W98A 4QYEA 1TQPA 4A7CA 5A6OA 4UEUA 2HZ4A 2F7EE 4DGOA 3AT3A 4XRJA 2B1PA 3NAYA 5CVFA 1IR3A 1OZ1A 2BZHB 3U8WA 4G6OA 2BRGA 4FTLA 4IIRA 3CJFA 2G2FA 3D2KA 3FZOA 2C6IA 3BIZA 4H1JA 4F0GA 3V04A 4BI2A 3HRBA 3AC4A 3HEGA 3O8TA 2VGPA 2YEXA 3FY0A 2PZYA 1STCE 4CKIA 3FLSA 1U54B 2XIXA 3A7HA 3GEQA 1PYXA 4TYJA 3TACA 3OBJA 4KIPA 2PVKA 3A8XA 3NIZA 3MJ2A 3F3VA 3PIXA
chains in the Genus database with same CATH superfamily
1Q99A 2HY81 4BHNA 4G5JA 4CFUA 1T45A 4BDGA 3NLBA 4KSPA 4B9DA 4YUQA 4EH3A 3MTFA 4U3YA 1PXNA 2WU6A 3HV6A 2BDWA 4JDKA 4YTHA 1YWNA 4M66A 2PMNX 3ZUVA 3S00A 3FHIA 4IX4A 5LARA 2A27A 2GU8A 5BVFA 3BGZA 3W32A 3Q9ZA 5ACKA 3DB6A 2BTSA 1OECA 3FC2A 2YM5A 1Y6AA 3RPSA 4C3FA 4LDTA 4CFWA 1PW2A 4R5SA 4DC2A 1WFCA 3O7LB 3HZTA 4XOYA 4ZSJA 3LMIA 2NYAA 4L01A 2W1DA 3UOLA 4U7ZA 5BMMA 3NWWA 2C47A 4DAWA 4NJDA 5HU9A 1FGIA 2FA2A 2WOUA 5H3QA 2IW8A 2ZV7A 4CCBA 1UNLA 4C61A 1JWHA 4ENYA 1KUTA 4IQ6A 4ASZA 1PMEA 3O17A 2IVSA 4ZLYA 5IPJA 5M06A 3UC3A 4ZEGA 2WMSA 4F4PA 3KVXA 4ZTMA 2W06A 4FOCA 5TOZA 4QMNA 4FEXA 4KIKB 3AT2A 4BDJA 3G0EA 2WMXA 1M7NA 1W84A 4YZ9A 3WZDA 3WI6A 2J90A 2HELA 3BHUA 3D15A 2I1MA 4DH5A 4HCTA 3QX4A 4GU6A 3FYJX 5H9BA 3OOGA 2PUNA 4NYEA 5IQIA 3RCJA 4DGNA 4YLJA 4I22A 2JDSA 5BVWA 2QQ7A 4FSNA 2OBJA 2W05A 4MD8E 4AGCA 4BIBA 4CTCA 2PPQA 5FM3A 1XH4A 2Y9QA 1VJYA 4MXYA 4RVLA 2WIHA 4AXCA 3AC1A 3FLNC 4BYIA 4KINA 3DK3A 4FIFA 2GQSA 3GVUA 2WTDA 4XEYA 4C57A 4ZAUA 4BIEA 5KCVA 5FLFA 2W1IA 3CTQA 3AMAA 5AUUA 4X7QA 3F3WA 5HTBA 3AQVA 4IX3A 5LCKA 4E73A 4RLLA 4PTGA 3SC1A 4CFXA 4CZUA 3CY2A 3OROA 2ZDUA 4FTQA 4WO5A 1H1QA 3U9CA 4D1ZA 3W2QA 5G1XA 2FSMX 4AGDA 3G6HA 5DRBA 3LCTA 3RPYA 4E5BA 2UZVA 2YM7A 2QG7A 3LKMA 4WNOA 4C3PA 5J1VA 4ZMEA 4N4SA 3CY3A 2A1AB 2HAKA 4GSBA 4OR5A 4LL5A 4TPTA 4ACDA 5CU0A 4UX9A 2VTRA 3CTHA 5IQEA 3UIXA 5CEIA 3K5UA 4E93A 1TFFA 2OZOA 3IKAA 4EL9A 3FI8A 4YJPA 3E63A 3R00A 2ITQA 5IEYA 2HXLA 4BGGA 2GHLA 2P0CA 3IGGA 3PDTA 2A4LA 3GFWA 4DFUA 3WF9A 4AGWA 3PXFA 4XP0A 2PE2A 4FTAA 5EDRA 2Z7QA 4F7SA 2IVTA 5DT4A 5AUWA 5CNOA 5C03A 3PUFC 3QYZA 5T68A 3NSZA 1HCLA 2WQBA 3G2FA 4HOKA 4EHZA 4E5WA 3EYGA 3W55A 4BKJA 2GS6A 2IZTA 4MCVA 5KX8A 1H07A 1A9UA 3QTQA 5FDPA 5I4NA 2B0QA 4UXQA 3TV4A 2R3PA 1YQJA 5BYLA 1Q8WA 3BI6A 3QBNA 4ACCA 2JDVA 4GG7A 4JQ7A 5E92A 2BHEA 3POOA 3GU6A 4HPTE 2JIVA 3MV5A 3UNZA 1KE5A 3EQPA 5AP2A 4C4JA 4Z7HA 4YZBA 3AC8A 4HNFA 4A06A 2SRCA 3P4KA 2GHGA 3U4WA 3VS3A 5IUGA 4DHFA 4Z9LA 4N6ZA 3GGFA 2XS0A 4IB1A 2Q0NA 5CF6A 3PPZA 4BVUA 3R9OA 4OGRA 5IQHA 5K0KA 4FRFA 4K2RA 3H0YA 2ZAZA 3F2NA 2H34A 3DLZA 3TUBA 4I20A 3RVGA 4QP2A 4FKTA 4KS8A 5L8KA 3QXPA 1O9UA 1VLRA 4FSQA 4E6AA 4MWHA 2J0KA 4DFBA 4ZSGA 5CSVA 4IDTA 5CSXA 3BQCA 3V5TA 1H08A 2XCHA 4TZRA 3ORXA 3NUYA 1CMKE 3ROYA 5J9ZA 4BDAA 3AOXA 1E1VA 2YCFA 4U81A 1QMZA 4F70A 3PJCA 4C58A 3AD4A 3UYTA 2JEDA 2WU7A 4QTBA 3OW4A 5ITAA 4MXCA 4CT1A 5I3OA 2ESMA 4O7VA 2V55A 3KRRA 4PP9A 5DBXA 5DEWA 4CCUA 1GY3A 5FXQA 4RMZA 2QOQA 3SG8A 4B4LA 4F6WA 2GPHA 3SOAA 4FSUA 3LMHA 3FHRA 3DXPA 2UW4A 4OTGA 3ZS5A 1YXXA 2C6DA 3A4PA 3COMA 3MWUA 4MQ2A 2ITVA 2C3LA 2C69A 3HYHA 3PXKA 4GT4A 3TNPC 3QCQA 1V1KA 3DGKA 3DZOA 3LHJA 5AEPA 3KXHA 4AN3A 4F6SA 5IH4A 4DFXE 2OWBA 5M44A 3DAKA 4LOOA 2QC6A 3KEXA 3QKLA 3ALNA 4JBPA 5HG7A 3IO7A 3H3CA 3RNIA 3ZO4A 4ZZOA 4FUYA 5M57A 4K33A 1CKJA 4O91A 5TF9A 4BI1A 5I0BA 3SXSA 1Q8YA 4ASDA 1Q8TA 4YP8A 3TL8A 2VTJA 2PWLA 2VX0A 4LUDA 4TYGA 5L6OA 1SNXA 1UNGA 2OIBA 5E8WA 3Q5IA 5KBRA 3FMKA 4PRJA 4BCKA 2VTPA 4WD5A 5C4KA 3OCBA 4YTCA 4G31A 3C13A 4KBKA 2EXCX 4B8LA 4X3FB 1OBDA 1WVYA 1ZXEA 3NS9A 3NW5A 5LMAA 2Y8OA 3VBTA 5J7BA 3IPHA 4MD7E 4JR3A 4CYIA 5E9EA 5HCXA 3IW5A 4QMQA 3NYNA 3F3ZA 2BRMA 4JAJA 4EUTA 1YI6A 3R7UA 4UN0C 3AKJA 4AWIA 2NRUA 3RHKA 4M13A 4XV1A 2G01A 3AD5A 3G9NA 4KIOA 4OBPA 3ZHPC 2UW0A 3DTWA 1OB3A 3PY0A 4IH8A 3SLSA 2Y4IC 4OTIA 4QMSA 2PVFA 3D14A 3D4QA 5C9CA 4I5MA 1R0EA 5EHYA 4DBNA 2XNEA 4BDBA 4FG8A 3ZDIA 4UWYA 3UNJA 2RSVA 4XLIA 3TZ7A 4CLIA 2HIWA 2ITOA 5CZIA 2YIWA 3U51A 3KC3A 4MHAA 2WMRA 4ZSLA 3JVSA 2XJ2A 2CLQA 4RQKA 5E91A 4FZAB 4PTCA 4RZWA 3PIYA 3MJ1A 2KTYA 3QTWA 3HVCA 4ANLA 3DBEA 2PZIA 3DY7A 3MVJA 4O7YA 2XIRA 5KMJA 3QRTA 1UA2A 2W4OA 5I5ZA 1E9HA 3DOGA 4W9XA 5H2UA 3TT0A 2A19B 3TKUA 1GZKA 2UZTA 4FX3A 3W1FA 2JFLA 4P7EA 5E8YA 1R39A 4M0YA 4FL1A 3M11A 3A4OX 5M4CA 3BYVA 1FOTA 2GNIA 3LLTA 3P7AA 2P33A 3ORMA 2C6LA 4FTKA 3LJ1A 4QMLA 4ZJVA 3D5UA 4U6RA 1ATPE 5HQ0A 3Q2JA 3KA0A 4I0SA 2WELA 1V0PA 2O0UA 1ZYJA 3NGAA 1XH7A 5AP6A 3VW8A 3KN6A 4KRCA 2CNUA 2OW3A 1GNGA 2QOLA 3GC0A 3PTGA 1FBNA 5GINE 4TYHB 4USFA 3NUPA 3QQUA 4WBBB 2B52A 4AA4A 2RGPA 2A0CX 3PE1A 3GQIA 3GFEA 4GFOA 4PX6A 4AZFA 4CEGA 4DEDA 5EKNA 5LVOA 4D2VA 4DT9A 4S30A 3OY3A 1AQ1A 5AX3A 3EQRA 2VWUA 3A60A 3TNQB 3FMDA 4Q2AA 5HICA 3W8QA 5LXMA 3WE8A 4O0TA 5F20A 4DHIB 4L9IA 2Z7LA 3DKCA 3HMPA 2JBOA 3R9NA 3GENA 2W1HA 3LPBA 4DH1A 4O0YA 3GCVA 5DWRA 5KZ0A 1UNHA 3R1YA 4M97A 3I0OA 4GFMA 3EJ1A 4QTAA 2XAMA 2V7OA 3O2MA 4EK3A 4HGEA 1BKXA 2XRUA 4RA4A 4O7SA 1SVGA 2OU7A 4IHPA 1ZWSA 3MDYA 3ITZA 4GW8A 4QMXA 4EQCA 5CEOA 4CFVA 3TTIA 3E3BX 1WBOA 3E8DA 5CEMA 2UW6A 3IDBA 1JKTA 4RJ3A 5KHWA 1JPAA 3VUDA 4O81A 3OCGA 2Z8CA 3C4EA 1URCA 1NA7A 3VJNA 3ZYAA 1U5QA 3FY2A 2XNNA 4FKQA 3QZIA 4HYIA 5BYZA 5EW9A 3EKKA 3THBA 1FVTA 3UZRA 4YZDA 3COKA 3FSKA 3MVMA 3L8SA 5JZNA 2UZNA 3RHXA 4EOKA 3IDCA 3BRBA 5CY3A 4AZEA 2R5TA 4YJSA 5ANIA 5EDPA 4CMUA 2PUPA 5BVKA 2VAGA 4EK8A 3UZTA 5KBQA 1RDQE 4GK2A 4S31A 5IF1A 4H1MA 3VS2A 1X8BA 5BQ0A 5AJQA 3OTUA 1VYZA 4ID7A 1RQQA 4IFGA 4ZK5A 3RPRA 4RFMA 4AXFA 1GIHA 3TUCA 1MRVA 4WSQA 3HA6A 4EHVA 5I9XA 3EN9A 5ETIA 4CYJA 2G9XA 3MY0A 4CKJA 3PUPA 3NUAA 4LGDA 3VUTA 1J7LA 1S9JA 3R8PA 4DBXA 5JMSA 4I24A 4EZ7A 5F1ZA 1QPJA 4I92A 4IXPA 4DH3A 4DCEA 5D10A 5E4HA 4WRSA 1Z5MA 3R6XA 3WE4A 3NFFB 3N4VA 1OPKA 2PVRA 3QF9A 2YJRA 1MRUA 4EOIA 3P0MA 3PY3A 3EYHA 3KF7A 4BRXA 2X7OA 4BICA 3SAYA 2J6MA 2R3MA 3QWJA 5HLNA 2HY0A 4O7LA 3CCNA 2GCDA 1T46A 3N9XA 4G3DA 4OTRA 3R9DA 5C8NA 2JAMA 4C33A 5JQ8A 3FI2A 3O0GA 5DRDA 1XMLA 2LGCA 3ZM4A 4E6DA 3EQGA 3Q2MA 3NVKI 3DQWA 3QCYA 2VWVA 4QP7A 4TW9A 4O96A 3W16A 2ERZE 3PJ3A 4TKSA 2JKMA 4BR3A 5HNIX 1JKLA 4YURA 5LMBA 3R8MA 3S2PA 4EORA 2NNWB 1O6LA 4RWLA 5BMSA 3I60A 4TWOA 5HG5A 4MBJA 1YXSA 4L3LA 4R7HA 2XZSA 2CNQA 5DR2A 5A46A 1JVPP 2OZAB 1IAJA 4ZMFA 4EK4A 4NFNA 2R3HA 1SNUA 4NM5A 3GC7A 5AV4A 2C1BA 3NPCA 4XBUA 3WBLA 4F65A 2BROA 4BWPA 1PF8A 2F57A 3W2CA 2RFSA 3ZFYA 3KXZA 2UZDA 4DEGA 3R7OA 5EHOA 5H8GA 3PJ1A 3SDJA 5L2TA 4LGHA 4LRKA 4W4VA 5IA4A 4MBIA 3WF8A 3MYGA 4I21A 3DDPA 4DGMA 3TI1A 3AC3A 2P3GX 1Q4LA 2WD1A 3P7BA 3QD4A 5FWKK 4QP6A 5AADA 5D9HA 4DFNA 4O4EA 4RVTA 4F6UA 1GZNA 3RM7A 1R1WA 3ZSHA 5BV3A 4MNEB 4FSYA 3R7VA 2BR1A 3A99A 4U44A 2XBJA 3W18A 4JG6A 4RG0A 4CZTA 3ORNA 4HYSA 4WUAA 3Q6WA 5D7AA 4EQUA 5CSHA 4FTMA 1TZDA 1XWSA 3BV2A 3DKOA 2CGVA 3W10A 4TWNA 4E3CA 4O22A 3Q3BA 5M51A 5K3YA 5EQYA 4DH7A 3PSDA 2J0IA 5CWZA 3EQCA 3AC2A 4IZAA 3BYUA 1YHVA 3N4TA 2XBAA 3A8WA 5EI6A 4CRLA 3UDSA 4GH2A 4FKUA 4H3BA 4FVQA 4AOTA 3NCGA 3PJ8A 4OTFA 3GC9A 3QQGA 3UODA 3V5WA 3ZO3A 3IONA 1G8SA 2QU6A 3EKNA 2PUIA 4YC8A 3DNDA 4O4CA 3LFNA 4J1RA 4ITJA 3JUHA 1XBCA 3CP9A 3O51A 4MF1A 4U80A 3D7TA 3HUCA 2R2PA 2ZV9A 3DBDA 3T9TA 5K0XA 5JGAA 3RWPA 3BHYA 2CLXA 4IWOA 1MQBA 4CMOA 3P1AA 5HD7A 4DF3A 5EI2A 4X2NA 5DNRA 3IDPA 3QD2B 5A3XA 4FTNA 1L8TA 1LP4A 2BDJA 3ORZA 2X39A 3VUHA 5E8XA 4IC7A 3FI4A 3LLAA 4FT5A 4NL0A 1SM2A 4FYNA 3RNYA 3N51A 1PY5A 1WAKA 2I0VA 3GI3A 5HCYA 3ULIA 3ET7A 3QC4A 2HYYA 1W2CA 1XMMA 5IMEA 2QO7A 5L3AA 4JAIA 4EOOA 3DB8A 4O0RA 2YABA 4RX7A 1CM8A 4CFFA 4E4XA 3L8VA 4USEA 5L2QA 4BWXA 5FP6A 5J7HA 2IEWA 3K5VA 2IN6A 4G3FA 3VBVA 3DT1A 4A9RA 2HCKA 2XK9A 3BYMA 3MPTA 2WEIA 4NW5A 4FL3A 3JS2A 3V8SA 4O4DA 1J1CA 2H9VA 3E92A 2WMVA 2VTTA 3KULB 4O0UA 4FNYA 3V5QA 1W0XC 4GK3A 1UWHA 4M15A 3QQJA 2X9EA 5AM7A 2BKKA 4BCNA 2VWWA 2GNJA 3BU3A 3LW0A 3QTUA 2BFXA 3GCSA 4QDVA 4ARKA 2I0HA 5IUIA 5AUVA 3KY2A 1REKA 4FR4A 4CQGA 5I3RA 3TTJA 4ANQA 3QZGA 3W0NA 1V0OA 4WOVA 4DDIA 4ANSA 2C5VA 2WTVA 3LM5A 2OFVA 4CFMA 4AN2A 1OPLA 2VRXA 4QTDA 4BN1A 4W8EA 1ERKA 3FKLA 1A06A 5AUYA 1OL2A 4IVBA 3QALE 3U9NA 2VO7A 5D11A 4YPDA 4I23A 3TV6A 3DU8A 2FUMA 4O86A 2WGJA 3RCDA 3ZFMA 4D2PA 2YM6A 3W2RA 3SG9A 2WQOA 1LPUA 2HK5A 2ZMCA 3HV5A 4X2FA 1J7IA 4QMVA 2WIPA 3HV3A 3NVMB 3OEFX 5GJGA 3UMWA 3NNUA 5LVNA 5BUJA 5DG5A 1XR1A 3L8XA 4FUXA 4M3QA 4FV8A 4DLIA 2PYWA 3F5GA 3HRCA 3ZO1A 4AA5A 4E8AA 3FPMA 2H96A 3VC4A 3ZOSA 5IISA 2UW5A 2GS2A 4C7TA 5IG1A 4Q5EA 2ZFYA 1G8JA 3HMIA 2VTSA 2GNGA 2YDIA 3BZ3A 4JDIA 2HWOA 4CKRA 4MF0A 4FIJA 3RAWA 5CVHA 3U4UA 4Y73A 2PVHA 2XF0A 3QAME 5GNKA 4O84A 2G15A 1ZMWA 3HP2A 2X8IA 4U97A 2C1AA 3WF7A 3F3TA 2OKRA 4BDIA 3BYOA 4FKSA 4WA9A 3ZMMA 4II5A 3UVQA 3LCOA 1U5RA 3V5JA 3AT4A 4EK5A 2H8HA 2OLCA 1MUOA 2QOIA 4G9CA 3FC1X 4BKZA 5F9EA 4DFYA 3FI3A 4AAYA 2CKEA 3RZFA 5L4QA 2UW8A 4IWQA 4U45A 5M55A 3UZPA 3EQHA 4UB7A 4GUEA 1LEWA 4Y95A 3K3IA 2X4ZA 3A62A 4L44A 4PL5A 2QI8A 5ETFA 2UW7A 3RK7A 3FXWA 4Y83A 4GIIA 5AWMA 3JY0A 2VO6A 1H25A 3I5NA 1FVVA 4DFLA 4D4RA 4IB0A 5A4TA 3BU6A 4W8DA 4FIIA 4UMRA 3LFBA 4ZTLA 3R22A 3N4UA 4FKJA 4K8AA 4FYOA 5CTPA 2ZV8A 3OCTA 4JRNA 2PE1A 4CQEA 3RAKA 4CT2A 5C4LA 4B99A 5J87A 4FSZA 1JQHA 4TTHB 4NJ3A 1PMVA 3MH2A 3QZFA 3VQHA 5ANEA 4EHEA 4RJ8A 2GS7A 1H8FA 4ZS0A 2J0JA 4V0GB 4JRVA 2W1ZA 3CGFA 3IGOA 2P2IA 4J8NA 4RIYA 3DZQA 5JH6A 1QPDA 2X2KA 4YBKA 3Q96A 2VZ6A 4ZP5A 3ML1A 5M08A 3AKKA 3QU0A 3F2RA 1W82A 4D4YA 3W0PA 4I5HA 2GNFA 2YITA 3OT8A 5AUTA 1YXVA 3UOHA 1GIJA 1R0PA 1UWJA 5AR7A 3FLYA 3RPOA 4A4XA 4FKVA 3HMNA 4OLIA 4CMTA 3PWDA 4GMYA 2W5BA 4QPAA 1OVEA 4M67A 1I44A 4I6FA 2X9FA 3HKOA 3HP5A 4UWBA 3RP9A 2X4FA 4JIAA 3CTJA 4E20A 3RMFA 3CGOA 3FMHA 3UG2A 4PNKA 5IA0A 3R7EA 3QQLA 4KRDA 1XH9A 5FGKA 2X6EA 4YMJA 1APME 3ORTA 2VO3A 5HG9A 5B2KA 5HE3A 4CGAA 4IAYA 2YDKA 3VW6A 2PVYA 4ZIMA 1Q24A 4BWKA 4BCQA 2HW7A 4TNDA 5KNJA 3FV8A 2BRNA 4PMMA 3GP0A 4DTBA 2FGIA 4NIFA 3VBXA 2W0JA 3VS4A 3NR9A 2OJFE 3NYVA 4G34A 4P90A 4RFYA 5E1SA 4ACHA 4OAUC 4AOIA 3L9LA 3NNXA 1QPEA 3LFAA 4U79A 3U55A 1BYGA 4XG6A 3TIZA 1W2FA 3EB0A 4IWDA 4Y8DA 4UXLA 4FTCA 3BLQA 4ZY5A 3M1SA 3PZHA 4H3QA 5CI6A 2R64A 4J7BA 4EOSA 2QOBA 3L9NA 3CEKA 1AD5A 3R9RA 4IAFA 3FL4A 2OIDA 5HO7A 5A6NA 3LJ0A 4F9AA 3L1SA 2VTOA 3KGAA 3BGQA 3OD6X 4LUEA 3FKOA 4BHZA 2OO8X 4DN5A 2EXMA 3ACKA 3LOKA 2XMYA 3R30A 3PVWA 4KBCA 1FMOE 4BZDA 3ZDUA 3KVWA 4YLKA 3DPKA 4DT8A 4FGBA 1U46A 4MQ1A 4NEUA 5EK7A 3WF5A 4AE9A 4G16A 3DK6A 1FPUA 4FZFB 2VGOA 4PV0A 1ZOGA 2XKFA 2B9IA 5GIOE 1DS5A 5CSWA 5K9IA 3V8WA 3GNIB 2R3JA 3V5LA 2BAQA 4HYHA 4ZTNA 1J1BA 3ZFXA 3UDBA 4G3GA 3ZSIA 2BILB 4BTJA 5J5TA 2PMOX 4N57A 4BB4A 2PVLA 3QD3A 4D0XA 3CS9A 3WIGA 3KF4A 5HEZA 3CPCA 3EN7A 1UU8A 3Q4CA 3R7GA 4OTPA 4PDOA 4C36A 4E5AX 3ZBXA 3QRKA 2XNMA 4CG9A 4AA0A 1H00A 5EDQA 4DG0E 3CSVA 4GT3A 3PXYA 2JIIA 4E4MA 4R5YA 3SHEA 3LFFA 3PXRA 2ITZA 3BWJA 4GJ2A 2Z60A 3ZEWA 1OKWA 4NZWB 5FBNC 5IQDA 1GOLA 2DQ7X 4AXAA 5IMXA 3V3VA 3HLLA 4ZY6A 4NIFB 5CS6A 4K6ZA 4RVKA 4CNHA 4M69A 2XNBA 4QTEA 3ZLXA 4AW5A 4PDPA 4ZLOA 2Q0BA 3P78A 1P14A 4BCIA 4O21A 1LR4A 4Y5QA 3W2SA 2R3FA 2PZPA 2J9MA 2JDTA 5E8TA 4HYUA 1DI8A 4ASEA 2I6LA 4DEHA 1PXKA 1Q3DA 3DQXA 4J52A 4QPSA 3R8ZA 4ACMA 5M07A 1YOLA 2J0LA 3C0IA 4EYJA 1ZAOA 4U40A 1CKPA 3AD6A 4GG5A 3F66A 3QZHA 3BHVA 3QLGA 5DR9A 5LMKC 1K9AA 2XYNA 2Z2WA 1IASA 3QGWA 2V7AA 4RIXA 4XHKB 4YC6A 2AUHA 2YIXA 4PPBA 5FXSA 3RK5A 4DH8A 3A61A 1PXOA 2R3IA 3BQRA 4QP8A 2Y6MA 4F99A 5KZIA 1NVRA 4EWQA 5HIDA 1G8AA 4DEIA 3OUNB 5HLWA 2HWPA 3EQBA 3R01A 4FMQA 3OWJA 5CYIA 3DFAA 5AP4A 2NRYA 2J51A 2BFYA 4IDVA 2WQNA 2EB2A 4GFGA 4HZSA 4S32A 5BVEA 2NPQA 3MFSA 4Z16A 1HCKA 4BCPA 5DFPA 4FTUA 1KE6A 4RPVA 5CQUA 4LV7A 1JOWB 2GTMA 2NP8A 3DAEA 3OS3A 4WNKA 4C3RA 3DFCB 4AACA 2YWVA 5CU3A 2P55A 3PVUA 3NRMA 4ZJJA 3IECA 3GU4A 3OT3A 5HOAA 1W83A 4RQVA 3EQFA 4EBVA 4LM5A 4X21A 2OF2A 1M7QA 2QKRA 3OWPA 4YGAA 4D55A 4N6YA 5KUPA 2GQGA 4M7IA 3RALA 2YACA 5EM7A 3LFDA 5D1JA 4B0GA 4EZ3A 4AP7A 3UDZA 4MVFA 4ZTSA 2XB7A 3F7WA 3R02A 4FT9A 4LYNA 4DYMA 2VTNA 3Q52A 2UUEA 2JDRA 4TNBA 4YNEA 4C59A 2R0UA 3AMBA 5CSPA 3PWYA 2KULA 4I5PA 3Q4UA 4XCUA 4YJOA 2E9UA 3SRVA 4L7SA 5GZ8A 4O7TA 3GXLA 1V0BA 2YIRA 4TWPA 4L52A 5IA5A 3I4BA 3ZEPA 2F7XE 3PA3A 4XS2A 2G2HA 3P86A 3DDQA 2JFMA 4NCTA 5HORA 1M52A 3R8UA 3VS1A 4LOQA 4NWMA 4AOJA 5CAPA 3NEWA 1RJBA 5C8MA 2PTKA 4ERWA 3MH1A 2IF8A 5DA3A 4BL1A 1AGWA 3CBLA 5C27A 3TJDA 2QO2A 4ZTRA 2YM8A 3Q9XA 3VRZA 2F9GA 4DTAA 3VS6A 3CLYA 2RG5A 4KNBA 4RJ7A 5AP0A 1YDTE 4IB5A 5T3QA 2FSTX 4GRBA 3PP1A 5CF4A 2YM3A 4RIWA 3PVGA 2X6DA 3FZSA 1SVEA 5IDPA 4JXFA 3QHWA 4F9WA 3KMMA 4YO4A 4LV8A 4RFZA 5EI8A 1P4OA 1REJA 3KN5A 5CLPA 4UALA 1Q41A 3B2TA 4Z55A 1LUFA 4FOBA 3EZVA 5M4UA 2O64A 3O7LD 1YOJA 2QKWB 4RC2A 4EOLA 3QTRA 2WTJA 4BDKA 4NM7A 4AFJA 3MY5A 3F5XA 3NUNA 3VUIA 4GVJA 3RTPA 1O6KA 2CCIA 3LCSA 2LAVA 5M09A 3DNEA 3KCFA 2ITNA 4C4HA 3OFMA 5IA3A 2YWPA 3NMUF 3MFUA 1H1WA 4ZSAA 4JMQA 3QQHA 4FNXA 4GT5A 4GKIA 3VO3A 3U6IA 2E9NA 4O82A 3UO5A 4O6EA 4FKLA 2F2CB 5AR4A 3BV3A 3PG3A 3AG9A 4FV5A 2A98A 5JFXA 4K1BA 3ZLSA 4XBRA 3LQ8A 4H05A 4FG7A 2FVDA 4XNEA 4F1OA 1M2RA 2C6KA 2PK9A 4NK9A 3W0RA 1S9IA 3TEIA 3LQ5A 1IA8A 3P23A 4P2KA 3GCUA 3SRVB 3G51A 3ANQA 4DEEA 4FNWA 2AYPA 5DGZA 3PIZA 5DLSA 1TQIA 2C0OA 5GHVA 3R8LA 3UE4A 2PMLX 3VUKA 4C37A 2EB3A 4E6CA 5HIBA 5LMKA 2RKUA 3NCZA 4I0RA 4TL0A 4EZ5A 4GV1A 1A48A 4ZOGA 2CNVA 3OWLA 4I6QA 3UGCA 5E7RA 3L9MA 4K9YA 3EWHA 5ANOA 4Q9ZA 4YZMA 1MP8A 5H8EA 3JPVA 4GK4A 4DEAA 4FTJA 3ORKA 1M17A 4OW8A 4IAZA 2WQEA 2YCQA 2F4JA 2PVMA 5AIKA 3D2IA 4PPAA 2R3OA 4BTKA 4YSJA 1H4LA 3R1QA 4QMPA 4OT6A 3NYOA 2Y0AA 3EL7A 4B7TA 4QMYA 3KIOC 2JD5A 1NVSA 2XNOA 1MQ4A 3UPXA 4D2WA 4XG4A 2E9PA 3VVHA 3BU5A 4CSVA 5B2MA 5AR3A 4XG7A 1OKYA 2FB8A 4YBJA 4BGQA 2VO0A 4FKWA 4FK6A 4H3PA 4L3JA 1OKZA 5AP1A 2UV2A 2BUJA 4FZ6A 4H58A 3S0OA 5AP7A 3Q9YA 3TNWA 4RJ5A 3F2AA 3H4JA 2OK1A 4RWJA 1OM1A 3KMWA 3C5IA 5BPYA 2WXVA 4FV2A 3JR1A 4F9BA 5B2LA 2B54A 5HVJA 2CHLA 2V62A 4MTAA 3OZ6A 1XH8A 3FQHA 4EWHA 3PA5A 3EN6A 4LRJA 5JKGA 4HCUA 1ZOEA 1O6YA 4YU2A 2IVVA 2UVXA 2BZIB 3SW4A 5K5XA 2CGXA 4G5PA 4IW0A 4DTKA 2XANA 2W4JA 4GIHA 2QR7A 1XH6A 4H36A 3ZRMA 1ZYLA 5HO8A 2C68A 4LV5A 3H9OA 1DAWA 4FEWA 3PYYA 4JVGA 4XG2A 3AGMA 2CGUA 3PA4A 3QXOA 3R28A 4QO9A 3ENMA 3FLZA 4DA5A 4BCGA 4E4LA 3F7ZA 4KUJA 1KE8A 2WKMA 4Y85A 5EHLA 3ZONA 3QUPA 4FKRA 4OTQA 4HVGA 2X7GA 3AXWA 3DXQA 1J7UA 5BX0A 3TKHA 3PE2A 4L42A 5C01A