4G3CA

Crystal structure of apo murine nf-kappab inducing kinase (nik)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
342
structure length
315
Chain Sequence
PVEEYLVHALQGSVSSGQAHSLASLAKTWSDNEGVLLTEKLKPVDYEYREEVHWMTHQPRVGRGSFGEVHRMKDKQTGFQCAVKKVRLEVFRVEELVACAGLSSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLIKQMGCLPEDRALYYLGQALEGLEYLHTRRILHGDVKADNVLLSSDGSRAALCDFGHALCLQIPGTETHMAPEVVMGKPCDAKVDIWSSCCMMLHMLNGCHPWTQYFRGPLCLKIASEPPPIREIPPSCAPLTAQAIQEGLRKEPVHRASAMELRRKVGKALQEVGGLKSPWKGEYKEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords NF-kappa-beta-inducing kinase
publication title The crystal structure of the catalytic domain of the NF-kappaB inducing kinase reveals a narrow but flexible active site.
pubmed doi rcsb
source organism Mus musculus
total genus 111
structure length 315
sequence length 342
chains with identical sequence B
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2012-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4g3cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4g3cA01
3KF4A 2W1CA 3GOPA 3MYGA 4KKGA 4EK8A 4PNKA 2XIKA 1PXMA 3DQXA 3UVRA 4ACHA 3IDCA 3OEFX 2WO6A 2R2PA 3EYGA 4G3EA 4YJRA 3OROA 5HKMA 3L8VA 5CU4A 5JEBA 5M4FA 1ZMUA 4QPAA 4RT7A 5AV4A 2PZ5A 1GZ8A 2C6EA 4V01A 4DT9A 2UVXA 3VAPA 2DQ7X 4BTJA 4EQMA 3ORLA 2JGZA 4RFZA 1XJDA 2JIVA 3DAKA 4FTNA 3OW3A 4FK6A 5HD7A 3CJGA 5HGIA 4C2WA 1ZRZA 3LMIA 1T45A 2PWLA 4D1ZA 4X0MA 2JKQA 5G1XA 4K9YA 4ACMA 3N4TA 3EQIA 4XRJA 2BZHB 3QQUA 3Q6WA 3TCPA 2GHMA 4L42A 4XG8A 2WU7A 5HG7A 4A9RA 1KUTA 4BZDA 2AUHA 3QZHA 4Z9LA 1IAJA 3FEGA 3TV7A 1CMKE 4YHFA 2XNPA 2VO7A 2YIYA 2O5KA 3AMYA 4FKUA 4U40A 4XG2A 4C4IA 3NUYA 1QPEA 3BZ3A 5HO8A 3DA6A 4KIQA 3ZFXA 4Y83A 4EH8A 4TYHA 4AGDA 1U4DA 3EL7A 2VO0A 5FXSA 4ASEA 2C5XA 4QMSA 4MVFA 2RF9A 3OBJA 1JSUA 2OXDA 2QD9A 3SW4A 2P2IA 3GP0A 4R3RA 2ITVA 2PVHA 1L8TA 4EBWA 4H58A 3SX9A 5BQ0A 2OJGA 2RSVA 2ERZE 5CEPA 2KULA 3R71A 5CEQA 3C4FA 1IEPA 3Q5ZA 4QD6A 2F2UA 2ITOA 3W2SA 2ZV2A 4XHKB 2WIHA 3QGWA 4AN3A 2REIA 5GZ9A 2BRHA 1G8AA 4P90A 3TL8A 4XG3A 2B4SB 2CGXA 5TE0A 1Y6AA 2XMYA 2GCDA 3AD6A 2ITQA 5IUHA 4CYJA 4I6FA 4EH4A 2PULA 3QBNA 4U3YA 5AUTA 3KGAA 5C4LA 5IA3A 5HQ0A 4MXXA 4GFMA 4O0UA 4GT3A 2YEXA 3S3IA 5F95A 4J95A 1S9IA 4OTIA 5M57A 3QD3A 1DS5A 5JRQA 2BHEA 3UYTA 1DM2A 3T9TA 3FXXA 4PL3A 4U5JA 5LWNA 4EH5A 4AZWA 2EB3A 2XRWA 2VX1A 4IW0A 4LI5A 2KTYA 5AM6A 2ETMA 3D5VA 3D83A 3EZRA 3FL4A 3MH0A 4NSTA 4NZWB 4EOIA 5CEMA 3MBLA 3EKKA 3UP2A 4USEA 1FGIA 1E1XA 2OKRA 3ANRA 3C0IA 4RWJA 2C6LA 4RLKA 4BKYA 2G01A 2RKUA 3D4QA 4M14A 4E6QA 2QHMA 2W05A 3F66A 3W2PA 3SVVA 3AC2A 5CEOA 1J1BA 2B54A 2EWAA 4B8LA 2A2AA 1YWVA 3VVHA 3I7CA 4CTCA 4LM5A 4RSSA 4RZWA 3UO6A 2E9PA 5EM5A 5C27A 2XNEA 4KIOA 3CSVA 3A62A 4DE4A 5L6PA 2WU6A 1JBPE 4DFUA 2FSMX 2FA2A 3D5WA 3ERKA 2WD1A 4AE6A 4F6UA 1UWHA 3KXZA 4FV3A 4PMTA 4ZTNA 3D0EA 4F6WA 3PXRA 2BRGA 2RFSA 1XBAA 2B9IA 4QMZA 5LVMA 1WVYA 4IHPA 1XO2B 4FKRA 3KRWA 3ZUUA 2YFXA 3LFNA 3ANQA 4QQTA 5LMKC 3IG7A 3CTJA 2OU7A 3UOHA 4ZXTA 1JSVA 3PJCA 1TQMA 4FTMA 5CNNA 3E92A 4QMUA 3RGFA 2V55A 4NU1A 2OFUA 4M15A 2PZRA 2Y0AA 3OXIA 4OT6A 4UEUA 4AG8A 4BDCA 2GQSA 3F5UA 5HVYA 2OG8A 3VRZA 2OZOA 3U4UA 3IO7A 2WQBA 2W1ZA 3HV4A 3K54A 3SD0A 3UODA 4MQ2A 4NM3A 5J9ZA 3KMMA 3UC4A 2R4BA 3NGAA 3TNWA 2HXLA 5HBJA 3OHTA 3DLZA 3U54A 3MH3A 3QFVA 2XEYA 4ANQA 3LXPA 4G16A 3SQQA 3FC1X 4E1ZA 4FUXA 4EOOA 4G5JA 4F7SA 4X3FB 4Q5HA 3NW7A 4LOOA 4JX3A 2IJMA 4RVKA 2G2FA 1YI3A 4GT5A 3QC4A 3HMOA 3QRJA 5DEYA 2HW7A 4WBBB 1GZOA 4JRNA 3VIDA 4YNOA 3UIUA 3G0EA 5L2QA 4BDEA 4DH8A 1OL6A 2QR7A 3GC7A 2HELA 2UZEA 1U54B 4EOLA 3MPAA 3C5IA 2Z2WA 4JQ8A 4W8EA 2QKWB 4YTFA 2XJ0A 1SNUA 3V6SA 2P33A 4BCQA 5C8NA 3JXWA 5EDPA 4H36A 5KCVA 1APME 4CT2A 3R8PA 3DBEA 2O63A 2VTHA 3ORMA 3VUHA 3C0HA 3UG2A 3R9RA 3E8CA 3FXWA 2BDFA 1M2PA 4G1WA 4UYAA 5ETCA 1H8FA 1BUHA 1OKZA 3IS5A 4FEUA 1O9UA 4BN1A 3MB6A 3KA0A 4TPTA 3VBYA 3M11A 1NVQA 2JDVA 3U9CA 3DS6A 3OTUA 5AM7A 3TJCA 4E5BA 2YM8A 4C4HA 1YXUA 5CS6A 2FSTX 3R8ZA 4WNKA 2QOOA 2SRCA 1NT2A 4NEUA 2O0UA 4FKTA 4CGAA 4G6LA 4IB3A 4F1MA 2Z60A 5BUEA 3WI6A 1A48A 3DJ7A 4U43A 1KE8A 4QMYA 3CPCA 2WMRA 2OI4X 3EQBA 4D2VA 3VS6A 4DGMA 3PIZA 5FP6A 3RNYA 4CKIA 1A9UA 2FO0A 4MF1A 3VJNA 2EXCX 3FQHA 3I6UA 3RALA 3O23A 4ACDA 2R3NA 4Q9ZA 3ENMA 2BKZA 1OBDA 3BPRA 1NVRA 2J90A 5J1VA 4IACA 4YTCA 3LFQA 4UMRA 3KMUA 5HIBA 4MBJA 3KF7A 1Y91A 3DFAA 4WT6A 3JY0A 1CKIA 4HOKA 3P78A 5CF6A 1Y57A 1NXKA 4FZ6A 1XH7A 4KAOA 5F1ZA 4C34A 3VBTA 2FSLX 2ZV9A 4QNAA 3QCXA 4RIXB 4U41A 4FKPA 4CZUA 3QLGA 4G6NA 5KO1A 2FVDA 2IW8A 1PXLA 4CMUA 2CPKE 3ET7A 3GB2A 2QHNA 1OL2A 3R1YA 5E8WA 3R7VA 3PRIA 3P7AA 5AUUA 3FQSA 2VTRA 1PXJA 4JJRA 3QTRA 4YLJA 3W1FA 5CAOA 4R3CA 5E91A 3THBA 3P7CA 4UALA 2ZAZA 4NTTA 2QOQA 2GPHA 3BBWA 4G17A 5L2SA 5LJJA 4AW2A 2WMVA 5CEIA 1XKKA 4G3CA 3SLSA 1K9AA 3AD5A 3BEAA 3PZHA 3UYSA 1S9JA 2J0LA 4BCKA 5GINE 2UW0A 4W8DA 3RP9A 3QTQA 4FIHA 3MY1A 5B2MA 5IDNA 2QOHA 4XP0A 4BWKA 5EYMA 4C62A 3ZFYA 3I7BA 1OKYA 4IJPA 4FIJA 4U44A 4MF0A 4QP3A 3MVLA 4YJOA 4G3GA 5KZ0A 5IA2A 4D28A 5IEYA 3L9MA 1YW2A 3TIZA 2IZUA 4FKSA 4AN2A 5M44A 2YJRA 4U6RA 3U8WA 2BFXA 2XK8A 4ANSA 5AUYA 2YZAA 3ZC6A 4O84A 4OGRA 3C5UA 3FKNA 2DS1A 5CX9A 2XIXA 4PX6A 2GNLA 3TKIA 5BPYA 4O0VA 3ROCA 3C4EA 4QMWA 4X3FA 3PPKA 4K77A 4EH7A 4CKJA 5AV0A 4QTAA 3F7ZA 1J7IA 2X6EA 1IASA 3AMBA 3EN7A 5IQIA 2ZM1A 4AX8A 4QYYA 3DB8A 4W9WA 5JFVA 2WTIA 3AC1A 1Q8WA 2Z7RA 3R63A 1AD5A 1K3AA 5AIRA 4XBUA 3SV0A 3HYHA 2XUUA 4UX9A 5ETAA 2EVAA 1ZARA 4DCEA 2CCIA 4MCVA 3NYNA 1U54A 4MHAA 2ONLA 4OR5A 4G9CA 5IH5A 4L3PA 2PE1A 4GW8A 4ZOGA 4CFXA 4DEAA 4O21A 4O7TA 4FV2A 4NM5A 3ZDIA 2GSFA 5H8EA 4G9RA 5IPJA 4IIRA 4NFMA 2QU5A 3PSCA 3A4PA 4FTKA 5AP3A 2ITTA 5KBRA 4I93A 2VTIA 2OJFE 5AADA 3LHJA 1YHSA 2XNNA 2CGWA 4FTQA 5L3AA 4WSYA 2OK1A 2BFYA 3K2LA 3R7YA 4GYIA 3TZ8A 4XG6A 4GKIA 4HNFA 3SA0A 3WZEA 1P5EA 4YBJA 3FI8A 2UW6A 3C7QA 5GIPE 2JDRA 4RC3A 4FV7A 3QRKA 4YHJA 2ITYA 1K2PA 5DGZA 5HU9A 4FKWA 5ANJA 1DAYA 5A4CA 1ZAOA 3QCSA 4BCMA 5B2KA 1ND4A 2BKKA 4M69B 4IMYA 1OPKA 4ZTQA 5E8ZA 4GRBA 4IBMA 3RKBA 3SRVB 3EQRA 4BDIA 4BCPA 1OL7A 2FYSA 3OUKA 3W33A 4USFA 4J96A 4KSPA 3VJOA 5I0BA 1H0VA 5TKDA 2VUWA 4LMUA 3RNIA 3HMPA 4FT9A 4UXLA 4EWQA 1IA9A 5BYYA 2VWUA 3EB0A 5KMNA 3ORXA 4PNIA 4A9TA 2W1DA 4C58A 2H9VA 1WVWA 4AT4A 4D2SA 4HCVA 4ARKA 4QP7A 2CN8A 3R22A 4E6DA 3C4CA 3UZPA 3E7OA 5BVDA 3BGZA 1UU8A 2BAKA 2YM6A 4MNFA 4DG3E 4EOJA 4QPMA 4LOPA 4EYMA 3HRFA 3O51A 4FTLA 4IX5A 2JEDA 3C13A 4U9AA 3RWQA 4A7CA 2JITA 1PY5A 2WMSA 3MA6A 5CU6A 5FQDC 4FMQA 5F4NA 4KWPA 3UO5A 2FSOX 4ACGA 4MXAA 2C6DA 3DPKA 1V1KA 4TWPA 4AACA 3UPZA 3NPCA 5KMLA 3DXPA 4R7HA 3ZS5A 5LQFA 2V7OA 3ALNA 5JN2A 5IISA 3O8UA 5M09A 3ZDUA 1VYZA 4I5CA 3PXKA 4DFZE 2G1TA 4QMVA 4TKSA 4EHZA 2XZSA 5K4IA 5AUZA 2GDOA 3G33A 3NZ0A 1EH4A 4KS8A 3FI2A 3QHWA 2CCHA 2HENA 4XCUA 3PWYA 1YXVA 2HZNA 5JZNA 5TO8A 3ZH8A 4E4XA 5HTIA 4QQ5A 1YXXA 2BIYA 3ZXZA 3U51A 5A14A 1OECA 3MY5A 1OMWA 4FYOA 2BPMA 3TNIA 4O82A 1F0QA 4LMNA 5EHLA 2VRXA 4DBXA 5HVKA 3RK5A 2BMCA 1QCFA 3P1AA 4FGBA 4NCTC 5BMMA 5AWMA 4AUAA 5AMNA 3VNTA 3F3UA 3ORKA 3Q9ZA 5FRIA 2R3QA 2Y6OA 4BTKA 2H96A 4CKRA 3KRLA 3QTIA 4QMTA 4WA9A 1WBWA 4XOZA 4C33A 5KKRB 3GEQA 2ZJWA 5A4LA 3EQCA 4KKHA 4F0GA 2P55A 3EH9A 4L7FA 3R7GA 4DFNA 3HMNA 4YJVA 5CF8A 2R64A 1U5QA 5I4NA 3QUEA 2F7XE 4RMZA 4IFGA 2GS6A 4EK3A 3MIAA 4LGGA 5CT7A 4EHVA 4EUUA 2QOFA 5C03A 3DKOA 5AR8A 3UBDA 3ZU7A 5BUIA 1XH4A 2HWOA 2HY0A 4EC9A 3WF8A 4GK4A 3WBLA 4M66A 1FMOE 1H24A 1QPCA 2QO2A 3MVMA 4E4MA 1UWJA 3LVPA 3P79A 2F9GA 4MYGA 4ALUA 2YWPA 3CCNA 4CEGA 3MH2A 3MN3A 2W5BA 2YJSA 4DTAA 2BZKB 3RPRA 4BWXA 5AP6A 3BV3A 4X2FA 2R3LA 4F9AA 1BI7A 3SG8A 3BX5A 3EFJA 1VEBA 3TNQB 5KNJA 5BMSA 1YKRA 3PLAE 4C4FA 3OTVA 3I1AA 1RE8A 3V01A 5M53A 4FSNA 4ENXA 4MXZA 3ODZX 4W4VA 2VZ6A 3BYUA 5AP4A 1WFCA 3BQRA 3MJ2A 3F61A 3PXYA 4QO9A 4YZCA 3DDPA 4FTJA 3SRVA 5D10A 5EKNA 4QRCA 2PUPA 5AP1A 3ZYAA 3GXLA 4FA2A 4AW5A 3R2YA 4IAFA 3UQGA 4S30A 4CFUA 3E93A 3QA0A 3V5TA 2GQGA 4FG8A 4U0IA 5EK7A 2OIQA 4L01A 5AR3A 3OCSA 3VS5A 2FH9A 3PY1A 4FOCA 4OAUC 5BVOA 3OCGA 4JXFA 1KE6A 3OY3A 4C36A 2G2HA 4BDAA 3K5UA 1E1VA 4FKGA 4AZTA 2GS7A 1ZMWA 2QNJA 4X3FC 4M8TA 3CGFA 5J79A 1Q8YA 2HY81 3MWUA 5CI7A 2EB2A 3I0QA 4XMOA 3EL8A 3LJ0A 5CF4A 1U5RA 1YOJA 4EH3A 3UOKA 3FMDA 4PUZA 5FG8A 3FMMA 2J50A 4J98A 2HAKA 3TI1A 3QZIA 5DOSA 4B8MA 3FLYA 3CIKA 1KE5A 2X9EA 4DH3A 4F09A 4YZMA 4IAYA 1ZY5A 1M52A 3RVGA 1FMKA 1XWSA 4ZLOA 1YOLA 4Y85A 4J8NA 3NW6A 3KKVA 5E8YA 3DCVA 4KD1A 4TYEA 3ETAA 1W83A 2PPQA 1O6YA 3ZO4A 3BHTA 1CKPA 1Q61A 1IAHA 3PDTA 3V5WA 4F6SA 3EQFA 4QTEA 1CSNA 4DC2A 2ZYBA 4DFYA 1NW1A 3O8PA 4HVGA 3GU6A 4I5PA 3DBFA 3KCFA 3HZTA 1TVOA 5D12A 5F20A 4F9CA 4UB7A 1NY3A 3ZSGA 2RGPA 4CXAA 3IGOA 5D7VA 3PP0A 2VWXA 5IQHA 2J0MB 3F7WA 3VC4A 4IX4A 2C6KA 4DF3A 5I9VA 5FTOA 4CCBA 4DG2E 2VX0A 3IW8A 2J0JA 4FC0A 3GFEA 1PKDA 1H1RA 5JRSA 1M2QA 4D2WA 3F3ZA 4D2RA 4HW7A 3S1HA 5IQAA 4BZOA 1JAMA 2YLFA 1UNLA 3ZC5A 3LIJA 4EOQA 3FL5A 3ATSA 2J2IB 4MWIA 5IQGA 4IDVA 3UOLA 2OICA 3EN4A 3QU0A 3VF9A 2A27A 3PPZA 5E8VA 1P2AA 2XNOA 3PWDA 4LOQA 4DYMA 5J5SA 2OJIA 3WILA 1TQPA 4N6YA 2WMBA 2IVTA 3ELJA 1GY3A 5D9HA 4RJ7A 3UTOA 2R3OA 4DCAA 3FSFA 3QWJA 3JVSA 2BRBA 3QRIA 4HGTA 2C1BA 2YIXA 4OTPA 5LWMA 3H4JA 2BALA 2NRYA 1BKXA 2GNGA 2PVMA 3BU6A 3MJ1A 2OF4A 4J97A 5HE0A 5HNGA 5JQ5A 5D7AA 3R8LA 2YA9A 1PMNA 2X8DA 1FVVA 2GMXA 2H34A 3PVGA 4JBOA 4K2RA 5DPVA 4RWIA 2JDSA 4WG3A 5I5ZA 3LFAA 4C3RA 2PZYA 4DA5A 4FTUA 4ENYA 3WZDA 3WZKA 3QKKA 4ZMFA 1P14A 2RG5A 4FOBA 3V6RA 5H8BA 4RX7A 2JBPA 2X2LA 5HD4A 3B2TA 3PJ1A 3WF9A 4O83A 1RJBA 1ATPE 3O7LD 5HCYA 3W2CA 4ZZOA 1Z5MA 3FY2A 3P0MA 4FSMA 5CSXA 1ZWSA 4L3JA 4PPCA 5B7VA 3QCYA 1WVXA 3LFFA 4JLCA 5ANEA 4ANBA 5KMKA 3DGKA 3OVVA 4RFYA 1A06A 4OUCA 5HG9A 3E3PA 3O8TA 3TACA 2HZ4A 4G34A 5EHYA 4CFNA 3WF7A 3Q53A 3LFDA 3NAXA 1DI8A 2CKPA 2VTSA 2E9NA 4O96A 2I1MA 2XJ1A 5LCJA 1W7HA 5K4JA 2C3JA 3NUUA 5HZNA 3FI3A 4FEQA 4R1VA 2LAVA 4R3PA 4JDJA 4A07A 3OWLA 2YDKA 3E3BX 5A4TA 2JBOA 1LPUA 4Y5QA 1WBSA 3N51A 5HNIX 3OC1A 5HCXA 3DLSA 4M97A 4AOJA 4U80A 2UZLA 2C69A 4FT3A 5HVJA 2WQMA 5DT0A 2C4GA 4BCGA 4XG9A 4U7ZA 1IA8A 3ZZWA 5IQCA 2YWVA 4M7IA 3EFWA 1M2RA 1REKA 3NNUA 4AFEA 5I9XA 4FSWA 4RX5A 4IFCA 4DGGA 3AT3A 3OMVA 4P5ZA 4KIKA 5DT3A 3T3UA 4O7SA 4KSQA 4EZ7A 5JQ8A 3FLSA 4W4YA 4XV3A 4TYIA 5IG1A 1GZKA 5EDRA 2C68A 4O86A 2A1AB 4FODA 2BRMA 4R1YA 3VUKA 4IXPA 3DK3A 4E6CA 2C47A 4M67A 5E9EA 4C37A 5EG3A 5LVOA 3NWWA 3KXNA 3GCQA 3MFSA 5LARA 5HTBA 2XB7A 2C1AA 2E9VA 3LQ8A 3O0GA 3F82A 2C6IA 4FIIA 3FI4A 5IA4A 1P4FA 2BTSA 3UNZA 4HVDA 4NM0A 4WSQA 2BROA 3BBTB 2FUMA 3EWHA 3FYKX 2X4ZA 4G5PA 4C59A 4EKLA 2PTKA 4YUQA 4XS2A 1YDRE 4A9SA 2ITWA 5JFXA 4E6AA 4FNXA 4XX9A 4ZLYA 3N4VA 3NYVA 5EYDA 2UZTA 4IZ7A 1WZYA 2YAAA 3EKNA 2J4ZA 1F5QA 3UMWA 2A4LA 2C5NA 4JBVA 4AU8A 4EOSA 5I3RA 4UBAA 3NEWA 4LV8A 3DZOA 4RIYA 1YWRA 3BIZA 5CXHA 3FHRA 3C1XA 5T68A 5GNKA 4F7LA 4IDTA 5C8MA 4IX6A 4CQGA 4I5HA 4L3LA 3D9VA 1YI6A 4C3PA 5FEEA 3CPBA 3DT1A 5K0XA 5LOHA 4U3ZA 4MD7E 3ZLYA 1PYXA 3A7GA 4BL1A 3UZRA 3D7TB 4ITIA 4XP2A 4DBNA 2R3GA 4LRKA 4LRMA 2YDIA 3GGFA 3PJ2A 5AUVA 5C9CA 1Q24A 3MY0A 4ONAA 3UVQA 2J51A 3MI9A 4ZSEA 5AP7A 1H4LA 3AD4A 4QP6A 2W99B 4E73A 4F64A 5K9IA 4BDBA 1KOAA 4MKCA 2J5FA 4O1OA 4YSJA 2OXXA 3KRJA 5L6OA 3DAJA 4PMPA 4TY1A 4AA4A 4DN5A 3TV4A 5HO7A 5AR5A 2BAJA 1R39A 4DGOA 2OF2A 5EQPA 4O0TA 2VTOA 2F57A 3CJFA 3HECA 2PMNX 3Q04A 4GMYA 3R7EA 4FEWA 2IPXA 3MW1A 3FYJX 5CNOA 3ZEPA 5AP0A 4G6OA 3NVMB 4MEDA 4AAAA 3IQ7A 3F6XA 3UVPA 3CKXA 3FMNA 2Z7LA 4ZSAA 3E8EA 3L8XA 3NIZA 3EYHA 4JL9A 5M07A 2QVSE 3OT8A 2VTLA 2Q0NA 2O8YA 2BHHA 4ERWA 2JC6A 2R3JA 3QUDA 3ZM4A 3LFSA 3F5XA 1UVRA 4K11A 3G90X 4WUAA 4AP7A 4LGDA 2VV9A 3MPTA 4RJ6A 1WCCA 5IQEA 2CGUA 4FV0A 2UW7A 2C0TA 2ETRA 3RZFA 3EQGA 5KKRC 3QAME 1KV2A 3LQ3A 4X21A 4IB0A 4QMLA 1JKKA 3R8UA 3OWKA 3KVWA 3AGMA 3VF8A 3V8SA 4UWCA 5CF5A 4BDDA 1FVRA 4ZEGA 1YDSE 4YMJA 4ZTMA 4R5SA 4XEYA 1YWNA 1ZYJA 3EN6A 5AP2A 3Q4UA 3CY2A 2HW6A 5AAEA 3L9LA 3KREA 4BDJA 3NSZA 4GCJA 3TZ9A 2E2BA 4RJ5A 4IAKA 4O7VA 3RBWA 3WZJA 5DMZA 3OBGA 4RA4A 3IW6A 4FNZA 4QP8A 1GIIA 4KINA 4Y46A 2CLXA 4HCTA 4FV9A 4ZTLA 1SVHA 4QMXA 3DV3A 2YM7A 3OXTA 4HCUA 4CT1A 2F49A 4PQNA 5E7RA 2A19B 5KX8A 3KVXA 4WNPA 2BVAA 4UMPA 2R3MA 2RIOA 3D7ZA 1H08A 4WOVA 4X7QA 1HOWA 3G5DA 4W9XA 3UE4A 4BI0A 5I9YA 2XNBA 3KXHA 4HYHA 3KY2A 1Q8ZA 3VO3A 1Y8YA 2XEZA 3ZBFA 5HBEA 3SOCA 4C0TA 1CKJA 1BL7A 4IC7A 4JX7A 2FGIA 4N70A 4O2ZA 1SVEA 2OIBA 3E8DA 4YPSA 4ZP5A 2B9FA 3HGKA 5ACBC 3ORTA 3R00A 2B1PA 2GNHA 2PZPA 3O50A 4MXOA 5AUWA 3POZA 3CTQA 1YHWA 4H3BA 5AAFA 4N4SA 5LMBA 1OIYA 1KOBA 4OLIA 2BCJA 5IQDA 3VHEA 3Q4TA 1ZOHA 2XK4A 4PPBA 2YITA 3IW7A 4F1TA 2P3GX 2PVJA 3OCTA 5H8GA 3D5UA 4GFGA 5BVWA 5AA8A 3D7TA 1SNXA 4GG5A 2Y4IB 4PTEA 5CAPA 1ZZ2A 4BIEA 3HA8A 4FKLA 2HWPA 4D2PA 3VRYA 4JIAA 1H28A 2VWIA 5HE2A 2XYUA 4RZVA 5KHWA 3RPOA 1PHKA 3NNXA 1JQHA 2YDJA 3GENA 5DFPA 3DXQA 2PZIA 3AC5A 3DQWA 2JFMA 4TNDA 3NX8A 5BVKA 2PMIA 2J0IA 3CQEA 1AGWA 3R30A 4PL5A 3COKA 4U45A 3IDPA 4QMOA 2YIWA 4WRSA 3QALE 4ZSLA 2B9HA 3GBZA 3WYXA 3PUPA 4QTBA 3ACKA 3U9NA 2UZDA 3DOGA 3Q9WA 4JVGA 5C01A 2W1IA 3MPMA 3QZGA 1XBBA 3LCKA 4TW9A 4DH7A 1B39A 4P7EA 5FTGA 3G6HA 3LKMA 3FBVA 4QTDA 3QRTA 5AR7A 5CQUA 3C4WA 5JGBA 4FSQA 3K3JA 4RC4A 4TTHB 5HIDA 1GOLA 1SMHA 3MVHA 4NKAA 3ZLXA 3PRFA 5HG8A 3FC2A 2UVZA 4I24A 3BLRA 4HYIA 5E1EA 2QO9A 3ORIA 3QQHA 3PSBA 3FUPA 5FUTA 1OUKA 1JSTA 1IRKA 2Z7QA 2IW9A 2CNQA 5JK3A 3A7FA 2V7AA 4XV2A 4B6LA 4C61A 4TWOA 2W1GA 4BCIA 3FLZA 4MX9A 3PFQA 1ZOGA 2EUFB 2XKEA 5CSPA 4DLJA 3O71A 4BBEA 3R73A 5EW8A 4MBLA 4EH9A 4EOMA 4PP7A 4UZDA 5DT4A 4FBXA 1UU7A 3F3WA 4C4JA 4N57A 1H07A 3VBQA 3QX4A 2WMUA 4G31A 3FE3A 5EI6A 4DH5A 4ERKA 4L45A 3R8VA 4BGGA 4FKOA 3DU8A 4L9IA 4RX9A 5CXZA 2X7OA 2XIYA 3QKLA 4I4EA 5A6NA 4WO5A 3I0OA 3ZO1A 3R6XA 2CLQA 2PVLA 4A4XA 3NYOA 4E26A 3LCDA 4CLJA 2QU6A 2I0HA 3WF5A 1URCA 3LLTA 1BX6A 3WF6A 3GC0A 4FV5A 3ALOA 3CC6A 3T3VA 4O7YA 4AZSA 1H1WA 4Z7HA 4JQ7A 4WD5A 2BR1A 5DVRA 5GZAA 3HL7A 5J1WA 3FLWA 4WKQA 1QL6A 3UC3A 4C3FA 3A8XA 5IUGA 3S00A 5IMEA 4RLLA 3QZFA 5CSHA 4FV8A 4ZS4A 2YN8A 4GKHA 4TWCA 1W98A 5EM7A 4HZRA 3QD2B 4CD0A 4ASDA 3S95A 4UMQA 4D9TA 3S0OA 1I09A 2YM4A 4QQJA 3TN8A 3ROYA 5H9BA 2IZTA 2X81A 4I0TA 4IB5A 1YOMA 4EWHA 4IWPA 3GNIB 1KE7A 2PE0A 3UGCA 4M12A 4RX8A 4YZ9A 2VWYA 2WEVA 3PIXA 4RIWA 4OW8A 3EZVA 4FSZA 3DTCA 4I94A 5IA1A 5A54A 3MTLA 4IZAA 2IWIA 3KU2A 3PE1A 4S31A 4PPAA 3HV7A 5CTPA 4CV9A 1O6KA 3RCJA 4E8AA 2WMWA 2VTPA 4EHGA 4I92A 3PXZA 4EKKA 3BELA 3CGOA 3SXFA 1P4OA 4FVQA 4RVLA 1MP8A 3NAYA 4FNWA 4O0XA 3RAKA 3TV6A 4XLVA 2C0IA 3L8PA 5ANGA 4WBOA 4DTKA 1SVGA 2PMOX 3F2AA 4CFMA 4D1XA 5IH6A 3IPHA 5FGKA 1OIUA 4OTWA 5EOLA 5BNJA 3NCZA 2UZNA 2GNJA 4NK9A 5FM3A 1U46A 4PDOA 1R1WA 1R0PA 3B8QA 4IWQA 4RQKA 3DK7A 4V0GB 2QONA 2YISA 3O96A 3G6GA 5FWKK 2IVSA 3FPMA 2PUUA 4IZ5A 5E8UA 4B7TA 4JBQA 1Q3DA 3A7IA 3EQDA 3TZ7A 3H0ZA 2CSNA 4JDHA 2QOIA 4U8ZA 4R77A 5DEWA 3QGYA 5FEQA 3JVRA 4O6LA 5GZ8A 3BI6A 4I5MA 3IK3A 4PTGA 2R9SA 2BAQA 2CHLA 2Y7JA 3WE4A 5C26A 5CSWA 3AC4A 1Q3WA 4MQ1A 3Q5IA 5HEZA 1XR1A 3RAIA 4ACCA 2ZB0A 3QLFA 2R0UA 1VZOA 4MD8E 3RHXA 2XK7A 2VD5A 3A60A 2PUNA 2P2HA 3GC8A 5AUXA 5G6VA 3MV5A 1UA2A 2HIWA 3IECA 4ZTHA 3QXOA 3T8OA 4GV1A 3OOGA 3BEGA 3V3VA 4AOIA 3N4UA 2ZMCA 5KZIA 4TWNA 3GC9A 4BB4A 1UNHA 1REJA 4LG4A 4I23A 3LE6A 2UZOA 4KA3A 4GVAA 5FBOA 5TT7A 3KMWA 2XKCA 3SXSA 5C4KA 3FZPA 1J1CA 5ANKA 3Q4CA 2QG5A 5M08A 4CTBA 3ODYX 2OIDA 5E8SA 3O17A 3DXNA 4JR7A 4FZ7A 1YVJA 3W16A 3D2IA 4NM7A 4UWYA 3BYMA 4ZY4A 4D5KA 2JAVA 4AFJA 2Y9QA 4BDKA 3DFCB 2PL0A 1JKSA 3OD6X 3QTUA 4DHFA 4RG0A 4H05A 4L8MA 4AT5A 1GZNA 2HCKA 3HDNA 4AGWA 3I5ZA 3GU8A 2XM9A 3GU4A 3KK8A 4QYHA 4ASXA 4Y73A 4YGAA 4HVHA 4IJ9A 5KUPA 3SOAA 3GFWA 2C3IB 5F94A 2ZM3A 5K5XA 2VWZA 4CYIA 5EFQA 2I0VA 3MTFA 2YCRA 1J3HA 4ID7A 3BV2A 2GU8A 4JR3A 4W4XA 4EHEA 5JKGA 4PV0A 4BGHA 3LCTA 4YJNA 3I6WA 4LQMA 3FLQA 3KXXA 2CKOA 1KV1A 3Q96A 3FXZA 3F5GA 4YPDA 3H9OA 4FV6A 2ZV7A 3KK9A 4AF3A 4DEBA 4WG4A 4CMOA 4NTSA 3CS9A 3HDMA 3EQPA 3LFBA 3ORNA 3PZEA 4KBCA 2CDZA 2XIRA 4HJOA 4YC3A 1OPLA 3VW8A 3TDVA 4BY9E 1R0EA 4ZIMA 2YCFA 2ZB1A 4K0YA 5CWZA 3RJCA 4B99A 4CCUA 3UQCA 1ZMVA 4L53A 3F69A 2Y8OA 3POOA 3NRMA 3U4WA 4ANLA 3QQJA 1OGUA 3A7HA 4AWIA 1YRPA 3RI1A 2PY3A 3HNGA 4RQVA 4JBPA 3COMA 4YZNA 3FMHA 5J95A 2XJ2A 2YCSA 3Q52A 3VBXA 3DZQA 2ZM4A 1FOTA 1JOWB 3HA6A 3S4QA 3WIGA 4V0GA 1H1PA 5FLFA 3CD3A 3PA4A 3LM0A 2IVVA 2XS0A 3P5KA 2C5VA 2WHBA 5DR6A 4DEHA 2W5AA 2J6MA 1V0PA 2VX3A 5D1JA 3E7VA 2WNTA 3P86A 4YHTA 4ZTSA 4YTIA 4XJ0A 1OL5A 2X4FA 4UZHA 3KEXA 2E9OA 2R3PA 4CQEA 2R3IA 4GH2A 4Q9SA 4O0YA 4MAOA 2O65A 3Q60A 4S33A 3FZOA 5IKWA 3LLAA 4F0IA 2PVYA 4HYSA 3PY0A 4LUDA 4YC8A 4GSBA 4PL4A 4TYJA 4K8AA 3ZBXA 3ZMMA 4BGQA 3NDMA 4BIBA 2OFVA 3PG1A 2AYPA 3GCVA 4Q2AA 3V5PA 2WMXA 2GTMA 4PMMA 2JKKA 5LMAA 3JR1A 2XBAA 1H00A 3FKLA 3W2RA 2V5QA 3W10A 4AZEA 4E93A 1Q8UA 3AMAA 5CU0A 2XK9A 2OO8X 4YJQA 3TKHA 3BLQA 3LMGA 5CLPA 3ZUVA 4XNEA 1BI8A 2IO6A 2R5TA 4UY9A 4FTIA 4JS8A 3QHRA 4QQCA 2YACA 4O1PA 5DRDA 3ZLSA 4M0YA 3BWFA 2C6OA 4EEVA 1H1SA 2XYNA 4FNYA 2VTNA 4QMMA 2VTMA 4FG7A 4LYNA 4F9BA 4KIKB 2IZRA 4YSMA 4IZYA 2ONLC 1WMKA 5DE2A 4JT3A 3PVUA 2R3HA 4MWHA 3GU7A 5FTQA 4OTFA 3R83A 3NVKI 4IADA 2Y4IC 5B0XA 4QP2A 3DNDA 3PXFA 3FLNC 4TRLA 3FPQA 3Q9YA 1OKWA 3R7IA 5IEVA 3UMXA 4E7WA 1CTPE 4QT1A 3NCGA 4O6EA 5A6OA 5L2WA 1J7UA 4K6ZA 5M55A 1QPDA 4F99A 3FQEA 5I9WA 3T9IA 3BCEA 4Z16A 4ZSJA 4BYJA 3AT2A 4L67A 1IG1A 2BILB 2AC3A 2J5EA 1WBOA 4F7NA 3F3VA 4U97A 4C4GA 3L1SA 2UZWE 3R21A 2PMLX 3GCPA 3I4BA 1XH5A 3HRBA 4NL0A 1JWHA 1SYKA 3C4ZA 3P7BA 3WZUA 2R3FA 4O81A 3CY3A 2Q0BA 4F9YA 1XH8A 2C6TA 3II5A 4FF8A 4C4EA 4H1MA 1MQBA 4WRGA 5L8KA 3NUNA 3HLLA 3UO4A 1YQJA 1UU9A 3ZO2A 4D4VA 2F2CB 4Q5EA 3AGLA 4FGRA 4FVRA 2X1NA 1H01A 4RIYB 4NIFA 4A9YA 3LFEA 4L00A 4F08A 1Z9XA 4KB8A 4A06A 1J7LA 3LZBA 4HGLA 4IWOA 3DKGA 3TDWA 4GL9A 4RRVA 2IVUA 3FKOA 4O91A 5L4QA 3FHIA 3SG9A 4H3QA 1L3RE 3AOXA 1XBCA 4F63A 4YU2A 4G3DA 3HP2A 3ITZA 5A4QA 3NUPA 5KMIA 4X3JA 5CZHA 2HK5A 1M7QA 4H39A 4ZTRA 4JI9A 3SGCA 4R7IA 3RINA 3QWKA 1OZ1A 1Q8TA 4IC8A 4MNEB 2EXMA 3L8SA 4O7RA 2JDTA 5HOAA 1ZZLA 2VU3A 2O3PA 3GCUA 4ASZA 3TIYA 5AA9A 3A99A 3LCOA 3WE8A 2W1FA 4WUNA 5HIEA 4NJDA 4JAIA 3R1QA 5A3XA 4BTMA 5AV2A 3NYXA 2Q83A 2R3KA 1W84A 3RHKA 4K18A 3VN9A 5IMXA 1X8BA 2HOGA 2VTQA 3TUDA 5B2LA 4U79A 2W4KA 4FICA 4YBKA 2YABA 4F4PA 4BCOA 2UW3A 3ZSHA 3OCBA 4FSUA 3BLHA 3SKCA 4N0SA 1PF8A 1NVSA 4I6QA 4KNBA 3I5NA 4XUFA 2XK3A 3GT8A 4RPVA 4PY1A 3UIXA 5GJFA 5TOZA 3P08A 3OWJA 3UQFA 4DH1A 1W0XC 3DBCA 3JPVA 2GTNA 4YTHA 1UKHA 1ZYLA 2ITNA 4X2JA 3BRBA 5EQYA 5IF1A 3Q4ZA 2J9MA 2GNFA 4D0XA 3QQGA 4JDIA 3VULA 4D2TA 2ZVAA 2JFLA 5FXQA 4YC6A 4AW1A 4ZJJA 3KRRA 3OOMA 4DT8A 2G9XA 2CNUA 3FY0A 4ALWA 5HBHA 1Q99A 2VN9A 3QL8A 5EYCA 4O7LA 3HMMA 2WZJA 2VGPA 3BYOA 4D1SA 4WIHA 3VUMA 4CZTA 3DTWA 4QP1A 3R28A 4JQEA 3NUXA 3G2FA 3GOKA 1OKVA 2B7AA 1Y8GA 1PYEA 3PE2A 4GT4A 4XG7A 3TXOA 5EW3A 4A4OA 5K3YA 4XP3A 4AA5A 4P5QA 5GHVA 4IX3A 4R7BA 2X9FA 5EYKA 5CVFA 4IB1A 5M56A 3UOJA 1R78A 1Y6BA 1PMEA 5FP5A 3EHAA 5A9UA 5HX6A 3OY1A 3PVBA 4FKIA 3HV3A 5AX3A 4F7JA 2PE2A 3K3IA 3R9DA 4DEDA 5H3QA 4CFWA 3QQLA 4LV5A 2RFEA 4I4FA 5F9EA 4GG7A 3BGPA 4F9WA 5DHJA 5JT2A 2WB8A 4Z3VA 3DKFA 4EK4A 1YXSA 4J99A 3CKWA 5AV1A 4RBLA 1LP4A 3VUIA 1JVPP 3ZFMA 2I40A 2GFSA 2RL5A 3F2NA 1PXKA 4FZDB 4IVAA 2F4JA 3U87A 4CV8A 5KMMA 1M17A 3QC9A 3QKMA 4BHZA 4M0ZA 3EN9A 2OWBA 3G9LX 5KBQA 4ITJA 5L8LA 3BHHA 4FTCA 3BHVA 4RFMA 4CG9A 1OBGA 3C0GA 4FV4A 3FZRA 2WIPA 3V8WA 1VR2A 1ZOEA 2WOTA 2B53A 2GHGA 3EOCA 3TNPC 5BVFA 2ITZA 2UW4A 3FZSA 2CJMA 4MBIA 5JGAA 1OUYA 3C9WA 4EL9A 4ZY6A 2QOCA 4AA0A 4AOTA 4DFXE 3NUAA 3CTHA 3ULZA 4NKSA 4O27B 3AXWA 4HNIA 5FM2A 1TKIA 5LXMA 4FTOA 5EM6A 3QA8A 3QRUA 2WELA 2VNWA 2XRUA 5GJDA 4CZYB 2UUEA 3VHKA 2XH5A 3Q2MA 2XVDA 3M2WA 4APPA 2ITUA 1QMZA 3H9RA 4KRDA 3NW5A 4O38A 3ZRKA 4MNEA 4WG5A 2WXVA 3R1SA 4HZSA 5DIAA 2W96B 3DBQA 3W2OA 4FL1A 4YURA 3R8MA 5JSMA 4E4LA 5E8TA 3HAVA 4R78A 3MFRA 1B38A 3BU3A 3ZM9A 1VYWA 2JIUA 5AV3A 4DITA 4FX3A 4BIDA 3PXQA 4DFLA 5HU3A 3F3TA 4ZZMA 4CVAA 1MRUA 2OJ9A 4GUBA 2H6DA 4IANA 4WNOA 5E8XA 1HCKA 1H25A 3L9NA 4E3CA 1H27A 2V22A 3Q9XA 4MD9E 4QTCA 2X39A 5LVLA 3FZ1A 1Q41A 2VAGA 3MH1A 3FSKA 5H2UA 1ZXEA 4FKVA 3BE9A 4BBMA 4FZFB 3IGGA 2C3LA 3EJ1A 3LJ2A 5BVEA 3TTIA 4RA5A 1OITA 3TKUA 3PPJA 5A4EA 3R01A 3FDNA 2GHLA 2QCSA 4GU6A 4Y95A 5E92A 2QOLA 4D5HA 3E88A 5AEPA 4OTGA 3W32A 5JMSA 1E9HA 3HVCA 3QD4A 4BYIA 4Y5HA 3AC8A 5D11A 4S2ZA 5K0KA 1YI4A 2HXQA 2ZDTA 4S34A 3GVUA 4UMTA 4RC2A 5HG5A 4E20A 4YO6A 2WTKB 2QURA 3RAHA 4EK5A 4EC8A 2C6MA 2ZV8A 4U81A 3UNJA 4I0SA 1LUFA 5T6KA 5HLNA 1OVEA 3MA3A 5JFWA 4LFIA 2XCHA 5EI2A 3RK7A 3SC1A 3DBDA 4FVPA 1DAWA 4JOAA 3GI3A 4Y8DA 3NR9A 1JLUE 5M51A 3U6IA 3V5QA 3ZHPC 4PTCA 1OI9A 5AX9A 4O0RA 1Q97A 3TWJA 4AT3A 3DKCA 5CEKA 4RWKA 4LUEA 4MTAA 2OW3A 2VTTA 4HVSA 5IA5A 4M68A 3N9XA 4EH2A 2BIKB 3G0FA 4L6QA 3RWPA 2Y6MA 3COHA 3ORPA 3R9HA 3TZMA 1ZYCA 3OXZA 3UDBA 4BTFA 4BCNA 4QYGA 4GK3A 4NT4A 2JKOA 1JNKA 4ANOA 3VW6A 4A9UA 4CMTA 3I81A 4EK6A 5EOBA 2WTWA 2QLQA 4TZRA 2XM8A 2W1EA 4NW5A 4DINA 5HO6A 2X7FA 2QKRA 2BTRA 3KRXA 3RPYA 4J1RA 5HLWA 4M13A 3ZLWA 4BHNA 4XH6A 3D14A 2UZUE 3LM5A 3OUNB 5CY3A 3ZSIA 4MK0A 3ENHA 5HI2A 3NUSA 1V0OA 3FV8A 4ZJIA 4C35A 4CLIA 1XH6A 4RIWB 2PSQA 3CEKA 4UWBA 3SW7A 4I6HA 3D15A 4DGNA 2NRUA 2X7GA 3GQLA 3BHUA 1ERKA 2P0CA 4GIIA 4YO4A 4RGJA 5M4IA 3ZOSA 2VTJA 4X6QC 1BMKA 1KSWA 1GIJA 3IKAA 5CENA 4D58A 5LVPA 3NNWA 4D4SA 3QQKA 3TTJA 5HNBA 4NJ3A 3MS9A 4KBKA 2YHVA 3R9NA 3JY9A 3M1SA 3R9OA 4XG4A 2ITXA 3CP9A 3NMUF 3QYWA 4BZNA 5CALA 1GJOA 4BC6A 3ZRLA 5J9YA 2X8IA 2P4IA 4RJ8A 4EOKA 2BRNA 4BR3A 3SHEA 3R1NA 3ZZEA 4PP9A 4D4RA 4J71A 2C30A 4RJ4A 3Q2JA 4YJSA 3E5AA 4CRSA 1KWPA 2NPQA 2GNIA 4I0RA 4FIEA 1PXIA 2V62A 4O7ZA 3TG1A 3ULIA 3LJ1A 1FBNA 3IONA 4XV9A 5ANIA 5IEXA 4FKJA 5EH0A 1H26A 3LPBA 4O7NA 3PLSA 5EHOA 2QQ7A 1PXPA 4J52A 1GAGA 4AW0A 4UYNA 2FB8A 3W8LA 3OF0A 3F88A 3Q32A 4L7SA 2QODA 3HX4A 1FQ1B 3GQIA 2DWBA 1PMVA 4K1BA 3ZXTA 3AQVA 3QYZA 4ZZNA 3VUDA 5J5TA 4EUTA 4NWMA 3V51A 4E5AX 5EDQA 4IAAA 2E9UA 4NCTA 4BDFA 2WMQA 1M14A 3SAYA 5I3OA 3PJ3A 4EOPA 4FI1A 3GUBA 2X2KA 5CYIA 4FEXA 1T46A 3I60A 2BUJA 5DR9A 3AT4A 4B0GA 3RPSA 3FZTA 3EFLA 3OS3A 4EORA 5M4CA 3DAEA 4XOYA 1U59A 3JYAA 5EKOA 4AQCA 5EW9A 5L2IA 5LVNA 2RFDA 4UV0A 3BWJA 4QYEA 3ZUTA 3AC3A 1PRYA 5CASA 2X0GA 3MDYA 4FL3A 3RTPA 5HX8A 3TM0A 3B2WA 1HCLA 4GU9A 2W9FB 2WKMA 2UZBA 4HPUE 5IA0A 3D2KA 3U6JA 1PJKA 2UVYA 1RQQA 2W9ZB 3CQUA 4HGEA 4G3FA 1AQ1A 5DR2A 2I6LA 3VS0A 4QP4A 4YNEA 3MB7A 3VS7A 3COIA 5FXRA 3HKOA 4PDPA 5ACKA 5CT0A 5J7HA 4A4LA 3HV5A 3QTXA 4QNYA 4C2VA 4HYUA 3QTWA 5JZJA 4PDYA 4PMSA 5M06A 1BL6A 2WPAA 4I3ZA 4L52A 5L8JA 5L6WL 4P2KA 4C8BA 4WHZA 3S2PA 4EZ5A 2ZMDA 3CD8A 5IQBA 5HE3A 5IU2A 3D5XA 5DG5A 1DI9A 4V04A 4J8MA 4JRVA 3VS2A 4AN9A 2W1HA 3QXPA 3FJQE 4JDKA 2OLCA 1OM1A 2PK9A 3FMJA 5TR6A 3GCSA 4RVMA 2XNMA 4BI1A 4CFVA 2YIQA 4ZAUA 2YCQA 2WTJA 1STCE 3DDQA 4IVDA 5E1SA 3WIKA 4MH7A 1CDKA 4FT0A 4J53A 4APCA 4CSVA 4FTAA 4BBFA 3EN5A 4DEIA 2YLEA 2RG6A 3OEZA 3RK9A 4DFBA 4FG9A 2GQRA 3OG7A 3NS9A 2LGCA 5FBNC 2QR8A 4JAJA 4GYGA 5CVGA 4FKQA 3LMHA 3KFAA 1W82A 2OBJA 3A61A 4BKZA 4NH1A 4PDSA 5JGDA 4YJTA 5CVHA 4H1JA 5ANOA 2EU9A 3ACJA 5IH4A 1MQ4A 3ID6C 2WMAA 4YZBA 5ICPA 3WOWA 4NW6A 3C51A 3G51A 1MRVA 4B9DA 4ZJVA 2YM3A 2Z8CA 3BU5A 1KE9A 3RM6A 2QI8A 4UN0C 3F2RA 1B6CB 4WNMA 3VBWA 4GJ2A 2OZAB 1CM8A 2R7BA 4KBAA 3P23A 1I44A 2J7TA 4FT5A 3OZ6A 2W4OA 4ZLZA 4C7TA 4R5YA 5A46A 2YZLA 4IEBA 3IOPA 3DJ6A 4CG8A 3H3CA 4DEGA 1OIRA 2CMWA 4F65A 4F0FA 2ITPA 3PA5A 4BKJA 1BLXA 5AJQA 3E63A 3PYYA 3CQWA 3CXWA 3V8TA 2EXEA 2BZIB 2R0IA 1UV5A 3KB7A 3LW0A 3EFKA 3E64A 1GIHA 2XKDA 3KN6A 3CR0A 3UNKA 4QP9A 4EJ7A 4RVTA 4FV1A 4FSTA 2QOBA 3LXLA 4L43A 4NFNA 4ALVA 1YXTA 1SZMA 2NNWB 4AGUA 5AAGA 1TQIA 2IG7A 2O2UA 2WMTA 2IZSA 4GK2A 2W17A 2R3RA 3U55A 3QF9A 3VBVA 2QC6A 4Z55A 1JKLA 5ITAA 3R2BA 4B4LA 5ETFA 3PJ8A 2PVNA 2W5HA 3CE3A 3HRCA 3RAWA 2W0JA 1WBPA 4O0SA 3PA3A 2G2IA 2AC5A 3V5LA 4YLKA 2VWWA 5CAVA 3RCDA 4ANNA 5L2TA 3ZCLA 4L44A 4BICA 3Q3BA 3D94A 3W2QA 2IN6A 4H3PA 4KKEA 3TUCA 3HEGA 5IZFA 2C5OA 3W8QA 3MFUA 5JH6A 5IDPA 3BQCA 2B52A 5HHWA 4C57A 4IAZA 4ANMA 5KMOA 3OW4A 3A7JA 1Q62A 4FZAB 4TL0A 1LR4A 4IQ6A 2B55A 2UW8A 4OBQA 5HE1A 2CKQA 1RDQE 4L68A 5IUIA 3UG1A 4XV1A 1GNGA 2VTAA 3FMLA 4AE9A 4EJNA 5E90A 3DK6A 5AIKA 1WBVA 3W18A 2VO6A 4JIKA 1OB3A 1H1QA 1NA7A 3G15A 4ORKA 3FMEA 4XYFA 4RIXA 2NP8A 5GIOE 3QD0A 2PVKA 3MFTA 2JAMA 3BHYA 1Q5KA 5BVNA 1VJYA 1ZYDA 4BI2A 4FSYA 4D55A 1URWA 3BE2A 2WEIA 3E8NA 4DAWA 1YDTE 5DN3A 3CBLA 4BCHA 1LEWA 4BCJA 4RWLA 3KC3A 4OTRA 4MXYA 4KABA 2I7QA 5HESA 3ZTXA 3MIYA 1BYGA 4OAVB 5T3QA 3OP5A 2XCKA 5LCKA 2G15A 3C4XA 2OXYA 4I21A 3VQHA 2X8EA 4O7WA 3O2MA 2PYWA 4EZ3A 4NIFB 4F70A 5FDXA 3TEIA 3UIBA 1RW8A 2ETKA 2XNGA 5KE0A 3UP7A 4O2PA 3KULB 3MGYA 4CFFA 2PVFA 5HICA 1FGKA 1PXNA 2VWVA 4IH8A 3VWAA 5JFSA 1JKTA 3R02A 2HYYA 4KRCA 2NO3A 5BYLA 3BKBA 4R6VA 4IAIA 3H0YA 2WTKC 3UPXA 4L46A 1XH9A 1O6LA 1IR3A 1F3MC 2YERA 3QUPA 3H30A 2WTCA 4K33A 4USDA 5AP5A 4I1ZA 3TT0A 4IWDA 2OJJA 1M7NA 2XP2A 4JG7A 4BFMA 1FPUA 5J87A 2YAKA 2OZAA 3FAAA 4LRJA 4QMNA 4Z7GA 4QOXA 3PIYA 4GJ3A 3NNVA 3PVWA 4LGHA 2CGVA 2XK6A 5E4HA 4OBPA 3SXRA 4FT7A 2ACXA 4NUSA 3R04A 3JS2A 5BYZA 3R7UA 1V0BA 2CKEA 3A8WA 4XBRA 3VUTA 5J8IA 4BWPA 4FE2A 4W4WA 4HPTE 4RJ3A 4LL5A 5HLPA 5AFVA 4OTDA 2OSCA 2UW5A 4FTTA 2C3KA 2WQEA 3HAMA 5AR2A 5DI1A 3MSSA 1PMUA 2B0QA 3BYVA 3FMKA 4YJPA 3LQ5A 5D41A 5FD2A 2R7IA 3NIEA 4GS6A 4I6BA 3DJ5A 3TNHA 5EQEA 2OH4A 3DB6A 2W4JA 4X2GA 4E4NA 3QQFA 4PRJA 4RIOA 3B8RA 3R0TA 5J7BA 1Q4LA 1XQZA 5EI8A 5DRBA 2YIRA 2OGVA 3DY7A 3NLBA 4HVIA 5BX0A 4ZSGA 3E62A 4OTHA 4UXQA 1LEZA 4IVBA 5ANDA 3KN5A 4P4CA 3P9JA 4YR8A 4JNWA 4O0WA 4M69A 5M4UA 2VWBA 3UJGA 4R8QA 5I9UA 4EONA 5KHXA 4I20A 5HTCA 5CZIA 3QTZA 4DGLC 3VS4A 2ZOQA 2JDOA 4FYNA 4TYGA 4YJUA 5AR4A 4XRLA 1WBTA 3C50A 4BDGA 4TNBA 4AXAA 2VO3A 1PKGA 5K5NA 4FUYA 2WOUA 3EIDA 4X2KA 5I9ZA 3E87A 1JPAA 2Y4PA 4AZFA 3LCSA 2ERKA 3F5PA 2WTVA 3DNEA 3LXKA 3LAUA 3PTGA 4ITHA 4BCFA 2X2MA 4J7BA 2CNVA 2PUIA 2BZJA 4M84A 4OT5A 4BVUA 2C5YA 3QCQA 4GUEA 5CAQA 4CNHA 2A0CX 3Q6UA 1SM2A 5DBXA 4DLIA 2PU8A 3IOKA 5ETIA 4YP8A 4FEVA 3LFCA 2J0KA 4GVJA 2IW6A 3H9FA 2CN5A 4GFOA 5BUJA 2C0OA 3RMFA 4JG8A 3R7OA 1ZY4A 2F7ZE 4AZVA 3RM7A 1G5SA 2QO7A 3HUBA 4IM3A 4TN6A 4EH6A 3ATTA 3ZO3A 2QG7A 4G2FA 2O64A 4FR4A 1OPJA 4Y72A 5EM8A 4AGCA 5J9LA 2H8HA 2B9JA 4EQCA 2VNYA 2HZ0A 3PSDA 3A4OX 3OT3A 3EQHA 4BDHA 3ZONA 3RZBA 5IQFA 2XKFA 1Z57A 3UIMA 3F9NA 4ZK5A 4NYEA 3G9NA 3BGQA 4IM2A 2YM5A 3PG3A 5C8KA 2JD5A 3PY3A 1OL1A 4X6RA 3VS1A 4BRXA 4FTRA 4OBOA 5DNRA 4D9UA 3KULA 1W8CA 4OTQA 4U42A 5HORA 2BDJA 3AG9A 3KQ7A 4BF2A 3FWQA 2QLUA 3MVJA 4TT7A 5CQWA 1FINA 1MRYA 4O22A 4M3QA 4FSRA 3GU5A 2F7EE 2ZDUA 3K5VA 4EI4A 5CU2A 5FDPA 1YHVA 3M42A 3HMIA 3QX2A 4UMUA 5DA3A 4TYHB 3REPA 2JIIA 3P4KA 4KIPA 4QYFA 4DEEA 5C1QB 4S32A 4KS7A 3WYYA 4C38A 5DWRA 4GIHA 2HZIA 1WAKA 3HP5A 4TXCA 2W7XA 2VGOA 4HGSA 4N6ZA 3V04A 4ZMEA 2DYLA 2Z7SA 1UKIA 5CI6A 2WAJA 4DG0E 2XBJA 2BDWA 4ZY5A 3IW5A 2WQOA 2XA4A 2WQNA 4PWNA 4F1OA 4QMQA 5KMJA 1WBNA 5DLSA 4GEOA 1H0WA 3KXMA 5DYJA 3WARA 5CAUA 5CSVA 5HCZA 4IM0A 3KCKA 3LOKA 3RPVA 3HV6A 4CRLA 5LMKA 3ZRMA 3V5JA 1OIQA 2UZVA 3VUGA 3BYSA 1ZYSA 1MUOA 2GFCA 3CLYA 3I79A 2QOKA 3OWPA 3KXGA 2Z02A 1G3NA 2UW9A 2JKMA 2V0DA 3H10A 4XLIA 2DUVA 2I0EA 3TUBA 2XIZA 3KL8A 3QTSA 4FIFA 4JG6A 3O7LB 4LL0A 5CU3A 4D0WA 1UNGA 2WFYA 3JUHA 3PP1A 3A2CA 2XF0A 4EBVA 3HUCA 1UU3A 3MESA 2PVRA 3U6HA 2ESMA 4E5WA 4ZS0A 4II5A 3UZTA 4FIGA 1PXOA 1J91A 1ZLTA 2UV2A 3OFMA 2WGJA 1XHAA 2I0YA 3EMGA 4QMPA 4V05A 3VQUA 4YZDA 3VS3A 1G8SA 5TF9A 3IDBA 2W06A 2WTDA 4EYJA 4AS0A 5DH3A 4DTBA 5FEDA 3LXNA 4PF4A 4MXCA 5GJGA 2JLDA 2PHKA 3ORZA 4X2NA 3W55A 4FL2A 2GS2A 4C02A 5CANA 3L9PA 3SDJA 2RFNA 4FK3A 4QPSA 4IVCA 4KUJA 2OH0E 4D4YA 4EQUA 1R3CA 3TJDA 3ZEWA 3IW4A 2X6DA 4I41A 4IE9A 1PW2A 4YLLA 1QPJA 1FVTA 4I22A
chains in the Genus database with same CATH superfamily
3KF4A 3TMOA 2W1CA 3GOPA 3MYGA 4KKGA 4EK8A 4PNKA 2XIKA 1PXMA 3DQXA 3UVRA 4ACHA 3IDCA 3OEFX 2WO6A 2R2PA 3EYGA 4G3EA 4YJRA 3OROA 5HKMA 3L8VA 5CU4A 5JEBA 5M4FA 1ZMUA 4QPAA 4RT7A 5AV4A 2PZ5A 1GZ8A 2C6EA 4V01A 4DT9A 2UVXA 3VAPA 2DQ7X 4BTJA 4EQMA 3PUFC 3ORLA 2JGZA 4RFZA 1XJDA 2JIVA 3DAKA 4FTNA 3OW3A 4FK6A 5HD7A 3CJGA 5HGIA 4C2WA 3BL7A 1ZRZA 3LMIA 1T45A 2PWLA 4D1ZA 4X0MA 2JKQA 5G1XA 4AXEA 4K9YA 4ACMA 3N4TA 3EQIA 4XRJA 2BZHB 3QQUA 3Q6WA 3TCPA 2GHMA 4L42A 4XG8A 2WU7A 5HG7A 4A9RA 1KUTA 4BZDA 2AUHA 3QZHA 4Z9LA 1IAJA 3FEGA 3TV7A 1CMKE 4YHFA 3PFYA 2XNPA 2VO7A 2YIYA 2O5KA 3AMYA 4FKUA 4U40A 4XG2A 4C4IA 2A98A 3NUYA 1QPEA 3BZ3A 5HO8A 3DA6A 4KIQA 3ZFXA 4Y83A 4EH8A 4TYHA 4AGDA 1U4DA 3EL7A 2VO0A 5FXSA 4ASEA 2C5XA 1G8JA 4QMSA 4MVFA 2RF9A 3OBJA 1JSUA 2OXDA 2QD9A 3SW4A 2P2IA 3GP0A 4R3RA 2ITVA 2PVHA 1L8TA 4EBWA 4H58A 3SX9A 5BQ0A 2OJGA 2RSVA 2ERZE 5CEPA 2KULA 4JMQA 3R71A 5CEQA 3C4FA 1IEPA 3Q5ZA 4FJVA 4QD6A 2F2UA 2ITOA 3W2SA 2ZV2A 4XHKB 2WIHA 3QGWA 4AN3A 2REIA 5GZ9A 2BRHA 1G8AA 4P90A 3TL8A 4XG3A 2B4SB 2CGXA 5TE0A 1Y6AA 2XMYA 2GCDA 3AD6A 2ITQA 5IUHA 4CYJA 4I6FA 4EH4A 2PULA 3QBNA 4U3YA 5AUTA 3KGAA 5C4LA 5IA3A 5HQ0A 4MXXA 4GFMA 4O0UA 4GT3A 2YEXA 3S3IA 5F95A 4J95A 1S9IA 4OTIA 5M57A 3QD3A 1DS5A 5JRQA 2BHEA 3UYTA 1DM2A 3T9TA 3FXXA 4PL3A 4U5JA 1XMLA 5LWNA 4EH5A 4AZWA 2EB3A 2XRWA 2VX1A 4IW0A 4LI5A 2KTYA 5AM6A 2ETMA 3D5VA 3D83A 3EZRA 3FL4A 3MH0A 4NSTA 4NZWB 4EOIA 5CEMA 3MBLA 3EKKA 3UP2A 4USEA 1FGIA 1E1XA 2OKRA 3ANRA 3C0IA 4RWJA 2C6LA 4RLKA 4BKYA 2G01A 2RKUA 3D4QA 4M14A 4E6QA 2QHMA 2W05A 3F66A 3W2PA 3SVVA 3AC2A 5CEOA 1J1BA 2B54A 2EWAA 4B8LA 2A2AA 1YWVA 3VVHA 3I7CA 4CTCA 4LM5A 4RSSA 4RZWA 3UO6A 2E9PA 5EM5A 5C27A 2XNEA 4KIOA 3CSVA 3A62A 4DE4A 5L6PA 2WU6A 1JBPE 4DFUA 2FSMX 2FA2A 3D5WA 3ERKA 2XANA 2WD1A 4AE6A 4F6UA 1UWHA 3KXZA 4FV3A 4PMTA 4ZTNA 3D0EA 4F6WA 3PXRA 2BRGA 2RFSA 1XBAA 2B9IA 4QMZA 5LVMA 1WVYA 4IHPA 1XO2B 4FKRA 3KRWA 3ZUUA 2YFXA 3LFNA 3ANQA 4QQTA 5LMKC 3IG7A 3CTJA 2OU7A 3UOHA 4ZXTA 1JSVA 3PJCA 1TQMA 4FTMA 5CNNA 3E92A 4QMUA 3RGFA 2V55A 4NU1A 2OFUA 4M15A 2PZRA 2Y0AA 3OXIA 4OT6A 4UEUA 4AG8A 4BDCA 2GQSA 3F5UA 5HVYA 2OG8A 3VRZA 2OZOA 3U4UA 3IO7A 2WQBA 2W1ZA 3HV4A 3K54A 3SD0A 3UODA 4MQ2A 4NM3A 5J9ZA 3KMMA 3UC4A 2R4BA 3NGAA 3TNWA 2HXLA 5HBJA 3OHTA 3DLZA 4O4FA 3MH3A 3U54A 3QFVA 2XEYA 4ANQA 3LXPA 4G16A 3SQQA 3FC1X 4E1ZA 4FUXA 4EOOA 4G5JA 4F7SA 4X3FB 4Q5HA 3NW7A 4LOOA 4JX3A 2IJMA 4RVKA 2G2FA 1YI3A 4GT5A 3QC4A 3HMOA 3QRJA 5DEYA 2HW7A 4WBBB 1GZOA 4JRNA 3VIDA 4YNOA 3UIUA 3G0EA 5L2QA 4BDEA 4DH8A 1OL6A 2QR7A 3GC7A 2HELA 2UZEA 1U54B 4EOLA 3MPAA 3C5IA 2Z2WA 4JQ8A 4W8EA 2QKWB 4YTFA 2XJ0A 1SNUA 3V6SA 2P33A 4BCQA 5C8NA 3JXWA 5EDPA 4H36A 5KCVA 1APME 4CT2A 3R8PA 3DBEA 2O63A 2VTHA 3ORMA 3VUHA 3C0HA 3UG2A 3R9RA 3E8CA 3FXWA 2BDFA 1M2PA 4G1WA 4UYAA 5ETCA 1H8FA 1BUHA 1OKZA 3IS5A 4FEUA 1O9UA 4BN1A 3MB6A 3KA0A 4TPTA 3VBYA 3M11A 3W0QA 1NVQA 2JDVA 3U9CA 3DS6A 3VONA 3OTUA 5AM7A 3TJCA 4E5BA 2YM8A 4C4HA 1YXUA 5CS6A 2FSTX 3R8ZA 4WNKA 2QOOA 2SRCA 1NT2A 4NEUA 2O0UA 4FKTA 4CGAA 4G6LA 4IB3A 4F1MA 2Z60A 5BUEA 3WI6A 1A48A 3DJ7A 4U43A 1KE8A 4QMYA 3CPCA 2WMRA 2OI4X 3EQBA 4D2VA 3VS6A 4DGMA 3PIZA 5FP6A 3RNYA 4CKIA 1A9UA 2FO0A 4MF1A 3VJNA 2EXCX 3FQHA 3I6UA 3RALA 3O23A 4ACDA 2R3NA 4Q9ZA 3ENMA 2BKZA 1OBDA 3BPRA 1NVRA 2J90A 5J1VA 4IACA 4YTCA 3LFQA 4UMRA 3KMUA 5HIBA 4MBJA 3KF7A 1Y91A 3DFAA 4WT6A 3JY0A 1CKIA 4HOKA 3P78A 5CF6A 1Y57A 1NXKA 4FZ6A 1XH7A 4KAOA 5F1ZA 4C34A 3VBTA 2FSLX 2ZV9A 4QNAA 3QCXA 4RIXB 4U41A 4FKPA 4CZUA 3QLGA 4G6NA 5KO1A 2FVDA 2IW8A 1PXLA 4CMUA 2CPKE 3ET7A 3GB2A 2QHNA 1OL2A 3R1YA 5E8WA 3R7VA 3PRIA 3P7AA 5AUUA 3FQSA 2VTRA 1PXJA 4JJRA 3QTRA 4YLJA 3W1FA 5CAOA 4R3CA 5E91A 3THBA 3P7CA 4UALA 2ZAZA 4NTTA 2QOQA 2GPHA 3BBWA 4G17A 5L2SA 5LJJA 4AW2A 2WMVA 5CEIA 1XKKA 4G3CA 3SLSA 1K9AA 3AD5A 3BEAA 3PZHA 3UYSA 1S9JA 2J0LA 4BCKA 5GINE 2UW0A 4W8DA 3RP9A 3QTQA 4FIHA 3MY1A 5B2MA 5IDNA 2QOHA 4XP0A 4BWKA 5EYMA 4C62A 3ZFYA 3I7BA 1OKYA 4IJPA 4FIJA 4U44A 4MF0A 4QP3A 3MVLA 4YJOA 4G3GA 5KZ0A 5IA2A 4D28A 5IEYA 3L9MA 1YW2A 3TIZA 2IZUA 4FKSA 4AN2A 5M44A 2YJRA 4U6RA 3U8WA 2BFXA 2XK8A 4ANSA 5AUYA 2YZAA 3ZC6A 4O84A 4OGRA 3C5UA 2XAOA 3FKNA 2DS1A 5CX9A 2XIXA 4PX6A 2GNLA 3TKIA 5BPYA 4O0VA 3ROCA 3C4EA 4QMWA 4X3FA 3PPKA 4K77A 4EH7A 4CKJA 5AV0A 4QTAA 3F7ZA 1J7IA 2X6EA 1IASA 3AMBA 3EN7A 5IQIA 2ZM1A 4AX8A 4QYYA 3DB8A 4W9WA 5JFVA 2WTIA 3AC1A 1Q8WA 2Z7RA 3R63A 1AD5A 1K3AA 5AIRA 4XBUA 3SV0A 3HYHA 2XUUA 4UX9A 5ETAA 2EVAA 1ZARA 4DCEA 2CCIA 4MCVA 3NYNA 1U54A 4MHAA 2ONLA 4OR5A 4G9CA 5IH5A 4L3PA 2PE1A 4GW8A 4ZOGA 4CFXA 4DEAA 4O21A 4O7TA 4FV2A 4NM5A 3ZDIA 2GSFA 5H8EA 4G9RA 5IPJA 4IIRA 4NFMA 2QU5A 3PSCA 3A4PA 4FTKA 5AP3A 2ITTA 5KBRA 4I93A 2VTIA 2OJFE 5AADA 3LHJA 1YHSA 2XNNA 2CGWA 4FTQA 5L3AA 4WSYA 2OK1A 2BFYA 3K2LA 3R7YA 4GYIA 3TZ8A 4XG6A 4GKIA 4HNFA 3SA0A 3WZEA 1P5EA 4YBJA 3FI8A 2UW6A 3C7QA 5GIPE 2JDRA 4RC3A 4FV7A 3QRKA 4BJJB 4YHJA 2ITYA 1K2PA 5DGZA 5HU9A 4FKWA 5ANJA 1DAYA 5A4CA 1ZAOA 3QCSA 4BCMA 5B2KA 1ND4A 2BKKA 4M69B 4IMYA 1OPKA 4ZTQA 5E8ZA 4GRBA 4IBMA 3RKBA 3SRVB 3EQRA 4BDIA 4BCPA 1OL7A 2FYSA 3OUKA 3W33A 4USFA 4J96A 4KSPA 3VJOA 5I0BA 1H0VA 5TKDA 2VUWA 4LMUA 3RNIA 3HMPA 4FT9A 4UXLA 4EWQA 1IA9A 5BYYA 2VWUA 3EB0A 5KMNA 3ORXA 4PNIA 4A9TA 2W1DA 4C58A 2H9VA 1WVWA 4AT4A 4D2SA 4HCVA 2X0OA 4QP7A 2CN8A 3R22A 4ARKA 4E6DA 3C4CA 3UZPA 3E7OA 5BVDA 3BGZA 1UU8A 2BAKA 2YM6A 4MNFA 4DG3E 4EOJA 4QPMA 4LOPA 4EYMA 3HRFA 3O51A 4FTLA 4IX5A 2JEDA 3C13A 4U9AA 3RWQA 4A7CA 2JITA 1PY5A 2WMSA 3MA6A 5CU6A 5FQDC 4FMQA 5F4NA 4KWPA 3UO5A 2FSOX 4ACGA 4MXAA 2C6DA 3DPKA 1V1KA 4TWPA 4AACA 3UPZA 3NPCA 5KMLA 3DXPA 4R7HA 3ZS5A 5LQFA 2V7OA 3ALNA 5JN2A 5IISA 3O8UA 5M09A 3ZDUA 1VYZA 4I5CA 3PXKA 4DFZE 2G1TA 4QMVA 4TKSA 4EHZA 2XZSA 5K4IA 5AUZA 2GDOA 3G33A 3NZ0A 1EH4A 4KS8A 3FI2A 3QHWA 2CCHA 2HENA 4XCUA 3PWYA 1YXVA 2HZNA 5JZNA 5TO8A 3ZH8A 4E4XA 5HTIA 4QQ5A 1YXXA 2BIYA 3ZXZA 3U51A 5A14A 1OECA 3MY5A 1OMWA 4FYOA 2BPMA 3TNIA 4O82A 1F0QA 4LMNA 5EHLA 2VRXA 4DBXA 5HVKA 3RK5A 2BMCA 1QCFA 3P1AA 4FGBA 4NCTC 5BMMA 5AWMA 4AUAA 5AMNA 3VNTA 3F3UA 3ORKA 3Q9ZA 5FRIA 2R3QA 2Y6OA 4BTKA 2H96A 4CKRA 3KRLA 3QTIA 4QMTA 4WA9A 1WBWA 4XOZA 4C33A 5KKRB 3GEQA 2ZJWA 5A4LA 3EQCA 4KKHA 4F0GA 2P55A 3EH9A 4L7FA 3R7GA 4DFNA 3HMNA 4YJVA 5CF8A 2R64A 1U5QA 5I4NA 3QUEA 2F7XE 4RMZA 4IFGA 2GS6A 4EK3A 3MIAA 4LGGA 5CT7A 4EHVA 4EUUA 2QOFA 5C03A 3DKOA 5AR8A 3UBDA 3ZU7A 5BUIA 1XH4A 2HWOA 2HY0A 4EC9A 3WF8A 4GK4A 3WBLA 4M66A 1FMOE 1H24A 1QPCA 2QO2A 3MVMA 4E4MA 1UWJA 3LVPA 3P79A 2F9GA 4MYGA 4AXCA 4ALUA 2YWPA 3CCNA 4CEGA 3MH2A 3MN3A 2W5BA 2YJSA 4DTAA 2BZKB 3RPRA 4BWXA 5AP6A 3BV3A 4X2FA 2R3LA 4F9AA 1BI7A 3SG8A 3BX5A 3EFJA 1VEBA 3TNQB 5KNJA 5BMSA 1YKRA 3PLAE 4C4FA 3OTVA 3I1AA 1RE8A 3V01A 5M53A 4FSNA 4ENXA 4MXZA 3ODZX 4W4VA 2VZ6A 3BYUA 5AP4A 1WFCA 3BQRA 3MJ2A 3F61A 3PXYA 4QO9A 4YZCA 3DDPA 4FTJA 3SRVA 5D10A 5EKNA 4QRCA 2PUPA 5AP1A 3ZYAA 3GXLA 4FA2A 4AW5A 3R2YA 4IAFA 2XAMA 3UQGA 4S30A 4CFUA 3E93A 3QA0A 3V5TA 2GQGA 4FG8A 4U0IA 5EK7A 2OIQA 4L01A 5AR3A 3OCSA 3VS5A 2FH9A 3PY1A 4FOCA 4OAUC 5BVOA 3OCGA 4JXFA 1KE6A 3OY3A 4C36A 2G2HA 4BDAA 3K5UA 1E1VA 4FKGA 4AZTA 2GS7A 1ZMWA 2QNJA 4X3FC 4M8TA 3CGFA 5J79A 1Q8YA 2HY81 3MWUA 5CI7A 2EB2A 3I0QA 4XMOA 3EL8A 3LJ0A 5CF4A 1U5RA 1YOJA 4EH3A 3UOKA 3FMDA 4PUZA 5FG8A 3FMMA 2J50A 4J98A 2HAKA 3TI1A 3QZIA 5DOSA 4B8MA 3FLYA 3CIKA 1KE5A 2X9EA 4O4EA 4F09A 3UDTA 4YZMA 4IAYA 1ZY5A 1M52A 3RVGA 1FMKA 1XWSA 4ZLOA 1YOLA 4Y85A 4J8NA 3NW6A 3KKVA 5E8YA 3DCVA 4KD1A 4TYEA 3ETAA 1W83A 2PPQA 1O6YA 3ZO4A 3BHTA 1CKPA 1Q61A 1IAHA 3PDTA 3V5WA 4F6SA 3EQFA 4QTEA 1CSNA 4DC2A 2ZYBA 4DFYA 1NW1A 3O8PA 4HVGA 3NFFB 3GU6A 4I5PA 3DBFA 3KCFA 3HZTA 1TVOA 5D12A 5F20A 4F9CA 4UB7A 1NY3A 3ZSGA 2RGPA 4CXAA 3IGOA 5D7VA 3PP0A 2VWXA 5IQHA 2J0MB 3F7WA 3VC4A 4IX4A 2C6KA 4DF3A 5I9VA 5FTOA 4CCBA 1VLRA 4DG2E 2VX0A 3IW8A 2J0JA 4FC0A 3GFEA 1PKDA 1H1RA 5JRSA 1M2QA 4D2WA 3F3ZA 4D2RA 4HW7A 3S1HA 5IQAA 4BZOA 1JAMA 2YLFA 1UNLA 3ZC5A 3LIJA 4EOQA 3FL5A 3ATSA 2J2IB 4MWIA 5IQGA 4IDVA 3UOLA 2OICA 3EN4A 3QU0A 3VF9A 2A27A 3PPZA 5E8VA 1P2AA 2XNOA 3PWDA 4LOQA 4DYMA 5J5SA 2OJIA 3WILA 1TQPA 4N6YA 2WMBA 2IVTA 3ELJA 1GY3A 5D9HA 4RJ7A 3UTOA 2R3OA 4DCAA 3FSFA 3QWJA 3JVSA 2BRBA 3QRIA 4HGTA 2C1BA 2YIXA 4OTPA 5LWMA 3H4JA 2BALA 2NRYA 1BKXA 2GNGA 2PVMA 3BU6A 3MJ1A 2OF4A 4J97A 5HE0A 5HNGA 5JQ5A 5D7AA 3R8LA 2YA9A 1PMNA 2X8DA 1FVVA 2GMXA 2H34A 3PVGA 4JBOA 4K2RA 5DPVA 4RWIA 2JDSA 4WG3A 5I5ZA 3LFAA 4C3RA 2PZYA 4DA5A 4FTUA 4ENYA 3WZDA 3WZKA 3QKKA 4ZMFA 1P14A 2RG5A 4FOBA 3V6RA 5H8BA 4RX7A 2JBPA 2X2LA 5HD4A 3B2TA 3PJ1A 3WF9A 4O83A 1RJBA 1ATPE 3O7LD 5HCYA 3W2CA 4ZZOA 1Z5MA 3FY2A 3P0MA 4FSMA 5CSXA 1ZWSA 4L3JA 4PPCA 5B7VA 3QCYA 1WVXA 3LFFA 4JLCA 5ANEA 4ANBA 5KMKA 4DDGA 3DGKA 3OVVA 4RFYA 1A06A 4OUCA 5HG9A 3E3PA 3O8TA 3TACA 2HZ4A 4G34A 5EHYA 4CFNA 3UDSA 3WF7A 3Q53A 3LFDA 3NAXA 1DI8A 2CKPA 2VTSA 2E9NA 4O96A 2I1MA 2XJ1A 5LCJA 1W7HA 5K4JA 2C3JA 3NUUA 5HZNA 3FI3A 4FEQA 4R1VA 2LAVA 4R3PA 4JDJA 4A07A 3OWLA 2YDKA 3E3BX 5A4TA 2JBOA 1LPUA 4Y5QA 1WBSA 3N51A 5HNIX 3OC1A 5HCXA 3DLSA 4M97A 4AOJA 4U80A 2UZLA 2C69A 4FT3A 5HVJA 2WQMA 5DT0A 2C4GA 4BCGA 4XG9A 4U7ZA 1IA8A 3ZZWA 5IQCA 2YWVA 4M7IA 3EFWA 1M2RA 1REKA 3NNUA 4AFEA 5I9XA 4FSWA 4RX5A 4IFCA 4DGGA 3AT3A 3OMVA 4P5ZA 4KIKA 5DT3A 3T3UA 4O7SA 4KSQA 4EZ7A 5JQ8A 3FLSA 4W4YA 4XV3A 4TYIA 5IG1A 1GZKA 5EDRA 2C68A 4O86A 2A1AB 4FODA 2BRMA 4R1YA 3VUKA 4IXPA 3DK3A 4E6CA 2C47A 4M67A 5E9EA 4C37A 5EG3A 5LVOA 3NWWA 3KXNA 3GCQA 3MFSA 5LARA 5HTBA 2XB7A 2C1AA 2E9VA 3LQ8A 3O0GA 3F82A 2C6IA 4FIIA 3FI4A 5IA4A 1P4FA 2BTSA 3UNZA 4HVDA 4NM0A 4WSQA 2BROA 3BBTB 2FUMA 3EWHA 3FYKX 2X4ZA 4G5PA 4C59A 4EKLA 2PTKA 4YUQA 4XS2A 1YDRE 4A9SA 2ITWA 5JFXA 4E6AA 4FNXA 4XX9A 4ZLYA 3N4VA 3NYVA 5EYDA 2UZTA 4IZ7A 1WZYA 2YAAA 3EKNA 2J4ZA 1F5QA 3UMWA 2A4LA 2C5NA 4JBVA 4AU8A 4EOSA 5I3RA 4UBAA 3NEWA 4LV8A 3DZOA 4RIYA 1YWRA 3BIZA 5CXHA 3FHRA 3C1XA 5T68A 5GNKA 4F7LA 4IDTA 5C8MA 4IX6A 4CQGA 4I5HA 4L3LA 3D9VA 1YI6A 4C3PA 5FEEA 3CPBA 3DT1A 5K0XA 5LOHA 4U3ZA 4MD7E 3ZLYA 1PYXA 3A7GA 4BL1A 3UZRA 3D7TB 4ITIA 4XP2A 4DBNA 2R3GA 4LRKA 4LRMA 2YDIA 3GGFA 3PJ2A 5AUVA 5C9CA 1Q24A 3MY0A 4ONAA 3UVQA 2J51A 3MI9A 4ZSEA 5AP7A 1H4LA 3AD4A 4QP6A 2W99B 4E73A 4F64A 5K9IA 4BDBA 1KOAA 4MKCA 2J5FA 4O1OA 4YSJA 2OXXA 3KRJA 5L6OA 3DAJA 4F78A 4PMPA 4TY1A 4AA4A 4DN5A 3TV4A 5HO7A 5AR5A 2BAJA 1R39A 4DGOA 2OF2A 5EQPA 4O0TA 2VTOA 2F57A 3CJFA 3HECA 2PMNX 3Q04A 4GMYA 3R7EA 4FEWA 2IPXA 3MW1A 3FYJX 5CNOA 3ZEPA 5AP0A 4G6OA 3NVMB 4MEDA 4AAAA 3IQ7A 3F6XA 3UVPA 3CKXA 3FMNA 2Z7LA 4ZSAA 3E8EA 3L8XA 3NIZA 2XALA 4DH3A 3EYHA 4JL9A 5M07A 2QVSE 3OT8A 2VTLA 2Q0NA 2O8YA 2BHHA 4ERWA 2JC6A 2R3JA 3QUDA 3ZM4A 3LFSA 3F5XA 1UVRA 4K11A 3G90X 4WUAA 4AP7A 4LGDA 2XARA 2VV9A 3MPTA 4RJ6A 1WCCA 5IQEA 2CGUA 4FV0A 2UW7A 2C0TA 2ETRA 3RZFA 3EQGA 5KKRC 3QAME 1KV2A 3LQ3A 1OGYA 4X21A 4IB0A 4QMLA 1JKKA 3R8UA 3OWKA 3KVWA 3AGMA 3VF8A 3V8SA 4UWCA 5CF5A 4BDDA 1FVRA 4ZEGA 1YDSE 4YMJA 4ZTMA 4R5SA 4XEYA 1YWNA 1ZYJA 3EN6A 5AP2A 3Q4UA 3CY2A 2HW6A 5AAEA 3L9LA 3KREA 4BDJA 3NSZA 4GCJA 3TZ9A 2E2BA 4RJ5A 4IAKA 4O7VA 4QDEA 3RBWA 3WZJA 5DMZA 3OBGA 4RA4A 3IW6A 4FNZA 4QP8A 1GIIA 4KINA 4Y46A 2CLXA 4HCTA 4FV9A 4ZTLA 1SVHA 4QMXA 3DV3A 2YM7A 3OXTA 4HCUA 4CT1A 2F49A 4PQNA 5E7RA 3TYKA 2A19B 5KX8A 3KVXA 4WNPA 2BVAA 4UMPA 2R3MA 2RIOA 3D7ZA 1H08A 4WOVA 4X7QA 1HOWA 3G5DA 4W9XA 3UE4A 4BI0A 5I9YA 2XNBA 3KXHA 4HYHA 3KY2A 3AKLA 1Q8ZA 3VO3A 1Y8YA 2XEZA 3ZBFA 5HBEA 3SOCA 4C0TA 1CKJA 1BL7A 4IC7A 4JX7A 2FGIA 4N70A 4O2ZA 1SVEA 2OIBA 3E8DA 4YPSA 4ZP5A 2B9FA 3HGKA 5ACBC 3ORTA 3R00A 3UDZA 2B1PA 2GNHA 2PZPA 3O50A 4MXOA 5AUWA 3POZA 3CTQA 1YHWA 4H3BA 5AAFA 4N4SA 5LMBA 1OIYA 1KOBA 4OLIA 2BCJA 5IQDA 3VHEA 3Q4TA 1ZOHA 2XK4A 4PPBA 2YITA 3IW7A 4F1TA 2P3GX 2PVJA 3OCTA 5H8GA 3D5UA 4GFGA 5BVWA 5AA8A 3D7TA 1SNXA 4GG5A 2Y4IB 4PTEA 5CAPA 1ZZ2A 4BIEA 3HA8A 4FKLA 2HWPA 4D2PA 3VRYA 4JIAA 1H28A 2VWIA 5HE2A 2XYUA 4RZVA 5KHWA 3RPOA 1PHKA 3NNXA 1JQHA 2YDJA 3GENA 5DFPA 3DXQA 2PZIA 3AC5A 3DQWA 2JFMA 4TNDA 3NX8A 5BVKA 2PMIA 2J0IA 3CQEA 1AGWA 3R30A 4PL5A 3COKA 4U45A 3IDPA 4QMOA 2YIWA 4WRSA 3QALE 4ZSLA 2B9HA 3GBZA 3WYXA 3PUPA 4QTBA 3ACKA 3U9NA 2UZDA 3DOGA 3Q9WA 4JVGA 5C01A 2W1IA 3MPMA 3QZGA 1XBBA 3LCKA 4TW9A 4DH7A 1B39A 4P7EA 5FTGA 3G6HA 3LKMA 3FBVA 4QTDA 3QRTA 5AR7A 5CQUA 3C4WA 5JGBA 4FSQA 3K3JA 4RC4A 4TTHB 5HIDA 1GOLA 1SMHA 3MVHA 3W0OA 4NKAA 3ZLXA 3PRFA 5HG8A 3FC2A 2UVZA 4I24A 3BLRA 4HYIA 5E1EA 2QO9A 3ORIA 3QQHA 3PSBA 3FUPA 5FUTA 1OUKA 1JSTA 1IRKA 2Z7QA 2IW9A 2CNQA 5JK3A 3A7FA 2V7AA 4XV2A 4B6LA 4C61A 4TWOA 2W1GA 4BCIA 3FLZA 4MX9A 3PFQA 1ZOGA 2EUFB 2XKEA 5CSPA 4DLJA 3O71A 4BBEA 3R73A 5EW8A 4MBLA 4EH9A 4EOMA 4PP7A 4UZDA 3AKKA 5DT4A 4FBXA 1UU7A 3F3WA 4C4JA 4N57A 4DHIB 1H07A 3VBQA 3QX4A 2WMUA 4G31A 3FE3A 5EI6A 4DH5A 4ERKA 4L45A 3R8VA 4BGGA 4FKOA 3DU8A 4L9IA 4RX9A 5CXZA 2X7OA 2XIYA 3QKLA 4I4EA 5A6NA 4WO5A 3I0OA 3ZO1A 3R6XA 2CLQA 2PVLA 4A4XA 3NYOA 4E26A 4MUQA 3LCDA 4CLJA 2QU6A 2I0HA 3WF5A 1URCA 3LLTA 1BX6A 3WF6A 3GC0A 4FV5A 3ALOA 3CC6A 3T3VA 1W2DA 4AZSA 4O7YA 1H1WA 4Z7HA 4JQ7A 4WD5A 2BR1A 5DVRA 5GZAA 3HL7A 5J1WA 3FLWA 4WKQA 1QL6A 1G8KA 3UC3A 4C3FA 3A8XA 5IUGA 3S00A 4DHJA 5IMEA 4RLLA 3QZFA 5CSHA 4FV8A 4ZS4A 2YN8A 4GKHA 4TWCA 1W98A 5EM7A 4HZRA 3QD2B 4CD0A 4ASDA 3S95A 4UMQA 4D9TA 3S0OA 1I09A 2YM4A 4QQJA 3TN8A 3ROYA 5H9BA 2IZTA 2X81A 4I0TA 4IB5A 1YOMA 4EWHA 4IWPA 3GNIB 1KE7A 2PE0A 3UGCA 4M12A 4RX8A 4LV7A 4YZ9A 2VWYA 2WEVA 3PIXA 4RIWA 4OW8A 3EZVA 4FSZA 3DTCA 4I94A 5IA1A 1W2FA 5A54A 3MTLA 4IZAA 2IWIA 3KU2A 3PE1A 4S31A 4PPAA 3HV7A 5CTPA 4CV9A 1O6KA 3RCJA 4E8AA 2WMWA 2VTPA 4EHGA 4I92A 3PXZA 4EKKA 3BELA 3CGOA 3SXFA 1P4OA 4FVQA 4RVLA 1MP8A 3NAYA 4FNWA 4O0XA 3RAKA 3TV6A 4XLVA 2C0IA 3L8PA 5ANGA 4WBOA 4DTKA 1SVGA 2PMOX 3F2AA 4CFMA 4D1XA 5IH6A 3IPHA 5FGKA 1OIUA 4OTWA 5EOLA 5BNJA 3NCZA 2UZNA 2GNJA 4NK9A 5FM3A 1U46A 4PDOA 1R1WA 1R0PA 3B8QA 4IWQA 4RQKA 3DK7A 4V0GB 2QONA 2YISA 3O96A 3G6GA 5FWKK 2IVSA