4G3CA

Crystal structure of apo murine nf-kappab inducing kinase (nik)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
342
structure length
315
Chain Sequence
PVEEYLVHALQGSVSSGQAHSLASLAKTWSDNEGVLLTEKLKPVDYEYREEVHWMTHQPRVGRGSFGEVHRMKDKQTGFQCAVKKVRLEVFRVEELVACAGLSSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLIKQMGCLPEDRALYYLGQALEGLEYLHTRRILHGDVKADNVLLSSDGSRAALCDFGHALCLQIPGTETHMAPEVVMGKPCDAKVDIWSSCCMMLHMLNGCHPWTQYFRGPLCLKIASEPPPIREIPPSCAPLTAQAIQEGLRKEPVHRASAMELRRKVGKALQEVGGLKSPWKGEYKEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NF-kappa-beta-inducing kinase
publication title The crystal structure of the catalytic domain of the NF-kappaB inducing kinase reveals a narrow but flexible active site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 111
structure length 315
sequence length 342
chains with identical sequence B
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2012-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4g3cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4g3cA01
4AZWA 3ZCLA 3ORTA 4O0UA 4DGMA 3COHA 4F99A 2Y4IC 4BCIA 4Z7GA 4BKJA 2BDFA 5TF9A 4EH2A 1M17A 1GJOA 4YJPA 3CE3A 3ZS5A 4NWMA 2OK1A 4ZTNA 4BRXA 1CTPE 5M06A 5H3QA 3A8XA 1ZY5A 1MRUA 2DS1A 2GHMA 4AU8A 2R7BA 3B2TA 3DKFA 3REPA 4FG8A 4TN6A 3LCTA 4NKAA 3RM6A 2WOTA 3GU4A 3UOKA 3R7YA 5FEQA 4E5BA 4O7NA 5I3OA 3ENMA 4C7TA 1Y91A 4GS6A 1OGUA 2YM8A 1ATPE 3DS6A 4GG7A 3EN9A 4PY1A 1J3HA 2YCFA 3MVJA 3ORMA 3SA0A 3PRFA 4HYHA 2OJFE 4KA3A 5IQIA 2R3QA 2Y6MA 2J0JA 4GJ3A 5AR4A 3FLZA 3R7VA 3FV8A 3TCPA 5EM8A 2YIRA 3U4UA 4D9UA 1OL7A 2FGIA 4NKSA 3QYZA 4F70A 3DTWA 3TM0A 4FTKA 2QOOA 2G9XA 4ZSLA 4UZHA 1OIUA 5EQEA 1YQJA 2FYSA 4X3FB 4C59A 3DPKA 3MH3A 4HZSA 4OTRA 3OCGA 4KBAA 4OTWA 4S30A 4S34A 4U43A 4PRJA 4YC6A 4E73A 5D10A 4BCKA 2ZV7A 3D4QA 4NFMA 5DNRA 5J7BA 2HK5A 5T68A 2BIKB 2XJ0A 2QONA 4Y5QA 5EH0A 4FZAB 4U3ZA 5JZNA 3R7UA 1XBCA 4XV1A 5IEXA 3FEGA 4PV0A 3PXFA 3OBGA 2EVAA 2V7AA 2ZV9A 5HE3A 4EOMA 3MFRA 3NVMB 1PYXA 4EUUA 4U41A 4I6BA 3DA6A 4L45A 4LG4A 1XH9A 2J0IA 2NP8A 3PSDA 2PVFA 5AR5A 3EKKA 3KRJA 4AFEA 1BYGA 3AT2A 4EKKA 3QALE 1CKPA 2Y4PA 3D7TA 3RAKA 2Y4IB 4HCTA 5DH3A 3N4VA 3ZO2A 1O6YA 3CD3A 2VTJA 4A07A 4TYEA 4XG4A 1AGWA 4P90A 3RGFA 4L3LA 3Q3BA 4DEBA 3QYWA 2OH0E 2RFDA 3S2PA 4LL5A 4K9YA 3AOXA 2OIQA 4TYGA 4F6SA 4MXXA 3HP2A 2B9JA 2XRWA 2PZ5A 4C34A 3V5TA 3AMYA 2QLUA 3C5UA 3R63A 5JN2A 4I6QA 4KBKA 1UNLA 2OJ9A 4F7LA 5I9UA 5IA0A 3UYSA 4PX6A 4C8BA 3PSCA 5ITAA 1VYZA 2J50A 3FBVA 3MVHA 1JBPE 2F7EE 5GZ8A 2V7OA 4G2FA 4USEA 3BLRA 3DDQA 5IEVA 5J87A 3EZVA 3DXQA 1H8FA 2C3KA 3L8SA 3V04A 3BU5A 3C4CA 2PMIA 2YISA 3BEAA 5KMOA 3FLYA 4Z55A 4MTAA 2I0YA 2X4FA 4FV8A 3SRVB 4O7SA 4X21A 3FLWA 4YHTA 2WNTA 3TNWA 5LOHA 3O71A 1GIIA 3IO7A 4QP8A 3VJOA 4NCTC 4YSJA 4RC2A 1GZNA 4U42A 3BBWA 4IVCA 3QQJA 5HG5A 5GINE 4JJRA 3GP0A 3PZHA 3ZDIA 2A4LA 1U5QA 4I93A 4ZLOA 3BIZA 4RWLA 5CSWA 5TKDA 3PXKA 5A4EA 3BHTA 2GFSA 5EW9A 2X6DA 3G2FA 3VF8A 4B7TA 2B53A 1Q8TA 3GU8A 4FL3A 2VTOA 2A2AA 5IU2A 1YDRE 1GIJA 1M14A 2H96A 4BVUA 3I81A 2PVLA 5BYLA 3HMPA 2WQMA 5ETCA 3E8CA 2X39A 3R7EA 4E1ZA 4R3RA 1WBWA 5BMMA 2VGPA 4AW2A 2FA2A 3AC5A 3MVMA 2C0OA 3FQHA 3UOHA 3L8VA 5FUTA 1R1WA 4OAVB 3QTXA 2E9VA 2OLCA 4RJ7A 3BHUA 4JT3A 4F09A 3D94A 5T6KA 5CVGA 2ZOQA 2PVJA 2W4OA 1ZOGA 5CEQA 1PXKA 1FQ1B 1YXSA 5AWMA 3EB0A 4BKYA 4V0GB 2REIA 3F66A 4D4YA 3NZ0A 3UIMA 2ETRA 4D58A 2P33A 1V0OA 5AV0A 3BHVA 2JKMA 4P5QA 3OCTA 3NIEA 2BAJA 4BI2A 4F7SA 4BDHA 4CVAA 1OECA 3U87A 1OL1A 4AW5A 3BGPA 2J4ZA 4AZEA 2IZRA 5EYMA 3ZOSA 2X6EA 1AD5A 3ORKA 2WIPA 3FMNA 5E8XA 5K9IA 4QTEA 3BLQA 4S33A 3FZRA 3SOAA 3IONA 4QMTA 1SMHA 2HENA 4XJ0A 2ITQA 4UEUA 4QP7A 2C3JA 3IGOA 2XCHA 4U81A 4EOOA 4IANA 4D28A 5CF8A 4C57A 3H0ZA 3FPMA 5J1VA 3ORLA 4EI4A 4CV8A 2VWWA 5M4IA 2Z60A 3EWHA 4I5HA 3FSFA 4L7FA 5A3XA 4EK4A 3HV3A 3VJNA 3TUBA 1UKIA 5JFWA 2VO3A 4EOJA 3O50A 1SVGA 1XQZA 2A1AB 3ZRLA 5FGKA 1Q8YA 4IX4A 4IJPA 3CGFA 3WBLA 4MYGA 4NIFA 4R7BA 3R8LA 3MSSA 5DR2A 5IUGA 5KUPA 2CNVA 4QT1A 4Q9SA 2OG8A 3VW6A 3F88A 4KIKB 3O17A 4YZMA 4BCGA 4I4EA 4O84A 4MKCA 4QNAA 3UC3A 5H8BA 3VQUA 4A9TA 3HGKA 3ZXTA 5LVOA 3A62A 3TTJA 1VEBA 3O23A 4EQUA 4FODA 4GT4A 5A54A 1ZYSA 3QTIA 3A61A 5ANIA 3C5IA 2J51A 1JSUA 4J1RA 4F1TA 4EC9A 2R2PA 3N4TA 4QP1A 3W2CA 4HVSA 5JGDA 3PVBA 3GVUA 4C61A 2BVAA 2C6KA 4UV0A 3PVUA 4L7SA 2FVDA 4QQCA 3ZO3A 4FMQA 4CT2A 3QFVA 4D4RA 4W4XA 4QPAA 3A7GA 2HXQA 4F6UA 4JRVA 5KMIA 3MH1A 2VWYA 4O1PA 4JNWA 4LL0A 3ERKA 4R7IA 1OKWA 1PMVA 3OMVA 3LMHA 2IZTA 3D2KA 4JRNA 4W8EA 2VWZA 4BIDA 5IA3A 4AA0A 1PYEA 3IG7A 3HRFA 4XV3A 4FEUA 4WSQA 1IAHA 5AP0A 4HVHA 1L3RE 3ROYA 5KMLA 2Z7RA 3D14A 3QRTA 3RAIA 4BWPA 5AIKA 4J71A 5EK7A 5IF1A 2IPXA 1O6LA 2NO3A 2G2IA 5I9WA 3SDJA 4MXZA 4ZLYA 2WD1A 4XMOA 2W1EA 4AP7A 2R3RA 1XHAA 2P55A 4IDVA 3PP1A 4IAZA 5FEDA 3EQIA 4GKIA 4OLIA 3GFEA 4AGCA 3EL8A 3COKA 1QL6A 2WU7A 4GIHA 4HYSA 4M0YA 5DRDA 4BGGA 3PDTA 3PY1A 3TN8A 2HAKA 4F0FA 5AV2A 4LQMA 4DITA 1UU9A 2VZ6A 4FSRA 3Q04A 2ZM3A 2CCHA 3ET7A 4YTFA 5BVOA 4CKRA 1IAJA 5D9HA 1F3MC 3A2CA 3BCEA 3QA0A 4KIQA 4PDPA 3RZBA 2BIYA 4X3FA 5DYJA 3QF9A 3LFEA 4X2JA 2C1AA 1NY3A 3F5XA 4EKLA 4EZ5A 3BEGA 3ROCA 2FH9A 1WAKA 3DJ5A 1UKHA 4CXAA 4IACA 4DINA 2UVYA 4ANQA 4CYJA 3O7LB 1J7LA 5GJGA 2HXLA 5E9EA 1OM1A 2OWBA 2JAVA 2VNWA 3RWPA 3UQGA 4C3RA 2CN8A 4ZIMA 4YZNA 3ZZWA 5IUIA 1OBGA 2GCDA 3SKCA 1Q8ZA 3I4BA 3WZKA 4O7WA 3R0TA 3PA5A 1XH5A 2ERZE 4G6NA 4ENYA 3MS9A 4O96A 2YABA 3P4KA 2H8HA 2DUVA 4E20A 5L2IA 3H9RA 4CZYB 3PRIA 5DT0A 3W2SA 3AC2A 4NYEA 5B2MA 4DCEA 3IW7A 5AR3A 2W7XA 1GZKA 4EL9A 4BBEA 5AR7A 5AUUA 5FRIA 1ZYJA 3LQ8A 4YJUA 3R7OA 4CRSA 2UW6A 3PA3A 4CTBA 3RAWA 1GNGA 2G01A 2XNNA 3CTQA 5DWRA 3POOA 3Q6UA 3QTUA 1DAYA 3UYTA 4RX5A 2JKKA 2C6IA 4TNBA 4BI1A 4I41A 3B8RA 2QCSA 4BDEA 2PPQA 5CYIA 4DEEA 3MBLA 5T3QA 3MGYA 2PK9A 4QMQA 3IW4A 4PMSA 4MBLA 4EZ7A 5F95A 1PMNA 1VYWA 3SRVA 4L01A 2OO8X 5J9YA 4J7BA 4NW5A 2W5AA 3KGAA 3QZGA 4M15A 1SVHA 2I0HA 3I7CA 3VW8A 4NW6A 3OW4A 2XJ2A 2FSLX 3RVGA 3TZ7A 1IRKA 2YM4A 4EWQA 2WU6A 4MQ1A 4ACDA 3Q2JA 2VAGA 3HV6A 4CD0A 5KMNA 4J98A 3QKMA 4XLVA 5BNJA 4J52A 5AUYA 4IZ7A 1PRYA 2YDKA 4ZMFA 1UU7A 2QG5A 5DEYA 4GW8A 3KA0A 5BUEA 5BVWA 5CANA 1DI8A 4DEIA 4KIPA 4FNXA 4L00A 4L9IA 4U40A 4GUEA 3QD3A 5TT7A 5J1WA 4GU9A 5ICPA 3KB7A 1MRYA 3CY3A 5HG7A 4DC2A 2UVXA 4YJTA 3NRMA 3MJ1A 3ZXZA 3QHWA 4OTHA 4RX9A 5CQUA 3ZLXA 4A7CA 4AOJA 2WZJA 3GUBA 1OUKA 3QC4A 4F9WA 5C8NA 2VN9A 3FHIA 2C6MA 1P14A 3QTZA 4C2WA 3LCOA 2BTRA 2WMWA 4BDIA 5EM6A 3PJ1A 3MA6A 4QYFA 4D1XA 5BVKA 4O0RA 3G0FA 4XOYA 3D0EA 2BDJA 1G8SA 2QR7A 5CX9A 4V0GA 4BTMA 3S4QA 1F0QA 2QKRA 1G3NA 3LCSA 4JG8A 3R71A 4FR4A 4HGLA 4IB3A 4C4EA 4BBMA 2I7QA 3R7GA 5DI1A 3QQFA 4RZWA 2C6TA 3CY2A 3F2AA 3EL7A 3ZC5A 2CCIA 4IB5A 3E87A 3HRBA 4DN5A 4TTHB 2VTQA 5ETIA 4DBNA 1LUFA 3DZOA 4KUJA 2QHMA 4WBOA 4ACCA 1LP4A 3MFSA 3KXXA 3CBLA 4NCTA 3TT0A 4IZYA 3D9VA 1M2PA 2BAKA 5CTPA 4H58A 5DVRA 3R73A 4DFBA 3QD0A 5FEEA 3QQKA 5BYYA 4IDTA 1I09A 4QD6A 1K9AA 5M4FA 3CQUA 3BU6A 4DF3A 4X0MA 5IH5A 4GFGA 3HP5A 3NAYA 2WB8A 3D5XA 5HBEA 3W8LA 5IDNA 2VWBA 2R3JA 4U3YA 3SAYA 5AR2A 3DZQA 4QQJA 4XYFA 4DEDA 3MIAA 1ZWSA 4QTDA 5CVHA 1PXJA 4DEGA 2PZYA 4XX9A 5E8SA 4NSTA 5CENA 2UW4A 3G9LX 4FNYA 2UW7A 4DAWA 5DFPA 4W9WA 3IK3A 3QUEA 1MQ4A 4XEYA 2VTRA 3UNKA 2C3LA 2WTDA 4KIKA 4GMYA 3ZLSA 4D4VA 3OW3A 4BKZA 4C33A 5CF5A 3MW1A 4DG3E 4DH3A 5KKRC 5KBQA 4FSNA 2YEXA 4RIXB 4BWKA 4BTJA 5FTGA 3SOCA 3OY3A 4FTMA 1H1SA 2A0CX 3BYSA 4GCJA 4K33A 4HGSA 1RE8A 4BZNA 2WEIA 5JKGA 3OF0A 2F9GA 3RPSA 5AX3A 3QKLA 5JGBA 3VS7A 2AUHA 5CSHA 5HTBA 4DG0E 2W4JA 4FF8A 3NUNA 1RW8A 4JAJA 2F57A 5HIBA 4U44A 4FKSA 3FYJX 4XUFA 2W17A 1O9UA 3CPCA 2WMBA 1CKIA 4ERWA 4A9YA 4GK4A 4HPTE 4OT5A 5AM7A 2FB8A 3EKNA 3MB6A 5HESA 3UGCA 3FI3A 4O0XA 4F64A 3CIKA 3ATSA 4U0IA 1JNKA 3MWUA 3K3IA 2XKEA 4CG9A 2OIDA 2VUWA 5HNGA 2B9HA 1JPAA 3BE2A 3DK7A 4G1WA 5AAFA 1U46A 4E7WA 4EOQA 2ACXA 4ZS4A 3NNVA 2JEDA 4R3CA 3DBEA 4M84A 2UW8A 5IA5A 1G8AA 4A4XA 1I44A 3KN6A 3EOCA 1M7QA 1FINA 5C01A 2W1GA 5FBOA 4FK3A 2P2IA 4MK0A 4CQGA 1REJA 3OXZA 3UG1A 4YLLA 2YA9A 2BHHA 2IWIA 2OH4A 2WIHA 4HYUA 3A60A 5HIDA 3BU3A 2WEVA 3F5GA 4IFGA 5DE2A 3TEIA 3UODA 2PWLA 2WGJA 2YWVA 2PUNA 1E1VA 3S3IA 1YXVA 4X2FA 1PXMA 2YFXA 4MNEA 5IQHA 4TPTA 1W0XC 3QCYA 4OTIA 4P7EA 2VV9A 2UV2A 4PTGA 4IX3A 5TR6A 5HCXA 2QVSE 3HDNA 4FV2A 3F3UA 4RWKA 3PWDA 3LZBA 4XV9A 3S0OA 2R3LA 5EKOA 4QMVA 3T3VA 5LXMA 2ESMA 3G9NA 1RQQA 2J6MA 3LFSA 3ULZA 2QOFA 2GNJA 1YDTE 2PVHA 2WPAA 3DAEA 3FMDA 1TQPA 3TNHA 2E9OA 3P7CA 5JFVA 2O8YA 3G6GA 2BILB 3GQLA 3AT4A 3H3CA 1Q24A 3FKNA 3SV0A 1H1QA 3GBZA 2QO2A 3PPZA 4BWXA 4TW9A 3GCSA 4C37A 3ORIA 2UW9A 4GU6A 4BYIA 3I6WA 2WXVA 1YWRA 1YXUA 3OOMA 2G2HA 3LQ5A 2BAQA 2WFYA 1H1RA 2X9FA 2WMVA 3QWJA 4FV0A 1OBDA 2X8EA 4ASZA 4XG8A 5J79A 3U4WA 4IWOA 4RVKA 4FUYA 3ZFMA 3PWYA 4FT3A 3TACA 4D0WA 2Z02A 4FKIA 4DE4A 4K6ZA 4L3JA 3QXPA 4I3ZA 4PMPA 5CT7A 3Q5IA 3ZYAA 1ZYLA 2EUFB 3QTQA 2PMLX 4KKGA 3W8QA 2HOGA 4CTCA 3TDWA 5C4KA 2Y7JA 1XKKA 3DQXA 4IHPA 1UV5A 4PQNA 5DA3A 2J5FA 4OBOA 5AP6A 1WCCA 3R8MA 4EHZA 3NCGA 5A6NA 4ORKA 4J96A 1UNGA 4AGWA 4HVGA 5HTCA 4CV9A 4FKGA 2X2KA 3EJ1A 5AUVA 5CNOA 3UG2A 2ITTA 1WBPA 2C68A 5CQWA 2PVMA 3WF8A 3EQBA 4ANSA 3FKOA 3A7JA 3SD0A 2J0MB 3RINA 5CF4A 3UZTA 4EK6A 4TWNA 2W1DA 2JIIA 2YIWA 4MF1A 4X3FC 3ZDUA 2O2UA 4RFYA 4DFNA 3NNXA 4IX5A 2WQEA 3VS2A 3GCVA 4BTKA 2X7GA 3DBCA 5C1QB 3L9PA 4QP2A 5IA2A 3B2WA 4YZDA 4LUDA 4K1BA 3GT8A 3QTRA 4FZDB 2NRUA 2O0UA 5EFQA 2GS6A 2JDSA 5EOLA 3RPOA 4E93A 5FP6A 3VS3A 2WOUA 4FTOA 5AUXA 3FXZA 4F65A 3R2YA 5HG8A 4YJNA 4ALUA 5DN3A 1JWHA 5C8KA 3EYGA 3FL4A 3VHKA 3NR9A 4QP9A 3RNYA 3O8UA 1KUTA 3D5WA 4FOBA 4I6FA 5GNKA 2ZDTA 3WIGA 4ZS0A 4EH4A 4C4JA 4DFXE 3TZ8A 2VTLA 3DCVA 3Q4UA 5G1XA 4U7ZA 4MWIA 4AT5A 5M4CA 3LMGA 3RK7A 3UE4A 4BF2A 4RMZA 2GNHA 2PHKA 5M53A 2CNUA 4WNKA 4O7ZA 2QOCA 2B0QA 5H2UA 3ZHPC 1FVVA 4LM5A 3HEGA 3LJ2A 5CXHA 5ACKA 4P5ZA 4WHZA 3TKUA 2W4KA 1GAGA 4ZY6A 2QURA 3CXWA 3KXZA 4LI5A 2YM3A 5TE0A 3RK5A 4QPSA 3WARA 1ZZ2A 3ZEPA 1URCA 4JBQA 2UZBA 5E8ZA 2P3GX 2QQ7A 4U9AA 3NEWA 2ITVA 4I0TA 4WG5A 3ZUTA 5GJDA 3TKIA 3QU0A 1OIRA 1YOJA 3P0MA 3P7AA 3GU6A 2W1HA 4RWIA 1GIHA 1LEZA 2C47A 5FWKK 4YLKA 1IEPA 3DGKA 3E88A 1YWNA 3DB6A 4RZVA 4ZSJA 3E92A 5HVYA 3U51A 3MV5A 4WRGA 4IM2A 2PMNX 2QOKA 3UNJA 3TL8A 3ZSIA 4CMTA 4JDIA 5L6OA 4R5SA 4FKTA 1YOLA 2G1TA 3KVWA 4C3PA 4YO6A 2ERKA 3TV7A 4G31A 4XH6A 2XNMA 1IR3A 5J5TA 3FZSA 3ZMMA 2WMQA 2WHBA 3GOKA 1P5EA 4IC8A 3U9CA 3WF7A 4AGUA 3KREA 2VWIA 4LYNA 3W2QA 4D2RA 3S95A 1H00A 4HGEA 4K8AA 3VS4A 4J97A 4JX3A 4X7QA 5DRBA 5HNIX 5K4JA 5DPVA 4NL0A 3UIXA 4RG0A 4QYYA 4YURA 3EN6A 2WMXA 3TUDA 4OAUC 4LMNA 2OXXA 3JYAA 4CFFA 5HLPA 4EEVA 4L8MA 4ARKA 1ZARA 3RHKA 5C4LA 4AXAA 4IZAA 3VUTA 2ITOA 3I5NA 1VJYA 2VTMA 4FKJA 4NTTA 2OZAB 5KHXA 3QRJA 2R3NA 1IASA 5AA9A 2VO0A 4FKVA 3CJGA 4RIXA 3Q52A 4I23A 4QMNA 4Y5HA 4I20A 4ENXA 4BCOA 3PYYA 4OUCA 3FHRA 3R01A 4M97A 3MY0A 3SW4A 2OICA 4EYMA 2C6OA 4LFIA 4DFZE 2BDWA 5AP5A 3C7QA 1KSWA 1PW2A 4KABA 3MTFA 4UB7A 3W1FA 3KXGA 2I1MA 3Q53A 4TYHB 1FOTA 5IQCA 2PULA 4C0TA 3NUAA 4R78A 1Q97A 3GQIA 3DBDA 4I1ZA 2YHVA 3MA3A 4UWBA 3VULA 2JD5A 4BB4A 3MB7A 3QGYA 2JKOA 4FV4A 4O6LA 5I9VA 4M8TA 3EFWA 3F6XA 4MBIA 4FOCA 3ZRMA 2BCJA 5AP2A 3TDVA 3JR1A 3W55A 4Y85A 5FD2A 3F3TA 1Q62A 2OIBA 4I0SA 4BI0A 1URWA 2XJ1A 1ZOEA 3TI1A 3IS5A 3ZTXA 2BFYA 4APCA 3T3UA 4RGJA 3QD4A 3LFQA 4ITIA 4ITHA 4L53A 2W9ZB 4RJ6A 2CSNA 2JLDA 4FT0A 5A4LA 3QC9A 1V0PA 3GCPA 3UO4A 4O82A 3LLAA 1WBTA 3CR0A 1HOWA 3ALOA 1W98A 4MVFA 4PDOA 4JX7A 4ACMA 3LKMA 1FGKA 5AP7A 1UU3A 2VGOA 3RHXA 3I6UA 5IH4A 2UZTA 5BUIA 3KL8A 4FT5A 4CFVA 3M1SA 2CLXA 1YI4A 3F3VA 3KQ7A 2W06A 3FQSA 5IQGA 4F4PA 2H6DA 2YDJA 5ANGA 3MFTA 2HY0A 2AC5A 2O63A 2C5NA 3OP5A 3VUGA 4CKIA 2QOQA 2YAKA 2E9NA 4PUZA 3E62A 4RJ3A 4O7LA 5EW8A 4FSYA 1B6CB 5L6WL 3W32A 4D2WA 3DTCA 5HORA 4JVGA 4RA5A 4XP3A 2XVDA 3NMUF 2RFNA 3QBNA 4KS7A 4M68A 3SQQA 4BDJA 4RSSA 4B99A 4MEDA 3CTJA 2CMWA 2PE2A 3L9MA 5TOZA 4C02A 3KEXA 5DHJA 3VS0A 4RIWB 4JXFA 3ZLYA 3VBXA 4DH1A 3QLGA 2B1PA 2I0VA 1O6KA 2VWVA 2VTIA 4YJVA 4IADA 3FLSA 5L2TA 1EH4A 2GS2A 1SZMA 1OZ1A 4NFNA 3ETAA 5K0KA 4PPAA 4YBKA 3ANQA 3PE1A 2BRGA 2FO0A 4FEQA 1AQ1A 1OPJA 4HJOA 4QTCA 5DR9A 4MWHA 4AZFA 5JH6A 3HA8A 2QO9A 2W1ZA 3A7IA 2GU8A 3E8DA 3LCKA 4MX9A 4TWOA 5H9BA 2WTJA 5CEIA 3T8OA 5BMSA 5AAEA 1ZXEA 4RC4A 4Y72A 4N6YA 3GENA 4U5JA 4GK2A 2J7TA 2FSOX 3AQVA 2PZRA 5EQPA 4E6QA 3JVSA 3M11A 1T45A 1OI9A 3Q32A 2XNPA 5L2QA 3LFCA 2J90A 3P7BA 3LE6A 3OCSA 2ZDUA 4NK9A 3O8TA 1M52A 4U6RA 2O64A 2CKEA 1Z9XA 3WILA 4WA9A 2YM5A 4W4WA 3WZJA 4ASXA 4PTCA 3P23A 1OVEA 1VR2A 3FDNA 2XIZA 3FXWA 2XKFA 5CNNA 3UIUA 3EQFA 2QOBA 4JIKA 3ZONA 1HCKA 3GC9A 4XP0A 2XBAA 4UWYA 4DGGA 4O83A 4KAOA 4UN0C 2JKQA 5DG5A 1ZY4A 3UPXA 1WBVA 4ACGA 1J7IA 3Q4ZA 4EWHA 5FDPA 2X8DA 3I1AA 4FTTA 3W2OA 5CSVA 5KMJA 2GPHA 4UXQA 3KF4A 1V0BA 2XF0A 4O86A 2O3PA 5HO6A 2UVZA 4JBVA 4DLIA 5CXZA 1BUHA 4WUNA 2VO6A 4I4FA 1CKJA 1CDKA 2R4BA 1REKA 1ZLTA 4O6EA 5BPYA 3GU7A 5GJFA 3SXRA 3LM0A 4FC0A 5AUZA 2BRBA 4OTQA 1BX6A 4ZAUA 5KHWA 3NUXA 3G5DA 5LVLA 4PP9A 1H27A 3FE3A 3EYHA 3DKGA 5BQ0A 2CNQA 2HCKA 4FGRA 2DYLA 3FY0A 3PXZA 1P2AA 2XRUA 2Z2WA 2AC3A 4FIEA 5KNJA 4XOZA 4FKQA 1IA9A 4WOVA 5M44A 4I21A 1APME 1W8CA 2UUEA 3KVXA 1OPKA 4PPCA 4P4CA 4EC8A 4EHVA 5IQBA 3HRCA 3NIZA 5CS6A 3EFKA 1YVJA 5F20A 3U6IA 3FC2A 3VO3A 3HAMA 4H39A 2C6DA 5L8LA 5FG8A 3E7VA 4PL3A 4FVQA 3O51A 3VUKA 4FTNA 3CQEA 3ENHA 3POZA 3LCDA 2SRCA 2QD9A 2VWUA 4FKUA 3L1SA 4MNEB 4XRLA 4FIJA 3OUKA 3SXFA 4FIIA 1X8BA 2J5EA 3DNDA 2CN5A 3V6SA 4EJ7A 4EOPA 4GT5A 3V5WA 5KMMA 1ZMVA 4O27B 2XIKA 3KRWA 2X9EA 3U54A 1WFCA 4DTKA 4WNPA 4FVRA 4JR3A 3L8PA 4GH2A 2ITWA 1WBOA 5C9CA 2QLQA 4Y46A 2BRHA 2P4IA 2X4ZA 3FUPA 2VX3A 4HYIA 5CU3A 4D2TA 3CSVA 2HIWA 3GCUA 1ZYCA 4OTGA 3QX4A 1Y57A 4GYGA 1NXKA 2C5YA 3AC1A 3Q9XA 5HBHA 3UTOA 4A9RA 1Z5MA 5J7HA 2BALA 4R7HA 2OZAA 2XA4A 3UP2A 1OL5A 3QUDA 4LRMA 4MF0A 5HTIA 4FSMA 2CLQA 3KC3A 2YACA 1ZAOA 4U79A 3HMMA 1U4DA 5CZIA 3Q60A 5CAVA 2HW7A 4YJOA 1YOMA 2PUUA 3AD6A 4QMSA 4V01A 1JSVA 4IAKA 1XJDA 3OCBA 3W2PA 4AG8A 2C6EA 4QMXA 2C1BA 1W82A 4D1SA 4TYHA 3R1NA 1Q4LA 3EHAA 2Z8CA 3C4FA 3TG1A 3CC6A 1U5RA 4FZFB 5EDPA 2ETKA 4RA4A 2CPKE 1YI6A 3E3PA 5AUWA 2EU9A 4BDBA 4Q9ZA 5HO7A 4EJNA 4GG5A 2BRMA 2CKQA 5CI7A 1R3CA 5HCYA 2X7FA 4NEUA 4AZTA 1K3AA 5E7RA 5AP1A 3TJDA 4BFMA 4GT3A 1YW2A 5D7VA 3F82A 3HX4A 2NPQA 4X2GA 3NUYA 3VUDA 2PUIA 4N4SA 4PTEA 3RALA 2VTSA 3BPRA 5M56A 3MIYA 4FKWA 5CWZA 1WZYA 4ID7A 3FPQA 5HG9A 4BICA 4EQMA 3UO5A 3EH9A 3R21A 1H01A 3HNGA 4ITJA 3BWFA 4F6WA 1Q3DA 2IVUA 3PP0A 3BKBA 4IBMA 5EI8A 1H08A 1JKLA 3HVCA 4Q2AA 4DFLA 4F7NA 4DT8A 2XCKA 2WTKC 5M08A 4B6LA 2VU3A 3TNIA 3C50A 2UZLA 5LVMA 4BYJA 2ONLC 2OKRA 1NVRA 5IQEA 3L9NA 3EIDA 3LFDA 1OB3A 4AT4A 3COIA 3OWPA 3TJCA 4H1MA 1M2RA 4EBWA 4C62A 4J53A 4XLIA 2WTCA 2C69A 2Y8OA 5E8VA 4FL1A 4UMTA 2WMUA 2W1CA 3LOKA 4KD1A 1GOLA 3V3VA 4LGGA 2YLFA 4K2RA 2XNBA 3UDBA 4CCUA 4GFOA 4USFA 5HOAA 3WF6A 4ZSEA 4EH8A 2GNIA 3MFUA 4PL5A 4M67A 4E5WA 3SG8A 2KTYA 3T9TA 2X1NA 2I6LA 4PPBA 5K0XA 4DFUA 3WZEA 4QQTA 3EN5A 4D55A 4A4OA 5M4UA 4EOLA 4GUBA 2QOLA 4YGAA 3VBWA 2RF9A 3KXHA 3ORPA 3P5KA 4CFMA 4FZ7A 3C51A 5HCZA 3IDBA 2WTWA 4C4HA 4AA5A 1OL2A 4YTHA 3QTWA 2E9UA 2R64A 3KKVA 4F9CA 4O0YA 3R22A 3ODYX 4QYGA 4RIWA 5J95A 4R8QA 4RIOA 3QHRA 3V8SA 4O7YA 4ZY5A 4U45A 3AD5A 2UZUE 4OTPA 2ITZA 4XG2A 3KY2A 2C5XA 3RI1A 4S31A 4BBFA 3C0IA 2IN6A 2C5VA 2IJMA 1M7NA 3TIYA 2HZNA 2WTIA 5AIRA 4NM0A 4HNIA 5E92A 4E5AX 4YBJA 4Z16A 3QZIA 4OGRA 2B9FA 1E1XA 2WMAA 3N51A 2YJRA 3OXTA 3DLZA 4AS0A 2UW3A 2Y9QA 1YXXA 2J0KA 2HY81 5ANKA 3W2RA 2VX0A 2YAAA 4FG7A 3KMMA 2BKKA 1XR1A 3BV3A 4AACA 3Q9WA 2WTKB 2IZSA 4D5KA 2DWBA 1BMKA 1FVTA 3ITZA 4A9SA 4EYJA 4NM5A 1K2PA 4ANMA 3OY1A 4HVDA 5FM2A 3BQCA 4ZSAA 3MYGA 3TV6A 3BV2A 3A4OX 3ORXA 5CU0A 5D7AA 3OEFX 4QYEA 2QR8A 3LM5A 3NLBA 2Q0BA 2R0UA 3KULB 3GB2A 1WVXA 5D11A 4E3CA 3GI3A 1J1BA 1STCE 2JBOA 2VNYA 5E8UA 2XNGA 4AGDA 3JS2A 4ANOA 4TL0A 1SNUA 3L9LA 3IPHA 4QMOA 3VS5A 4BCQA 4FTJA 5CALA 2FSMX 2RL5A 5C26A 2DQ7X 2I0EA 4RFZA 4XV2A 3VBQA 2XS0A 5HLNA 2W99B 3E93A 3EQCA 4H3QA 5FTOA 3NPCA 4BC6A 4LOOA 5EQYA 3BYUA 2IVTA 5KZ0A 3TNQB 4CMUA 2VTPA 3C9WA 3Q4TA 5AV4A 3EN7A 4IXPA 5DT4A 3UNZA 5CAPA 2OJIA 4XG7A 4YJRA 3TXOA 4DA5A 5C8MA 5ANOA 4RFMA 4DLJA 4EHGA 4WD5A 4UMUA 2PTKA 5IPJA 5KBRA 3DJ7A 4AZSA 2RSVA 3BYMA 3LXKA 4X6QC 4BY9E 4BDAA 3OTUA 2EXEA 4GRBA 4FTQA 3ZM4A 3ZFXA 3SG9A 4I0RA 4XG3A 2ZMDA 3PJCA 1OIQA 5IEYA 3UVQA 4EONA 2YCQA 4YJSA 2XEZA 4AWIA 3RPYA 5JGAA 3DV3A 3HZTA 2Q83A 3VNTA 2GMXA 3PY0A 4Y8DA 3WI6A 4D2PA 3A4PA 4E4XA 5BVEA 2E2BA 4XG6A 2CJMA 4I6HA 4JG6A 1PY5A 4GJ2A 3RWQA 4UXLA 4ZTSA 3GEQA 3WF9A 2QOHA 4MXAA 4FEVA 1JLUE 4QOXA 2Y0AA 4B8MA 4OR5A 4FTIA 1XBAA 2ZB0A 3I79A 2RGPA 2GTMA 3PJ8A 4YPDA 2QG7A 4ANLA 2ITXA 4YC8A 3WYXA 2KULA 5GIPE 3FKLA 3G6HA 2YLEA 3I0OA 3OOGA 4YC3A 4KRDA 4KBCA 3HA6A 4JDHA 4BHNA 4ZK5A 3BGQA 3EQGA 4A06A 4UBAA 1WVWA 1RDQE 2EWAA 3KRLA 3P79A 1WVYA 3KU2A 4H3PA 4JBOA 5HO8A 3V8TA 4PNKA 3D5UA 2F2CB 4O21A 3ZSGA 1P4OA 2GNGA 4D2VA 2PVRA 4FTCA 3UO6A 1H24A 1KV2A 1Q8UA 3DJ6A 5D1JA 3FLNC 2XK4A 1JKTA 3QQLA 4O0VA 4LMUA 5GHVA 3WIKA 2HZIA 3V5QA 4FEWA 4F9BA 3K54A 2HYYA 3PSBA 4UWCA 1Q5KA 3LIJA 3UPZA 4G6OA 3PXRA 4RX7A 2XK3A 4FI1A 4GK3A 4K18A 4M7IA 5FLFA 4FV5A 1ZZLA 4J8NA 2IG7A 2XK6A 4FGBA 4Z9LA 3EZRA 4ASDA 1WBSA 3RMFA 3U9NA 4B4LA 5CEMA 1QPCA 2XP2A 5ANDA 3BZ3A 1XH8A 5I3RA 4BCFA 3OFMA 4WNOA 4YLJA 4BR3A 1A9UA 3BE9A 3QQUA 4O2ZA 3HV5A 4XCUA 5LCKA 3NNWA 4E26A 3FJQE 2FSTX 2PL0A 5LWNA 3C4ZA 5BVDA 1R0PA 4ALWA 4LOPA 4ZXTA 4X6RA 5IQFA 3VHEA 4UMRA 2HW6A 5KZIA 2BFXA 4JG7A 3R00A 2J9MA 3U6JA 4RVLA 3SLSA 1DM2A 3VVHA 4HPUE 2PVNA 3I60A 2VTAA 5M07A 2B55A 3IKAA 3V5JA 2V22A 3DBQA 3BHHA 2WQBA 4Z3VA 3Q4CA 4GSBA 1PMEA 3ZUUA 3LHJA 4RPVA 1OMWA 4BDCA 2GQSA 3PLSA 4IWQA 3I5ZA 4BCMA 3THBA 3FZPA 4O0WA 1B39A 4FSQA 3DU8A 3W10A 4AF3A 2VX1A 5TO8A 3D7ZA 1UNHA 2JIUA 4RIYB 4K0YA 2JDVA 2VD5A 3II5A 4IC7A 3ZC6A 2BROA 3PA4A 4EOSA 4K77A 4I94A 2BZIB 3VC4A 5HGIA 4YUQA 3ELJA 4IIRA 4PNIA 1SNXA 3AT3A 5A4QA 4LGDA 5IISA 4GFMA 3R8UA 3V5LA 1H0VA 3DT1A 2GNLA 3FMHA 4FTUA 4MQ2A 3P08A 3UOJA 3HECA 1MUOA 3DK6A 3PIYA 4FK6A 4DH7A 5IG1A 2PYWA 3SGCA 2ZAZA 3F2NA 2RG6A 5EDQA 1GY3A 1KWPA 3AD4A 3R8VA 2B52A 4JQ8A 3SX9A 2IW8A 3UQCA 3C0HA 1BLXA 5EDRA 3I0QA 1ZRZA 1U59A 1W83A 4CQEA 5CAUA 3SC1A 4HW7A 5D41A 4AOTA 3RZFA 2YERA 4NM7A 4UY9A 1JSTA 4G3FA 5LMKC 1UA2A 3QWKA 4DHFA 4CSVA 3KMWA 5JMSA 1KE5A 3NX8A 4B0GA 4USDA 4ZZNA 3PG1A 1OL6A 2F7XE 2PY3A 2UZOA 5GZ9A 4EH7A 4RWJA 5EYDA 3BRBA 3FZOA 3OEZA 3LXNA 4FSWA 3TWJA 3FZ1A 4C4FA 1OIYA 3V51A 3QCXA 1KOAA 3Q9YA 3ZU7A 2ITNA 4O0TA 2BR1A 4EBVA 2F2UA 4Q5EA 1UVRA 1LR4A 3DFAA 5CI6A 5BVFA 1Z57A 5IZFA 2GSFA 4KKEA 3CQWA 4BIEA 5AAGA 2ZB1A 5DLSA 4CFUA 2X0GA 3NWWA 3KXMA 4L52A 3UMXA 2C0IA 3LXPA 4JS8A 4O0SA 4G9RA 3VQHA 2ZM4A 3KCKA 5E1EA 1PXNA 4QRCA 2R3HA 4UZDA 3UBDA 4YTCA 4JIAA 3ZZEA 3F9NA 3W33A 2VTTA 3BELA 4M14A 1F5QA 4NZWB 4D2SA 2GQRA 5EI2A 3HAVA 4UALA 4RX8A 3OHTA 3UVPA 5HI2A 3FMJA 4O2PA 2XK7A 2XIYA 2W96B 3C4EA 5FDXA 5HVJA 4NUSA 2JDRA 2X2LA 3MH0A 1A48A 2R3MA 1OKYA 3RK9A 1PKGA 2ITYA 5BYZA 3VAPA 1Y6AA 2OGVA 2YCRA 4YJQA 4EH9A 2V0DA 4FE2A 3IECA 3ZO1A 5H8GA 4CKJA 4MXCA 4ZZMA 4M3QA 2JC6A 2W05A 2XIXA 3R6XA 4G5JA 4W4YA 3AC4A 3FI2A 3H9FA 4HCUA 4M12A 3VRZA 4CEGA 4H3BA 2XYUA 2OFUA 5B7VA 2ONLA 2XEYA 4LOQA 3OWKA 4FT7A 3HUCA 4L46A 4TNDA 4FEXA 2W5HA 4TWPA 4QMMA 2QOIA 4AN2A 3N9XA 2QO7A 3ODZX 3KULA 4F9AA 3IOPA 5AV3A 4AFJA 5CU2A 4DT9A 3EQRA 4E4MA 3DLSA 4R3PA 5DT3A 3ZFYA 2G2FA 4MXYA 2QODA 4QP6A 3U6HA 4O7RA 3DKOA 1YHWA 4AZVA 3AXWA 3MESA 3ZSHA 1Q41A 4R5YA 4ASEA 1SM2A 3E63A 3V6RA 3OD6X 5IMXA 3NYVA 4EH6A 4U97A 3FZTA 4L68A 2JGZA 2OXDA 3HL7A 3JXWA 3CKWA 5IMEA 2R3PA 4KKHA 2ZJWA 4QPMA 4O7VA 4LV5A 4HNFA 2PVYA 4XRJA 2YITA 2R7IA 5DMZA 4QMWA 5FXSA 1Q61A 3V5PA 4DH8A 4H05A 4YP8A 1R39A 2O5KA 5M57A 4NU1A 4I92A 5FXRA 3PPJA 4ZJIA 1XO2B 3DXPA 3DB8A 2B4SB 3UOLA 3VWAA 3QZFA 4NJ3A 3BGZA 3BHYA 4HZRA 5ANJA 4ZEGA 4I22A 4BDGA 4IAIA 4IWPA 3UJGA 1VZOA 3R8ZA 3RAHA 1H25A 3VS6A 4F1OA 3PLAE 3LAUA 2WTVA 4F0IA 4DBXA 3NS9A 3MPTA 4IMYA 2R3KA 3WE8A 2VRXA 5JQ5A 3E8EA 4CT1A 4FNWA 4BN1A 1A06A 2V55A 2OFVA 4EHEA 5FTQA 1KE7A 1OUYA 1RJBA 5C27A 4AW1A 4DH5A 1QPEA 4FV6A 4QMZA 4F1MA 2B54A 3HV4A 4G3DA 5E1SA 5LVNA 3CPBA 5K3YA 3O0GA 4N70A 4BDDA 4DTBA 1BL6A 1DI9A 1YWVA 3C1XA 4I5MA 4NJDA 5AM6A 1FMKA 4WT6A 2JDTA 3Q2MA 1PXPA 3RJCA 2LAVA 5B2LA 4FIHA 5I9ZA 3B8QA 3QCQA 5FQDC 4L42A 3OC1A 3IW6A 4ANBA 3NUSA 3WZUA 4CFXA 3OUNB 1H28A 5BX0A 2WMTA 5EOBA 1OKZA 3I7BA 3MY5A 5HBJA 5E8YA 3SXSA 1XH7A 4F9YA 2XKCA 4BZOA 3JPVA 4YO4A 3F7ZA 5DOSA 4EUTA 2XIRA 4AW0A 2UZNA 4H1JA 2IO6A 1PKDA 4G3EA 4J95A 1Q99A 4W8DA 2XM8A 3E3BX 5AEPA 3E64A 2HZ4A 4YR8A 2XUUA 3KMUA 4L67A 4FA2A 1KE6A 3LFAA 5HU9A 2JDOA 3ID6C 1FGIA 3FLQA 5AR8A 1E9HA 4N6ZA 3PIZA 4ACHA 4EOIA 1OPLA 3FAAA 1XBBA 4FV1A 1FMOE 3R28A 4Z7HA 3QUPA 4D0XA 2ZM1A 2QU5A 5I0BA 4PMMA 4Y83A 5ETFA 4BGQA 5IKWA 4FSTA 1L8TA 5JFXA 2XBJA 2GS7A 3WF5A 3WOWA 2YIXA 2ZV8A 5GZAA 1WBNA 3QZHA 3VBYA 5EM7A 4A9UA 4AN9A 4UMPA 3ZBXA 3C4WA 4E6AA 2QNJA 3KK8A 4RLLA 3F5PA 2UZDA 2RIOA 4OBPA 4TRLA 2XNEA 3BLHA 2BTSA 4C3FA 1KE9A 4YTIA 4ZP5A 5LQFA 3KRXA 1UWJA 4I24A 5A46A 3VIDA 2VO7A 2IVVA 5A9UA 3RNIA 4JL9A 3GXLA 3NAXA 3QD2B 4QTBA 4C2VA 4F0GA 5M55A 2BZJA 1PMUA 2C5OA 1XWSA 2LGCA 5L2WA 4CLIA 4AX8A 4FTLA 4ZTHA 2EB2A 2YZLA 1WMKA 4TYIA 5KO1A 4DTAA 5CVFA 2JITA 1R0EA 4RIYA 3CEKA 3MJ2A 4GEOA 4MCVA 5EKNA 4CLJA 5IQDA 3PVWA 2CDZA 5IDPA 4HVIA 4GL9A 2IVSA 1PXOA 3HV7A 3TIZA 4CCBA 4YNOA 3QAME 4RVTA 1XH4A 1ERKA 3BI6A 4MNFA 4WKQA 3RM7A 2GTNA 2RG5A 5E8WA 3BQRA 3KXNA 5JZJA 5LCJA 3NW6A 3AC8A 3Q9ZA 3U8WA 3MY1A 3QGWA 1Q8WA 2XMYA 2VWXA 3IW8A 3R1QA 1W7HA 3UIBA 2GQGA 5AV1A 2WQOA 3ZUVA 4DEAA 2B9IA 5IUHA 3KN5A 3R30A 4NTSA 2PSQA 5AMNA 3KK9A 3OT8A 5EHYA 4EK8A 1Q3WA 3HLLA 3GOPA 5A14A 3K2LA 4DG2E 3AMAA 5JQ8A 4FUXA 3FI8A 2HZ0A 3LLTA 2CGWA 3GC7A 5LMAA 1YI3A 3FQEA 5CT0A 3ALNA 2C4GA 1NVSA 3F61A 3OXIA 5E8TA 3ATTA 3TTIA 5EW3A 4WSYA 2YM7A 2OI4X 2X2MA 4TYJA 3KF7A 4QMLA 3D15A 4AE9A 2QKWB 4B9DA 3JY9A 4BHZA 4ZJVA 1KV1A 4AA4A 4HGTA 1H1WA 5GIOE 5HD4A 3QX2A 1S9IA 5HICA 5L4QA 4GKHA 3VS1A 4RJ5A 5FXQA 5AA8A 3MTLA 4R77A 3VBVA 4FTAA 4IAYA 2W0JA 3AGLA 3DFCB 1UU8A 4KS8A 2OBJA 4IFCA 3MN3A 4QMPA 4YZBA 4TKSA 4HCVA 3RCDA 4ALVA 3LVPA 2W1FA 3CKXA 3ZH8A 4MD8E 2H34A 2UW0A 4O7TA 3EN4A 4L6QA 4S2ZA 3RKBA 1H4LA 4M69B 5HE0A 4WG3A 3KFAA 1NW1A 3JUHA 3K3JA 4XBRA 1HCLA 2YWPA 2XZSA 1ZOHA 4X2NA 3MVLA 3Q5ZA 4ZLZA 3LXLA 2CGUA 4UYAA 4JDJA 3NSZA 3O7LD 3OROA 1P4FA 1JKSA 3OWLA 4MHAA 4YNEA 4EOKA 5IQAA 2IZUA 4D1ZA 4PDYA 4AE6A 3KCFA 5CASA 3R9RA 1MRVA 2PVKA 3C0GA 5JRQA 3VUIA 3QTSA 4LGHA 4BCHA 4FT9A 1GZ8A 5LMBA 3OT3A 4IE9A 2GHGA 3LFNA 4G3CA 4JAIA 2PE0A 2XNOA 3R83A 1R78A 4ZJJA 4YMJA 2BRNA 4CGAA 4TWCA 3CP9A 3OVVA 4OTDA 2PMOX 4YHJA 3G15A 1LEWA 2OJGA 3A7FA 2EXCX 4RVMA 4S32A 2J0LA 3DXNA 5EG3A 3TZ9A 2PU8A 3PIXA 3OTVA 5CF6A 5EM5A 4JI9A 5KCVA 2BKZA 3GC0A 3QRIA 4KSPA 4QMYA 4IVAA 4BCJA 4G9CA 4FV3A 4EQCA 4ZTMA 3TKHA 1YKRA 3GFWA 4LV8A 4ZMEA 5EHOA 4LUEA 3PZEA 3LFFA 4F08A 2GDOA 4IVBA 4CYIA 4C38A 3N4UA 1CMKE 5LMKA 3IOKA 4C36A 1BI7A 4R1VA 5IA4A 4KNBA 2GNFA 3C4XA 3G90X 5ETAA 3E7OA 4DFYA 3VBTA 4WRSA 3VRYA 2XYNA 3UC4A 3RPRA 2OXYA 3FXXA 4KWPA 4BCNA 1JVPP 3ACJA 4BDFA 4MH7A 3QXOA 4IW0A 4YZ9A 2QC6A 3QKKA 2CHLA 3DOGA 2UW5A 4GVJA 4NT4A 5ANEA 1DAWA 5L2SA 5DGZA 3A99A 4ZY4A 4IB1A 4NH1A 5A4CA 3BYOA 4J99A 3ACKA 3EQPA 4KSQA 3ORNA 3EQDA 4RQKA 3F3ZA 3BYVA 3ZO4A 3FWQA 3TUCA 2JFMA 2BPMA 2WQNA 4MBJA 1U54B 1BKXA 3MPAA 3FMEA 3G33A 3FC1X 3R1YA 3GCQA 4FV9A 4JQ7A 4JR7A 4R1YA 4TY1A 3T9IA 3QCSA 2HWPA 1JAMA 3NW5A 1H0WA 3C13A 3LFBA 3OS3A 4FYOA 3IDCA 1FVRA 2W5BA 2BZKB 4PDSA 1W84A 3DY7A 5F9EA 3P9JA 1FPUA 4UX9A 5I4NA 3HMNA 4IJ9A 2Z7QA 3PXYA 4Y95A 3FI4A 5DEWA 4FKPA 3UZPA 4DGNA 4YU2A 5CEOA 1V1KA 5AP4A 4YHFA 4PMTA 4QTAA 4M0ZA 1Y8GA 2R3OA 2QHNA 2YDIA 4NM3A 4C4GA 4EH3A 3HKOA 5HLWA 5K4IA 3DQWA 1TQMA 3QL8A 4OT6A 4IEBA 5HU3A 3NW7A 4FKLA 1TKIA 4FVPA 3WYYA 3D2IA 3PJ2A 3ULIA 1H07A 3F5UA 3MI9A 3PXQA 3R2BA 5CU6A 2EB3A 4XG9A 4WG4A 2HWOA 2OF2A 2QI8A 3CGOA 2V62A 1CSNA 4E6DA 3PVGA 4MD9E 5ACBC 3K5VA 4IB0A 4G3GA 1YXTA 4E4NA 4E4LA 3ZLWA 3OG7A 4N0SA 5CLPA 3F2RA 1QPDA 5I9XA 3WE4A 5B2KA 3CCNA 3AC3A 3VUHA 3S1HA 4DCAA 4G16A 1IG1A 3QA8A 5JRSA 3GU5A 5F4NA 4QP4A 2X81A 3R1SA 3FSKA 2AYPA 2A19B 3ZBFA 1DS5A 2UZVA 5B0XA 4IH8A 2F4JA 5CZHA 3LJ1A 3EQHA 4OBQA 2PE1A 3COMA 2YIYA 3R9OA 2X8IA 3DK3A 4EK3A 1GZOA 3F69A 4QMUA 4IVDA 4PF4A 4WBBB 2CKPA 3EFLA 5CEKA 5IA1A 5HE1A 3SVVA 4ZTLA 5CAQA 3IW5A 2OZOA 4FIGA 1YHSA 3PJ3A 4AAAA 4AT3A 4BIBA 3UQFA 3NYNA 4O22A 5K5NA 3HMIA 3OZ6A 3W16A 4DYMA 2CKOA 4XHKB 3VUMA 3BX5A 4GYIA 4IM0A 3EFJA 4MAOA 5EYCA 3GC8A 3R8PA 1ZMWA 3LW0A 4U80A 4WUAA 3ZRKA 5LWMA 3UVRA 4UMQA 3MDYA 1TQIA 5FP5A 4FNZA 2W1IA 4FKOA 2OW3A 1PF8A 2A27A 4YZCA 5F1ZA 5FM3A 3RPVA 3E5AA 5DR6A 2JIVA 3E8NA 4UYNA 5J5SA 4YSMA 3R9HA 2WKMA 3LPBA 1KOBA 1YDSE 1B38A 3F7WA 3GGFA 2WO6A 4P2KA 1BL7A 2UZEA 2ITUA 3M2WA 1J7UA 3R02A 3FMKA 3MPMA 2JAMA 3HDMA 4DEHA 1JQHA 4DGOA 2NNWB 2R9SA 3BWJA 2IW6A 4IWDA 2VTHA 3KRRA 5HE2A 2PZIA 2VTNA 3RCJA 5LVPA 3RP9A 2XK9A 1NA7A 4G6LA 4E8AA 4EORA 3NYOA 2OU7A 4LRKA 2QU6A 5KMKA 1FBNA 4B8LA 4RJ8A 4XBUA 5A6OA 5I9YA 5E90A 2WMSA 5CY3A 3V01A 4FKRA 3H30A 4PP7A 3WZDA 5M51A 4X3JA 5K5XA 1NT2A 5EHLA 4FV7A 2YN8A 5HIEA 4Q5HA 1PHKA 4FICA 4KB8A 5BVNA 5HEZA 3UZRA 5KX8A 4D5HA 5JT2A 4QQ5A 5AP3A 2XH5A 1CM8A 1ZMUA 2JBPA 2J2IB 4DGLC 2ZVAA 2YZAA 4FSZA 4FG9A 3HUBA 3PFQA 3CD8A 4QP3A 3D7TB 4XS2A 4XNEA 1H1PA 3IDPA 3CTHA 3NDMA 1QMZA 4IQ6A 4V04A 3QQHA 4E6CA 4QYHA 4ZSGA 4G34A 2C30A 4RJ4A 3RTPA 3QRKA 5IH6A 1YRPA 1NVQA 3VN9A 3DBFA 1PXIA 2EXMA 5CU4A 4IAFA 4JLCA 2ETMA 4A4LA 2GHLA 3NUPA 4OW8A 1OKVA 4L43A 3G0EA 4C4IA 3PPKA 1YHVA 4X2KA 3TV4A 4FIFA 4AN3A 3AGMA 3D83A 5AADA 5AUTA 1J91A 4ZTQA 1QPJA 3NCZA 3NGAA 5JEBA 3U55A 4FTRA 4FX3A 4RBLA 5FBNC 4GIIA 1IA8A 3H0YA 4PL4A 5EI6A 3ORZA 3O2MA 3W18A 4F7JA 3PY3A 2H9VA 3D5VA 2FUMA 4BL1A 4M69A 3TZMA 3IGGA 2YJSA 3QQGA 2GFCA 1J1CA 2I40A 3Q6WA 4O91A 5LJJA 3HYHA 2P0CA 3QRUA 4JQEA 1PJKA 2WAJA 5CEPA 2YIQA 2YM6A 5JK3A 4CFWA 4CRLA 3JY0A 1Y8YA 5G6VA 1OITA 4YPSA 5HNBA 2RFEA 1MQBA 3SHEA 5HX6A 1S9JA 4WNMA 2P2HA 2NRYA 4FSUA 2UZWE 3LMIA 4II5A 3PUPA 4I5PA 4W9XA 4CFNA 2E9PA 3UMWA 3LJ0A 3GNIB 2R3GA 3BBTB 2CGXA 3NYXA 4ERKA 4JOAA 5HZNA 4BDKA 2F49A 4XP2A 3FY2A 4LRJA 5KE0A 4AUAA 2R3FA 4KINA 4APPA 4J8MA 4AQCA 3NVKI 3UP7A 4L3PA 2Z7SA 5BUJA 4FL2A 4D4SA 1T46A 2BZHB 4FZ6A 4M66A 3PE2A 2Z7LA 3NUUA 2ZV2A 3Q96A 3P1AA 4BTFA 5L8KA 2OSCA 3CS9A 4MD7E 4CZTA 4C58A 5KKRB 4Y73A 4G17A 2R0IA 3FYKX 1BI8A 2F7ZE 4ZOGA 3V8WA 5CSXA 1H26A 1QCFA 1SYKA 2WMRA 3RBWA 3H4JA 5DIAA 4RT7A 3TNPC 2ITPA 5AFVA 2YCSA 4KRCA 3R9DA 2Y6OA 5J9ZA 3OBJA 4BCPA 4ONAA 3H9OA 4OTFA 5HHWA 4N57A 2G15A 4K11A 4H36A 4WIHA 2XB7A 2X7OA 4D9TA 1M2QA 1U54A 4EZ3A 2C3IB 4ZZOA 5I5ZA 4O81A 5CAOA 2BMCA 3M42A 4FBXA 2W9FB 4IM3A 4C35A 5AJQA 3CJFA 2ZMCA 3ZEWA 4TT7A 2RFSA 4IAAA 4QNYA 4TZRA 5LARA 4ANNA 4CNHA 3H10A 1MP8A 2XK8A 4U8ZA 4RQVA 4CG8A 2RKUA 3DAKA 4KIOA 4ZTRA 5E91A 3HMOA 4W4VA 4BGHA 4GVAA 3A8WA 1G5SA 1Y6BA 4L44A 4PWNA 5L6PA 2V5QA 4IZ5A 4O38A 1KE8A 3R9NA 2PUPA 5E4HA 3NNUA 3O8PA 5L3AA 5J9LA 5HQ0A 1UWHA 5HD7A 5J8IA 4JBPA 4O1OA 4CMOA 3F3WA 1LPUA 3A7HA 1ZYDA 4G5PA 3AG9A 3VF9A 4BZDA 5DBXA 3DKCA 3R7IA 5HX8A 3S00A 1XH6A 4MXOA 3P78A 4WO5A 3K5UA 2C0TA 4F63A 3FL5A 5A4TA 5L8JA 3FMLA 4JDKA 4QO9A 4RRVA 2HELA 4GV1A 2OF4A 5HVKA 3OWJA 3PG3A 5D12A 4NIFB 4EH5A 3ANRA 3QLFA 2IW9A 3FMMA 2C6LA 3R04A 3L8XA 5JFSA 3SW7A 2XM9A 2XKDA 4V05A 1ND4A 4R6VA 4TXCA 4AOIA 1SVEA 3CLYA 1TVOA 3G51A 3DDPA 3MH2A 3AMBA 2Q0NA 5F94A 3LQ3A 2PZPA 2BHEA 2ZYBA 5M09A 3DNEA 3P86A 1PXLA 2JFLA 2OJJA 3JVRA 4FYNA 4EK5A 2O65A 3EMGA 2B7AA 4RC3A 4CZUA 4HOKA 2R3IA 2WELA 2R5TA 3DAJA 4M13A 5HKMA 3ZM9A 5AX9A 2CGVA 2BUJA 5EYKA 1JOWB 5C03A 4I5CA 5H8EA 5JSMA 3PTGA 5CSPA 3O96A 1JKKA 4IX6A 4RLKA 3IQ7A
chains in the Genus database with same CATH superfamily
4AZWA 3ZCLA 3ORTA 4O0UA 4DGMA 3COHA 4F99A 2Y4IC 4BCIA 4Z7GA 3NFGB 4BKJA 2BDFA 5TF9A 4EH2A 1M17A 1GJOA 4YJPA 3CE3A 3ZS5A 4NWMA 2OK1A 4ZTNA 4BRXA 1CTPE 5M06A 5H3QA 3A8XA 1ZY5A 1MRUA 2DS1A 2GHMA 4AU8A 2R7BA 3B2TA 3DKFA 3REPA 4FG8A 4TN6A 3LCTA 4NKAA 3RM6A 2WOTA 3GU4A 3UOKA 3R7YA 5FEQA 4E5BA 4O7NA 5I3OA 3ENMA 4C7TA 1Y91A 4GS6A 1OGUA 2YM8A 1ATPE 3DS6A 4GG7A 3EN9A 4PY1A 1J3HA 2YCFA 3MVJA 3ORMA 3SA0A 3PRFA 4HYHA 2OJFE 4KA3A 5IQIA 2R3QA 2Y6MA 2J0JA 4GJ3A 5AR4A 3FLZA 3R7VA 3FV8A 1G8JA 3TCPA 5EM8A 2YIRA 3U4UA 4D9UA 1OL7A 2FGIA 4NKSA 3QYZA 4F70A 1TZDA 1ST4A 3DTWA 3TM0A 4FTKA 2QOOA 2G9XA 4ZSLA 4UZHA 1OIUA 3BLAA 5EQEA 1YQJA 2FYSA 4X3FB 4C59A 3DPKA 3MH3A 4HZSA 4OTRA 3OCGA 4KBAA 4OTWA 4S30A 4S34A 4U43A 4PRJA 4YC6A 4E73A 5D10A 4BCKA 2ZV7A 3D4QA 4NFMA 5DNRA 5J7BA 2HK5A 5T68A 2BIKB 2XJ0A 2QONA 4Y5QA 5EH0A 4FZAB 4U3ZA 5JZNA 3R7UA 1XBCA 4XV1A 5IEXA 3FEGA 4PV0A 3PXFA 3OBGA 2EVAA 2V7AA 2ZV9A 5HE3A 4EOMA 3MFRA 3NVMB 1PYXA 4EUUA 4U41A 4I6BA 3DA6A 4L45A 4LG4A 1XH9A 2J0IA 2NP8A 3PSDA 2PVFA 5AR5A 3EKKA 3KRJA 4AFEA 1BYGA 3AT2A 4EKKA 3QALE 3NFFB 1CKPA 2Y4PA 3D7TA 3RAKA 2Y4IB 4HCTA 5DH3A 3N4VA 3ZO2A 1O6YA 3CD3A 2VTJA 4A07A 4TYEA 4XG4A 1AGWA 4P90A 3RGFA 4L3LA 3Q3BA 4DEBA 3QYWA 2OH0E 2RFDA 3S2PA 4LL5A 4K9YA 3AOXA 2OIQA 4TYGA 4F6SA 4MXXA 3HP2A 2B9JA 2XRWA 2PZ5A 4C34A 3V5TA 3AMYA 2QLUA 3C5UA 3R63A 5JN2A 4I6QA 4KBKA 1UNLA 2OJ9A 4F7LA 5I9UA 5IA0A 3UYSA 4PX6A 4C8BA 3PSCA 5ITAA 1VYZA 2J50A 3FBVA 3MVHA 1JBPE 2F7EE 5GZ8A 2V7OA 4G2FA 4USEA 3BLRA 3DDQA 5IEVA 5J87A 3EZVA 3DXQA 1H8FA 2C3KA 3L8SA 3V04A 3BU5A 3C4CA 2PMIA 2YISA 3BEAA 5KMOA 3FLYA 4Z55A 4MTAA 2I0YA 2X4FA 4FV8A 3SRVB 4O7SA 4X21A 3FLWA 4YHTA 2WNTA 3TNWA 5LOHA 3O71A 1GIIA 3IO7A 4QP8A 3VJOA 4NCTC 4YSJA 4RC2A 1GZNA 4U42A 3BBWA 4IVCA 3QQJA 5HG5A 5GINE 4JJRA 3GP0A 3PZHA 3ZDIA 2A4LA 1U5QA 4I93A 4ZLOA 3BIZA 4RWLA 5CSWA 5TKDA 3PXKA 5A4EA 3BHTA 4AXDA 2GFSA 5EW9A 2X6DA 3G2FA 3VF8A 4B7TA 2B53A 1Q8TA 3GU8A 4FL3A 2VTOA 2A2AA 5IU2A 1YDRE 1GIJA 1M14A 2H96A 4BVUA 3I81A 2PVLA 5BYLA 3HMPA 2WQMA 5ETCA 3O5AA 3E8CA 2X39A 3R7EA 4E1ZA 4R3RA 1WBWA 5BMMA 2VGPA 4AW2A 2FA2A 3AC5A 3MVMA 2C0OA 3FQHA 3UOHA 3L8VA 5FUTA 1R1WA 4OAVB 3QTXA 2E9VA 2OLCA 4RJ7A 3BHUA 4JT3A 4F09A 3D94A 5T6KA 4AXEA 5CVGA 2ZOQA 2PVJA 2W4OA 1ZOGA 5CEQA 1PXKA 1FQ1B 1YXSA 5AWMA 3EB0A 4BKYA 4V0GB 2REIA 3F66A 4D4YA 3NZ0A 3UIMA 2ETRA 4D58A 2P33A 1V0OA 5AV0A 3BHVA 2JKMA 4P5QA 3OCTA 3NIEA 2BAJA 4BI2A 4F7SA 4BDHA 4CVAA 1OECA 3U87A 1OL1A 4AW5A 3BGPA 2J4ZA 4AZEA 2IZRA 5EYMA 3ZOSA 2X6EA 1AD5A 3ORKA 2WIPA 3FMNA 5E8XA 5K9IA 4QTEA 3BLQA 4S33A 3FZRA 3SOAA 3IONA 4QMTA 1SMHA 2HENA 4XJ0A 2ITQA 4UEUA 2XANA 4QP7A 2C3JA 3IGOA 2XCHA 4U81A 4EOOA 4IANA 4D28A 5CF8A 4C57A 3H0ZA 3FPMA 5J1VA 3ORLA 4EI4A 4CV8A 2VWWA 5M4IA 2Z60A 3EWHA 4I5HA 3FSFA 4L7FA 5A3XA 4EK4A 3HV3A 3VJNA 3TUBA 1UKIA 5JFWA 2VO3A 4EOJA 3O50A 1SVGA 1XQZA 2A1AB 3ZRLA 5FGKA 1Q8YA 4IX4A 4IJPA 3CGFA 3WBLA 4MYGA 4NIFA 4R7BA 3R8LA 3MSSA 5DR2A 5IUGA 5KUPA 2CNVA 4QT1A 4Q9SA 2OG8A 3VW6A 3F88A 4KIKB 3O17A 4YZMA 4BCGA 4I4EA 4O84A 4MKCA 4QNAA 3UC3A 5H8BA 3VQUA 4A9TA 3HGKA 3ZXTA 5LVOA 3A62A 3TTJA 1VEBA 3O23A 4EQUA 4FODA 4GT4A 5A54A 1ZYSA 3QTIA 3A61A 5ANIA 3C5IA 2J51A 1JSUA 4J1RA 4F1TA 4EC9A 2R2PA 3N4TA 4QP1A 3W2CA 4HVSA 5JGDA 2AEGA 3PVBA 3GVUA 4C61A 2BVAA 2C6KA 4UV0A 3PVUA 4L7SA 2FVDA 4QQCA 3ZO3A 4FMQA 4CT2A 3QFVA 4D4RA 4W4XA 4QPAA 3A7GA 2HXQA 4F6UA 4JRVA 5KMIA 3MH1A 2VWYA 4O1PA 4JNWA 4LL0A 3ERKA 4R7IA 1OKWA 1PMVA 3OMVA 3LMHA 2IZTA 3D2KA 4JRNA 4W8EA 2VWZA 4BIDA 5IA3A 4AA0A 1PYEA 3IG7A 3HRFA 4XV3A 4FEUA 4WSQA 1IAHA 5AP0A 4HVHA 1L3RE 3ROYA 5KMLA 2Z7RA 3D14A 3QRTA 3RAIA 4BWPA 5AIKA 4J71A 5EK7A 5IF1A 2IPXA 1O6LA 2NO3A 2G2IA 5I9WA 3SDJA 4MXZA 4ZLYA 2WD1A 4XMOA 2W1EA 4AP7A 2R3RA 1XHAA 2P55A 4IDVA 3PP1A 4IAZA 5FEDA 3EQIA 5BV3A 4GKIA 4OLIA 3GFEA 4AGCA 3EL8A 3COKA 1QL6A 2WU7A 4GIHA 4HYSA 4M0YA 5DRDA 4BGGA 3PDTA 3PY1A 3TN8A 2HAKA 4F0FA 5AV2A 4LQMA 4DITA 1UU9A 2VZ6A 4FSRA 3Q04A 2ZM3A 2CCHA 3ET7A 4YTFA 5BVOA 4CKRA 1IAJA 5D9HA 1F3MC 3A2CA 3BCEA 3QA0A 4KIQA 4PDPA 3RZBA 2BIYA 4X3FA 5DYJA 3QF9A 3LFEA 4X2JA 2C1AA 1NY3A 3F5XA 4EKLA 4EZ5A 3KIOC 3BEGA 3ROCA 2FH9A 1WAKA 3DJ5A 1UKHA 4CXAA 4IACA 4DINA 2UVYA 4ANQA 4CYJA 3O7LB 1J7LA 5GJGA 2HXLA 5E9EA 1OM1A 2OWBA 2JAVA 2VNWA 3RWPA 3UQGA 4C3RA 2A98A 2CN8A 4ZIMA 4YZNA 3ZZWA 5IUIA 1OBGA 2GCDA 3SKCA 1Q8ZA 3I4BA 3WZKA 4O7WA 3R0TA 3PA5A 1XH5A 2ERZE 4G6NA 4ENYA 3MS9A 4O96A 2YABA 3P4KA 2H8HA 2DUVA 4E20A 5L2IA 3H9RA 4CZYB 3PRIA 5DT0A 3W2SA 3AC2A 4NYEA 5B2MA 4DCEA 3IW7A 5AR3A 2W7XA 1GZKA 4EL9A 4BBEA 5AR7A 5AUUA 5FRIA 1ZYJA 3LQ8A 4YJUA 3R7OA 4CRSA 2UW6A 3PA3A 4CTBA 3RAWA 1GNGA 2G01A 2XNNA 3CTQA 5DWRA 3POOA 3Q6UA 3QTUA 1DAYA 3UYTA 4RX5A 2JKKA 2C6IA 4TNBA 4BI1A 4I41A 2IF8A 3B8RA 4AQKA 2QCSA 4BDEA 2PPQA 5CYIA 4FJVA 4DEEA 3MBLA 5T3QA 3MGYA 2PK9A 4QMQA 3IW4A 4PMSA 4MBLA 4EZ7A 4QDVA 5F95A 1PMNA 1VYWA 3SRVA 4L01A 2OO8X 5J9YA 4J7BA 4NW5A 2W5AA 3KGAA 3QZGA 4M15A 1SVHA 2I0HA 3I7CA 3VW8A 4NW6A 3OW4A 2XJ2A 2FSLX 3RVGA 3TZ7A 1IRKA 2YM4A 4EWQA 2WU6A 4MQ1A 4ACDA 3Q2JA 2VAGA 3HV6A 4CD0A 5KMNA 4J98A 3QKMA 4XLVA 5BNJA 4J52A 5AUYA 4IZ7A 1PRYA 2YDKA 4ZMFA 1UU7A 2QG5A 5DEYA 4GW8A 3KA0A 5BUEA 5BVWA 5CANA 1DI8A 4DEIA 4KIPA 4FNXA 4L00A 4L9IA 4U40A 4GUEA 3QD3A 5TT7A 5J1WA 4GU9A 5ICPA 3KB7A 1MRYA 3CY3A 5HG7A 4DC2A 2UVXA 4YJTA 3NRMA 2X0QA 3MJ1A 3ZXZA 3QHWA 4OTHA 4RX9A 5CQUA 3ZLXA 4A7CA 4AOJA 2WZJA 3GUBA 1OUKA 3QC4A 4F9WA 5C8NA 2VN9A 3FHIA 2C6MA 1P14A 3QTZA 4C2WA 3LCOA 2BTRA 2WMWA 4BDIA 5EM6A 3PJ1A 3MA6A 4QYFA 4D1XA 5BVKA 4O0RA 3G0FA 4AAYA 4XOYA 3D0EA 2BDJA 1G8SA 2QR7A 5CX9A 4V0GA 4BTMA 3S4QA 1F0QA 2QKRA 1G3NA 3LCSA 4JG8A 3R71A 4FR4A 4HGLA 4IB3A 4C4EA 4BBMA 2I7QA 3R7GA 5DI1A 3QQFA 4RZWA 2C6TA 3CY2A 3F2AA 3EL7A 3ZC5A 2CCIA 4IB5A 3E87A 3HRBA 4DN5A 4TTHB 2VTQA 5ETIA 4DBNA 1LUFA 3DZOA 4KUJA 2QHMA 4WBOA 4ACCA 1LP4A 3MFSA 3KXXA 3CBLA 4NCTA 3TT0A 4IZYA 3D9VA 1M2PA 2BAKA 5CTPA 4H58A 5DVRA 3R73A 4DFBA 3QD0A 5FEEA 3QQKA 5BYYA 4IDTA 1I09A 4QD6A 1K9AA 5M4FA 3CQUA 3BU6A 4I6LA 4DF3A 4X0MA 5IH5A 4GFGA 3HP5A 3NAYA 2WB8A 3D5XA 5HBEA 3W8LA 5IDNA 2VWBA 2R3JA 4U3YA 3SAYA 5AR2A 3DZQA 4QQJA 4XYFA 4DEDA 3MIAA 1ZWSA 4QTDA 5CVHA 1PXJA 4DEGA 2PZYA 4XX9A 5E8SA 4NSTA 5CENA 2UW4A 3G9LX 4FNYA 2UW7A 4DAWA 5DFPA 4W9WA 3IK3A 3QUEA 1MQ4A 4XEYA 3W0PA 2VTRA 3UNKA 2C3LA 2WTDA 4KIKA 4GMYA 3ZLSA 4D4VA 3OW3A 4BKZA 4C33A 5CF5A 3MW1A 4DG3E 4DH3A 5KKRC 5KBQA 4FSNA 2YEXA 4RIXB 4BWKA 4BTJA 5FTGA 3SOCA 3OY3A 4FTMA 1H1SA 2A0CX 3BYSA 4GCJA 4K33A 4HGSA 1RE8A 4BZNA 2WEIA 5JKGA 3OF0A 2F9GA 3RPSA 5AX3A 3QKLA 5JGBA 3VS7A 2AUHA 5CSHA 5HTBA 4DG0E 2W4JA 4FF8A 3NUNA 1RW8A 4JAJA 2F57A 5HIBA 4U44A 4FKSA 3FYJX 4XUFA 2W17A 1O9UA 3CPCA 2WMBA 1CKIA 4ERWA 4A9YA 4GK4A 4HPTE 4OT5A 5AM7A 2FB8A 3EKNA 3MB6A 4DDGA 5HESA 3UGCA 3FI3A 4O0XA 4F64A 3CIKA 3ATSA 4U0IA 1JNKA 3MWUA 3K3IA 2XKEA 4CG9A 2OIDA 2VUWA 5HNGA 2B9HA 1JPAA 3BE2A 3DK7A 4G1WA 5AAFA 1U46A 4E7WA 4EOQA 2ACXA 4ZS4A 3NNVA 2JEDA 4R3CA 3DBEA 4M84A 2UW8A 5IA5A 1G8AA 4A4XA 1I44A 3KN6A 3EOCA 1M7QA 1FINA 5C01A 2W1GA 5FBOA 4FK3A 2P2IA 4MK0A 4CQGA 1REJA 3OXZA 3UG1A 4YLLA 2YA9A 2BHHA 2IWIA 2OH4A 2WIHA 4HYUA 3A60A 4LV7A 5HIDA 3BU3A 2WEVA 3F5GA 4IFGA 5DE2A 3TEIA 3UODA 2PWLA 2WGJA 2YWVA 2PUNA 1E1VA 3S3IA 1YXVA 4X2FA 1PXMA 2YFXA 4MNEA 5IQHA 4TPTA 1W0XC 3QCYA 4OTIA 4P7EA 2VV9A 2UV2A 4PTGA 4IX3A 5TR6A 5HCXA 2QVSE 3HDNA 4FV2A 3F3UA 4RWKA 3PWDA 3LZBA 4XV9A 3S0OA 2R3LA 5EKOA 4QMVA 3T3VA 5LXMA 2ESMA 3G9NA 1RQQA 2J6MA 3LFSA 3ULZA 2QOFA 2GNJA 1YDTE 2PVHA 2WPAA 3DAEA 3FMDA 1TQPA 3TNHA 2E9OA 3P7CA 5JFVA 2O8YA 3G6GA 2BILB 3GQLA 3AT4A 3H3CA 1Q24A 3FKNA 3SV0A 1H1QA 3GBZA 2QO2A 3PPZA 4BWXA 4TW9A 3GCSA 4C37A 3ORIA 2UW9A 4GU6A 4BYIA 3I6WA 2WXVA 1YWRA 1YXUA 3OOMA 2G2HA 3LQ5A 2BAQA 2WFYA 1H1RA 2X9FA 2WMVA 3QWJA 4FV0A 1OBDA 2X8EA 3AKKA 4ASZA 4XG8A 5J79A 3U4WA 4IWOA 4RVKA 4FUYA 3ZFMA 3PWYA 4FT3A 3TACA 4D0WA 2Z02A 4FKIA 4DE4A 4MUQA 4K6ZA 4L3JA 3QXPA 4I3ZA 4PMPA 5CT7A 3Q5IA 3ZYAA 1ZYLA 4O4DA 2EUFB 3QTQA 2PMLX 4KKGA 3W8QA 2HOGA 4CTCA 3TDWA 5C4KA 2Y7JA 1XKKA 3DQXA 4IHPA 1UV5A 4PQNA 5DA3A 2J5FA 4OBOA 5AP6A 1WCCA 3R8MA 4EHZA 3NCGA 5A6NA 4ORKA 4J96A 1UNGA 4AGWA 4HVGA 5HTCA 4CV9A 4FKGA 2X2KA 3EJ1A 5AUVA 5CNOA 3UG2A 2ITTA 1WBPA 2C68A 5CQWA 2PVMA 3WF8A 3EQBA 4ANSA 3FKOA 3A7JA 4DDIA 3SD0A 2J0MB 3RINA 5CF4A 3UZTA 4EK6A 4TWNA 2W1DA 2JIIA 2YIWA 4MF1A 4X3FC 3ZDUA 2O2UA 4RFYA 4DFNA 3NNXA 4IX5A 2WQEA 3VS2A 3GCVA 4BTKA 2X7GA 3DBCA 5C1QB 3L9PA 4QP2A 5IA2A 3B2WA 4YZDA 4LUDA 4K1BA 3GT8A 3QTRA 4FZDB 2NRUA 2O0UA 5EFQA 2GS6A 2JDSA 5EOLA 3RPOA 4E93A 3PUFC 5FP6A 3VS3A 2WOUA 4FTOA 5AUXA 3FXZA 4F65A 3R2YA 5HG8A 4YJNA 4ALUA 5DN3A 3ML1A 1JWHA 5C8KA 3EYGA 3FL4A 3VHKA 3NR9A 4QP9A 3RNYA 3O8UA 1KUTA 3D5WA 4FOBA 4I6FA 5GNKA 2ZDTA 3WIGA 4ZS0A 4EH4A 4C4JA 4DFXE 3TZ8A 2VTLA 3DCVA 3Q4UA 5G1XA 4U7ZA 4MWIA 4AT5A 5M4CA 3LMGA 3RK7A 3UE4A 4BF2A 2IEWA 4RMZA 2GNHA 2PHKA 5M53A 2CNUA 4WNKA 4O7ZA 2QOCA 2B0QA 5H2UA 3ZHPC 1FVVA 4LM5A 3HEGA 3LJ2A 5CXHA 5ACKA 4P5ZA 4WHZA 3TKUA 2W4KA 1GAGA 4ZY6A 2QURA 3CXWA 3KXZA 4LI5A 2YM3A 5TE0A 3RK5A 4QPSA 3WARA 1ZZ2A 3ZEPA 1URCA 4JBQA 2UZBA 5E8ZA 2P3GX 2QQ7A 4U9AA 3NEWA 2ITVA 4I0TA 4WG5A 3ZUTA 5GJDA 3TKIA 3QU0A 1OIRA 1YOJA 3P0MA 3P7AA 3GU6A 2W1HA 4RWIA 1GIHA 1LEZA 2C47A 5FWKK 4YLKA 1IEPA 3DGKA 3E88A 1YWNA 4LDTA 3DB6A 4RZVA 4ZSJA 3E92A 5HVYA 3U51A 3MV5A 4WRGA 4IM2A 2PMNX 2QOKA 3UNJA 3TL8A 3ZSIA 4CMTA 4JDIA 5L6OA 4R5SA 4FKTA 1YOLA 2G1TA 3KVWA 4C3PA 4YO6A 2ERKA 3TV7A 4G31A 4XH6A 2XNMA 1IR3A 5J5TA 3FZSA 3ZMMA 2WMQA 2WHBA 3GOKA 1P5EA 4IC8A 3U9CA 3WF7A 4AGUA 3KREA 2VWIA 4F78A 4LYNA 3W2QA 4D2RA 3S95A 1H00A 4HGEA 4K8AA 3VS4A 4J97A 4JX3A 4X7QA 5DRBA 5HNIX 5K4JA 5DPVA 4JMQA 4NL0A 3UIXA 4RG0A 4QYYA 4YURA 3EN6A 2WMXA 3TUDA 4OAUC 4LMNA 2OXXA 3JYAA 4CFFA 5HLPA 4EEVA 4L8MA 4ARKA 1ZARA 3RHKA 5C4LA 4AXAA 4IZAA 3VUTA 2ITOA 3I5NA 1VJYA 2VTMA 4FKJA 4NTTA 2OZAB 5KHXA 3QRJA 2R3NA 1IASA 5AA9A 2VO0A 4FKVA 3CJGA 4RIXA 3Q52A 4I23A 4QMNA 4Y5HA 4I20A 4ENXA 4BCOA 3PYYA 4OUCA 3FHRA 3R01A 4M97A 3MY0A 3SW4A 2OICA 4EYMA 3W0OA 2C6OA 4LFIA 4DFZE 2BDWA 5AP5A 3C7QA 1KSWA 1PW2A 4KABA 3MTFA 4UB7A 3W1FA 3KXGA 2I1MA 3Q53A 4TYHB 1FOTA 5IQCA 2PULA 4C0TA 3NUAA 3W0QA 4R78A 1Q97A 3GQIA 3DBDA 4I1ZA 2YHVA 3MA3A 4UWBA 3VULA 2JD5A 4BB4A 3MB7A 3QGYA 2JKOA 4FV4A 4O6LA 5I9VA 4M8TA 3EFWA 3F6XA 4MBIA 4FOCA 3ZRMA 2BCJA 5AP2A 3TDVA 3JR1A 3W55A 4Y85A 5FD2A 3F3TA 1Q62A 2OIBA 4I0SA 4BI0A 1URWA 2XJ1A 1ZOEA 3TI1A 3IS5A 3ZTXA 2BFYA 4APCA 3T3UA 4RGJA 3QD4A 3LFQA 4ITIA 4ITHA 4L53A 2W9ZB 4RJ6A 2CSNA 2JLDA 4FT0A 5A4LA 3UDSA 3QC9A 1V0PA 3GCPA 3UO4A 4O82A 3LLAA 1WBTA 3CR0A 1HOWA 3ALOA 1W98A 4MVFA 4PDOA 4JX7A 4ACMA 3LKMA 1FGKA 5AP7A 1UU3A 2VGOA 3RHXA 3I6UA 5IH4A 2UZTA 5BUIA 2XAOA 3KL8A 4FT5A 4CFVA 3M1SA 2CLXA 1YI4A 3F3VA 3KQ7A 2W06A 3FQSA 5IQGA 4F4PA 2H6DA 2YDJA 5ANGA 3MFTA 2O63A 2AC5A 2HY0A 2C5NA 3OP5A 3VUGA 4CKIA 2QOQA 2YAKA 2E9NA 4DHZA 4PUZA 3E62A 4RJ3A 4O7LA 5EW8A 4FSYA 1B6CB 5L6WL 3W32A 4D2WA 3DTCA 5HORA 4JVGA 4RA5A 4XP3A 2XVDA 3NMUF 2RFNA 3QBNA 4KS7A 4M68A 3SQQA 4BDJA 4RSSA 4B99A 4MEDA 3CTJA 2CMWA 2PE2A 3L9MA 5TOZA 4C02A 3KEXA 5DHJA 3VS0A 4RIWB 4JXFA 3ZLYA 3VBXA 4DH1A 1XMMA 3QLGA 2B1PA 2I0VA 1O6KA 2VWVA 2VTIA 4YJVA 4IADA 3FLSA 5L2TA 1EH4A 2GS2A 1SZMA 1OZ1A 4NFNA 3ETAA 5K0KA 4PPAA 4YBKA 3ANQA 3PE1A 2BRGA 2FO0A 4FEQA 1AQ1A 1OPJA 4HJOA 4QTCA 5DR9A 4MWHA 4AZFA 5JH6A 3HA8A 2QO9A 2W1ZA 3A7IA 2GU8A 3E8DA 3LCKA 4MX9A 4TWOA 5H9BA 2WTJA 5CEIA 3T8OA 5BMSA 5AAEA 1ZXEA 4RC4A 4Y72A 4N6YA 3GENA 4U5JA 4GK2A 2J7TA 2FSOX 3AQVA 2PZRA 5EQPA 4E6QA 3JVSA 3M11A 1T45A 1OI9A 3Q32A 2XNPA 5L2QA 3LFCA 2J90A 3P7BA 3LE6A 3OCSA 2ZDUA 4NK9A 3O8TA 1M52A 4U6RA 2O64A 2CKEA 1Z9XA 3WILA 4WA9A 2YM5A 4W4WA 3WZJA 4ASXA 4PTCA 3P23A 1OVEA 1VR2A 3FDNA 2XIZA 3FXWA 2XKFA 5CNNA 3UIUA 3EQFA 2QOBA 4JIKA 3ZONA 1HCKA 3GC9A 4XP0A 2XBAA 4UWYA 4DGGA 4O83A 4KAOA 4UN0C 2JKQA 5DG5A 1ZY4A 3UPXA 1WBVA 4ACGA 1J7IA 3Q4ZA 4EWHA 5FDPA 2X8DA 3I1AA 4FTTA 3W2OA 5CSVA 5KMJA 2GPHA 4UXQA 3KF4A 1V0BA 2XF0A 4O86A 2O3PA 5HO6A 2UVZA 4JBVA 4DLIA 5CXZA 4BJJB 1BUHA 4WUNA 2VO6A 4I4FA 1CKJA 1CDKA 2R4BA 1REKA 1ZLTA 4O6EA 5BPYA 3GU7A 5GJFA 3TYKA 3SXRA 3LM0A 4FC0A 5AUZA 2BRBA 4OTQA 1BX6A 4ZAUA 5KHWA 3NUXA 3G5DA 5LVLA 4PP9A 1H27A 3FE3A 3EYHA 3DKGA 5BQ0A 2CNQA 2HCKA 4FGRA 2DYLA 3FY0A 3PXZA 1P2AA 2XRUA 2Z2WA 2AC3A 2ZFYA 4FIEA 5KNJA 4XOZA 4QEBA 4FKQA 1IA9A 4WOVA 5M44A 4I21A 1APME 1W8CA 2UUEA 3KVXA 1OPKA 4PPCA 4P4CA 4EC8A 4EHVA 5IQBA 3HRCA 3NIZA 5CS6A 3EFKA 1YVJA 5F20A 3U6IA 3FC2A 3VO3A 3HAMA 4H39A 2C6DA 5L8LA 5FG8A 3E7VA 4PL3A 4FVQA 3O51A 3VUKA 4FTNA 3CQEA 3ENHA 3POZA 3LCDA 2SRCA 2QD9A 2VWUA 4FKUA 3L1SA 4MNEB 4XRLA 4FIJA 3OUKA 3SXFA 4FIIA 1X8BA 2J5EA 3DNDA 2CN5A 3V6SA 4EJ7A 4EOPA 4GT5A 3V5WA 5KMMA 1ZMVA 4O27B 2XIKA 3KRWA 2X9EA 3U54A 1WFCA 4DTKA 4WNPA 4FVRA 4JR3A 3L8PA 4GH2A 2ITWA 1WBOA 5C9CA 2QLQA 4Y46A 2BRHA 2P4IA 2X4ZA 3FUPA 2VX3A 4HYIA 5CU3A 4D2TA 3CSVA 2HIWA 3GCUA 1ZYCA 4OTGA 3QX4A 1Y57A 4GYGA 3W0RA 1NXKA 2C5YA 3AC1A 3Q9XA 5HBHA 3UTOA 4A9RA 1Z5MA 5J7HA 2BALA 4R7HA 2OZAA 2XA4A 3UP2A 1OL5A 3QUDA 4LRMA 4MF0A 5HTIA 4FSMA 2CLQA 3KC3A 2YACA 1ZAOA 4U79A 3HMMA 1U4DA 5CZIA 3Q60A 5CAVA 2HW7A 4YJOA 1YOMA 2PUUA 3AD6A 4QMSA 4V01A 1JSVA 4IAKA 1XJDA 3OCBA 3W2PA 4AG8A 2C6EA 4QDEA 4QMXA 2C1BA 1W82A 4D1SA 4TYHA 3R1NA 1Q4LA 3EHAA 2Z8CA 3C4FA 3TG1A 3CC6A 1U5RA 4FZFB 5EDPA 2ETKA 4RA4A 2CPKE 1YI6A 3E3PA 5AUWA 2EU9A 4BDBA 4Q9ZA 5HO7A 4EJNA 4GG5A 2BRMA 2CKQA 5CI7A 1R3CA 5HCYA 2X7FA 4NEUA 4AZTA 1K3AA 5E7RA 5AP1A 3TJDA 4BFMA 4GT3A 1YW2A 5D7VA 3F82A 3HX4A 2NPQA 4X2GA 3NUYA 3VUDA 2PUIA 4N4SA 4PTEA 3RALA 2VTSA 3BPRA 5M56A 3MIYA 4FKWA 5CWZA 1WZYA 4ID7A 3FPQA 5HG9A 4BICA 4EQMA 3UO5A 3EH9A 3R21A 1H01A 3HNGA 4ITJA 3BWFA 4F6WA 1Q3DA 2IVUA 3PP0A 3BKBA 4IBMA 5EI8A 1H08A 1JKLA 3HVCA 4Q2AA 4DFLA 4F7NA 4DT8A 2XCKA 2WTKC 5M08A 4B6LA 2VU3A 3TNIA 3C50A 2UZLA 5LVMA 4BYJA 4DHIB 2ONLC 2OKRA 1NVRA 5IQEA 3L9NA 3EIDA 3LFDA 1OB3A 4AT4A 3COIA 3OWPA