2W5BA

Human nek2 kinase atpgammas-bound
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
277
structure length
271
Chain Sequence
SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title Insights Into the Conformational Variability and Regulation of Human Nek2 Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 271
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2w5bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2w5bA01
4O22A 3E92A 4HGTA 4J97A 4BHZA 4G3FA 1ZY4A 5HEZA 3V3VA 2I0HA 1GZNA 1T45A 3KXXA 2EB3A 2EXMA 4B7TA 5EKNA 5BQ0A 2KTYA 5A6NA 1H1WA 1WAKA 5FD2A 3MBLA 2Q0BA 2J0LA 2Y4IB 1PKDA 4FV4A 1ZMUA 4JDJA 3IO7A 4NSTA 2XIRA 4AE9A 2SRCA 2XH5A 4FKWA 2QG7A 3PYYA 4X6RA 3O8UA 3AMAA 3MW1A 2VTRA 3OBJA 3ATTA 4K18A 1Q8WA 3PVGA 4I4FA 4S34A 4XJ0A 1PRYA 1YI6A 2YIXA 2QOCA 3DQWA 3FZSA 2Z7SA 5IQDA 3HYHA 4KA3A 3CBLA 3G6GA 4DFBA 3GI3A 5AV3A 3PUPA 2RGPA 5L8LA 2XKEA 1JPAA 4C57A 2W9FB 3NYXA 3FLYA 3NRMA 3AC8A 4YBJA 5FM2A 3MPMA 4N4SA 3ZLXA 3A99A 5CENA 2OIQA 4HVSA 3ANQA 5A4EA 5HI2A 5CAUA 2O65A 2VX1A 4CGAA 2VWVA 3GVUA 2OW3A 4ZTRA 5AEPA 2QOIA 3DJ7A 4EZ5A 4AP7A 3Q9YA 3CJFA 3OEFX 4BGGA 1IA9A 4D4YA 3O8PA 3W1FA 5JZNA 4EH3A 2ZDUA 3KA0A 5AM6A 3GCUA 4FIGA 4WBOA 3D5UA 4FV0A 5HIDA 4IAFA 1S9JA 3FPQA 3RWPA 4BCIA 1G8SA 3PE2A 1ZLTA 4FIIA 5HKMA 4DG0E 4ERKA 3HUCA 3TEIA 4DF3A 4FEUA 5D7AA 4C37A 2VGOA 5CEQA 1YOMA 3KK9A 3ZXTA 3E3PA 3NGAA 3DK7A 4XOYA 2ITNA 3FKNA 4O0SA 4YTCA 1ZRZA 4H05A 2G2HA 1DI8A 3MWUA 4ALUA 3MGYA 4TYHB 4CCBA 5TR6A 3E8DA 2XZSA 3D9VA 4G6NA 5F9EA 4LM5A 5CNNA 4BDBA 2ZAZA 3FI3A 1HCKA 3OS3A 3P79A 3Q60A 3PVBA 4FTAA 3RZFA 3UYSA 5LCKA 4K8AA 5AUYA 3G5DA 1B38A 3OMVA 4GJ2A 4NCTC 2XJ2A 4I5MA 5TOZA 4DBXA 3AG9A 1W8CA 2HW7A 4LV8A 5IH6A 4AOJA 1IG1A 4M15A 3W2CA 3V8TA 4O86A 1ZAOA 2VWXA 2PZYA 4BC6A 1M17A 4I94A 1NY3A 4QYEA 4KRDA 4L9IA 4BDFA 3SV0A 4FV5A 3AMYA 4IW0A 4AFEA 5HD4A 4MH7A 4J98A 3BELA 2CGWA 5DR2A 2X2LA 2DWBA 4O81A 3DKCA 2PYWA 3KRRA 3HUBA 2RSVA 3LFSA 2XVDA 4D9TA 4NK9A 3DFCB 4C59A 4QP2A 4QMVA 4ZTLA 4WIHA 3VBWA 4APCA 4J1RA 5M56A 2DYLA 5AUWA 4BWXA 2C68A 4HOKA 3ORNA 4D2WA 4G3GA 3VW6A 2BRGA 1R39A 4HVGA 2R3KA 3QGWA 3PE1A 5AV1A 4BVUA 1CM8A 1U5QA 3Q53A 5IEYA 1Q99A 5CZIA 3C0IA 3FLNC 4I1ZA 4ZY4A 4F6WA 4FKSA 5DRBA 4JOAA 3H0YA 3SLSA 4D9UA 2C69A 2EB2A 5E9EA 2YABA 4JBOA 2CPKE 2QLQA 5F94A 1J1CA 1H24A 1SVEA 3LJ0A 4M8TA 4PRJA 3I6WA 4NT4A 1PXNA 3WF8A 4IAIA 5KO1A 5C4LA 1OKVA 3CTHA 2OIDA 5AX9A 4HCTA 4M66A 3R7VA 4CXAA 2C47A 2PU8A 3O7LD 3QKLA 3FZ1A 5EFQA 2UW9A 3NVMB 1YDRE 2P55A 2UZBA 1UNGA 1U4DA 3FL5A 4DLIA 5DH3A 3IOPA 3PRFA 4YJTA 5T3QA 2UV2A 2BDJA 5ACBC 3UQCA 2C1AA 3WIKA 3DK3A 3LCKA 4RMZA 4W4WA 4LUEA 3TACA 5EHOA 4DEAA 2F49A 4I41A 3R22A 5HG5A 3KF7A 4ZIMA 3VF9A 3G9NA 1WCCA 5KZIA 3HV3A 2YIWA 2FSLX 3CTJA 3WYXA 4BCFA 5DGZA 4O7LA 4TWOA 3OZ6A 4LOQA 2PVKA 3SGCA 4RZVA 4F7JA 2X39A 5K9IA 3OXTA 3BV2A 4MXOA 5IF1A 2BAJA 2IVUA 5FUTA 2R4BA 4DGGA 3A4PA 2WMVA 3ZO3A 3CQUA 3AC3A 3NNUA 3UP7A 3T9TA 3BE9A 4MWHA 3K5VA 5HLNA 2CGUA 5AUZA 2ZJWA 2CKQA 4E5BA 2QODA 3ZM4A 5CU3A 2QR7A 2F9GA 3A8WA 3IS5A 4HVDA 2WGJA 4NWMA 3QD3A 2YFXA 3TV4A 1OL5A 3QCXA 5KE0A 1OL1A 4ACHA 2HXLA 1NXKA 5E8YA 2IVVA 3TNIA 4DFNA 4GVAA 4WNOA 1J7IA 5BVDA 4D58A 3R9RA 5I9ZA 2OKRA 3UNJA 2YIYA 3VRYA 3LKMA 3BYMA 2BHHA 3PLSA 4O1PA 3HV6A 4JQEA 5E90A 5FRIA 2HWPA 2GNHA 2ZV9A 2ITQA 3PXZA 4FTNA 4FE2A 2X0GA 3KEXA 1R0EA 3FQSA 4L7FA 1P5EA 2PULA 4PTCA 1UNHA 4Y46A 4FT9A 5C01A 5K5NA 3OTUA 3LJ2A 2VTMA 3U4UA 3DKFA 4EUTA 4BCPA 1M2PA 2XKDA 3ZBXA 2GPHA 2C6EA 4IWOA 2J2IB 3NCGA 1YVJA 2WMWA 1R3CA 3FMNA 5AA8A 4N57A 2XEZA 4MF1A 1CMKE 3DXNA 4FKUA 4LUDA 1IRKA 1H27A 3CKWA 1QCFA 3KMMA 4QP1A 3U6HA 3KN6A 3ORTA 3ZSHA 3RGFA 5CEKA 4TYEA 3V8WA 3RAWA 4BZOA 3AT4A 3BRBA 2YN8A 3POZA 5AP3A 5B2KA 2OXYA 5CQWA 5C03A 4AE6A 1WVYA 2GS7A 4BI0A 1LUFA 4YJNA 4FZDB 4DE4A 1BI8A 3GCVA 3VUMA 4E4LA 5ANJA 2C0OA 4FV3A 3JS2A 4QTCA 3RAIA 1JLUE 3SRVB 4B6LA 2I0EA 3KXNA 3Q6WA 3HGKA 3JVRA 4HNIA 4LOPA 3UJGA 5FDPA 2BIYA 4MVFA 5GZ8A 2CNQA 3PVWA 5J9YA 1RE8A 3EYGA 4WNMA 3SC1A 5CAQA 3MTLA 3VJOA 4R3RA 5AV4A 2RF9A 1FGIA 4TT7A 3KKVA 2WFYA 3QX2A 5FGKA 3VQUA 2A19B 3RPYA 3UOKA 2WQEA 5LJJA 5AM7A 1GIIA 4DH7A 2FB8A 4NL0A 5DBXA 3DNDA 4BFMA 2IZTA 2WOTA 3FDNA 4KIKA 3VO3A 2GSFA 5HO7A 4L44A 4QPSA 4EK8A 1ZARA 4AW2A 1KWPA 3EIDA 4FX3A 5FTOA 4MX9A 3VWAA 4HYHA 2GCDA 4FV9A 3HV7A 1G3NA 5DA3A 4B4LA 1PF8A 4EOJA 4NZWB 4ITJA 4QYGA 1RJBA 4RQKA 1H00A 1U54A 2V22A 3MTFA 4L00A 3UPXA 5BVFA 3ACKA 3ZS5A 4ZTNA 1M7QA 3R8PA 3DT1A 3CR0A 3RCDA 4AUAA 2RKUA 3OEZA 5T68A 3Q5IA 3C5UA 1M14A 2W1CA 3IECA 3KF4A 3RAKA 3WIGA 4RC2A 4PMSA 3R8VA 3VUGA 4ALWA 3NUNA 4PDOA 4WRGA 5EQEA 5D41A 2X7OA 1SMHA 3A7FA 3ZEWA 3R1SA 3E7OA 4AT4A 1Q8ZA 1OPLA 3EKNA 4I24A 2QC6A 3TCPA 5JRSA 1YWNA 4FSQA 3D5WA 4FICA 3QTXA 3LMGA 5ANDA 2OH0E 4L67A 2JKOA 3DNEA 5JRQA 4D55A 1BMKA 4CYIA 2W0JA 2BVAA 2R3RA 3HECA 4GMYA 5KX8A 3AD4A 2QOLA 3COKA 4WG5A 4FT0A 2OI4X 4BKZA 3GBZA 4F63A 4TTHB 3LAUA 4Q5HA 3IW6A 4CV8A 1NVQA 3RNIA 4BKYA 2EXEA 1NVSA 3QFVA 5K4IA 3WF5A 3O96A 1R78A 5EYKA 2Q0NA 4GJ3A 4EK4A 3ZEPA 3FMKA 3BYUA 3AQVA 4FIFA 4FSRA 2C0TA 4BCJA 4FI1A 2FH9A 2GS2A 3RAHA 3WE4A 4CFFA 3LFAA 4QPAA 4BTMA 1J91A 3NW5A 2QLUA 2XK3A 3O2MA 2XA4A 5ETIA 4O7RA 2VV9A 3EN5A 4DFYA 4ZJIA 3GFEA 3T8OA 3CC6A 1YDTE 4DGMA 4U7ZA 2OK1A 3HVCA 3BU6A 4G16A 1GZ8A 3PPKA 4DCAA 5CSXA 4X2FA 4F4PA 4ITHA 4RFZA 4AW0A 4PV0A 1JKLA 4BTFA 4RIYA 3TZ8A 4PX6A 4E73A 2WHBA 2WMXA 2PUNA 4N0SA 3NWWA 5E92A 2Z7LA 5AX3A 4RX7A 4G5PA 2F7ZE 4FV8A 4L42A 2QHMA 4RC3A 5ANIA 3F7ZA 1YOJA 5JN2A 4KABA 4BBEA 1FMOE 5J9ZA 5AIRA 4HYIA 5K0XA 4V05A 4XHKB 4GG5A 1KE8A 3F61A 3UZTA 5J95A 4ANOA 3FYKX 4XMOA 2PE2A 5A4LA 4D2TA 2XIXA 3HAMA 4XG6A 4ALVA 3V5JA 4CFNA 1B39A 5HE0A 4KKGA 2UW6A 2FGIA 3KRJA 5D12A 1YI4A 5L3AA 2OG8A 3NNVA 4D2RA 3L9PA 4LI5A 3EB0A 4LFIA 4DEHA 3I5NA 1SVHA 5CXZA 4IVBA 3RK7A 5FQDC 3ZTXA 3HRCA 4E3CA 2ZM3A 4O7WA 4EHZA 5FP5A 2UZUE 3QUPA 1TQPA 3HA6A 4NIFB 5CU0A 4C4FA 4DTAA 2X8IA 4Y83A 4YPDA 2Z02A 4BF2A 3C4WA 3ZONA 1OZ1A 4S31A 3BZ3A 2YDKA 4I5HA 3HNGA 1Q3WA 1FMKA 2R7IA 3GQIA 4FKGA 4I5CA 2PSQA 4IFGA 1J3HA 4ONAA 4LQMA 4EKLA 3NCZA 2YWVA 2Y7JA 3LMIA 5DR6A 3TUBA 2C6LA 3Q96A 3R7OA 3DCVA 2XEYA 3BGQA 2YM4A 2ETMA 4FMQA 4JS8A 3F5GA 1YOLA 4CLJA 5HU3A 3R8UA 2YLEA 4HCUA 3FZRA 4P4CA 4UXLA 3GOKA 4NFMA 3Q9XA 4BHNA 2QOOA 2OJIA 4NM5A 2J7TA 3QTZA 4H3PA 4IQ6A 4RFMA 4EYMA 1VZOA 1KUTA 3MFTA 4QYHA 4BDJA 3GQLA 4O7SA 4FNZA 2RFDA 4M12A 3R00A 4XV3A 4QP7A 5E8VA 4F6SA 5KCVA 3QYWA 4FNXA 3QLFA 2VO7A 4AGUA 4F0GA 4Z16A 2CNVA 3N4TA 4CYJA 4G1WA 4U3YA 2VTLA 4QMXA 4UBAA 5EKOA 3C4EA 3CIKA 3R9HA 4BRXA 3VJNA 4OBQA 5L6PA 3EZRA 4TYGA 4AF3A 5B7VA 4U97A 4FOBA 5FXSA 4E4MA 5JMSA 3ATSA 2JC6A 2WMBA 1WBVA 3C0GA 1H1SA 3L9LA 5M51A 3E88A 2I0YA 3UIXA 1PXKA 2E2BA 2JIIA 3L9MA 4KIKB 4UWYA 3QD4A 5LVLA 5HORA 3II5A 4L46A 3LLAA 4IIRA 4JBPA 2XIZA 3W2PA 4LRKA 1OIRA 5KBQA 3IK3A 4LMNA 5EDRA 2V5QA 4DH1A 3SXRA 5AP0A 1U54B 4Y73A 3MFSA 5M57A 2A1AB 4EZ3A 4W9WA 4OR5A 4BIDA 3H0ZA 4Y5HA 4DGLC 1Q8YA 5JFVA 4IZ7A 3K3IA 4AZFA 4RSSA 2C3LA 4RIWA 2F2CB 2GNJA 3D7TB 3R04A 4H3QA 4U0IA 3T3UA 3SVVA 3TDWA 5EH0A 4ZY6A 3HL7A 3RHKA 4AZTA 2HW6A 4JG8A 4YC8A 4KB8A 4CT1A 3H9FA 2BMCA 4FSYA 5EOLA 5IQHA 4EZ7A 3UGCA 4YJSA 4YNEA 5CEIA 2BFXA 2PWLA 4RGJA 3K5UA 3KVWA 5J5SA 2C3KA 3BHUA 3HMIA 1GIHA 3PZHA 5HCZA 5LVPA 4GIIA 4QP3A 5JFSA 3DK6A 3OY3A 4I22A 5G1XA 2R3OA 2NRUA 3QF9A 1OIUA 1KOAA 3PJ8A 2XK4A 2IW8A 3F3VA 4IM2A 3RHXA 5KMMA 4IEBA 3QXOA 4AOTA 4YBKA 3G90X 4Y95A 3MYGA 2W4OA 3D83A 2IO6A 3DB6A 4IX4A 5CQUA 1DAWA 2WMAA 3D2KA 3LVPA 2C5VA 3ZLWA 3FMJA 3MVLA 4KINA 2WIPA 3DDQA 4IB0A 2ETRA 3CD8A 4IB3A 3SX9A 5TF9A 4BCHA 3COIA 2IN6A 3TIZA 2WTCA 4OTQA 5E7RA 5H3QA 3RK9A 5CI7A 4XLVA 5EI6A 4PDYA 5IA5A 3LM0A 1K3AA 1PXMA 3AD6A 3FLWA 4BDKA 4TNBA 4K11A 3W16A 4FSMA 3BE2A 4I0RA 4GSBA 4KWPA 1Q24A 3R7UA 3TDVA 4UZHA 4BL1A 4W9XA 3OBGA 1URWA 3VRZA 5FXRA 2WB8A 4RWIA 2UW4A 3PIYA 5CSVA 3WI6A 4PNKA 5IZFA 3O71A 4RWLA 4ACMA 4U42A 3TJCA 2RG6A 2XNOA 4GFGA 3F69A 4LV5A 3ZDUA 4FL2A 4CD0A 1DAYA 3R83A 2O3PA 5EYDA 4MXZA 2R3FA 2P2IA 1CTPE 3OF0A 5IQCA 2RFNA 2PMOX 2X8EA 4IZ5A 4X2NA 4O0RA 3VUDA 4BIBA 2IW9A 1XH7A 2ESMA 2V55A 5E4HA 2JFLA 3BYVA 2JKMA 2E9VA 5DG5A 1WBSA 3MH1A 3I7CA 3H9RA 4ZEGA 3TKUA 4KS8A 4I6BA 2GDOA 2J51A 5A4QA 4XG7A 4H1JA 3PRIA 4UALA 5CEPA 4L43A 2VNYA 4XV2A 3QRUA 1LP4A 3BIZA 4ACGA 4DG2E 3U55A 2ZV8A 4PMTA 4DFZE 4JQ7A 5J5TA 5FBOA 4EOLA 2WQOA 1Y8YA 2R3JA 3PXQA 4BKJA 1VYWA 3PWYA 3VF8A 4UMPA 4II5A 4YTHA 5IISA 2XNNA 2QU6A 2Y9QA 4QRCA 4QYYA 2YA9A 5FM3A 5DRDA 4C2VA 3VNTA 4O7TA 4FKQA 4X0MA 5HVYA 3H3CA 5H8EA 3DXPA 2PUUA 3S3IA 4AOIA 4HYSA 3AT2A 4CFVA 3SG8A 4C34A 2UW5A 3RK5A 3VIDA 3QQJA 2YM8A 3ULIA 1E1XA 4YO4A 3HKOA 2BRHA 1IEPA 4IE9A 2YLFA 3F66A 5L2TA 2C6TA 4O7ZA 2B54A 4MXYA 4FEXA 3OFMA 4QTDA 5FP6A 3N51A 4R78A 2JIUA 5J9LA 2PE0A 4GS6A 2YISA 4KAOA 4OTHA 2V0DA 4PY1A 5A3XA 3KC3A 3LM5A 1MRYA 4QP6A 2ITOA 3VHKA 2FYSA 3PJ2A 3DLZA 4QOXA 5IQIA 4BCQA 2B55A 3ET7A 3GC8A 3QGYA 1VYZA 5BMMA 2HK5A 3TKHA 3A4OX 3CY2A 3FWQA 5LWMA 3C4CA 3FLSA 2YM3A 1JVPP 4L3LA 4DEDA 2XKCA 1SM2A 3FAAA 4KRCA 4EK6A 3P1AA 2BDWA 1BI7A 4ZSJA 5BVKA 4O6LA 4EHGA 3F82A 3KULB 3TWJA 3V6RA 3R6XA 1WBPA 5EI2A 3NNXA 3UMWA 4D2SA 1UU7A 4AT5A 1WBWA 4U44A 3BV3A 3R9DA 4RX5A 3K54A 2I0VA 2WTWA 3TNHA 4FKOA 3ZRMA 2OF2A 3I6UA 4RA5A 5CF5A 3QALE 1PYXA 3ORMA 2BTRA 2R3NA 2VTTA 2IPXA 3D14A 5DEWA 2BKZA 3OCBA 5IEVA 1QMZA 1PXOA 2ZMDA 2ERZE 4JDIA 5E8SA 5M4UA 2OBJA 2XNMA 1GJOA 3IPHA 1OGUA 2Z8CA 3KB7A 4IB1A 5M55A 4PWNA 4JDHA 4A9YA 1SNXA 4EOQA 3P4KA 4XH6A 4MWIA 3SG9A 1CDKA 4C02A 4WBBB 1FVRA 4XP3A 3Q2JA 4BIEA 2WO6A 3B2WA 4RZWA 3ZOSA 2IG7A 5CAOA 5JGDA 4ZLZA 3QQUA 1FPUA 2CGVA 3EQGA 5EDQA 4XYFA 3PVUA 3LMHA 3THBA 3SA0A 3UG2A 2GQGA 3V51A 5E8TA 3KY2A 4RIWB 2X9EA 2VTAA 1PY5A 3D0EA 4JG6A 1PJKA 4PL3A 1YXVA 5BYLA 3QQLA 4M67A 4WG3A 4EOOA 3PXKA 4ZS4A 3ULZA 3ZO1A 1YXXA 3UTOA 1XR1A 1H01A 4OTRA 4EI4A 3ACJA 2BZJA 1H28A 4GT3A 3OROA 4MKCA 4RVTA 4ZMFA 3R28A 3PG1A 3QKMA 4FSTA 5DI1A 1PMEA 3FPMA 5GIPE 2VU3A 2WAJA 3RMFA 4V01A 2G01A 4MXAA 4FGBA 4U8ZA 4JVGA 3PXRA 5K0KA 3PPZA 3QC9A 2YDIA 4HPTE 1ZWSA 2QVSE 5E8WA 2X8DA 3FY2A 3GC7A 5IUGA 5KHXA 3V01A 2BHEA 4YJOA 3SRVA 4ASEA 3UZRA 3CQWA 3F3TA 3OXIA 4EWQA 3IDPA 4FNWA 4ID7A 2QONA 3LFDA 3A7IA 4OT5A 3BPRA 4RVLA 2F2UA 4AA0A 5B2LA 4M97A 2BAQA 2BILB 2W4KA 2WMQA 5HBEA 4CSVA 2OH4A 2PVLA 3W55A 4X3FA 4BGQA 3QTRA 3JXWA 4O96A 5CXHA 5BYZA 5M4IA 3IG7A 3BU5A 3G33A 3PPJA 2UUEA 4FZFB 3IQ7A 3NUSA 4YZNA 5L8JA 2B4SB 2YWPA 5DT0A 2B9HA 4MAOA 3LCTA 3LJ1A 3A7HA 4RBLA 4ENXA 4NEUA 2VO0A 4GK2A 5HVKA 5HESA 2GTNA 3F2AA 2QURA 4WSYA 2R3IA 1NT2A 4XNEA 4NM7A 3HDMA 3LXLA 3CS9A 1O6KA 1M2RA 2GU8A 4YP8A 5J79A 5KKRC 3V8SA 2Y6OA 4G17A 2BIKB 4V0GB 2GNIA 4O2ZA 5HE1A 2G2IA 4YHJA 2VAGA 3SQQA 2PTKA 4H58A 1OIYA 5A4CA 1ZY5A 3LCDA 1ZOGA 2XF0A 1I09A 3CQEA 4ZTHA 4EH2A 1MQBA 3HMOA 3O7LB 4JR7A 4FOCA 4NTTA 3HLLA 5F4NA 4ZJVA 3ZMMA 4KUJA 3LFFA 3AGLA 4YJPA 3JR1A 4FZ6A 2XS0A 3A62A 1VJYA 4MBJA 2HY0A 5LMBA 2VWYA 3FZTA 2WMUA 4CMOA 4E8AA 1Q41A 4RWJA 4NM0A 1XBBA 5HG8A 2W06A 3ETAA 4ZMEA 3EKKA 2W5BA 5TT7A 2YEXA 4KKEA 4BDDA 3NYOA 4M69A 2P33A 4TWNA 1SVGA 2IVTA 3ENMA 4A4LA 1OL2A 4EWHA 4L52A 5KMLA 5IQFA 1U59A 5D7VA 2HYYA 2BKKA 1UKHA 4IJPA 3K3JA 4IVAA 5CT7A 4ZTSA 3REPA 4DFXE 2YM6A 3UG1A 5DR9A 3NAYA 3RPOA 4ACCA 1Q8UA 4AT3A 1APME 2ZB0A 2J0JA 4KIOA 3MH0A 4G6LA 5EHLA 4YJVA 3DQXA 3KRWA 4I4EA 2VX0A 4CRSA 4P2KA 4E20A 2W4JA 4LL5A 3I81A 3QQGA 4TWPA 3FZOA 3VBVA 1Q61A 5J8IA 3QC4A 2J4ZA 1Z57A 3ORIA 4F0FA 3LW0A 2WMTA 2ITTA 3PA4A 3QWKA 4K33A 4U3ZA 5M4CA 3TKIA 1A48A 4GKIA 4Z3VA 5HQ0A 5M53A 4DA5A 3UVRA 2BUJA 3OVVA 4U40A 5CAVA 4CG8A 3Q6UA 2UZEA 5CTPA 3E8CA 4RJ5A 5M4FA 2VTOA 4ASXA 3KU2A 4ZS0A 3S0OA 2W1IA 4ZTQA 3RPSA 4AACA 5CU2A 4PPAA 4KKHA 2CLQA 4FZ7A 3GU5A 4IAAA 2E9UA 3C5IA 1Y91A 4U81A 3RKBA 4DT9A 4FK3A 4MBLA 4D1SA 3O17A 4CRLA 3P78A 2R3LA 3AC1A 3F5XA 2IZRA 3FSKA 4IZYA 5B2MA 2WNTA 2WU6A 3LIJA 1MP8A 4AAAA 2H6DA 4F7NA 2C6KA 4WA9A 5LCJA 1OECA 4QMLA 4C36A 3H4JA 2J0MB 3EQPA 4IVCA 4F09A 3DZQA 3ZFXA 4OLIA 3G0EA 3OWLA 4GIHA 3SKCA 3DJ6A 3HDNA 2HELA 3QA8A 2XJ1A 2RG5A 4X2JA 3P7BA 1DS5A 2J6MA 3U8WA 4IBMA 4C4JA 2HCKA 4FSUA 3ZUVA 2GNGA 2JGZA 3NUPA 2A27A 5AR8A 4RQVA 3FLZA 1GZKA 2CN8A 3FXZA 1YHVA 4FT7A 5CEOA 5IMXA 2Y4IC 5B0XA 1LEWA 1SZMA 5EK7A 5CSHA 5CLPA 4M0YA 4PQNA 2BZHB 2ZOQA 5FWKK 3RM7A 4NIFA 3EN6A 4LGHA 5IMEA 4C3FA 2H8HA 1CKJA 2B9IA 3E7VA 3ROYA 2GHMA 2BALA 2PVFA 4WT6A 3NLBA 4Q5EA 3WF7A 1KE6A 4A9TA 3DBQA 5LVMA 3UPZA 4ZP5A 3O8TA 1Q3DA 2JKQA 4UEUA 3GU6A 5DYJA 1OKYA 3EQHA 2WTDA 1QPJA 3R7EA 4FKTA 2WQMA 3BX5A 3TI1A 3FHRA 1TQIA 3G0FA 4DITA 4ITIA 3O23A 3KL8A 2JIVA 3GT8A 3ITZA 5ITAA 5LOHA 3GFWA 4NW5A 4TZRA 3QAME 4FEQA 1G5SA 3EQDA 3W32A 4C3RA 1I44A 4JL9A 3TUDA 3RNYA 4GKHA 3D5XA 2XNGA 1K9AA 2IZUA 3QCQA 4PPCA 3PDTA 1EH4A 5CZHA 2XYNA 4FV7A 5ANGA 1XH6A 3NW6A 4H39A 3D15A 4ASDA 1Q4LA 4FVPA 1WBOA 2YM7A 5IG1A 4HNFA 5FXQA 1H8FA 4X3FB 3C0HA 2WIHA 3TXOA 4ENYA 1WBNA 4E1ZA 5M07A 3PA3A 3F9NA 4A4OA 5KMJA 3DS6A 4B8LA 4E93A 3FC2A 4JLCA 4XG9A 2NPQA 4F9AA 4Q2AA 4MYGA 2CLXA 3QRIA 3AGMA 2C6MA 2XCHA 4XLIA 3FQHA 2GNLA 2X81A 2XBAA 3HMMA 4ZLYA 4IDVA 2VD5A 5AR4A 3QTQA 4WRSA 4G3CA 5L2IA 2FVDA 4QMUA 3DY7A 4WD5A 2HY81 3HMNA 3UIMA 4LOOA 5DIAA 4I3ZA 2PPQA 1QPEA 4WG4A 3OT8A 4LL0A 2ZYBA 4YTFA 5L2WA 4ZK5A 4PL4A 3ENHA 1P2AA 4V04A 1CSNA 4UMTA 3ZXZA 2VGPA 3ZRKA 5HX6A 1OKZA 1FGKA 2YCSA 5JQ5A 4UX9A 4GK4A 4XRLA 4YJRA 4J71A 3RPRA 3MH2A 1UA2A 4P5ZA 3BBTB 1L3RE 3LXPA 4OW8A 3D7TA 3ORKA 2Z60A 2H9VA 2YJRA 4F0IA 4DC2A 4FZAB 4QQCA 4MD9E 2YHVA 2JITA 4GT5A 1ZXEA 3QHWA 1UU9A 2YCRA 2C3IB 3FXXA 4K6ZA 2J9MA 3FMLA 2GHGA 3R0TA 4OAVB 5EM5A 1O6LA 4R7BA 4PP9A 2XNEA 2EWAA 4MTAA 2GNFA 4D4SA 4JJRA 4G6OA 3VS3A 2UZVA 3ZFMA 2VTQA 4K77A 4I6QA 3QBNA 1UNLA 4R1VA 4M69B 4A9RA 1U46A 1YQJA 3R63A 2QO2A 2CDZA 3FSFA 2O63A 5JSMA 2WU7A 5GZAA 3HX4A 3VUTA 1KE5A 3KMUA 3H10A 5E1EA 1ND4A 2UW3A 4NYEA 3EFWA 3FHIA 3LFCA 4FA2A 2EXCX 2IVSA 3DZOA 3N4VA 1Q8TA 4W4XA 3NSZA 3QX4A 4GT4A 2QQ7A 3R1YA 4AS0A 1XHAA 4U5JA 5KBRA 3MA6A 4UY9A 1PHKA 2E9PA 4GK3A 3DXQA 2HENA 4O38A 4P90A 1ZOHA 4JIKA 3MIAA 1H25A 2F57A 5FTGA 3PXFA 4GU9A 4X2GA 5JFWA 1VR2A 3V5LA 2HZ0A 3PWDA 4FTCA 5BUEA 3BEGA 4WUNA 4RC4A 2R2PA 4FVRA 3BQRA 5LMAA 4CFMA 1OPJA 3IW8A 4AN3A 3GEQA 3OTVA 3EOCA 4AA5A 3DBFA 4DBNA 2NNWB 3ZC5A 4CFXA 4XBRA 5HE2A 2C6DA 2E9NA 3I5ZA 2LAVA 3NMUF 1NA7A 4U79A 5HX8A 2CN5A 4QQ5A 2FO0A 4G3EA 3UMXA 1MRUA 1UU3A 2J0IA 3DTWA 3FMDA 3QRTA 4TXCA 4ANNA 4BCOA 4FV2A 3CSVA 2EUFB 2C6OA 2OICA 4IWQA 2XP2A 3OC1A 4FTMA 1TKIA 2XB7A 4ZJJA 4RIXB 3TL8A 4GV1A 3WZUA 3UBDA 4AN2A 3ODYX 4Y8DA 4CQEA 4Z9LA 3FC1X 4MEDA 2W1FA 3WBLA 1OBDA 5ANEA 4BWPA 4KIQA 4QMYA 4PPBA 2ACXA 2JFMA 2VWIA 1JAMA 4O6EA 5I0BA 3PXYA 4QMWA 1OMWA 3QTSA 4FKLA 2VZ6A 4IC8A 4IC7A 4PDPA 1OKWA 2OFVA 4R7IA 1P14A 3KK8A 3MN3A 4YO6A 5HTIA 2WKMA 3QL8A 2CNUA 3QYZA 2W1HA 4F1TA 1UU8A 2JDVA 4AN9A 5E91A 2GQRA 4CMUA 4EHEA 3AXWA 5IQBA 4EH4A 2GQSA 1PYEA 5EYCA 5TO8A 2IW6A 4IM3A 3RJCA 4CFUA 2W96B 5CASA 5BVNA 5IA0A 4YPSA 3AD5A 4CCUA 4IAKA 4MHAA 4B99A 4CMTA 3GC0A 4AX8A 4DEGA 4RG0A 2HZ4A 4J53A 5EG3A 5KMNA 4U6RA 3ZBFA 4EC9A 5CU4A 3ORZA 4JRNA 1YHWA 5DHJA 5BPYA 2UZLA 3WYYA 1XJDA 3Q4ZA 5EW8A 3EL8A 1V0OA 3DOGA 2B7AA 5F95A 3B8QA 3LXKA 4UXQA 4UWBA 1H1RA 4ZZNA 2NO3A 2FA2A 2W7XA 4O1OA 3PJ1A 3OY1A 2XRUA 3VS5A 2R3GA 3NR9A 3LXNA 5HGIA 4BBFA 1OBGA 2OWBA 5FEQA 3VS2A 4HJOA 2JEDA 4M84A 2B9JA 2O8YA 4ZZMA 3FI2A 4FTRA 4IM0A 2XK6A 3E62A 3KVXA 1FINA 2WQBA 2X6DA 3QTIA 4FKPA 5DFPA 3T9IA 5KMKA 3WOWA 3R8MA 4RT7A 3UYTA 3CPCA 3Q32A 3O51A 5IA1A 2BCJA 2F7XE 3KULA 4BBMA 5AAEA 2WTIA 4ZSEA 3C4FA 2CSNA 4TW9A 4NTSA 3GB2A 1XH4A 5IDNA 2PVYA 3BLQA 3DFAA 3R2BA 2C6IA 4BCNA 3S95A 5CYIA 5A4TA 3FI8A 4EH8A 3HA8A 2G9XA 3RALA 4EC8A 3U4WA 2JAMA 4J95A 1M2QA 4GFMA 5FEDA 4ANMA 4E6DA 5AP5A 5GJFA 3U6JA 4BI1A 3EJ1A 4U45A 4J7BA 4PNIA 2O64A 1BL7A 2CCHA 2WTKB 3NVKI 5A9UA 1MRVA 2C5XA 3G6HA 5BVEA 3QCSA 4XG3A 4LYNA 4IB5A 1U5RA 1IAHA 2J50A 2PVNA 3C1XA 3FQEA 5CVGA 3QQFA 3Q5ZA 4IADA 2FSOX 3EN7A 3FBVA 2WZJA 3IDBA 4RVKA 5AP1A 2B52A 5ICPA 2R9SA 4BR3A 3SOCA 2CKOA 2OLCA 2GHLA 4UWCA 3LFBA 1KOBA 1PW2A 1R1WA 1XBAA 2FUMA 3GU8A 3VS4A 4DYMA 3G2FA 2UVZA 3GCQA 3ZSIA 2WPAA 5TKDA 3H9OA 5JGAA 3OOGA 4AZEA 4JG7A 5JQ8A 3EN9A 3LQ8A 5AUTA 2CMWA 4GW8A 2J90A 4XG8A 4I0SA 3QQKA 2XM8A 2PL0A 5AMNA 3QWJA 3QD0A 4OTFA 3SOAA 4AFJA 4R77A 3FYJX 3MY5A 4I93A 3HP5A 1OPKA 3FXWA 4RFYA 3U9NA 3UNZA 2R64A 3D94A 3V04A 3ZUUA 3E93A 2R3MA 4GG7A 1J7UA 3QU0A 3I7BA 1Q5KA 3GGFA 3QZGA 4F9CA 1WZYA 4IX6A 3V5PA 2QOQA 4YNOA 3U51A 3MB7A 4AA4A 3QUEA 5FEEA 1HOWA 2VTJA 5M06A 3TG1A 1CKPA 4HGLA 1UV5A 5HIEA 4FODA 4AQCA 4FK6A 2AUHA 1Z9XA 3UOHA 4HZSA 4NJ3A 4AU8A 5HZNA 3CJGA 4O7YA 4HVHA 4GUEA 1OUKA 4UN0C 5GINE 3C9WA 2WD1A 3IOKA 4U43A 1JKTA 1T46A 2BRNA 3HRBA 3W2SA 4FL3A 3SW4A 2QR8A 3BHYA 4JI9A 1V1KA 2CHLA 1V0BA 4PF4A 2XYUA 4V0GA 4OBPA 2QO7A 3BGPA 4ZSGA 3DB8A 4YZ9A 1PMVA 1WFCA 3TUCA 1STCE 3G15A 4XG2A 4MXXA 3UVPA 3VS6A 3WF9A 2PVMA 2BTSA 2XK7A 5HO8A 5EI8A 5DT3A 2XIKA 4XV1A 4C33A 4HYUA 4RJ8A 1L8TA 4FIHA 4MD7E 3BQCA 3R9NA 2HIWA 4ANBA 4F99A 5ETCA 2PZIA 3W18A 3NS9A 3ZO2A 3D5VA 5E8UA 4W8EA 4JQ8A 2OIBA 3N4UA 3OP5A 3KMWA 4G3DA 4D5HA 2C4GA 2YDJA 2QG5A 4G31A 4ZOGA 3TT0A 4F9BA 4F9YA 2Z7QA 4RLLA 4BDIA 4DHFA 1Y57A 4ANLA 5DN3A 2HOGA 3UO6A 2OZOA 4BTKA 3FI4A 4QTEA 3KCFA 5E1SA 4LG4A 5DT4A 3ZDIA 1E1VA 3BEAA 5J87A 3Q9ZA 3Q04A 5EM8A 1YKRA 4BGHA 5HHWA 3WF6A 3PIXA 4Q9ZA 3M42A 4FEVA 3FMHA 1XWSA 4F65A 1X8BA 4F7SA 4FSWA 3TZ9A 4FGRA 1ZZLA 4FNYA 5K4JA 4XEYA 5FBNC 3P5KA 3CXWA 3EQFA 4LRJA 4O0YA 5CS6A 3R9OA 3PSDA 3LFNA 4FL1A 4OUCA 5C8KA 5H9BA 3W2RA 3BWJA 4CZTA 3ID6C 3BBWA 3GNIB 5HIBA 4AGWA 3OCTA 1ZOEA 3EL7A 3V5TA 3VVHA 2RFEA 3RM6A 4YC6A 3KCKA 4FKVA 3HV5A 2UZDA 2OJJA 5ANOA 4QMMA 4DEEA 3MPTA 4PTGA 2P4IA 1HCLA 4XX9A 5E8XA 4F1OA 4F64A 4ORKA 2R3QA 2HZNA 4FTTA 1SYKA 4OTIA 2VWBA 4EORA 3DTCA 3B8RA 5L4QA 3KREA 3RTPA 1WMKA 3GCSA 2CKPA 3EHAA 4NJDA 3NIZA 3KRXA 2YJSA 1AGWA 1OL7A 3ODZX 4XP0A 4O7NA 4YJQA 4IHPA 4EQCA 5DPVA 1M52A 4J8NA 3SD0A 2PHKA 2ZV7A 2WQNA 4QNAA 5KHWA 2P2HA 2QOHA 3F2NA 2IWIA 3LLTA 4DN5A 3ANRA 3O50A 5JZJA 4FIEA 4AGDA 5M09A 4BYIA 4O27B 2WXVA 2YITA 4IFCA 4NUSA 4JAIA 5H2UA 5IU2A 4FV1A 4UMRA 4MF0A 4EQUA 3OD6X 3POOA 4O0WA 4ERWA 1MUOA 2A0CX 3IW7A 1A9UA 2ZDTA 4FC0A 4OGRA 4QP4A 4BCKA 4XS2A 4XG4A 3C7QA 1GNGA 4D0WA 4D1XA 3V5WA 3IGOA 4Q9SA 1FVVA 5AWMA 5CWZA 2HWOA 1OM1A 3MSSA 3LFQA 3UOLA 3UZPA 3MS9A 5HICA 3TTIA 3BU3A 4RJ4A 1MQ4A 5LMKA 2B0QA 1KV2A 3PSBA 3R21A 4IX5A 4KS7A 5ETFA 3QCYA 4MBIA 5I3OA 1ZYSA 5GJDA 2DS1A 3TZMA 2W1EA 3F5UA 5HLPA 5EW3A 4TN6A 3UO4A 3VUHA 3QRJA 1URCA 4AW1A 2V7AA 2GS6A 1BL6A 4IWPA 3UVQA 3BGZA 3A60A 5BMSA 2VRXA 4C4IA 5AA9A 4NFNA 2X9FA 4F9WA 4IVDA 4FG8A 5JH6A 2WTKC 4QTAA 4C2WA 5GHVA 3FE3A 4D4RA 2X2KA 4DFLA 4TKSA 2I1MA 3MDYA 3W10A 3E63A 4G2FA 5KUPA 1QPCA 4UB7A 4UYNA 4EH7A 2PZRA 3K2LA 3WE8A 2JBPA 2W17A 2DUVA 1PKGA 4IANA 4ARKA 3MVJA 4MK0A 3F5PA 3S2PA 4TL0A 4YU2A 5DEYA 3V5QA 4W4VA 4OTDA 4JBVA 4DCEA 2JDOA 4QP8A 2ITWA 3DLSA 4UMUA 1UVRA 2OSCA 3AC5A 4ZY5A 4EHVA 3BLHA 1W0XC 3IW5A 5C8MA 3P7AA 2UZNA 2QU5A 3QZHA 4R5SA 3BKBA 5JK3A 3GC9A 1H26A 5I9VA 3AC2A 4ZSLA 2C5YA 5H8BA 5BVOA 2HZIA 2C30A 5LARA 1SNUA 2HXQA 4QMNA 4DGNA 2C5OA 4A4XA 4A7CA 1P4OA 2C1BA 3PY1A 4S30A 4DTKA 3QZIA 4AWIA 4IX3A 4RA4A 4USEA 4O83A 4EYJA 1GAGA 4JXFA 4X2KA 4X6QC 3VN9A 3GXLA 2ZM1A 4O84A 3HV4A 5DWRA 4UYAA 3RCJA 2BZIB 5KMIA 3EFJA 3P23A 4FSNA 5CAPA 2R0IA 2OXXA 3C50A 3E5AA 2W99B 4FKIA 2XIYA 2YCQA 4O0UA 4DINA 5JFXA 4GYGA 2XJ0A 1YI3A 5EQPA 3BHTA 4WHZA 2A2AA 3R73A 4LMUA 4E6CA 5IH5A 3BHVA 4XV9A 4MQ1A 5C8NA 1FBNA 3TV6A 4BWKA 4JDKA 3F88A 4J99A 2AC3A 2J0KA 3C51A 2QOKA 5JKGA 1RDQE 2XMYA 3NYVA 2JD5A 5KZ0A 5AP4A 2YAKA 4YTIA 4CTBA 1ZYLA 1BUHA 4MD8E 3KXGA 1B6CB 2VN9A 3D2IA 3BYOA 3NUYA 5A54A 4EONA 4ZAUA 5K5XA 3F6XA 3VHEA 3KFAA 3KRLA 4EOPA 5IDPA 2GMXA 1JWHA 3BI6A 3EMGA 5DLSA 2FSMX 3SAYA 4MNEB 2R3HA 4UV0A 5A6OA 3UC3A 2QOFA 4QNYA 2BDFA 1ATPE 5BVWA 3TTJA 1JNKA 1YHSA 4EH5A 4M13A 3MPAA 4H1MA 4M7IA 4L7SA 5HG7A 4C58A 4I20A 3ELJA 3FL4A 3QHRA 3Q4TA 3QLGA 4BDGA 5G6VA 5IA2A 4FT3A 4PTEA 3LFEA 3OW3A 3QZFA 2WTVA 3M11A 3NX8A 4M68A 4E4NA 4O0XA 5CX9A 1GY3A 4EH6A 1V0PA 3G51A 2R7BA 3COMA 3NPCA 4FG7A 4BCMA 3HEGA 4O91A 3OT3A 4BY9E 4YLLA 3QQHA 3KXMA 4U80A 3TN8A 3TNQB 5L6OA 3AT3A 2PMIA 4PUZA 4KD1A 4QMTA 4AG8A 3QUDA 1PMNA 1KE7A 2ITPA 3ZLSA 4USFA 5AV0A 2Z7RA 3DAKA 1ZYDA 4RJ3A 4EQMA 2REIA 1LR4A 4CNHA 3COHA 4E26A 3VBYA 2OFUA 4FKJA 4WNKA 2XK8A 1IA8A 2YERA 2I40A 4LRMA 5AP2A 3RP9A 5AADA 2RL5A 4MQ2A 2ITXA 4ANQA 1IASA 2JKKA 4PMPA 3HZTA 5BNJA 1REKA 4FVQA 2XUUA 3NNWA 3NUXA 4RJ6A 4D2PA 4XOZA 1W98A 5HD7A 3LQ5A 4Z55A 3UNKA 4QTBA 5L6WL 3FLQA 3ORLA 2WMRA 5AP7A 4GCJA 3RI1A 4EK3A 3GCPA 2O5KA 2V62A 4C8BA 1Y6AA 1TVOA 4RIXA 3FMMA 5DMZA 3UODA 5CALA 3I60A 4XP2A 1XBCA 3CEKA 1ERKA 3L8XA 1QPDA 3TJDA 4BI2A 3I1AA 3JUHA 4GVJA 3AC4A 4EUUA 4NW6A 3L1SA 5E8ZA 4BZNA 5IQGA 3EQIA 3TNPC 2OZAB 3DJ5A 4DT8A 2IZSA 3L8VA 5IH4A 5I9YA 5AFVA 1OB3A 4GU6A 5D9HA 5EDPA 4FTQA 2UW8A 4A06A 1J7LA 3U54A 3L8PA 4EL9A 4BB4A 1IAJA 2VWZA 1RQQA 2O0UA 4FV6A 3PY0A 4G9RA 3SHEA 4U41A 4W4YA 4C35A 5HTBA 3LQ3A 1Y6BA 1ZMVA 2PK9A 2XNBA 4S33A 2BRBA 5CVHA 3UDBA 3WILA 3E87A 4QT1A 4GL9A 4M3QA 4I21A 2Y8OA 4JT3A 4PDSA 5J7HA 4YSJA 1AD5A 3LOKA 3VBTA 4ASZA 1WVWA 3O0GA 2VTIA 4DH3A 4YR8A 2ZVAA 3EQCA 1R0PA 4MXCA 1Q97A 3HP2A 4NH1A 3B2TA 4G9CA 1RW8A 4WO5A 2ERKA 4HVIA 1OVEA 3ZLYA 2V7OA 2YZAA 4FIJA 4EKKA 2OJGA 2PZPA 4D4VA 3I0OA 5CY3A 2QD9A 4RIOA 2BFYA 2QKWB 4EJ7A 5AAFA 4J52A 3BLRA 4AZSA 1JSTA 2X4ZA 5CSWA 4YHFA 5AR7A 4O0TA 2QI8A 4E6AA 2VO3A 4J8MA 2PE1A 4NKSA 4ANSA 3CY3A 4D0XA 4JX7A 3TM0A 2ONLA 2UZOA 3I4BA 4FTOA 3ORPA 1JOWB 4DGOA 3W8QA 4YURA 2QOBA 4TNDA 3JYAA 2W05A 4J96A 2QCSA 4M14A 3L8SA 4EBVA 5IEXA 4DFUA 4B9DA 5I4NA 3PLAE 1YWVA 2PVHA 3D7ZA 4FTUA 1H08A 4RX9A 3CLYA 3A2CA 3NYNA 3KQ7A 1A06A 3FEGA 3R1NA 5EM7A 1K2PA 1NW1A 2RIOA 5BUJA 3LPBA 2B53A 2JDSA 3CPBA 4QD6A 4USDA 2G1TA 2ITUA 3GUBA 3QTWA 4PL5A 2ITYA 5DOSA 4DLJA 5A14A 2VWWA 4A9SA 5HNIX 4RJ7A 5FLFA 3IW4A 3PTGA 3VBQA 4E4XA 2XBJA 2WOUA 1LPUA 2WMSA 1ZZ2A 2AYPA 2BROA 2NP8A 2ZMCA 5HOAA 4C62A 2Y6MA 3AMBA 3NDMA 4C7TA 1REJA 2EVAA 2XCKA 4GEOA 4JBQA 5ACKA 1PXLA 4F08A 5EYMA 3LZBA 4YLKA 3WZEA 4LGDA 4D5KA 4R5YA 3ZM9A 1XH5A 5BX0A 1XKKA 4YZDA 3UE4A 1G8AA 2WEIA 4F7LA 4IZAA 1DM2A 2WEVA 1W84A 2UZWE 2BPMA 2UVXA 2W1DA 3OHTA 5HCYA 4Y5QA 5CT0A 3VBXA 5CANA 3Q9WA 4QQTA 3OOMA 3PFQA 4OBOA 2X7FA 4WOVA 5C26A 4C38A 4LGGA 4FTKA 4M0ZA 5KMOA 3DKOA 4CT2A 5TE0A 4C4EA 4WKQA 5EW9A 4I6FA 4YC3A 2OO8X 4DG3E 2ZM4A 1CKIA 3L9NA 4CFWA 1YXTA 2R5TA 3G9LX 4YZMA 4EOKA 5L8KA 5IQEA 5GJGA 1PXIA 4CTCA 3R1QA 5AR5A 3F3ZA 3IDCA 4BDHA 3BHHA 4YSMA 5LQFA 2YZLA 3NEWA 4KNBA 5HG9A 2W1GA 4GRBA 4JIAA 3ZCLA 5HCXA 4OTWA 4A9UA 2KULA 4L3JA 1H4LA 4A07A 5F1ZA 4CZUA 2YIQA 2UZTA 4CV9A 4DEIA 4DH5A 4IWDA 2PMNX 3E64A 4FUYA 2EU9A 3EZVA 3QA0A 3OCGA 2GFCA 5IQAA 3FKLA 4TPTA 2J5EA 1ZMWA 3Q4UA 3MV5A 4AZWA 5DE2A 3ZHPC 3UOJA 4F1MA 3DGKA 4O21A 2VWUA 4WUAA 4DEBA 3S4QA 3R8LA 3NUUA 4JNWA 3PIZA 2YAAA 1UWJA 3JPVA 1YWRA 4QMQA 3QKKA 3FY0A 4B8MA 4FYOA 3U9CA 4AXAA 4D1ZA 2BAKA 4AW5A 4K2RA 2I7QA 1IR3A 3W33A 3Q2MA 1YRPA 5CU6A 3NIEA 3SXSA 5BUIA 4L53A 4NCTA 4IAYA 3LHJA 1KE9A 2YACA 3R71A 2PZ5A 3R7IA 1OL6A 2ITVA 3OUKA 3F7WA 3P86A 4DH8A 4C0TA 3VUKA 3BYSA 3IKAA 5I3RA 3MH3A 5JEBA 4L8MA 1BKXA 2QHNA 3R8ZA 3CTQA 3ZU7A 2JDTA 3DAJA 1FVTA 2XKFA 3DBCA 2UVYA 2X1NA 2JAVA 3DKGA 2P0CA 3ALNA 4E5AX 3HAVA 1O9UA 2X7GA 1ZYCA 4IDTA 1XH8A 5AJQA 5LWNA 2PUIA 4N6ZA 4O0VA 4KBAA 3WARA 3ZZWA 4CKRA 3OG7A 3ALOA 2H34A 2VNWA 4EOIA 3PZEA 5L2QA 3VS7A 5CSPA 5J1WA 5KNJA 3SW7A 4BZDA 2VTPA 4CQGA 2PMLX 2H96A 4E7WA 2Q83A 3RVGA 5AUUA 3VQHA 4QMZA 4R3PA 2PY3A 2VX3A 3EQBA 4C4GA 4I92A 5CNOA 3W8LA 4HW7A 3HRFA 5IUIA 4ZXTA 3RZBA 3KN5A 5C27A 4HGEA 3A61A 4IJ9A 4HPUE 4CEGA 4YMJA 2W9ZB 5IA4A 3DV3A 3H30A 2BR1A 3IGGA 3WZDA 4XCUA 4G5JA 5LMKC 4UZDA 1VEBA 4CG9A 2DQ7X 3VAPA 3OWPA 5C9CA 4QMSA 3U6IA 5ETAA 3DA6A 3FUPA 4GUBA 5AP6A 3PJ3A 2B1PA 1JKKA 4NM3A 4QYFA 3ERKA 3MJ2A 3PJCA 3BWFA 4YGAA 3Q52A 3TNWA 3EQRA 1PMUA 1PXJA 3EN4A 3ORXA 4C4HA 3GU7A 3MY1A 1WVXA 4ZSAA 4XBUA 3RINA 3ZC6A 5IKWA 4L6QA 5CVFA 4YHTA 2VUWA 2C3JA 1O6YA 4N6YA 5LVNA 1H07A 4FUXA 4Z7GA 4YZCA 5DNRA 5I9XA 3EFLA 5HU9A 3R30A 5HNGA 3SXFA 1YDSE 5I9WA 4GH2A 5AIKA 4APPA 4X3JA 3ZUTA 2ETKA 2AC5A 3PP1A 4H3BA 3E8NA 3S00A 4BICA 1XO2B 2XK9A 1GZOA 1Z5MA 3MVHA 3M2WA 3P0MA 4JR3A 4CKJA 2YIRA 2JLDA 5C1QB 3MJ1A 3OW4A 3QD2B 5IUHA 4BTJA 5I5ZA 4O7VA 3CGOA 2XRWA 1W83A 5ANKA 1QL6A 4JRVA 4IH8A 5GNKA 4QQJA 4EEVA 1WBTA 3M1SA 3UC4A 4R6VA 4RRVA 5HTCA 2VTSA 2PUPA 4OTGA 2JDRA 4EOMA 4KBCA 4X3FC 4X7QA 1JQHA 4K1BA 4RWKA 3DU8A 2CCIA 3CKXA 4FBXA 5HBJA 4K9YA 5LXMA 4BCGA 5HO6A 2PVRA 2Y4PA 4JX3A 4CKIA 4TWCA 4MNFA 4I23A 1S9IA 3UQFA 5EQYA 3KXZA 4Y72A 3EWHA 1H0VA 5M44A 3JY0A 3I0QA 3WZJA 3MI9A 3PG3A 4BYJA 1M7NA 3QXPA 3OWJA 4GYIA 4ZZOA 2ZB1A 3OUNB 3PP0A 1YXSA 1YW2A 4G34A 1BYGA 3E3BX 4X21A 4OAUC 3T3VA 4F70A 4FTLA 2F4JA 2FSTX 1GOLA 2QO9A 3ZO4A 3NUAA 4HCVA 3HMPA 2CJMA 3OCSA 4QO9A 2VO6A 3D4QA 4YUQA 4D28A 3PSCA 3OWKA 4EH9A 3QTUA 4KBKA 4R1YA 5J1VA 3MY0A 4AGCA 2QKRA 3NZ0A 4R3CA 4L3PA 4UMQA 1H1QA 5I9UA 2YCFA 4S32A 3SDJA 4EOSA 1PXPA 4FF8A 3DPKA 4P5QA 5AUXA 3MFRA 4F6UA 3DBEA 3A7JA 5GZ9A 3EFKA 5H8GA 2I6LA 2W1ZA 3LCOA 5EOBA 4KSQA 1GIJA 4KIPA 5HE3A 4FKRA 5AV2A 4BDAA 5CF4A 4WSQA 4YZBA 1P4FA 2G15A 1H0WA 4FT5A 1E9HA 4P7EA 1FOTA 4U9AA 4DTBA 3AOXA 1OI9A 5D10A 3ZYAA 4FTJA 4EK5A 3NAXA 3R02A 4GFOA 5F20A 2JBOA 1JKSA 5AR3A 5AR2A 3KGAA 3RBWA 4TYJA 3UIBA 3P9JA 4CZYB 3ZFYA 4MCVA 3WZKA 2VTHA 2RFSA 4RLKA 5K3YA 3ZRLA 2CKEA 2Y0AA 3JVSA 5T6KA 4KSPA 4FYNA 4E6QA 5GIOE 5LVOA 3MIYA 5CI6A 5HVJA 3FV8A 4BDCA 4RPVA 3VULA 4HZRA 3LCSA 2WTJA 2ZV2A 4L68A 1OUYA 3CE3A 4EJNA 4R8QA 5C4KA 3CGFA 4BDEA 3EH9A 5IPJA 3F2RA 2C0IA 3Q4CA 4TYHA 2BRMA 3A8XA 4BN1A 3MESA 2IJMA 1F3MC 3JY9A 5M08A 1OIQA 3UO5A 4YLJA 3U87A 4I6HA 3ROCA 1KV1A 2P3GX 4EBWA 1ZYJA 5BYYA 5JT2A 3P7CA 2UW0A 3C13A 4XUFA 5KKRB 4O2PA 1XH9A 4E5WA 2C5NA 2VTNA 3V6SA 1DI9A 4QP9A 3MA3A 5J7BA 3TV7A 3W2OA 3S1HA 4QMOA 4L01A 5D11A 1FQ1B 2R3PA 3E8EA 3MFUA 3C4ZA 4WNPA 3R7YA 4CLIA 2O2UA 4S2ZA 3RWQA 4Z7HA 3EYHA 4TYIA 2OJ9A 2B9FA 2GTMA 3R01A 1BX6A 1TQMA 4OTPA 3ZH8A 2J5FA 4MNEA 4AZVA 3A7GA 3CCNA 5HBHA 4FTIA 4YJUA 3UIUA 4C3PA 5CEMA 2WELA 2GFSA 4RIYB 2A4LA 4DAWA 2LGCA 3VUIA 1JSUA 3GENA 1JSVA 2OGVA 2X4FA 1J1BA 1YXUA 4IAZA 3VC4A 4FR4A 3NW7A 3Q3BA 5L2SA 4TY1A 1Q62A 5D1JA 4I5PA 3ZSGA 5IA3A 1UKIA 2UW7A 1F5QA 4K0YA 2Z2WA 4R7HA 3UQGA 3ZZEA 1AQ1A 2X6EA 3OXZA 4RVMA 4TRLA 4ZLOA 5AAGA 5JGBA 2ITZA 4ZTMA 3CP9A 1UWHA 3F3UA 4RX8A 2HAKA 5FG8A 2X2MA 5CF6A 4O82A 5AUVA 4CVAA 1H1PA 5EHYA 4N70A 3C4XA 1NVRA 3FZPA 1KSWA 3DAEA 3CD3A 3W2QA 3MVMA 4C61A 1OITA 4IXPA 2OXDA 4OT6A 3P08A 3TIYA 4Y85A 3GP0A 3FKOA 5EM6A 4IACA 1LEZA 2XNPA 3LE6A 3FJQE 3GOPA 4FEWA 3UP2A 4JAJA 3MB6A 3VS0A 5DVRA 2OF4A 4XRJA 2W5AA 3VS1A 3I79A 3R7GA 3QRKA 4FG9A 2PVJA 2F7EE 3FMEA 2E9OA 2QNJA 4QMPA 5HNBA 4W8DA 3VW8A 4HGSA 3BCEA 4PP7A 5HLWA 3TZ7A 4H36A 4NKAA 3RPVA 2ONLC 3PA5A 2YM5A 2NRYA 4QPMA 1XQZA 2XM9A 1F0QA 3N9XA 1W82A 3GU4A 4L45A 5FDXA 4PMMA 3IONA 4FSZA 1JBPE 2OJFE 4B0GA 1BLXA 5CF8A 3DBDA 4ACDA 1Y8GA 2R0UA 3R2YA 2G2FA 2W5HA 4I0TA 5A46A 2OU7A 5FTQA 1W7HA 2BZKB 2OZAA 4IMYA 3DDPA 4D2VA 3PY3A 3F3WA 4NU1A 3KXHA 2CGXA
chains in the Genus database with same CATH superfamily
4O22A 3E92A 4HGTA 4J97A 4BHZA 4G3FA 1ZY4A 5HEZA 3V3VA 2I0HA 1GZNA 1T45A 3KXXA 2EB3A 2EXMA 4B7TA 5EKNA 5BQ0A 2KTYA 5A6NA 1H1WA 1WAKA 5FD2A 3MBLA 2Q0BA 2J0LA 2Y4IB 1PKDA 4FV4A 1ZMUA 4JDJA 3IO7A 4NSTA 2XIRA 4AE9A 2SRCA 2XH5A 4FKWA 2QG7A 3PYYA 4X6RA 3O8UA 3AMAA 3MW1A 2VTRA 3OBJA 3ATTA 4K18A 1Q8WA 3PVGA 4I4FA 4S34A 4XJ0A 1PRYA 1YI6A 2YIXA 2QOCA 3DQWA 3FZSA 2Z7SA 5IQDA 3HYHA 4KA3A 3CBLA 3G6GA 4DFBA 3GI3A 5AV3A 3PUPA 2RGPA 5L8LA 2XKEA 1JPAA 4C57A 2W9FB 3NYXA 3FLYA 3NRMA 3AC8A 4YBJA 5FM2A 3MPMA 4N4SA 3ZLXA 3A99A 5CENA 2OIQA 4HVSA 3ANQA 3KIOC 5A4EA 5HI2A 5CAUA 2O65A 2VX1A 4CGAA 2VWVA 3GVUA 2OW3A 4ZTRA 5AEPA 2QOIA 3DJ7A 4EZ5A 4AP7A 3Q9YA 3CJFA 3OEFX 4BGGA 1IA9A 4D4YA 3O8PA 3W1FA 5JZNA 4EH3A 2ZDUA 3KA0A 5AM6A 3GCUA 4FIGA 4WBOA 3D5UA 4FV0A 5HIDA 4IAFA 1S9JA 3FPQA 3RWPA 4BCIA 1G8SA 3PE2A 1ZLTA 4FIIA 5HKMA 4DG0E 4ERKA 3HUCA 3TEIA 4DF3A 4FEUA 5D7AA 4C37A 2VGOA 5CEQA 1YOMA 3KK9A 3ZXTA 3E3PA 3NGAA 3DK7A 4XOYA 2ITNA 3FKNA 4O0SA 4YTCA 1ZRZA 4H05A 2G2HA 1DI8A 3MWUA 4ALUA 3MGYA 4TYHB 1TZDA 4CCBA 5TR6A 3E8DA 2XZSA 3D9VA 4G6NA 5F9EA 4LM5A 5CNNA 4BDBA 2ZAZA 3FI3A 1HCKA 3OS3A 3P79A 3Q60A 3PVBA 4FTAA 3RZFA 3UYSA 5LCKA 4K8AA 5AUYA 3G5DA 1B38A 3OMVA 4GJ2A 4NCTC 2XJ2A 4I5MA 5TOZA 4DBXA 3AG9A 1W8CA 2HW7A 4LV8A 5IH6A 4AOJA 1IG1A 4M15A 3W2CA 3V8TA 4O86A 3W0MA 1ZAOA 2VWXA 2PZYA 4BC6A 1M17A 4I94A 1NY3A 4QYEA 4KRDA 4L9IA 4BDFA 3SV0A 4FV5A 3AMYA 4IW0A 4AFEA 5HD4A 4MH7A 4J98A 3BELA 2CGWA 5DR2A 2X2LA 2DWBA 4O81A 3DKCA 2PYWA 3KRRA 3HUBA 2RSVA 3LFSA 2XVDA 4D9TA 4NK9A 3DFCB 4C59A 4QP2A 4QMVA 4ZTLA 4WIHA 3VBWA 4APCA 4J1RA 5M56A 2DYLA 5AUWA 4BWXA 2C68A 4HOKA 3ORNA 4D2WA 4G3GA 3VW6A 2BRGA 1R39A 4HVGA 2R3KA 3QGWA 3PE1A 5AV1A 4BVUA 1CM8A 1U5QA 3Q53A 5IEYA 1Q99A 5CZIA 3C0IA 3FLNC 4I1ZA 4ZY4A 4F6WA 4FKSA 5DRBA 4JOAA 3H0YA 3SLSA 4D9UA 2C69A 2EB2A 5E9EA 2YABA 4JBOA 2CPKE 2QLQA 5F94A 1J1CA 1H24A 1SVEA 3LJ0A 4M8TA 4PRJA 3I6WA 4NT4A 1PXNA 3WF8A 4IAIA 5KO1A 5C4LA 1OKVA 3CTHA 2OIDA 5AX9A 4HCTA 4M66A 3R7VA 4CXAA 2C47A 2PU8A 3O7LD 3QKLA 3FZ1A 5EFQA 2UW9A 3NVMB 1YDRE 2P55A 2UZBA 1UNGA 1U4DA 3FL5A 4DLIA 5DH3A 3IOPA 3PRFA 4YJTA 5T3QA 2UV2A 2BDJA 5ACBC 3UQCA 2C1AA 3WIKA 3DK3A 3LCKA 2X0PA 4RMZA 4W4WA 3W0SA 4LUEA 3TACA 5EHOA 4DEAA 2F49A 4I41A 3R22A 5HG5A 3KF7A 4ZIMA 3VF9A 3G9NA 1WCCA 5KZIA 3HV3A 2YIWA 2FSLX 3CTJA 3WYXA 4BCFA 5DGZA 4O7LA 4TWOA 3OZ6A 4LOQA 2PVKA 3SGCA 4RZVA 4F7JA 2X39A 5K9IA 3OXTA 3BV2A 4MXOA 5IF1A 2BAJA 2IVUA 5FUTA 2R4BA 4DGGA 3A4PA 2WMVA 3ZO3A 3CQUA 3AC3A 3NNUA 3UP7A 3T9TA 3BE9A 4MWHA 3K5VA 5HLNA 2CGUA 5AUZA 2ZJWA 2CKQA 4E5BA 2QODA 4O4CA 3ZM4A 5CU3A 2QR7A 2F9GA 3A8WA 3IS5A 4HVDA 2WGJA 4NWMA 3QD3A 2YFXA 3TV4A 1OL5A 3QCXA 5KE0A 1OL1A 4ACHA 2HXLA 1NXKA 5E8YA 2IVVA 3TNIA 4DFNA 4GVAA 4WNOA 1J7IA 5BVDA 4D58A 3R9RA 5I9ZA 2OKRA 3UNJA 2YIYA 3VRYA 3LKMA 3BYMA 2BHHA 3PLSA 4O1PA 3HV6A 4JQEA 5E90A 5FRIA 2HWPA 2GNHA 2ZV9A 2ITQA 3PXZA 4FTNA 4FE2A 2X0GA 3KEXA 1R0EA 3FQSA 4L7FA 1P5EA 2PULA 4PTCA 1UNHA 4Y46A 4FT9A 5C01A 5K5NA 3OTUA 3LJ2A 2VTMA 3U4UA 3DKFA 4EUTA 4BCPA 1M2PA 2XKDA 3ZBXA 2GPHA 2C6EA 4IWOA 2J2IB 3NCGA 1YVJA 2WMWA 1R3CA 3FMNA 5AA8A 4N57A 2XEZA 4MF1A 1CMKE 3DXNA 4FKUA 4LUDA 1IRKA 1H27A 3CKWA 1QCFA 3KMMA 4QP1A 3U6HA 3KN6A 3ORTA 3ZSHA 3RGFA 5CEKA 4TYEA 3V8WA 3RAWA 4BZOA 3AT4A 3BRBA 2YN8A 3POZA 5AP3A 5B2KA 2OXYA 5CQWA 5C03A 4AE6A 1WVYA 2GS7A 4BI0A 1LUFA 4YJNA 4FZDB 4DE4A 1BI8A 3GCVA 3VUMA 4E4LA 5ANJA 2C0OA 4FV3A 3JS2A 4QTCA 3RAIA 1JLUE 3SRVB 4B6LA 2I0EA 3KXNA 3Q6WA 3HGKA 3JVRA 4HNIA 4LOPA 3UJGA 5FDPA 2BIYA 4MVFA 5GZ8A 2CNQA 3PVWA 5J9YA 1RE8A 3EYGA 4WNMA 3SC1A 5CAQA 3MTLA 3VJOA 4R3RA 5AV4A 2RF9A 1FGIA 4TT7A 3KKVA 2WFYA 3QX2A 5FGKA 3VQUA 2A19B 3RPYA 3UOKA 2WQEA 5LJJA 5AM7A 1GIIA 4DH7A 2FB8A 4NL0A 5DBXA 3DNDA 4BFMA 2IZTA 2WOTA 3FDNA 4KIKA 3VO3A 2GSFA 5HO7A 4L44A 4QPSA 4EK8A 1ZARA 4AW2A 1KWPA 3EIDA 4FX3A 5FTOA 4MX9A 3VWAA 4HYHA 2GCDA 4FV9A 3HV7A 1G3NA 5DA3A 4B4LA 1PF8A 4EOJA 4NZWB 4ITJA 4QYGA 1RJBA 4RQKA 1H00A 1U54A 2V22A 3MTFA 4L00A 3UPXA 5BVFA 3ACKA 3ZS5A 4ZTNA 1M7QA 3R8PA 3DT1A 3CR0A 3RCDA 4AUAA 2RKUA 3OEZA 5T68A 3Q5IA 3C5UA 1M14A 2W1CA 3IECA 3KF4A 3RAKA 3WIGA 4RC2A 4PMSA 3R8VA 3VUGA 4ALWA 3NUNA 4PDOA 4WRGA 5EQEA 5D41A 2X7OA 1SMHA 3A7FA 3ZEWA 3R1SA 3E7OA 4AT4A 1Q8ZA 1OPLA 3EKNA 4I24A 2QC6A 3TCPA 5JRSA 1YWNA 4FSQA 3D5WA 4FICA 3QTXA 3LMGA 5ANDA 2OH0E 4L67A 2JKOA 3DNEA 5JRQA 4D55A 1BMKA 4CYIA 2W0JA 2BVAA 2R3RA 3HECA 4GMYA 5KX8A 3AD4A 2QOLA 3COKA 4WG5A 4FT0A 2OI4X 4BKZA 3GBZA 4F63A 4TTHB 3LAUA 4Q5HA 3IW6A 4CV8A 1NVQA 3RNIA 4BKYA 2EXEA 1NVSA 3QFVA 5K4IA 3WF5A 3O96A 1R78A 5EYKA 2Q0NA 4GJ3A 4EK4A 3ZEPA 3FMKA 3BYUA 3AQVA 4FIFA 4FSRA 2C0TA 4BCJA 4FI1A 2FH9A 2GS2A 3RAHA 3WE4A 4CFFA 3LFAA 4QPAA 4BTMA 1J91A 3NW5A 2QLUA 2XK3A 3O2MA 2XA4A 5ETIA 4O7RA 2VV9A 3EN5A 4DFYA 4ZJIA 3GFEA 1XMLA 3T8OA 3CC6A 1YDTE 4DGMA 4U7ZA 2OK1A 3HVCA 3BU6A 4G16A 1GZ8A 3PPKA 4DCAA 5CSXA 4X2FA 4F4PA 4ITHA 4RFZA 4AW0A 4PV0A 1JKLA 4BTFA 4RIYA 3TZ8A 4PX6A 4E73A 2WHBA 2WMXA 2PUNA 4N0SA 3NWWA 5E92A 2Z7LA 5AX3A 4RX7A 4G5PA 2F7ZE 4FV8A 4L42A 2QHMA 4RC3A 5ANIA 3F7ZA 1YOJA 5JN2A 4KABA 4BBEA 1FMOE 5J9ZA 5AIRA 4HYIA 5K0XA 4V05A 4XHKB 4GG5A 1KE8A 3F61A 3UZTA 5J95A 4ANOA 3FYKX 4XMOA 2PE2A 5A4LA 4D2TA 2XIXA 3HAMA 4XG6A 4ALVA 3V5JA 4CFNA 1B39A 5HE0A 2AEGA 4KKGA 2UW6A 2FGIA 3KRJA 5D12A 1YI4A 5L3AA 2OG8A 3NNVA 4D2RA 3L9PA 4LI5A 3EB0A 4LFIA 4DEHA 3I5NA 1SVHA 5CXZA 4IVBA 3RK7A 5FQDC 3ZTXA 3HRCA 4E3CA 2ZM3A 4O7WA 4EHZA 5FP5A 2UZUE 3QUPA 1TQPA 3HA6A 4NIFB 5CU0A 4C4FA 4DTAA 2X8IA 4Y83A 4YPDA 2Z02A 4BF2A 3C4WA 3ZONA 1OZ1A 4S31A 3BZ3A 2YDKA 4I5HA 3HNGA 1Q3WA 1FMKA 2R7IA 3GQIA 4FKGA 4I5CA 2PSQA 4IFGA 1J3HA 4ONAA 4LQMA 4EKLA 3NCZA 2YWVA 2Y7JA 3LMIA 5DR6A 3TUBA 2C6LA 3Q96A 3R7OA 3DCVA 2XEYA 3BGQA 2YM4A 2ETMA 4FMQA 4JS8A 3F5GA 1YOLA 4CLJA 5HU3A 3R8UA 2YLEA 4HCUA 3FZRA 4P4CA 4UXLA 3GOKA 4NFMA 3Q9XA 4BHNA 2QOOA 2OJIA 4NM5A 2J7TA 3QTZA 4H3PA 4IQ6A 4RFMA 4EYMA 1VZOA 1KUTA 3MFTA 4QYHA 4BDJA 3GQLA 4O7SA 4FNZA 2RFDA 4M12A 3R00A 4XV3A 4QP7A 5E8VA 4F6SA 5KCVA 3QYWA 4FNXA 3QLFA 2VO7A 4AGUA 4F0GA 4Z16A 2CNVA 3N4TA 4CYJA 4G1WA 4U3YA 2VTLA 4QMXA 4UBAA 5EKOA 3C4EA 3CIKA 3R9HA 4BRXA 3VJNA 4OBQA 3W0PA 5L6PA 3EZRA 4TYGA 4AF3A 5B7VA 4U97A 1ST4A 4FOBA 5FXSA 4E4MA 5JMSA 3ATSA 2JC6A 2WMBA 1WBVA 3C0GA 1H1SA 3L9LA 5M51A 3E88A 2I0YA 3UIXA 1PXKA 2E2BA 2JIIA 3L9MA 4KIKB 4UWYA 3QD4A 5LVLA 5HORA 3II5A 4L46A 3LLAA 4IIRA 4JBPA 2XIZA 3W2PA 4LRKA 1OIRA 5KBQA 3IK3A 4LMNA 5EDRA 2V5QA 4DH1A 3SXRA 5AP0A 1U54B 4Y73A 3MFSA 5M57A 2A1AB 4EZ3A 4W9WA 4OR5A 4BIDA 3H0ZA 4Y5HA 4DGLC 1Q8YA 5JFVA 4IZ7A 3K3IA 4AZFA 4RSSA 2C3LA 4RIWA 2F2CB 2GNJA 3D7TB 3R04A 4H3QA 4U0IA 3T3UA 3SVVA 3TDWA 5EH0A 4ZY6A 3HL7A 3RHKA 4AZTA 4DHJA 2HW6A 4JG8A 4YC8A 2X0OA 4KB8A 4CT1A 3H9FA 2BMCA 4FSYA 5EOLA 5IQHA 4EZ7A 3UGCA 4YJSA 4YNEA 5CEIA 2BFXA 2PWLA 4RGJA 3K5UA 3KVWA 5J5SA 2C3KA 3BHUA 3HMIA 1GIHA 3PZHA 5HCZA 5LVPA 4GIIA 4QP3A 5JFSA 3DK6A 3OY3A 4I22A 5G1XA 2R3OA 2NRUA 3QF9A 1OIUA 1KOAA 3PJ8A 2XK4A 2IW8A 3F3VA 4IM2A 3RHXA 5KMMA 4IEBA 3QXOA 4AOTA 4YBKA 3G90X 4Y95A 3MYGA 2W4OA 3D83A 2IO6A 3DB6A 4IX4A 5CQUA 1DAWA 2WMAA 3D2KA 3LVPA 2C5VA 3ZLWA 3FMJA 3MVLA 4KINA 2WIPA 3DDQA 4IB0A 2ETRA 3CD8A 4IB3A 3SX9A 5TF9A 4BCHA 3COIA 2IN6A 3TIZA 2WTCA 4OTQA 5E7RA 5H3QA 3RK9A 5CI7A 4XLVA 5EI6A 4PDYA 5IA5A 3LM0A 1K3AA 1PXMA 3AD6A 3FLWA 4BDKA 4TNBA 4K11A 3W16A 4FSMA 3BE2A 4I0RA 4GSBA 4KWPA 1Q24A 3R7UA 3TDVA 4UZHA 4BL1A 1ST0A 4W9XA 3OBGA 1URWA 3VRZA 5FXRA 2WB8A 4RWIA 2UW4A 3PIYA 5CSVA 3WI6A 4PNKA 5IZFA 3O71A 4RWLA 4ACMA 4U42A 3TJCA 2RG6A 3O5AA 2XNOA 4GFGA 3F69A 4LV5A 3ZDUA 4FL2A 4CD0A 1DAYA 3R83A 2XAMA 2O3PA 5EYDA 4MXZA 2R3FA 2P2IA 1CTPE 3OF0A 5IQCA 2RFNA 2PMOX 2X8EA 4IZ5A 4X2NA 4O0RA 3VUDA 4BIBA 2IW9A 1XH7A 2ESMA 2V55A 5E4HA 2JFLA 3BYVA 2JKMA 2E9VA 4O4EA 1WBSA 5DG5A 3MH1A 3I7CA 3H9RA 4ZEGA 3TKUA 4KS8A 4I6BA 2GDOA 2J51A 5A4QA 4XG7A 4H1JA 3PRIA 4UALA 5CEPA 4L43A 2VNYA 4XV2A 3QRUA 1LP4A 3BIZA 4ACGA 4DG2E 3U55A 2ZV8A 4PMTA 4DFZE 4JQ7A 5J5TA 5FBOA 4EOLA 2WQOA 1Y8YA 2R3JA 3PXQA 4BKJA 1VYWA 3PWYA 3VF8A 4UMPA 4II5A 4YTHA 2XAOA 5IISA 2XNNA 2QU6A 2Y9QA 4QRCA 4QYYA 2YA9A 5FM3A 5DRDA 4C2VA 2ZFYA 3VNTA 4O7TA 4FKQA 4X0MA 5HVYA 3H3CA 5H8EA 3DXPA 2PUUA 3S3IA 4AOIA 4HYSA 3AT2A 4CFVA 3SG8A 4C34A 2UW5A 3RK5A 3VIDA 3QQJA 2YM8A 3ULIA 1E1XA 4YO4A 3HKOA 2BRHA 1IEPA 4IE9A 2YLFA 3F66A 5L2TA 2C6TA 4O7ZA 2B54A 4MXYA 4FEXA 3OFMA 4QTDA 5FP6A 3N51A 4R78A 2JIUA 5J9LA 2PE0A 4GS6A 2YISA 4KAOA 4OTHA 2V0DA 4PY1A 5A3XA 3KC3A 3NFFB 3LM5A 1MRYA 4QP6A 2ITOA 3VHKA 2FYSA 3PJ2A 3DLZA 4QOXA 5IQIA 4BCQA 2B55A 3ET7A 3GC8A 3QGYA 1VYZA 5BMMA 2HK5A 3TKHA 3A4OX 3CY2A 3FWQA 5LWMA 3C4CA 3FLSA 2YM3A 1JVPP 4L3LA 4DEDA 2XKCA 1SM2A 3FAAA 4KRCA 4EK6A 3P1AA 2BDWA 1BI7A 4ZSJA 5BVKA 4O6LA 4EHGA 3F82A 3KULB 3TWJA 3V6RA 3R6XA 1WBPA 5EI2A 3NNXA 3UMWA 4D2SA 1UU7A 4AT5A 1WBWA 4U44A 3BV3A 3R9DA 4RX5A 3K54A 2I0VA 2WTWA 3TNHA 4FKOA 3ZRMA 2OF2A 3I6UA 4RA5A 5CF5A 3QALE 1PYXA 3ORMA 2BTRA 2R3NA 2VTTA 2IPXA 3D14A 5DEWA 2BKZA 3OCBA 5IEVA 1QMZA 1PXOA 2ZMDA 2ERZE 4JDIA 5E8SA 5M4UA 2OBJA 2XNMA 1GJOA 3IPHA 1OGUA 2Z8CA 3KB7A 4IB1A 5M55A 4PWNA 4JDHA 4A9YA 1SNXA 4EOQA 3P4KA 4XH6A 4MWIA 3SG9A 1CDKA 4C02A 4WBBB 1FVRA 4XP3A 3Q2JA 4BIEA 2WO6A 3B2WA 4RZWA 3ZOSA 2IG7A 5CAOA 5JGDA 4ZLZA 3QQUA 1FPUA 2CGVA 3EQGA 5EDQA 4XYFA 3PVUA 3LMHA 3THBA 3SA0A 3UG2A 2GQGA 3V51A 5E8TA 3KY2A 4RIWB 2X9EA 2VTAA 1PY5A 3D0EA 4JG6A 1PJKA 4PL3A 1YXVA 5BYLA 3QQLA 4M67A 4WG3A 4EOOA 3PXKA 4ZS4A 3ULZA 3ZO1A 1YXXA 3UTOA 1XR1A 1H01A 4OTRA 4EI4A 3ACJA 2BZJA 1H28A 4GT3A 3OROA 4MKCA 4RVTA 4ZMFA 3R28A 3PG1A 3QKMA 4FSTA 5DI1A 1PMEA 3FPMA 4FJVA 5GIPE 2VU3A 2WAJA 3RMFA 4V01A 2G01A 4MXAA 4FGBA 4U8ZA 4JVGA 3PXRA 5K0KA 3PPZA 3QC9A 2YDIA 4HPTE 1ZWSA 2QVSE 5E8WA 2X8DA 3FY2A 3GC7A 5IUGA 5KHXA 3V01A 2BHEA 4YJOA 3SRVA 4ASEA 4MUQA 3CQWA 3UZRA 3F3TA 3OXIA 4EWQA 3IDPA 4FNWA 4ID7A 2QONA 3LFDA 3A7IA 4OT5A 3BPRA 4RVLA 2F2UA 4AA0A 5B2LA 4M97A 2BAQA 2BILB 2W4KA 2WMQA 5HBEA 4CSVA 2OH4A 2PVLA 3W55A 4X3FA 4BGQA 3QTRA 3JXWA 4O96A 5CXHA 5BYZA 5M4IA 3IG7A 3BU5A 3G33A 3PPJA 2UUEA 4FZFB 3IQ7A 3NUSA 4YZNA 5L8JA 2B4SB 2YWPA 5DT0A 2B9HA 4MAOA 3LCTA 3LJ1A 3A7HA 4RBLA 4ENXA 4NEUA 2VO0A 4GK2A 5HVKA 5HESA 2GTNA 3F2AA 2QURA 4WSYA 2R3IA 1NT2A 4XNEA 4NM7A 3HDMA 3LXLA 3CS9A 1O6KA 1M2RA 2GU8A 4YP8A 5J79A 5KKRC 3V8SA 3AKKA 2Y6OA 4G17A 2BIKB 4V0GB 2GNIA 4O2ZA 5HE1A 2G2IA 4YHJA 2VAGA 3SQQA 2PTKA 4H58A 1OIYA 5A4CA 1ZY5A 3LCDA 1ZOGA 2XF0A 1I09A 3CQEA 4ZTHA 4EH2A 1MQBA 3HMOA 3O7LB 4JR7A 4FOCA 4NTTA 3HLLA 5F4NA 4ZJVA 3ZMMA 4KUJA 3LFFA 3AGLA 4YJPA 3JR1A 4FZ6A 2XS0A 3A62A 5BV3A 1VJYA 4MBJA 2HY0A 5LMBA 2VWYA 3FZTA 2WMUA 4CMOA 4E8AA 1Q41A 4RWJA 4NM0A 1XBBA 5HG8A 2W06A 3ETAA 4ZMEA 3EKKA 2W5BA 5TT7A 2YEXA 4KKEA 4BDDA 3NYOA 4M69A 2P33A 4TWNA 1SVGA 2IVTA 3ENMA 4A4LA 1OL2A 4EWHA 4L52A 5KMLA 5IQFA 1U59A 5D7VA 2HYYA 2BKKA 1UKHA 2IF8A 3K3JA 4IJPA 4IVAA 5CT7A 4ZTSA 3REPA 2YM6A 3UG1A 5DR9A 3NAYA 3RPOA 4ACCA 1Q8UA 4AT3A 1APME 2ZB0A 4DHZA 2J0JA 4KIOA 3MH0A 4G6LA 5EHLA 4YJVA 3DQXA 3KRWA 4I4EA 2VX0A 4CRSA 4P2KA 4E20A 2W4JA 4LL5A 3I81A 3QQGA 4TWPA 3FZOA 3VBVA 1Q61A 5J8IA 3QC4A 2J4ZA 1Z57A 3ORIA 4F0FA 3LW0A 2WMTA 2ITTA 3PA4A 3QWKA 4K33A 4U3ZA 5M4CA 3TKIA 1A48A 4GKIA 4Z3VA 5HQ0A 5M53A 3UDZA 3UVRA 4DA5A 2BUJA 3OVVA 4U40A 5CAVA 4CG8A 3Q6UA 2UZEA 5CTPA 3E8CA 4RJ5A 5M4FA 2VTOA 4ASXA 3KU2A 4ZS0A 3S0OA 2W1IA 4ZTQA 3RPSA 4AACA 5CU2A 4PPAA 4KKHA 2CLQA 4FZ7A 3GU5A 4IAAA 2E9UA 3C5IA 1Y91A 4U81A 3RKBA 4DT9A 4FK3A 4MBLA 4D1SA 3O17A 4CRLA 3P78A 2R3LA 3AC1A 3F5XA 2IZRA 3FSKA 4IZYA 5B2MA 2WNTA 2WU6A 3LIJA 3AKJA 1MP8A 4AAAA 2H6DA 4F7NA 2C6KA 4WA9A 5LCJA 1OECA 4QMLA 4C36A 3H4JA 2J0MB 3EQPA 4IVCA 4F09A 3DZQA 3ZFXA 4OLIA 3G0EA 3OWLA 4GIHA 3SKCA 3DJ6A 3HDNA 2HELA 3QA8A 2XJ1A 2RG5A 4X2JA 3P7BA 1DS5A 2J6MA 3U8WA 4IBMA 4C4JA 4BJJA 2HCKA 4FSUA 3P5JC 3ZUVA 2GNGA 2JGZA 3NUPA 2A27A 5AR8A 4RQVA 3FLZA 1GZKA 2CN8A 3FXZA 1YHVA 4FT7A 5CEOA 5IMXA 2Y4IC 5B0XA 1LEWA 1SZMA 5EK7A 5CSHA 5CLPA 4M0YA 4PQNA 2BZHB 2ZOQA 5FWKK 3RM7A 4NIFA 3EN6A 4LGHA 5IMEA 4C3FA 2H8HA 1CKJA 2B9IA 3E7VA 3ROYA 2GHMA 2BALA 2PVFA 4WT6A 3NLBA 4Q5EA 3WF7A 1KE6A 4A9TA 3DBQA 5LVMA 3UPZA 4ZP5A 3O8TA 1Q3DA 2JKQA 4UEUA 3GU6A 5DYJA 1OKYA 3EQHA 2WTDA 1QPJA 3R7EA 4FKTA 1W2CA 2WQMA 3BX5A 3TI1A 3FHRA 1TQIA 3G0FA 4DITA 4ITIA 3O23A 3KL8A 2JIVA 3GT8A 3ITZA 5ITAA 5LOHA 3GFWA 4NW5A 4TZRA 3QAME 4FEQA 1G5SA 3EQDA 3W32A 4C3RA 1I44A 4JL9A 3TUDA 3RNYA 4GKHA 3D5XA 2XNGA 1K9AA 2IZUA 3QCQA 4PPCA 1TFFA 3PDTA 1EH4A 5CZHA 2XYNA 4FV7A 5ANGA 1XH6A 3NW6A 4H39A 3D15A 4ASDA 1Q4LA 4FVPA 1WBOA 2YM7A 5IG1A 4HNFA 5FXQA 1H8FA 4X3FB 3C0HA 2WIHA 3TXOA 4ENYA 1WBNA 4E1ZA 5M07A 3PA3A 3F9NA 4A4OA 4LV7A 5KMJA 3DS6A 4B8LA 4E93A 3FC2A 4JLCA 4XG9A 2NPQA 4F9AA 4Q2AA 4MYGA 2CLXA 3QRIA 3AGMA 2C6MA 2XCHA 4XLIA 3FQHA 3W0OA 2GNLA 2X81A 2XBAA 3HMMA 4ZLYA 4IDVA 2VD5A 2XANA 5AR4A 3QTQA 4WRSA 4G3CA 5L2IA 2FVDA 4QMUA 3DY7A 4WD5A 2HY81 3HMNA 3UIMA 4LOOA 5DIAA 4I3ZA 2PPQA 1QPEA 4WG4A 3OT8A 4LL0A 2ZYBA 4YTFA 5L2WA 4ZK5A 4PL4A 3ENHA 1P2AA 4V04A 1CSNA 4UMTA 3ZXZA 2VGPA 3ZRKA 5HX6A 1OKZA 1FGKA 2YCSA 5JQ5A 4UX9A 4GK4A 4XRLA 4YJRA 4J71A 3RPRA 3MH2A 1UA2A 4P5ZA 3BBTB 1L3RE 3LXPA 4OW8A 3D7TA 3ORKA 2Z60A 2H9VA 2YJRA 4F0IA 4DC2A 4FZAB 4QQCA 4MD9E 2YHVA 2JITA 4GT5A 1ZXEA 3QHWA 1UU9A 2YCRA 2C3IB 3FXXA 4K6ZA 2J9MA 3FMLA 2GHGA 3R0TA 4OAVB 5EM5A 1O6LA 4R7BA 4PP9A 2XNEA 2EWAA 4MTAA 2GNFA 4D4SA 4JJRA 4G6OA 3VS3A 2UZVA 3ZFMA 4AXEA 2VTQA 4K77A 4I6QA 3QBNA 1UNLA 4R1VA 4M69B 4A9RA 1U46A 1YQJA 3R63A 2QO2A 2CDZA 3FSFA 2O63A 5JSMA 2WU7A 5GZAA 3HX4A 3VUTA 1KE5A 3KMUA 3H10A 5E1EA 1ND4A 2UW3A 4NYEA 3EFWA 3FHIA 3LFCA 4FA2A 2EXCX 2IVSA 3DZOA 3N4VA 1Q8TA 4W4XA 3NSZA 3QX4A 4GT4A 2QQ7A 3R1YA 4AS0A 1XHAA 4U5JA 5KBRA 3MA6A 4UY9A 1PHKA 2E9PA 4GK3A 3DXQA 2HENA 4O38A 4P90A 1ZOHA 4JIKA 3MIAA 1H25A 2F57A 5FTGA 3PXFA 4GU9A 4X2GA 5JFWA 1VR2A 3V5LA 2HZ0A 3PWDA 4FTCA 5BUEA