2XNPA

Structure of nek2 bound to cct244858
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
277
structure length
253
Chain Sequence
SRAEDYEVLYTIGTGYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSHRDLKPANVFLDGKQNVKLGDFGLFVGTPYYMSPEQMNRNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title Benzimidazole Inhibitors Induce a Dfg-Out Conformation of Never in Mitosis Gene A-Related Kinase 2 (Nek2) without Binding to the Back Pocket and Reveal a Nonlinear Structure-Activity Relationship.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 253
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xnpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xnpA01
1OGUA 2W1EA 2OG8A 3P7CA 4Q5EA 5E8TA 1OIQA 1FGIA 1K2PA 4QP7A 5CT7A 4YTIA 3MESA 4CRLA 2IVTA 3ZRLA 4CKRA 4G16A 3KMMA 4EORA 4FV7A 4X3FC 3R21A 2CHLA 3QRIA 5EYCA 3A4PA 4C38A 4G3DA 3RINA 4JXFA 5KZ0A 3U9NA 4FR4A 2WXVA 3UO6A 3I0OA 2CCHA 4GJ2A 3VULA 5JN2A 3ORXA 2NPQA 4AZTA 4L45A 1MRVA 3HUCA 4TY1A 3FI3A 3TV4A 1Q8YA 5EQYA 2YHVA 3M1SA 3FPMA 3W18A 3ZO3A 2OICA 3MV5A 4FKIA 2X2LA 3PJ2A 3K5VA 5E8UA 3BGPA 4FNWA 4HGLA 3UYTA 4J96A 5HX6A 1OIUA 3HZTA 4YC3A 3UG1A 3H30A 1J1CA 3IPHA 3P78A 2YIRA 1PXKA 2WB8A 3FKOA 3MGYA 1SMHA 4M84A 3CXWA 3I5NA 5EM7A 3ELJA 4L42A 3CC6A 2GFCA 3PLAE 4BCHA 2ZMDA 4DEHA 4CVAA 3II5A 1V0PA 3IGOA 5BVKA 1IA8A 1SVHA 2QKWB 3MB6A 4X21A 3QQFA 1XH9A 3R63A 4I92A 3TKHA 3OBJA 4RA5A 4DEIA 4YBKA 1HCLA 4H36A 4JBQA 4QQCA 4AFJA 3O7LB 1ZMWA 4BYJA 2YZAA 2VWXA 2YCQA 3OMVA 3QQGA 5CF5A 3HA6A 3CCNA 3QTIA 3EN6A 2OIQA 2ZM3A 4ZAUA 3SW4A 3QWKA 4U44A 5CAUA 2OXXA 2O64A 4UMQA 4ENYA 4DTKA 4YSJA 4MHAA 3ENHA 3QRTA 3BZ3A 2B9FA 3F2NA 4RIYA 3GC9A 4CYJA 4G6OA 3ZH8A 4X0MA 1B39A 4Y95A 5I9WA 5H2UA 3K3JA 4HCVA 5I9UA 4DEDA 3GQLA 3NZ0A 2FSTX 4MYGA 5AV3A 4EOJA 2XZSA 5EQPA 1QCFA 3TXOA 3SHEA 3BHVA 4GU6A 4AS0A 4D0XA 3VRYA 3PJ3A 3UYSA 4BGGA 2OJGA 5CNNA 2ZYBA 3G6HA 3MVHA 3RJCA 3BPRA 3POZA 4OTWA 1XH5A 4O7VA 4WSYA 2X6DA 3CD8A 5HCZA 2FA2A 2IG7A 2Y8OA 3T9IA 1F3MC 4ONAA 3VS0A 3NYVA 1WZYA 3AC5A 4QMUA 5HU3A 1PMUA 3D7ZA 3FLSA 4B6LA 5LCJA 1Q24A 3ZDUA 4FKSA 2VWIA 4E5BA 1KSWA 3RTPA 3QZFA 4J8NA 4HGTA 3ODYX 1ZYSA 3WIKA 3HDMA 4X3FB 4MWHA 3UIBA 1WBNA 2B9IA 3C4FA 3FKNA 2OW3A 5C1QB 4MAOA 2VTPA 4NM5A 5L8LA 2I0VA 3VS6A 2WTVA 1KOAA 2EB3A 4YLJA 3HV7A 4YZBA 3AC8A 4JAJA 4A9YA 4MX9A 5T6KA 4X2FA 5GIOE 5JFXA 2W5AA 2QOQA 3E88A 1MUOA 2WQBA 3LFFA 3LE6A 4RJ8A 3MA6A 5DVRA 5IF1A 3HL7A 5GIPE 1NVQA 1ATPE 1RJBA 2P4IA 3BELA 4G1WA 1CKPA 4F1OA 5DMZA 4KSPA 4EUTA 4XRLA 2WMTA 4KBAA 1YW2A 4I4EA 4PTEA 2WMWA 3QGWA 4FNXA 4A9TA 4GYGA 2KTYA 4YMJA 4PPBA 2P2IA 2WTKB 4IFGA 4FZAB 5KE0A 5DR6A 4EQUA 4FV6A 2PUNA 3RK7A 3FUPA 5FM2A 3P23A 4WNKA 2J0JA 4NW5A 1Y91A 2J5EA 4DG2E 2X7GA 3I6WA 4F08A 3E8CA 2VWWA 5AADA 3NIEA 3VN9A 4O7WA 4JOAA 5FEDA 4CEGA 1NVSA 5DN3A 2R3HA 3IW4A 1ZLTA 2CN8A 3M11A 3PRFA 2RG5A 1M17A 4DITA 3LLAA 4BI2A 1H00A 3G51A 2Y6MA 5KCVA 3I79A 1WCCA 3EQPA 4ITHA 3PA3A 1BUHA 4XS2A 1Z57A 2J2IB 4FTIA 3PG1A 4FV5A 3KGAA 3W32A 3ZC5A 4DC2A 3L8PA 1M7NA 3HGKA 1IEPA 2XIRA 4MQ2A 1SNUA 4AW1A 1ZYLA 2UW7A 2IWIA 4GVAA 1UKIA 3EFWA 3UVQA 4AZFA 3PP1A 1G5SA 4DGOA 4F6UA 3SDJA 4BDFA 2WTJA 3C7QA 4RLLA 3ZUTA 5EI8A 3P08A 3PY1A 3R2YA 5I9VA 4O0TA 3RK9A 2QNJA 4FUXA 4C4IA 3ZTXA 4CNHA 5IEVA 3Q2MA 4NYEA 4BHZA 4GFGA 4RJ3A 3FXXA 4TTHB 2GQGA 3EN4A 3KF7A 4ZJIA 4J1RA 5L6WL 2G2FA 4DT8A 3MH3A 2IZTA 2PVNA 2XNBA 3D5VA 2W4KA 2X2KA 3QZIA 4HGEA 5CTPA 5D9HA 3VUHA 2Q0BA 3TNWA 4PL3A 4J8MA 4QMPA 1QMZA 5DYJA 4KNBA 2V62A 4IZAA 2C5OA 3COMA 3HECA 4TWCA 4YLKA 3ZC6A 3GBZA 2VNYA 5CU3A 1LEWA 3Q3BA 4XMOA 2XYUA 2PTKA 3U51A 2X9FA 4A9RA 4CZUA 5EQEA 4DG3E 4ZY4A 4FV2A 3DTWA 1RE8A 3DXNA 2HZ0A 5A6NA 2YAAA 1M52A 4FTUA 1OZ1A 2UZWE 4N70A 3TZ8A 3ZUUA 2Z7RA 3Q4UA 4B8MA 2C6LA 4ZXTA 3F61A 3BIZA 3RALA 1KE5A 1OIYA 3UIMA 2IPXA 2ITVA 3GB2A 5E8ZA 4KS7A 4FK3A 3O7LD 5CI6A 4JDIA 3DAJA 1YHWA 3ITZA 5IA5A 2C0OA 1BMKA 3OBGA 4KD1A 3OW3A 4RFYA 1H0WA 4BKZA 4O2PA 3LQ5A 5A4QA 4RX5A 2ETRA 2OFUA 2Y0AA 4QPSA 3HYHA 1W84A 2A4LA 3FYKX 4E6DA 2HAKA 4IAFA 2WOUA 4RC2A 3LCKA 2ONLA 5J1WA 2XS0A 5ANKA 2VAGA 4O0RA 3UMWA 2Y4IC 4TWOA 3OF0A 2J9MA 4HYSA 2VTRA 2QI8A 4IVAA 2P33A 4FV0A 5M55A 5C9CA 3DPKA 4E7WA 5L2SA 3R7VA 5DR9A 3DZQA 3DNDA 4YPSA 4KSQA 2PY3A 2C3IB 2HCKA 1IA9A 4WT6A 4IX3A 3GXLA 4C2WA 3R7YA 3TKUA 3L8SA 2I0YA 5HG5A 2XKEA 3DCVA 3SAYA 4D9UA 5CAPA 4XJ0A 3TEIA 4L7FA 1O6LA 3FY2A 2EXEA 3FLQA 2F7ZE 2Z2WA 3R8ZA 4D2RA 4EK6A 4JDJA 3QBNA 1PXPA 3F5PA 4FYNA 3QCXA 2HZ4A 3MS9A 3EQGA 4AF3A 4YZNA 4OAVB 3FWQA 3PXFA 3KRRA 1OL6A 3PRIA 4EWQA 2YM8A 3LPBA 4QMZA 1FVTA 4G3EA 4EC8A 2I0HA 3VBYA 2OZOA 3HRCA 2WTDA 2DUVA 1PYXA 2GHLA 2X4FA 3COKA 1Q62A 5IQIA 3CY2A 1G8SA 3BE2A 3ZYAA 4CXAA 3VJOA 4J99A 4BBMA 3AT3A 1OIRA 4O7LA 3EQFA 5DH3A 3OY1A 3RAIA 4KA3A 3GUBA 3WF8A 2PZPA 2E9UA 4TKSA 1ERKA 5M57A 5IA3A 4TPTA 3MVJA 4C0TA 5L3AA 3KN5A 3ORPA 4DFLA 5L2IA 4MNEA 3AD4A 4N6ZA 3ALNA 5IA0A 5IEXA 4R5YA 3QXOA 3FAAA 4QP1A 1MQBA 4QYGA 3ZO2A 3DKOA 4TW9A 2XH5A 3NDMA 4H1JA 4HZRA 4FGRA 4FNYA 3GQIA 5K3YA 1FBNA 4JQEA 3C5UA 5FXRA 4BCQA 4FKOA 4QP8A 5DPVA 3DJ7A 2CGXA 4Y85A 4APCA 3QCQA 2CGWA 2W99B 5CWZA 4JLCA 1XBAA 1TVOA 4O38A 3BI6A 5IQDA 3V5PA 2PVJA 3EZVA 5HG8A 5KZIA 2GS2A 3PY0A 2WIHA 5AIKA 3LQ3A 4ANQA 4UMUA 3DBQA 4FIGA 5JZNA 5HLPA 3Q9WA 5TOZA 2YCFA 3P9JA 4FTOA 2YDIA 3ANQA 4BIBA 4N0SA 2VTOA 3VO3A 3GFEA 2NNWB 2Y4IB 5D7AA 5AV1A 5I9YA 1PXIA 4CKJA 3KXXA 3RWPA 3R9OA 3VQHA 3BHUA 2F49A 5FD2A 5JT2A 3QQKA 4C61A 4NM3A 1B6CB 3LM0A 4AT5A 4EUUA 3L9NA 4DCEA 1PXLA 2YEXA 4RZVA 4O7RA 4FMQA 5GZAA 5AM7A 5H9BA 2R7IA 4BCIA 3EZRA 4ZMFA 4BCGA 1H07A 2HIWA 3EFKA 5CSXA 3VRZA 5J9ZA 3QX2A 3N51A 4I23A 1E1VA 2CPKE 2B7AA 2F57A 1YVJA 3PTGA 3EL7A 3PXRA 1CMKE 4PQNA 5CF8A 4OTRA 5JGBA 1UU9A 4QP9A 2H96A 4M67A 5KMOA 3MIYA 3R30A 4BBFA 4FC0A 5H3QA 3UNZA 1M14A 5IU2A 1BKXA 4JVGA 2GNHA 5ACBC 2JDSA 1HCKA 1REKA 4LGGA 3FYJX 4UB7A 3HAVA 4LOOA 2PVMA 2PSQA 4FEVA 2XNOA 4X2JA 4JBVA 1XHAA 3RWQA 3VBTA 4FEUA 3NVKI 2YCRA 3F5XA 3EH9A 4M7IA 4HW7A 4C36A 3G6GA 3OUKA 4GT5A 3NNUA 3QX4A 2OH0E 5BYZA 4U0IA 2QHMA 3ROCA 3U8WA 1URWA 3QCSA 4BCJA 3AXWA 4RWIA 4KAOA 3UO5A 1OPLA 1GIHA 3KVWA 4FI1A 3EQIA 5FBOA 3BKBA 3VBVA 3KF4A 5AM6A 2W4OA 3LQ8A 2GSFA 4JG7A 4CLJA 5FP5A 3MWUA 3PJ1A 3FE3A 3P79A 4ZP5A 2ITYA 5ANDA 4RFZA 3NMUF 3Q60A 4ZZOA 3QTUA 5KMNA 3QYZA 3AC1A 4QTDA 4D2TA 4WNMA 2J5FA 5A4EA 5C8KA 3Q4CA 2VO3A 5FDPA 4U45A 1UV5A 3L1SA 3FHIA 5B2LA 3S00A 2X9EA 3IONA 2AC5A 4R3CA 1ZYCA 1YWNA 4MXCA 4JDHA 1R39A 3LVPA 5HHWA 3R28A 5M4UA 2ITTA 3JR1A 4D2SA 3AGMA 4EOOA 1SVGA 2PUIA 4Z3VA 4ANBA 2CCIA 5LMKC 5AP6A 4QMNA 2YDKA 4WRGA 4RVTA 4AOTA 2ITXA 4FSYA 4WG5A 1ZMUA 2OKRA 2RG6A 4IAYA 4CFMA 1GZ8A 5A46A 3FLNC 3GCSA 4TYHB 2YA9A 4KBCA 4I22A 1S9IA 4JRNA 1H1SA 3FI8A 1ZWSA 4BRXA 4ZLYA 1PY5A 4C4JA 3QCYA 5C27A 3G33A 5FLFA 4HYHA 5E8YA 5TT7A 3FMDA 3V6SA 4I41A 3LAUA 2EUFB 3KREA 5LQFA 3WYYA 2PZ5A 4G3CA 1JLUE 2Z7LA 3R8PA 4TNBA 5KMLA 5C01A 5ICPA 3V3VA 5AP7A 4Q9SA 3VJNA 1Q8WA 3LFAA 2UUEA 2W9ZB 4C37A 4U97A 4TNDA 5FWKK 3THBA 4F9BA 4GG5A 2ITOA 4X2GA 4DLIA 4G31A 3VW6A 5KBQA 4NH1A 1WFCA 1XQZA 3OFMA 2W17A 2ZMCA 4KUJA 4LGHA 3FEGA 3QTXA 5CANA 2I0EA 2YJRA 3FXZA 4O0UA 2UZEA 4FK6A 4FL2A 2RL5A 4J71A 4DFZE 5LMBA 2B9JA 1Q8UA 2JKMA 2Z60A 2W96B 3NX8A 4RJ7A 4E73A 4YPDA 1R1WA 4MD9E 5BX0A 1W82A 1Y57A 3QUEA 4Q2AA 4OUCA 2B9HA 1O6KA 3ZLXA 4BCPA 4DGMA 3Q9ZA 5M4CA 3HVCA 1Q5KA 3A61A 4XP3A 4AQCA 1VZOA 4HVGA 4FVRA 3MBLA 4IJPA 4QRCA 5HNGA 3ZS5A 5EG3A 3JS2A 3R22A 3BLRA 2YIWA 3S2PA 3NIZA 1JKSA 1OL1A 3DS6A 2VTQA 5G6VA 3U4WA 3UC4A 4YLLA 1NXKA 3DFAA 3W2CA 3PSBA 4BCOA 2I6LA 4RQVA 2C3KA 4EBVA 3V5TA 3BGQA 1ZYDA 2AUHA 3GT8A 3ATSA 4RT7A 4ZY5A 5T68A 1FOTA 3RP9A 4C8BA 5CAQA 4E4XA 5CASA 4DN5A 4EH4A 4BDGA 1JKTA 3BYVA 3C50A 4Z7GA 1H0VA 3N4TA 5C4LA 4PX6A 2EVAA 3WIGA 2XKCA 3UZRA 3SXSA 3NGAA 4QTEA 1BX6A 1V0BA 4NM7A 4XHKB 1DI8A 3AMYA 3QZGA 4QP2A 1BI7A 1MP8A 1UNLA 3UIUA 5HO8A 4AP7A 3FZRA 4WNPA 1FMOE 4EH8A 4I5PA 2JLDA 3AT4A 1VYZA 4DE4A 2WMQA 1R0PA 4WIHA 5I9ZA 5E8SA 4BFMA 4D4RA 4I94A 5K0KA 3HKOA 4E1ZA 4ZLOA 4LMUA 5EK7A 2RIOA 3NW6A 4FKVA 3TV6A 2JIIA 3D2KA 5DT0A 4D58A 2GNIA 4CZYB 3RGFA 4L44A 1IG1A 4IWQA 3DBDA 3C4WA 3GEQA 1XKKA 2OBJA 2NRYA 2C5YA 2XRWA 3FXWA 5K9IA 1Q8ZA 3FSKA 3OXIA 3N4UA 1OL2A 2QOBA 4H58A 5L6PA 4IZYA 5K5NA 2YCSA 4GT3A 2GS6A 3GOPA 1YI4A 3H9OA 3GCPA 3KL8A 3W8QA 3F69A 4CTCA 4FKQA 4BZOA 2SRCA 1QPEA 4N6YA 4QP3A 3WF9A 5IUGA 5JMSA 3CJGA 5HD4A 2VWUA 2FYSA 2YM6A 4PWNA 1CKJA 4MF0A 1UU7A 2C47A 3KN6A 4APPA 1WBWA 4ASDA 1GOLA 3PZEA 3CTHA 3HMNA 4UYAA 4WOVA 4DYMA 4LM5A 3RKBA 1LP4A 2QLUA 4KIPA 1E9HA 2O8YA 4BTKA 4Z16A 2XKFA 3V5LA 3WYXA 2W5HA 5HIBA 4IH8A 4IXPA 1I44A 2WEVA 5AP5A 1JKLA 5EHYA 3Q4TA 5TR6A 2F2CB 4RJ5A 4BZDA 1DI9A 1IR3A 3M42A 5JSMA 4M69B 4DGLC 5DR2A 4LL5A 3CS9A 3F5UA 3QAME 2YWVA 1MRUA 4D2WA 3I1AA 1JOWB 2LGCA 4V05A 4DH8A 1FQ1B 2HK5A 5I9XA 4FV4A 5DBXA 3CGOA 2YN8A 2ITQA 4HYUA 3OT3A 4RFMA 2WHBA 5ANJA 4GK2A 3Q53A 3D5XA 1QPDA 3OW4A 2BR1A 4XLIA 3UOLA 4XG7A 4CTBA 3BX5A 2WKMA 3QHRA 2XNPA 5AR2A 1BYGA 3BEGA 4RMZA 2VTTA 1NVRA 4YSMA 1SM2A 5ANGA 4NIFA 4ZSGA 3R7GA 5KHXA 4F70A 2UW0A 3QA0A 3EHAA 4FVPA 3F3WA 3UC3A 2X4ZA 4ITJA 2OJFE 3NEWA 3PDTA 5CU0A 4V04A 2H6DA 2QOOA 3R01A 3DOGA 2WU7A 2R0UA 4FTCA 4JAIA 3I60A 5F20A 1Z9XA 1PXNA 3ROYA 2WMSA 5JH6A 4KIKA 1YHVA 1YXTA 4AA0A 3ULIA 2BUJA 4O7ZA 4EQCA 5K4JA 4O86A 3H10A 2J0IA 5FBNC 5B2MA 2UZBA 4EH3A 1FGKA 4E4LA 4BIEA 5JKGA 5KBRA 1FMKA 4IX5A 4Q9ZA 4UWCA 4XP2A 2C5VA 4IAIA 3SXRA 4YHJA 5DEWA 2XB7A 1KE9A 3VS2A 4KIQA 3OS3A 3KXGA 2UZLA 5D41A 1XR1A 1ZYJA 4IEBA 4XEYA 4JIKA 3RHKA 3ZO4A 2PHKA 1V0OA 5IDNA 3CP9A 4ALUA 4QMSA 2B52A 3NAYA 3RAWA 1P5EA 4L53A 5K4IA 4XLVA 5DT4A 2UZVA 3SX9A 5HO7A 1UU3A 1Q4LA 4USFA 5M44A 4PMTA 3VBXA 2OGVA 2P55A 5CQWA 2OI4X 1KE6A 3R8UA 3S95A 3NUSA 2PL0A 3FPQA 4YURA 2HW7A 3W16A 1O6YA 2FUMA 3Q5ZA 4RIXA 5GJGA 3AD6A 1RDQE 1ZXEA 2C69A 3SC1A 4JR3A 2VWYA 4V0GA 4PTGA 5FG8A 2BZKB 4UV0A 2QG5A 4PY1A 4UMTA 3UVRA 2CSNA 1YKRA 4ZSLA 5LVLA 1AGWA 4LRKA 3SG9A 1W8CA 4H1MA 3UTOA 3NUXA 4RVLA 4NU1A 5CENA 4EK3A 3LCSA 2XK9A 3ZBFA 4YJSA 4CCUA 5HIDA 2QODA 2XF0A 4FT9A 3R7EA 2CKPA 1CTPE 3LJ1A 2CJMA 2BZIB 2YM4A 2E9PA 5B7VA 2ZVAA 1H1QA 2WTKC 1YXUA 3KULB 5L2WA 4O0XA 4TT7A 3EB0A 3Q6UA 1U5RA 4EOPA 4YC6A 2UZDA 4J98A 2E9NA 3F5GA 2Z8CA 3GFWA 4P7EA 3A7JA 4ACMA 1SNXA 4E4MA 4EHGA 4F1MA 3FZOA 3WZKA 4K6ZA 3IKAA 3G2FA 2WZJA 4JX3A 5HTCA 3VW8A 4U3YA 1DM2A 4D2VA 2B1PA 3M2WA 1WBVA 4MBJA 3PLSA 4YJNA 2VWBA 5AMNA 3RPRA 5IMEA 3MPMA 4O7SA 2PU8A 2ZM1A 2X39A 3KRLA 2W1ZA 4DEEA 2PULA 2ZAZA 2PMLX 5EOLA 4NWMA 4D4SA 5F1ZA 4U7ZA 2VO6A 3NWWA 3MFUA 3I5ZA 4O27B 5FDXA 2VV9A 4NZWB 2ZV2A 4HVSA 4R3PA 4H05A 2XNMA 3QQLA 4Y5QA 1QL6A 3KK8A 5HKMA 4GW8A 4MF1A 5M56A 3MDYA 4BDBA 4BWKA 3GP0A 4IANA 4F7SA 4EOQA 2J0KA 4FF8A 2ITWA 3LCOA 5D11A 4BDHA 5I4NA 3D83A 2PK9A 4B9DA 2BILB 4QD6A 5LVMA 4UBAA 5CEQA 4BKJA 4O22A 3OHTA 3RI1A 3ANRA 2BVAA 4V01A 2DYLA 3L9LA 3PWDA 4ANMA 4E5WA 5IG1A 2W1CA 4IAZA 5IISA 5HGIA 1YXXA 4O91A 2C1BA 4DCAA 2BTSA 1SVEA 2R3QA 2IW8A 1KUTA 4K11A 4DH1A 3PIYA 3QFVA 2R3FA 3ORIA 4UYNA 4OTQA 5CVHA 4CMUA 2QOLA 3LW0A 3V8SA 1ZZ2A 3GU8A 3LFBA 4H3PA 3BHTA 1P4OA 5ETIA 4QMYA 1L8TA 4PMSA 4OBOA 4D0WA 2GTMA 4NK9A 3PA5A 4YNOA 2O65A 4PPCA 1F0QA 4ZJVA 5BVOA 3IQ7A 1OB3A 2J90A 4O1PA 3JY0A 2YDJA 3U4UA 5AUWA 2YM7A 4BVUA 4F65A 4ZTSA 4RX7A 4BDJA 3LOKA 2O2UA 4GJ3A 3FL5A 3PA4A 5T3QA 4XOYA 4EH7A 2R3KA 5EI6A 5IA1A 1OPJA 4ZTNA 4ANSA 4DT9A 3CJFA 3A4OX 4B0GA 3I0QA 1OUYA 2J7TA 5LWMA 2B55A 1Q3DA 4Y8DA 3W2QA 4I3ZA 3VNTA 4XV2A 4BIDA 4ALWA 1IASA 2ZDUA 5GNKA 5JFSA 3HMPA 3KFAA 4AGCA 4ARKA 4AACA 2C6IA 2R3LA 2C5NA 3QWJA 3LMGA 4GT4A 3SQQA 2VN9A 2JIVA 4FTAA 5FXQA 3PPZA 4IB1A 3MFSA 3LKMA 1K9AA 5D10A 4I93A 4UXQA 2W5BA 3IG7A 1KOBA 3K54A 3OEFX 3KEXA 4J53A 4KB8A 5HCYA 5M08A 1JBPE 2FGIA 3DLZA 2UZTA 3V5QA 3NNVA 2R7BA 1YHSA 3VF8A 2W0JA 1CDKA 2WQOA 4XP0A 1H26A 3KCFA 3QC9A 4IB0A 1JVPP 3FMKA 4G34A 3QTSA 4EL9A 3IDPA 2XJ1A 1YOMA 3NW7A 3KC3A 4BN1A 5L6OA 4AX8A 5ETCA 3UOHA 3A62A 1MRYA 3RVGA 2VTSA 2PVHA 3W8LA 2WPAA 1OKWA 2VD5A 3OZ6A 4MTAA 4O7NA 4OTGA 5FM3A 3TACA 3KK9A 5AJQA 5JRQA 1OVEA 1GIJA 4E20A 4BR3A 2WMXA 3QD0A 3U9CA 4C4EA 4D4YA 5ANIA 3DT1A 3UP7A 1P4FA 4RWJA 4BDKA 2AC3A 2OSCA 3PXZA 5EDQA 4XV3A 4NJDA 3U54A 4BWXA 2VRXA 4L3JA 5IDPA 1U4DA 4W9WA 4F7LA 5HQ0A 5HOAA 5L2TA 4UZHA 3VF9A 4ZS4A 4P5ZA 4PF4A 3UOJA 2ESMA 3DDPA 2VUWA 2RSVA 4NEUA 4XG3A 5IKWA 3HV4A 1AQ1A 3E62A 1TQIA 5TO8A 2HW6A 4HNFA 3B8RA 3RPSA 4DH5A 4UX9A 3C5IA 3C9WA 4UWYA 1B38A 4WG4A 3TG1A 3WARA 4X3JA 2OZAB 2PYWA 5DA3A 3UE4A 2GNJA 2OXDA 3QC4A 5EFQA 4N4SA 5C8MA 3CBLA 3ZBXA 2IVVA 3BQRA 4QQ5A 5HVJA 4AOJA 2QOFA 4YJUA 3C51A 5M07A 4LUEA 1U5QA 3C4XA 3FC2A 2VGPA 5HESA 3WF5A 3RZBA 3SRVB 3F9NA 4G3GA 3CY3A 4GUBA 4F7NA 1GIIA 4RZWA 5CEKA 4LGDA 3VBQA 5HLNA 2ETMA 3VVHA 1U54B 2YM5A 3MIAA 2Y7JA 4QO9A 1H25A 1PMVA 4FKGA 5E1SA 5J7HA 3DBEA 4PL4A 5J9YA 1HOWA 2XBAA 3IDCA 2HZNA 1GZNA 2I40A 1H1RA 3R1NA 5AP4A 5IEYA 2CLXA 4MVFA 3ZFXA 4LRMA 2UZOA 3G5DA 2PZYA 4QP4A 3WOWA 3UGCA 4DGNA 3P4KA 1ZY4A 2YLFA 3EQBA 1OM1A 4RIWB 2XIKA 2RFDA 2XK3A 1MQ4A 2E9OA 5FTQA 4YJPA 1M2PA 4GIIA 4QT1A 4CV8A 3D4QA 3QRUA 3D7TB 4BWPA 4P90A 5C26A 4IVBA 3EN9A 3G90X 4GV1A 4MD7E 5CU2A 4O82A 2E2BA 4CKIA 2C6EA 3TNHA 2FVDA 3FLYA 3KA0A 3OOMA 3ODZX 4MCVA 1G8AA 5E91A 5HBJA 4O96A 3GU6A 1V1KA 3A60A 4RJ6A 3V5WA 3DK6A 3V01A 5HVKA 5FXSA 5AR3A 4CCBA 1P2AA 3BYMA 2R3GA 2O5KA 1OUKA 3DNEA 4F99A 5BYLA 3JYAA 3QHWA 5CEOA 2X0GA 4L00A 1J91A 5CZIA 2YERA 3CR0A 5EI2A 4CG9A 4A06A 2XRUA 1APME 3EFLA 3NCGA 4ZOGA 5HD7A 4USEA 2B0QA 3DFCB 4W8EA 5IA2A 1BI8A 4BDAA 1QPJA 5HCXA 5M4FA 4L52A 1ZOEA 3DY7A 2BAJA 2I7QA 3OUNB 2JBPA 3CGFA 4S30A 2X1NA 4YU2A 4AE6A 3GENA 5EYMA 2R3OA 4AA5A 3OC1A 4RA4A 5JRSA 4A4OA 2WU6A 3OD6X 4C59A 1PXMA 3TZMA 4ERKA 3GNIB 5EDRA 3UZPA 3K2LA 4EH2A 4GG7A 2C1AA 5J9LA 4FTLA 4IW0A 4EZ5A 2VTIA 5DWRA 2QOHA 3GCVA 4MQ1A 4XV9A 5BVWA 5AIRA 3ORKA 3ZZEA 3IOPA 4IDTA 5C8NA 4DEBA 1Q61A 2WQMA 5IUHA 2IZUA 2UW3A 4LYNA 1PF8A 4CT1A 4C4HA 2A1AB 3QGYA 2DQ7X 3CE3A 2QR8A 3R7OA 4FZ6A 4EYJA 4UMPA 5LCKA 4RGJA 3CQEA 4M0YA 4IBMA 4YJRA 3RAKA 3EYGA 1GNGA 4EOIA 4TRLA 4JS8A 3A7FA 1PW2A 3KRXA 4I6QA 2XK6A 2IW6A 4EOSA 5D7VA 1T45A 4PTCA 4R7HA 2WGJA 4O0SA 3UPZA 2GNFA 3OY3A 1UNGA 5AP3A 4XCUA 2CGUA 5DFPA 3QL8A 4RIYB 4XV1A 4DFBA 3O8PA 2PVRA 2YAKA 3QLFA 4CYIA 3BU3A 2NO3A 5HEZA 3ZSIA 2EXCX 2QR7A 4Y72A 4MD8E 5JGAA 3AMAA 5BNJA 5HE3A 4S31A 3EL8A 1REJA 2ZV7A 5DI1A 3C0GA 4R78A 3PXQA 1YXVA 3COHA 3FQHA 4WRSA 3VUKA 5AX3A 2EB2A 3V51A 3NUNA 3SLSA 3JVSA 2UZUE 3W10A 4X7QA 5HG9A 1GZOA 4NUSA 2JC6A 2IN6A 2XA4A 2IVSA 3PVUA 2BRNA 1DAWA 5ACKA 4BTFA 5AX9A 4KIOA 3EFJA 4GKIA 3DAEA 4DTBA 3DJ5A 3PG3A 2BRHA 4BICA 3HEGA 2ITUA 1NY3A 4QYYA 4WSQA 4P5QA 3EQHA 4E5AX 1PJKA 5CSWA 2C6KA 4N57A 1J1BA 3P1AA 4G5PA 4K33A 4QYHA 5AP1A 3CQWA 4K0YA 3LMIA 3H0YA 4ENXA 1Q8TA 3H4JA 5L8JA 2UW4A 2PVYA 2CLQA 3ZLSA 3IW6A 4GUEA 3ORZA 3P7BA 5A14A 3BE9A 3RM6A 3VAPA 4KRCA 3RNIA 4O6EA 1ZARA 4PNIA 4OAUC 3PPKA 3SV0A 4FTNA 2VU3A 3VS1A 4KKHA 2CNVA 4YZMA 4EH5A 3BU6A 3BEAA 4HYIA 5CY3A 4ITIA 2JIUA 5A54A 2B54A 4M3QA 3NVMB 2YACA 4AZEA 3KXZA 3BBWA 3DAKA 4PRJA 4NTSA 3A7HA 4QMMA 5E4HA 4UEUA 3KRWA 5A4LA 4DFXE 3R1SA 2JDVA 2W06A 2OZAA 3HNGA 3QQUA 5CU4A 4QTCA 5GHVA 1U59A 2YITA 2WO6A 3EJ1A 5FGKA 2ONLC 2YJSA 3HMOA 3FZ1A 4GFOA 4ZSJA 1VJYA 4JIAA 3G0FA 2VTAA 4PDPA 5KX8A 3C4ZA 3LCDA 4G6LA 4HPTE 4NFNA 5CS6A 3VS5A 3D5UA 2BTRA 4MNFA 1UU8A 2PWLA 3O8UA 1H1WA 4FKLA 4NFMA 4Y5HA 3PYYA 2H8HA 4I0RA 5EKOA 3F3UA 4LI5A 3Q2JA 4MXYA 3QTZA 3R9DA 4K18A 4WD5A 3MFRA 2VTLA 3CKXA 2DS1A 2XUUA 3A8WA 4OLIA 3DB8A 4DA5A 4AN9A 2GHGA 5H8GA 4FG7A 2PE1A 2W1GA 4EZ3A 3GVUA 3KQ7A 2Z02A 2QU6A 4C3PA 1R0EA 3VUTA 3W55A 3AC4A 4ZY6A 4AGUA 4DEAA 5J5SA 1S9JA 4O6LA 1YQJA 3GCUA 3MVMA 4GU9A 3CTJA 3PXYA 1XWSA 2BCJA 1OL7A 2C3LA 2XYNA 4JL9A 2R2PA 4MKCA 4IADA 4MK0A 5HE0A 2XK4A 5CNOA 1YDSE 5GJDA 4QQTA 4KABA 1WBOA 3MSSA 1VYWA 2WMRA 4AUAA 4EI4A 4JX7A 3SG8A 4U9AA 4UMRA 4QMOA 3DA6A 4ZTHA 5JEBA 5L8KA 5EM5A 3D15A 1XH4A 3R02A 2R5TA 4YBJA 5TE0A 2OJ9A 4FNZA 2E9VA 4FE2A 2B4SB 4EOKA 3SXFA 5H8BA 3W33A 3RNYA 5BUJA 2YISA 2QD9A 2C5XA 4K77A 2O3PA 4WUAA 5AFVA 3VWAA 3FV8A 4MBIA 4D5HA 4QP6A 4C4GA 5ETFA 2J51A 4XUFA 3W2SA 3G0EA 2YIQA 3GC8A 2QQ7A 1WVYA 3KXMA 3NR9A 4DEGA 3O50A 1OI9A 5HNIX 1T46A 1W98A 2ITNA 4FL1A 3UQCA 4E8AA 3OG7A 4AZWA 3IW7A 4FV8A 1Q3WA 4FT5A 4C35A 2C6MA 4AWIA 2OJJA 3MJ1A 5M09A 4W4VA 4EOLA 3ETAA 4IE9A 3MY1A 4LRJA 3TV7A 5EKNA 1H27A 5CXHA 3ID6C 4P4CA 3EQDA 3EKNA 3O2MA 4ZK5A 2OWBA 1Y6AA 4BCFA 3AOXA 3P86A 2PVKA 4TYJA 3D5WA 4GFMA 2PE0A 4B7TA 3PE1A 5KO1A 2QCSA 2C0TA 4I5CA 4FZ7A 1A06A 1FINA 3NCZA 3Q5IA 4GK4A 3LFSA 4UXLA 3WF7A 5CAVA 3E7OA 3QRKA 4OTHA 3E5AA 3R8VA 3MA3A 1H01A 3HRFA 3ZSHA 4AT4A 3AC3A 3UZTA 3ACJA 3IOKA 4FT3A 3F2AA 4YZCA 5HE1A 4X2KA 5CXZA 2JFLA 5LVNA 3HAMA 4YJVA 4X3FA 2RKUA 4FV9A 3TI1A 1LUFA 1OKZA 2BROA 3KKVA 4DH3A 3FL4A 5AP2A 1M7QA 4OTFA 2OIDA 3QD3A 2XP2A 2BHEA 3JUHA 3E8DA 3NYOA 2X8IA 1PKGA 4YJTA 4ANNA 1OMWA 1Q97A 2YLEA 4RIOA 3BCEA 2QO7A 3WE4A 4MEDA 5KNJA 4FIEA 2G9XA 2GPHA 2WD1A 3QRJA 1XBBA 4QMXA 4AT3A 4GCJA 3S1HA 3CPBA 3QALE 3Q9YA 4NT4A 1GZKA 4QMVA 4O7TA 3FMJA 4YJQA 3PUPA 4NKSA 4AG8A 2WQNA 4CQGA 3L9PA 3H9RA 3E92A 2WFYA 4IWOA 4G9RA 5HZNA 4TL0A 1UKHA 2ITZA 3HX4A 4M68A 4MBLA 3TTIA 4EK4A 3R71A 2NP8A 2VTMA 1PXOA 2P2HA 4H3QA 3T9TA 3WF6A 4BGHA 5A4CA 1IAJA 4EEVA 3PVBA 3WZJA 4RX9A 2P0CA 2GNLA 2JKOA 3ZLWA 3P7AA 2F7XE 3LJ0A 4IAAA 5G1XA 1K3AA 2CKOA 5AV4A 2HXLA 3R9NA 4I5MA 5AUTA 4PDSA 3F2RA 3QKMA 5CSVA 3LFDA 4BI0A 3DQXA 3IW8A 4IHPA 4MNEB 5AV0A 5DRDA 2ZDTA 2XM9A 2PMNX 2WMBA 4CMOA 1FPUA 1YWRA 3NYNA 3FI2A 3UNJA 1UNHA 3FMHA 3LCTA 5JFWA 3O17A 4ACGA 1ZAOA 5ITAA 4XG2A 3NLBA 3KCKA 3NUPA 5JGDA 3EQRA 1YWVA 2GHMA 3KVXA 3NPCA 3HV6A 4PPAA 5HBHA 3V8TA 3BV2A 5BMMA 3JVRA 3RZFA 3TIZA 4F0GA 3VHKA 4Q5HA 5BVEA 3PY3A 3F3TA 4FG8A 3FZTA 2GQRA 3Q96A 5J7BA 1W83A 2W05A 5F9EA 3DXQA 4JJRA 3F66A 3MB7A 1WVWA 2O0UA 4MXAA 1BLXA 2EWAA 4YJOA 3WZEA 3ZU7A 4A7CA 4FTTA 3ZFMA 3U55A 4HVHA 4K2RA 3SA0A 1EH4A 4FTQA 5D12A 2ERKA 3ZEWA 4F63A 2W9FB 2BRMA 3SOAA 1OKVA 4C58A 3DU8A 3BGZA 1OECA 4D5KA 2CDZA 4KKGA 5BMSA 4I1ZA 4I0SA 3DB6A 4XG9A 1KE7A 4IC7A 2XVDA 5KHWA 4WHZA 4D28A 1LEZA 4EHVA 3R2BA 3IK3A 4CFUA 1OL5A 4ACCA 4M15A 2CMWA 4I4FA 4BDIA 4GVJA 3F88A 4J97A 4KBKA 4NCTC 4W4WA 4R7IA 3FBVA 4UY9A 3LFQA 4RC3A 3LXLA 4S34A 5HTBA 3G9NA 2JD5A 3FC1X 1LR4A 4GEOA 3VIDA 1W7HA 2ZV9A 2QVSE 4EKLA 3T8OA 1WMKA 2YFXA 4BTMA 3UNKA 5FTGA 3B8QA 1Y8GA 2OO8X 1QPCA 3K5UA 2J0MB 3BHYA 4XNEA 4YGAA 3O8TA 4S33A 2FSOX 3KRJA 4OGRA 2X8EA 4IX6A 3D0EA 1PYEA 3R1YA 4BCKA 2C6DA 2R3PA 2QOIA 3GCQA 3I81A 5HBEA 5IQGA 4AU8A 3TDVA 3TJDA 2GTNA 5BQ0A 4FT7A 4CFXA 5KMJA 4ZZNA 4R6VA 5BYYA 1SYKA 2Y4PA 1YOJA 3FDNA 4BKYA 3TTJA 3I7BA 3MY0A 4F6WA 4LG4A 3T3VA 3PZHA 4UWBA 2VTHA 3H3CA 4U42A 4CD0A 5CF4A 4JBPA 2GNGA 1M2RA 3DJ6A 1Y8YA 2XJ2A 4BHNA 3R00A 3SKCA 3RCJA 3VC4A 3H0ZA 4WG3A 4FTMA 4R1VA 4EH9A 4K1BA 5H8EA 3RHXA 4OR5A 3VS3A 2R3NA 2XNGA 3HMIA 5DG5A 3ATTA 3ORMA 3O23A 4QMLA 5KKRB 4FSTA 2V0DA 2HELA 3EOCA 2QO9A 3MY5A 2X8DA 3CLYA 4IZ5A 4MH7A 2RGPA 4FIFA 4J95A 2PPQA 4O0YA 3GOKA 4TYGA 2UW6A 4U80A 1YOLA 4C62A 3UVPA 4ORKA 5M06A 3LXPA 5HVYA 4HCUA 1YI3A 3PXKA 4FSQA 1A9UA 2C68A 4O83A 3NAXA 3PWYA 1XH6A 4BDEA 4FX3A 3EKKA 4FBXA 3MPTA 5L2QA 4FOBA 5HORA 1OBDA 4YUQA 4M66A 1E1XA 2ZB0A 5EW8A 5AAGA 2WMAA 2PZRA 5EYKA 4L46A 3NNWA 3LFNA 4EKKA 3UQFA 3OWPA 4IJ9A 3EQCA 5HTIA 3E3PA 4O2ZA 5JFVA 4W4YA 4TWPA 5CF6A 5B2KA 5EW9A 3BWJA 4FIJA 5EHLA 5AR7A 1JQHA 4R1YA 3Q04A 1LPUA 3ZDIA 4W4XA 3EN5A 4Y46A 4D2PA 4YHFA 2YWPA 2R9SA 2HXQA 4OBQA 4U8ZA 2EXMA 5F94A 2BRGA 3BYUA 2VX1A 4HCTA 3BYOA 4FV1A 4K9YA 4WO5A 2AYPA 2JAMA 2VTNA 3C0HA 5CEPA 3TN8A 1WBTA 4JQ8A 4EC9A 4RVMA 3UMXA 3TNPC 2WTCA 3KB7A 1AD5A 3PIXA 3QTRA 3CQUA 3MH1A 4CT2A 3L8XA 3ENMA 5BVDA 2X7FA 2VO7A 4DBXA 4HJOA 4EWHA 4X6RA 4X2NA 3LXNA 4E4NA 1G3NA 1X8BA 2OLCA 4FIIA 5CSPA 4BGQA 1PHKA 1VR2A 3GU4A 3HDNA 3PJ8A 2XBJA 4I5HA 4OTIA 3LFCA 4YC8A 5LMAA 4MWIA 2J0LA 3VS4A 2IVUA 4QNYA 5KMMA 4GKHA 3AD5A 5EM6A 2ITPA 4D55A 3G9LX 4YO6A 1STCE 3MFTA 2JKKA 4L3LA 3LJ2A 4NJ3A 5EW3A 3R1QA 4IQ6A 3PFQA 3Q32A 4QMWA 5BVFA 3R7UA 3A7IA 2BZHB 2BDFA 3GU5A 4QYEA 5AUUA 5E8XA 1XH8A 2PMOX 4QMTA 4FG9A 4ACHA 5DT3A 2IZRA 4M0ZA 4C3RA 5BVNA 3H9FA 4ZSAA 3SVVA 3REPA 3ZLYA 3QXPA 3C4CA 4Z55A 1XJDA 4B4LA 1WBSA 2XEYA 4CV9A 5HU9A 4RX8A 3P5KA 3Q52A 4J52A 3A8XA 3UP2A 5I3RA 4W9XA 5KMKA 5IQEA 2C30A 3FMNA 4PDOA 5LARA 2V7OA 4KS8A 4FSUA 3S3IA 4EOMA 4EYMA 2JDOA 4D1XA 2A2AA 3BWFA 5ETAA 3FQSA 4ANLA 3TZ7A 1KWPA 2JFMA 2JKQA 3ZM9A 3ULZA 4ZLZA 3VQUA 4YZ9A 2CKEA 2BAKA 5CU6A 5M51A 5KUPA 3LXKA 5DNRA 5DLSA 4PV0A 5AV2A 2FSLX 4F6SA 3AGLA 4PUZA 4HNIA 3UODA 4I24A 3ZUVA 2VO0A 2WTWA 3QKKA 4IMYA 5FEQA 2GFSA 3TZ9A 2OH4A 3BHHA 1ZY5A 4FKRA 3ERKA 4BB4A 1KE8A 2WOTA 3E8NA 4AN2A 1H8FA 4GSBA 3ZXZA 4ZTMA 4FZFB 2UVZA 4I0TA 3OOGA 3HV5A 5AUYA 4G3FA 3HLLA 3IDBA 3UOKA 1F5QA 5IPJA 3RM7A 4L68A 2F2UA 5CQUA 2BFYA 5FEEA 4BZNA 4F7JA 2BFXA 3DKCA 5E92A 1BL6A 3BV3A 4YO4A 3U6JA 2BKZA 3ZM4A 3K3IA 3ZRMA 3NW5A 4MXXA 2OF2A 3PSDA 2QOCA 3BU5A 3TIYA 2B53A 1H28A 3GGFA 3MTLA 3QTQA 4TYHA 3A7GA 2KULA 3WBLA 2VTJA 4RC4A 4LL0A 4ZTRA 3QQHA 3BBTB 3ZSGA 4YHTA 1VEBA 2XIZA 4HPUE 4FL3A 2QONA 4DFUA 1CSNA 2ETKA 2J6MA 2XKDA 3FI4A 3QTWA 4IWPA 2XEZA 1JKKA 3DV3A 4L67A 5CLPA 3VS7A 5AR5A 4AFEA 4FEWA 4QPMA 2FB8A 3ZXTA 5IZFA 5I5ZA 5J5TA 3LHJA 3ZHPC 3VUMA 5CALA 4TYEA 3TUDA 3KMWA 1I09A 3C4EA 5FQDC 3V04A 1KV2A 4S2ZA 1JPAA 2GMXA 2PZIA 5IQCA 2OK1A 4G6NA 4U79A 4ZTLA 3MVLA 4FIHA 4NIFB 3P0MA 4RLKA 1UA2A 4EJNA 3VUGA 3N9XA 4NKAA 4QMQA 2W4JA 4JG6A 5E8VA 4U5JA 3AQVA 4L8MA 4F9YA 2FSMX 4LFIA 3BYSA 4CQEA 4M12A 2ZJWA 4KIKB 5DRBA 5JZJA 2X6EA 3FZSA 4I6FA 2F9GA 3NUUA 5DOSA 3DKGA 4HOKA 4CFVA 5AWMA 2V55A 4CFNA 4RVKA 3AC2A 4AZVA 5K5XA 3A99A 4I6HA 4F1TA 1ZZLA 4O81A 4FGBA 4S32A 5LJJA 4FTKA 3W1FA 3O71A 5GZ9A 5K0XA 2V5QA 3B2TA 4Y73A 2OJIA 4F9AA 4CG8A 4EHZA 4TWNA 4O0WA 3WZDA 1OKYA 4PMPA 5LOHA 3C0IA 4CFWA 3CTQA 4EZ7A 2GCDA 4ZSEA 2VGOA 4U81A 3I4BA 1TKIA 2XM8A 3R7IA 3VUDA 2PVFA 2R3RA 4F9WA 3R9RA 3EIDA 3TUBA 2WQEA 4A4XA 2C4GA 3I7CA 4DAWA 4DTAA 4I20A 4IM3A 4RIXB 4UALA 5A4TA 2HYYA 4IB3A 2OXYA 4U3ZA 4D1ZA 4V0GB 1PMEA 3ZONA 3MPAA 4IIRA 1RQQA 2V22A 2WAJA 3ZFYA 3HRBA 3ACKA 3KY2A 3KXHA 4XBUA 2YIXA 3OCTA 4D1SA 4GS6A 1URCA 3F6XA 3TKIA 1Z5MA 2ZM4A 5A6OA 5LMKA 5HIEA 5J8IA 3OXZA 1U46A 3IW5A 4FUYA 3F7ZA 4U6RA 4JQ7A 3HMMA 4AW0A 3ORNA 2YIYA 3OEZA 3MH2A 3EMGA 5F95A 4D4VA 4DH7A 2XK7A 4PP9A 4DG0E 4F4PA 1OBGA 5JQ8A 4RSSA 4TN6A 3UIXA 2A27A 4IZ7A 4U40A 4XG6A 2QC6A 4PP7A 3UPXA 4H3BA 4BYIA 4CLIA 4FVQA 4EH6A 2UW8A 4ZIMA 4F0FA 3F7WA 1JWHA 4XBRA 3R83A 2CN5A 4EHEA 3OWLA 3JXWA 2HWPA 2ZOQA 4JBOA 4G2FA 4R5SA 1WBPA 3GU7A 5C03A 3OCSA 5FTOA 2CNQA 2Y6OA 3KXNA 3E87A 2QKRA 1UWJA 4E93A 2ZB1A 4L3PA 2A0CX 4XOZA 3R6XA 3ZOSA 1ND4A 3V6RA 4QYFA 4R77A 4DLJA 2IO6A 1ZRZA 4DBNA 4C34A 3DK3A 2I1MA 3ZZWA 4YZDA 5DIAA 3L8VA 5IUIA 4TXCA 5GZ8A 1JSUA 2EU9A 5HE2A 3T3UA 3JPVA 2P3GX 3DQWA 2HZIA 3E7VA 4FKWA 4GIHA 2BALA 1R3CA 2R64A 4IB5A 4DFNA 2R3IA 3NNXA 2Y9QA 4LMNA 4IVDA 5TKDA 3AG9A 4BI1A 1Q99A 5L4QA 1M2QA 2H9VA 4FSMA 4HVIA 5HI2A 2BMCA 4AAAA 3BLQA 5TF9A 4FOCA 4AN3A 4RQKA 5J79A 4QTAA 5GINE 1ZOHA 5CZHA 1YI6A 1UWHA 3SOCA 4PNKA 4M69A 4WA9A 1Q41A 1P14A 4EJ7A 3RMFA 4G17A 1L3RE 3VHEA 1IRKA 4KWPA 3O96A 4DINA 3TUCA 2XIYA 1YRPA 2QOKA 3OP5A 2Q83A 4FA2A 2XIXA 4ACDA 3FHRA 2G2HA 4FTJA 1NA7A 3DZOA 3C1XA 4AXAA 2Z7QA 3D94A 2QURA 3TCPA 2J50A 3CIKA 2C6TA 3ZO1A 2QLQA 3DTCA 1WVXA 1H1PA 4BBEA 3NS9A 4HZSA 5HO6A 2F4JA 3TNIA 3G15A 4ZMEA 4F0IA 3ORTA 1PRYA 2UVYA 3PE2A 4E6AA 4I21A 3D9VA 2O63A 4YTHA 3RPYA 3NYXA 4NSTA 1IAHA 1UVRA 2XNEA 3OXTA 4AW5A 5IMXA 2Z7SA 3E93A 1TQPA 2WEIA 4O0VA 4QNAA 2JEDA 2VX3A 4U41A 3UBDA 4B8LA 1BL7A 5CVFA 3PIZA 4M13A 1FVVA 5I3OA 3FLZA 3MW1A 5AP0A 1OPKA 5LVOA 4JNWA 2YABA 1H08A 4FEXA 4F09A 5FUTA 2R3JA 3MH0A 5DE2A 4OT5A 1J3HA 4C7TA 4R7BA 5HX8A 3R9HA 3PSCA 5IQAA 3MTFA 2W7XA 3TNQB 4IWDA 3LIJA 3PP0A 2OU7A 1SZMA 2C6OA 2VWZA 3IECA 4MXZA 2GQSA 4BDDA 4M97A 4IVCA 3DXPA 1JAMA 2CKQA 5LWNA 4RWLA 4OTPA 4FSNA 4X6QC 4II5A 3B2WA 3COIA 4DGGA 4EQMA 4NW6A 4CRSA 4AOIA 4RBLA 4IC8A 5ANOA 3IO7A 4WNOA 5EM8A 4BDCA 4YP8A 1DAYA 2C0IA 3LMHA 4M8TA 3FKLA 3OCBA 1XO2B 1YDTE 3UDBA 3U6HA 2HY0A 4BL1A 3RBWA 3NSZA 2BIKB 3E63A 5BUIA 4HGSA 4GK3A 4ASXA 2YZLA 3CEKA 4QPAA 4Z7HA 1OITA 3FMLA 1O9UA 4HVDA 3QD2B 5IQBA 2Q0NA 3EN7A 4FKUA 2LAVA 3IGGA 5A3XA 3NUAA 5E7RA 5EH0A 3F3VA 4W8DA 1Y6BA 2X81A 4BF2A 3FZPA 4K8AA 4FZDB 5IQHA 1ZMVA 4NTTA 5IH5A 2VZ6A 3CKWA 4EK8A 3OVVA 3QA8A 4XH6A 4G9CA 2BHHA 5CX9A 2NRUA 3KULA 4R8QA 3SGCA 5CSHA 5FRIA 4JR7A 4ID7A 3TL8A 4LQMA 3FSFA 3LLTA 3UJGA 4ANOA 1NW1A 2W1DA 4IDVA 3QUDA 3ZRKA 4R3RA 4CMTA 2WELA 1PXJA 4IAKA 2QHNA 5EOBA 5IQFA 3DBFA 3AMBA 2R3MA 3TDWA 4L43A 4L6QA 3S4QA 2IZSA 3F3ZA 1XH7A 3OROA 3PVWA 3LM5A 2JGZA 5CVGA 3VUIA 4FKJA 3TWJA 4FV3A 4EONA 2UVXA 5CI7A 2OFVA 3TJCA 4WBOA 3JY9A 3U6IA 5FP6A 4JRVA 4XG8A 4YR8A 3QLGA 3QKLA 4IX4A 3ZMMA 3U87A 3C13A 3R73A 5M4IA 4PDYA 4WUNA 3LFEA 4RWKA 5HNBA 3DGKA 3ZEPA 4NCTA 1JNKA 4O84A 4CGAA 4I6BA 4GRBA 3DKFA 2RFEA 2WMUA 5AA8A 2OF4A 4F64A 2QG7A 4E6CA 3HP2A 3OWKA 3DLSA 2BPMA 1H24A 4CSVA 5IH6A 5I0BA 4E3CA 1JSVA 3I6UA 4IACA 4Z9LA 4UN0C 4UZDA 3VBWA 3QYWA 2JBOA 3MI9A 4E26A 3QF9A 1DS5A 2QU5A 3AT2A 2X7OA 2G1TA 1RW8A 2XK8A 2JITA 4JG8A 5AAEA 3N4VA 3TM0A 4OTDA 2BZJA 1PMNA 1PKDA 4DHFA 4KRDA 3DBCA 4A9UA 4EK5A 1W0XC 4A9SA 4TZRA 5IA4A 4GL9A 2RF9A 3PVGA 4USDA 3W2OA 4BCNA 2PUPA 2FO0A 4IM0A 3E8EA 1YXSA 3WE8A 2G01A 3CD3A 4P2KA 3WILA 4AGDA 5AAFA 5LXMA 3RK5A 4RJ4A 5AUXA 2HY81 3ZCLA 1NT2A 4XYFA 3D2IA 3FQEA 2DWBA 5DHJA 3BRBA 2BRBA 2UZNA 3LZBA 3ET7A 4FYOA 4B99A 4PL5A 5ANEA 4XX9A 3O0GA 2VX0A 4U43A 2XJ0A 4XG4A 4ASEA 4LV8A 5J95A 4Y83A 2HOGA 4H39A 4KKEA 4KINA 5EHOA 4O1OA 3FMMA 1KV1A 4TYIA 3BLHA 5AUZA 4C4FA 5BPYA 3RAHA 2CGVA 5KMIA 4QQJA 3E64A 4GMYA 2G2IA 2IW9A 1JSTA 3NUYA 4FSZA 3UG2A 3QZHA 5E8WA 4DF3A 3HA8A 5BUEA 4F9CA 4YTFA 3V5JA 5IH4A 2RFSA 4RG0A 4XRJA 4A4LA 4AZSA 3ORLA 2UV2A 4FICA 3A2CA 4BTJA 4L9IA 2GDOA 2UW9A 3EYHA 4LUDA 2HWOA 4NM0A 4O21A 5LVPA 2YM3A 1CM8A 4WBBB 3Q9XA 5AR4A 4ZJJA 3WZUA 5JK3A 2WIPA 3HP5A 4M14A 4BY9E 2JDTA 4FTRA 3SD0A 5AUVA 4JT3A 4LOQA 5EDPA 4AA4A 1XBCA 3R04A 2V7AA 3FJQE 2F7EE 4JI9A 4CFFA 3POOA 4C33A 4PMMA 4ALVA 2REIA 4FSRA 3GI3A 5J87A 3FY0A 2JDRA 3OWJA 4OW8A 2XCHA 5CEMA 4LOPA 2XMYA 2HENA 3OTUA 1CKIA 3Q6WA 5KKRC 4FKPA 1TQMA 3DDQA 1GY3A 3CPCA 4IM2A 3O51A 5E1EA 3RCDA 3RPVA 5CT0A 3BQCA 4ERWA 5D1JA 4GH2A 5AR8A 3FLWA 4A07A 2UW5A 2IJMA 3OTVA 3R0TA 3W2RA 4BC6A 5J1VA 3QUPA 4ZTQA 2ACXA 1R78A 4YTCA 2QO2A 3R8LA 1WAKA 2R4BA 4JDKA 3MYGA 2GU8A 2H34A 2PMIA 4QTBA 2A19B 5CYIA 5DEYA 3V8WA 5A9UA 2XCKA 3TT0A 5HICA 2C3JA 3Q4ZA 3E3BX 3KU2A 2FH9A 1ZOGA 4O7YA 3QU0A 5HG7A 4CZTA 4ZZMA 1GJOA 3DK7A 2W1IA 2WNTA 5AEPA 5JQ5A 2PUUA 2VNWA 3F82A 5C4KA 2GS7A 3D14A 4C02A 2W1HA 3W2PA 5HLWA 3QQJA 2ERZE 3OT8A 4WKQA 4L7SA 3SRVA 3S0OA 5EYDA 4J7BA 2G15A 3L9MA 4IFCA 4L01A 4FODA 5F4NA 2BDJA 3GC7A 1U54A 2RFNA 1A48A 4C3FA 2BIYA 2W1FA 3UO4A 3HUBA 2VWVA 4GYIA 3R8MA 2XNNA 3MN3A 4FT0A 5E90A 3HV3A 4FSWA 4BCMA 4ZEGA 4C57A 5DGZA 4ASZA 2BKKA 2BAQA 3CSVA 3PPJA 4RRVA 4AE9A 4ZS0A 5GJFA 3PJCA 2ZV8A 3QD4A 4FKTA 4AW2A 2BDWA 2PVLA 4OT6A 1GAGA 4RIWA 5CEIA 1J7IA 3RPOA 1FVRA 3GC0A 1J7LA 5E9EA 3UQGA 5B0XA 1J7UA 2JAVA 5M53A 3D7TA 2OIBA 3ALOA 5AA9A 3KMUA 2X2MA 3SW7A 2CNUA 4LV5A 4MXOA 3NRMA 4EBWA 5CAOA 4FEQA 3OCGA 4AGWA 4E6QA 4QOXA 4NL0A 4G5JA 4DFYA 1H4LA 1YDRE 3FMEA 2R0IA 3EWHA 4YNEA 3IS5A 3MJ2A 2WTIA 2J4ZA 4D9TA 4C2VA 4RPVA 4OBPA 3WI6A 2WMVA 2PE2A
chains in the Genus database with same CATH superfamily
1OGUA 2W1EA 2OG8A 3P7CA 4Q5EA 5E8TA 1OIQA 1FGIA 1K2PA 4QP7A 5CT7A 4YTIA 3MESA 4CRLA 2IVTA 3ZRLA 4CKRA 4G16A 3NFFB 3KMMA 4EORA 4FV7A 4X3FC 3R21A 2CHLA 3QRIA 5EYCA 3A4PA 2XALA 4C38A 4G3DA 3RINA 4JXFA 5KZ0A 3U9NA 4FR4A 2WXVA 3UO6A 3I0OA 2CCHA 4GJ2A 3VULA 5JN2A 3ORXA 2NPQA 4AZTA 4L45A 1MRVA 3HUCA 4TY1A 3FI3A 3TV4A 1Q8YA 5EQYA 2YHVA 3M1SA 3FPMA 3W18A 3ZO3A 2OICA 3MV5A 4FKIA 2X2LA 3PJ2A 3K5VA 5E8UA 3BGPA 4FNWA 4HGLA 3UYTA 4J96A 5HX6A 1OIUA 3HZTA 4YC3A 3UG1A 3H30A 1J1CA 3IPHA 3P78A 2YIRA 1PXKA 2WB8A 3FKOA 3MGYA 1SMHA 4M84A 3CXWA 3I5NA 5EM7A 3ELJA 4L42A 3CC6A 2GFCA 3PLAE 4BCHA 2ZMDA 4DEHA 4CVAA 3II5A 1V0PA 3IGOA 5BVKA 1IA8A 1SVHA 2QKWB 3MB6A 4X21A 3QQFA 1XH9A 3R63A 4I92A 3TKHA 3OBJA 4RA5A 4DEIA 4YBKA 1HCLA 4H36A 4JBQA 4QQCA 4AFJA 3O7LB 3NFGB 1ZMWA 4BYJA 2YZAA 2VWXA 2YCQA 3OMVA 3QQGA 5CF5A 3HA6A 3CCNA 3QTIA 3EN6A 2OIQA 2ZM3A 4ZAUA 3SW4A 1VLRA 3QWKA 4U44A 5CAUA 2OXXA 2O64A 4UMQA 4ENYA 4DTKA 4YSJA 4MHAA 3ENHA 3QRTA 3BZ3A 2B9FA 3F2NA 4RIYA 3GC9A 4CYJA 4G6OA 3ZH8A 4X0MA 1B39A 4Y95A 5I9WA 4LV7A 5H2UA 3K3JA 4HCVA 5I9UA 4DEDA 3GQLA 3NZ0A 2FSTX 4MYGA 5AV3A 4EOJA 2XZSA 5EQPA 1QCFA 3TXOA 3SHEA 3BHVA 4GU6A 4JMQA 4AS0A 4D0XA 3VRYA 3PJ3A 3UYSA 4BGGA 2OJGA 5CNNA 2ZYBA 3G6HA 3MVHA 3RJCA 3BPRA 3POZA 4OTWA 1XH5A 4O7VA 4WSYA 2X6DA 3CD8A 5HCZA 2FA2A 2IG7A 2Y8OA 3T9IA 1F3MC 4ONAA 3VS0A 3NYVA 1WZYA 3AC5A 4QMUA 5HU3A 1ST4A 1PMUA 3D7ZA 3FLSA 4B6LA 5LCJA 1Q24A 3ZDUA 4DDIA 4FKSA 2VWIA 4E5BA 1KSWA 3RTPA 3QZFA 4J8NA 4HGTA 3ODYX 1ZYSA 3WIKA 3HDMA 4X3FB 4MWHA 3UIBA 1WBNA 2B9IA 3C4FA 3FKNA 2OW3A 5C1QB 4MAOA 2VTPA 4NM5A 5L8LA 2I0VA 3VS6A 2WTVA 1KOAA 2EB3A 4YLJA 3HV7A 4YZBA 2NYAA 3AC8A 4JAJA 4A9YA 4MX9A 5T6KA 4X2FA 5GIOE 5JFXA 2W5AA 2QOQA 3E88A 1MUOA 2WQBA 3LFFA 3LE6A 4RJ8A 3MA6A 5DVRA 5IF1A 3HL7A 5GIPE 1NVQA 1ATPE 1RJBA 2P4IA 3BELA 4G1WA 1CKPA 4F1OA 5DMZA 4KSPA 4EUTA 4XRLA 2WMTA 4KBAA 1YW2A 4I4EA 4PTEA 2WMWA 3QGWA 4FNXA 4A9TA 4GYGA 2KTYA 4YMJA 4PPBA 2P2IA 2WTKB 4IFGA 4FZAB 5KE0A 3BLAA 5DR6A 4EQUA 4FV6A 2PUNA 3RK7A 3FUPA 5FM2A 3P23A 4WNKA 2J0JA 4NW5A 1Y91A 2J5EA 4DG2E 2X7GA 3I6WA 4F08A 3E8CA 2VWWA 5AADA 3NIEA 3VN9A 4O7WA 4JOAA 5FEDA 4CEGA 1NVSA 5DN3A 2R3HA 3IW4A 1ZLTA 2CN8A 3M11A 3PRFA 2RG5A 1M17A 4DITA 3LLAA 4BI2A 1H00A 3G51A 2Y6MA 5KCVA 3ML1A 3I79A 1WCCA 3EQPA 4ITHA 3PA3A 1BUHA 4XS2A 1Z57A 2J2IB 4FTIA 3PG1A 4FV5A 3KGAA 3W32A 3ZC5A 4DC2A 3W0MA 1TFFA 4DDGA 3L8PA 1M7NA 3HGKA 1IEPA 2XIRA 4MQ2A 1SNUA 4AW1A 1ZYLA 2UW7A 2IWIA 4GVAA 1UKIA 3EFWA 3UVQA 4AZFA 3PP1A 1G5SA 4DGOA 4F6UA 3SDJA 2XAOA 4AQKA 4BDFA 2WTJA 3C7QA 4RLLA 3ZUTA 5EI8A 3P08A 3PY1A 3R2YA 4DHZA 5I9VA 4O0TA 4BJJA 3RK9A 2QNJA 4FUXA 4C4IA 3ZTXA 4CNHA 5IEVA 3Q2MA 4NYEA 4BHZA 4GFGA 4RJ3A 3FXXA 4TTHB 2GQGA 3EN4A 3KF7A 4ZJIA 4J1RA 5L6WL 2G2FA 4DT8A 3MH3A 2IZTA 2PVNA 2XNBA 3D5VA 2W4KA 2X2KA 3QZIA 4HGEA 5CTPA 5D9HA 3VUHA 2Q0BA 3TNWA 4O4CA 4PL3A 4J8MA 4QMPA 1QMZA 5DYJA 4KNBA 2V62A 4IZAA 2C5OA 3COMA 3HECA 4TWCA 4YLKA 3ZC6A 3GBZA 2VNYA 5CU3A 1LEWA 3Q3BA 4XMOA 2XYUA 2PTKA 3U51A 2X9FA 2X0QA 4A9RA 5EQEA 4DG3E 4ZY4A 4FV2A 3DTWA 1RE8A 3DXNA 2HZ0A 5A6NA 2YAAA 1M52A 4FTUA 1OZ1A 2UZWE 4N70A 3TZ8A 3ZUUA 2Z7RA 3Q4UA 4B8MA 2C6LA 4ZXTA 3F61A 3BIZA 3RALA 1KE5A 1OIYA 3UIMA 2IPXA 2ITVA 3GB2A 5E8ZA 4KS7A 4FK3A 3O7LD 5CI6A 4JDIA 3DAJA 1YHWA 3ITZA 5IA5A 2C0OA 1BMKA 3OBGA 4KD1A 3OW3A 4RFYA 1H0WA 4BKZA 4O2PA 3LQ5A 5A4QA 4RX5A 2ETRA 2OFUA 2Y0AA 4QPSA 3HYHA 1W84A 2A4LA 3FYKX 4E6DA 2HAKA 4IAFA 2WOUA 4RC2A 3LCKA 2ONLA 5J1WA 2XS0A 5ANKA 2VAGA 4O0RA 3UMWA 2Y4IC 4TWOA 3OF0A 2J9MA 4HYSA 2VTRA 2QI8A 4IVAA 2P33A 4FV0A 5M55A 5C9CA 3DPKA 4E7WA 5L2SA 3R7VA 5DR9A 3DZQA 3DNDA 4YPSA 4KSQA 2PY3A 2C3IB 2HCKA 1IA9A 4WT6A 4IX3A 3GXLA 4C2WA 3R7YA 3TKUA 3L8SA 2I0YA 5HG5A 2XKEA 3DCVA 3SAYA 4D9UA 5CAPA 4XJ0A 3TEIA 4L7FA 1O6LA 3FY2A 2EXEA 3FLQA 2F7ZE 2Z2WA 3R8ZA 4D2RA 4EK6A 4JDJA 3QBNA 1PXPA 3BL9A 3F5PA 4FYNA 3QCXA 2HZ4A 3MS9A 3EQGA 4AF3A 4YZNA 4OAVB 3FWQA 3PXFA 3KRRA 1OL6A 3PRIA 4EWQA 2YM8A 3LPBA 4QMZA 1FVTA 4G3EA 4EC8A 2I0HA 3VBYA 2OZOA 3HRCA 2WTDA 2DUVA 1PYXA 2GHLA 2X4FA 3COKA 1Q62A 5IQIA 3CY2A 1G8SA 3BE2A 3ZYAA 4CXAA 3VJOA 4J99A 4BBMA 3AT3A 1OIRA 4O7LA 3EQFA 5DH3A 3OY1A 3RAIA 4KA3A 3GUBA 3WF8A 2PZPA 2E9UA 4TKSA 1ERKA 5M57A 5IA3A 4TPTA 3MVJA 4C0TA 5L3AA 3KN5A 3ORPA 4DFLA 5L2IA 4MNEA 3AD4A 4N6ZA 3ALNA 5IA0A 5IEXA 4R5YA 3QXOA 3FAAA 4QP1A 1MQBA 4QYGA 3ZO2A 3DKOA 4DHIB 4TW9A 2XH5A 4F78A 3NDMA 4H1JA 4HZRA 4FGRA 4FNYA 3GQIA 5K3YA 1FBNA 4JQEA 3C5UA 5FXRA 4BCQA 4FKOA 4QP8A 5DPVA 3DJ7A 2CGXA 4Y85A 4APCA 3QCQA 2CGWA 2W99B 5CWZA 4JLCA 1XBAA 1TVOA 4O38A 3BI6A 4LDTA 5IQDA 3V5PA 2PVJA 3EZVA 5HG8A 5KZIA 2GS2A 3PY0A 2WIHA 5AIKA 3LQ3A 4ANQA 4UMUA 3DBQA 4FIGA 5JZNA 5HLPA 3Q9WA 5TOZA 2YCFA 3P9JA 4FTOA 2YDIA 3ANQA 4BIBA 4N0SA 2VTOA 3VO3A 3GFEA 2NNWB 2Y4IB 5D7AA 5AV1A 5I9YA 1PXIA 4CKJA 3KXXA 3RWPA 3R9OA 3VQHA 3BHUA 2F49A 5FD2A 5JT2A 3QQKA 4C61A 4NM3A 1B6CB 3LM0A 4AT5A 4EUUA 3L9NA 4DCEA 1PXLA 2YEXA 4RZVA 4O7RA 4FMQA 5GZAA 5AM7A 5H9BA 2R7IA 4BCIA 3EZRA 4ZMFA 4BCGA 1H07A 2HIWA 3EFKA 5CSXA 3VRZA 5J9ZA 3PFYA 3QX2A 3N51A 4I23A 1E1VA 2CPKE 2B7AA 2F57A 1YVJA 3PTGA 3EL7A 3PXRA 1CMKE 4PQNA 5CF8A 4OTRA 5JGBA 1UU9A 4QP9A 2H96A 4M67A 5KMOA 3MIYA 3R30A 4BBFA 4FC0A 5H3QA 3UNZA 2XARA 1M14A 5IU2A 1BKXA 4JVGA 2GNHA 5ACBC 2JDSA 1HCKA 1REKA 4LGGA 3FYJX 4UB7A 3HAVA 4LOOA 2PVMA 2PSQA 4FEVA 2XNOA 4X2JA 4JBVA 1XHAA 3RWQA 3VBTA 4FEUA 3NVKI 2YCRA 3F5XA 3EH9A 4M7IA 4HW7A 4C36A 3G6GA 3OUKA 2IEWA 4GT5A 3NNUA 3QX4A 2OH0E 5BYZA 4U0IA 2QHMA 3ROCA 3U8WA 1URWA 3QCSA 4BCJA 3AXWA 4RWIA 4KAOA 3UO5A 1OPLA 1GIHA 3KVWA 4FI1A 3EQIA 5FBOA 3BKBA 3VBVA 3KF4A 5AM6A 2W4OA 3LQ8A 2GSFA 4JG7A 4CLJA 5FP5A 3MWUA 3PJ1A 3FE3A 3P79A 4ZP5A 2ITYA 5ANDA 4RFZA 3NMUF 3Q60A 4ZZOA 3QTUA 5KMNA 3QYZA 3AC1A 4QTDA 4D2TA 4WNMA 2J5FA 5A4EA 5C8KA 3Q4CA 2VO3A 5FDPA 4U45A 4QDEA 1UV5A 3L1SA 3FHIA 5B2LA 3S00A 2X9EA 3IONA 2AC5A 2AQXA 4R3CA 1ZYCA 1YWNA 4MXCA 4JDHA 1R39A 3LVPA 5HHWA 3R28A 5M4UA 2ITTA 3JR1A 4D2SA 3AGMA 4EOOA 1SVGA 2PUIA 4Z3VA 4ANBA 2CCIA 5LMKC 5AP6A 4QMNA 2YDKA 4WRGA 4RVTA 4AOTA 2ITXA 4FSYA 4WG5A 1ZMUA 2OKRA 2RG6A 4IAYA 4CFMA 1GZ8A 5A46A 3FLNC 3GCSA 4TYHB 2YA9A 4KBCA 4I22A 1S9IA 4JRNA 1H1SA 3FI8A 1ZWSA 4BRXA 4ZLYA 1PY5A 4C4JA 3QCYA 5C27A 3G33A 5FLFA 4HYHA 5E8YA 5TT7A 3FMDA 4AXCA 3V6SA 4I41A 3LAUA 2EUFB 3KREA 5LQFA 3WYYA 2PZ5A 4G3CA 1JLUE 2Z7LA 3R8PA 4TNBA 5KMLA 5C01A 5ICPA 3V3VA 5AP7A 4Q9SA 3VJNA 1Q8WA 3LFAA 2UUEA 2W9ZB 4C37A 4U97A 4TNDA 5FWKK 3THBA 4F9BA 4GG5A 2ITOA 4X2GA 4DLIA 4G31A 3VW6A 5KBQA 4NH1A 1WFCA 1XQZA 3OFMA 2W17A 2ZMCA 3AKJA 4KUJA 4LGHA 3FEGA 3QTXA 5CANA 2I0EA 2YJRA 3FXZA 4O0UA 2UZEA 4FK6A 4FL2A 2RL5A 4J71A 4DFZE 5LMBA 2B9JA 1Q8UA 2JKMA 2Z60A 2W96B 3NX8A 4RJ7A 4E73A 4YPDA 3W0SA 1R1WA 4MD9E 5BX0A 1W82A 1Y57A 3QUEA 4Q2AA 4OUCA 2B9HA 1O6KA 3ZLXA 4BCPA 4DGMA 3Q9ZA 5M4CA 3HVCA 1Q5KA 3A61A 4XP3A 4AQCA 1VZOA 4HVGA 4FVRA 3MBLA 4IJPA 4QRCA 5HNGA 3ZS5A 5EG3A 3JS2A 3R22A 3BLRA 2YIWA 3S2PA 3NIZA 1JKSA 1OL1A 3DS6A 2VTQA 5G6VA 3U4WA 3UC4A 4YLLA 1NXKA 3DFAA 3W2CA 3PSBA 4BCOA 2I6LA 4RQVA 2C3KA 4EBVA 3V5TA 3BGQA 1ZYDA 2AUHA 3GT8A 3ATSA 4RT7A 4ZY5A 5T68A 1FOTA 3RP9A 4C8BA 5CAQA 4E4XA 5CASA 4DN5A 4EH4A 4BDGA 1JKTA 3BYVA 3C50A 4Z7GA 1H0VA 3N4TA 5C4LA 4PX6A 2EVAA 3WIGA 2XKCA 3UZRA 3SXSA 3NGAA 4QTEA 1BX6A 1V0BA 4NM7A 4XHKB 1DI8A 3AMYA 3QZGA 4QP2A 1BI7A 1MP8A 1UNLA 3UIUA 5HO8A 4AP7A 3FZRA 4WNPA 1FMOE 4EH8A 4I5PA 2JLDA 3AT4A 1VYZA 4DE4A 2WMQA 1R0PA 4WIHA 5I9ZA 5E8SA 4BFMA 4D4RA 4I94A 1W2DA 3HKOA 5K0KA 3VONA 4E1ZA 4ZLOA 4LMUA 5EK7A 2RIOA 3NW6A 4FKVA 3TV6A 2JIIA 3D2KA 5DT0A 4D58A 2GNIA 4CZYB 3RGFA 4L44A 1IG1A 4IWQA 3DBDA 3C4WA 3GEQA 1XKKA 2OBJA 2NRYA 2C5YA 2XRWA 3FXWA 5K9IA 1Q8ZA 3FSKA 3OXIA 3N4UA 1OL2A 2QOBA 4H58A 5L6PA 4IZYA 5K5NA 2YCSA 4GT3A 2GS6A 3GOPA 1YI4A 3H9OA 3GCPA 3KL8A 3W8QA 3F69A 4CTCA 4FKQA 4BZOA 2SRCA 1QPEA 4N6YA 4QP3A 3WF9A 5IUGA 5JMSA 3CJGA 5HD4A 2VWUA 2FYSA 2YM6A 4PWNA 1CKJA 4MF0A 1UU7A 2C47A 3KN6A 4APPA 1WBWA 4ASDA 1GOLA 3PZEA 3CTHA 3HMNA 4UYAA 4WOVA 4DYMA 4LM5A 3RKBA 1LP4A 2QLUA 4KIPA 1E9HA 2O8YA 4BTKA 4Z16A 2XKFA 3V5LA 3WYXA 2W5HA 5HIBA 4IH8A 4IXPA 1I44A 2WEVA 5AP5A 1JKLA 5EHYA 3Q4TA 5TR6A 2F2CB 4RJ5A 4BZDA 1DI9A 1IR3A 3M42A 5JSMA 4M69B 4DGLC 5DR2A 4LL5A 3CS9A 3F5UA 3QAME 2YWVA 1MRUA 4D2WA 3I1AA 1JOWB 2LGCA 4V05A 4DH8A 1FQ1B 2HK5A 5I9XA 4FV4A 5DBXA 3CGOA 2YN8A 2ITQA 4HYUA 3OT3A 4RFMA 2WHBA 5ANJA 4GK2A 3Q53A 3D5XA 1QPDA 3OW4A 2BR1A 4XLIA 3UOLA 4XG7A 4CTBA 3BX5A 2WKMA 3QHRA 2XNPA 5AR2A 1BYGA 3BEGA 4RMZA 2VTTA 1NVRA 4YSMA 1SM2A 5ANGA 4NIFA 4ZSGA 3R7GA 5KHXA 4F70A 2UW0A 3QA0A 3EHAA 4FVPA 3F3WA 3UC3A 2X4ZA 4ITJA 2OJFE 3NEWA 3PDTA 5CU0A 4V04A 2H6DA 2QOOA 3R01A 3DOGA 2WU7A 2R0UA 4FTCA 4JAIA 3I60A 5F20A 1Z9XA 1PXNA 3ROYA 2WMSA 5JH6A 4KIKA 1YHVA 1YXTA 4AA0A 3ULIA 2BUJA 4O7ZA 4EQCA 5K4JA 4O86A 3H10A 2J0IA 5FBNC 5B2MA 2UZBA 4EH3A 1FGKA 4E4LA 4BIEA 5JKGA 5KBRA 1FMKA 4IX5A 4Q9ZA 4UWCA 4XP2A 2C5VA 4IAIA 3SXRA 4YHJA 5DEWA 2XB7A 1KE9A 3VS2A 4KIQA 3OS3A 3KXGA 2UZLA 5D41A 1XR1A 1ZYJA 4IEBA 4XEYA 4JIKA 3RHKA 3ZO4A 2PHKA 1V0OA 5IDNA 3CP9A 4ALUA 4QMSA 2B52A 3NAYA 3RAWA 1P5EA 4L53A 5K4IA 4XLVA 5DT4A 2UZVA 3SX9A 5HO7A 1UU3A 1Q4LA 4USFA 5M44A 4PMTA 3VBXA 2AEGA 2OGVA 2P55A 3W0RA 5CQWA 2OI4X 1KE6A 3R8UA 3S95A 3NUSA 2PL0A 3FPQA 4YURA 2HW7A 3W16A 1O6YA 2FUMA 3Q5ZA 4RIXA 5GJGA 3AD6A 1RDQE 1ZXEA 2C69A 3SC1A 4JR3A 2VWYA 4V0GA 4PTGA 5FG8A 2BZKB 4UV0A 2QG5A 4PY1A 4UMTA 3UVRA 2CSNA 1YKRA 4ZSLA 5LVLA 1AGWA 4LRKA 3SG9A 1W8CA 4H1MA 3UTOA 3NUXA 4RVLA 4NU1A 5CENA 4EK3A 3LCSA 2XK9A 3ZBFA 4YJSA 4CCUA 5HIDA 2QODA 2XF0A 4FT9A 3R7EA 2CKPA 1CTPE 3LJ1A 2CJMA 2BZIB 2YM4A 2E9PA 5B7VA 2ZVAA 1H1QA 2WTKC 1YXUA 3KULB 5L2WA 4O0XA 4TT7A 3EB0A 3Q6UA 1U5RA 4EOPA 4YC6A 2UZDA 4J98A 2E9NA 3F5GA 2Z8CA 3GFWA 4P7EA 3A7JA 4ACMA 1SNXA 4E4MA 4EHGA 4F1MA 3FZOA 3WZKA 4K6ZA 3IKAA 3G2FA 2WZJA 4JX3A 5HTCA 3VW8A 4U3YA 1DM2A 4D2VA 2B1PA 3M2WA 1WBVA 4MBJA 3PLSA 4YJNA 2VWBA 5AMNA 3RPRA 5IMEA 3MPMA 4O7SA 2PU8A 2ZM1A 2X39A 3KRLA 3PUFC 2W1ZA 4DEEA 2PULA 2ZAZA 2PMLX 5EOLA 4NWMA 4D4SA 5F1ZA 4U7ZA 3P5JC 2VO6A 3NWWA 3MFUA 3I5ZA 4O27B 5FDXA 2VV9A 4NZWB 2ZV2A 4HVSA 4R3PA 4H05A 2XNMA 3QQLA 4Y5QA 1QL6A 3KK8A 5HKMA 4GW8A 4MF1A 5M56A 3MDYA 4BDBA 4BWKA 3GP0A 4IANA 4F7SA 3UDSA 4EOQA 2J0KA 4FF8A 2ITWA 3LCOA 5D11A 4BDHA 3AKLA 5I4NA 3D83A 2PK9A 4B9DA 2BILB 4QD6A 5LVMA 4UBAA 5CEQA 4BKJA 4O22A 3OHTA 3RI1A 3ANRA 2BVAA 4V01A 2DYLA 3L9LA 3PWDA 4ANMA 4E5WA 5IG1A 2W1CA 4IAZA 5IISA 5HGIA 1YXXA 4O91A 2C1BA 4DCAA 2BTSA 1SVEA 2R3QA 2IW8A 1KUTA 4K11A 4DH1A 3PIYA 3QFVA 2R3FA 3ORIA 4UYNA 4OTQA 5CVHA 4CMUA 2QOLA 3LW0A 4CZUA 3V8SA 1ZZ2A 3GU8A 3LFBA 4H3PA 3BHTA 1P4OA 5ETIA 4QMYA 1L8TA 4PMSA 4OBOA 4D0WA 2GTMA 4NK9A 3PA5A 4YNOA 2O65A 4PPCA 1F0QA 4ZJVA 5BVOA 3IQ7A 1OB3A 2J90A 4O1PA 3JY0A 2YDJA 3U4UA 5AUWA 2YM7A 4BVUA 4F65A 4ZTSA 4RX7A 4BDJA 3LOKA 2O2UA 4GJ3A 3FL5A 3PA4A 5T3QA 4XOYA 4EH7A 2R3KA 5EI6A 5IA1A 1OPJA 4ZTNA 4ANSA 4DT9A 3CJFA 3A4OX 4B0GA 3I0QA 1OUYA 2J7TA 5LWMA 2B55A 1Q3DA 4Y8DA 3W2QA 4I3ZA 3VNTA 4XV2A 4BIDA 4ALWA 1IASA 2ZDUA 5GNKA 5JFSA 3HMPA 3KFAA 4AGCA 4ARKA 4AACA 2C6IA 2R3LA 2C5NA 3QWJA 3LMGA 4GT4A 3SQQA 2VN9A 2JIVA 4FTAA 5FXQA 3PPZA 4IB1A 3MFSA 3LKMA 1K9AA 5D10A 4I93A 4UXQA 2W5BA 3IG7A 1KOBA 3K54A 3OEFX 3KEXA 4J53A 4KB8A 5HCYA 5M08A 1JBPE 2FGIA 3DLZA 2UZTA 3V5QA 3NNVA 2R7BA 1YHSA 3VF8A 2W0JA 1CDKA 2WQOA 4XP0A 1H26A 3KCFA 3QC9A 4IB0A 1JVPP 3FMKA 4G34A 3QTSA 4EL9A 3IDPA 2XJ1A 1YOMA 3NW7A 3KC3A 4BN1A 5L6OA 4AX8A 5ETCA 3UOHA 3A62A 1MRYA 3RVGA 2VTSA 2PVHA 3W8LA 2WPAA 1OKWA 2VD5A 3OZ6A 4MTAA 4O7NA 4OTGA 5FM3A 3TACA 3KK9A 5AJQA 5JRQA 1OVEA 1GIJA 4E20A 4BR3A 2WMXA 3QD0A 3U9CA 4C4EA 4D4YA 5ANIA 3DT1A 3UP7A 1P4FA 4RWJA 4BDKA 2AC3A 2OSCA 3PXZA 5EDQA 4XV3A 4NJDA 3U54A 4BWXA 2VRXA 4L3JA 5IDPA 1U4DA 4O4DA 4W9WA 4F7LA 5HOAA 5HQ0A 4UZHA 3VF9A 5L2TA 4ZS4A 4P5ZA 4PF4A 3UOJA 2ESMA 3DDPA 2VUWA 2RSVA 4NEUA 4XG3A 5IKWA 3HV4A 1AQ1A 3E62A 1TQIA 5TO8A 2HW6A 4HNFA 3B8RA 3RPSA 4DH5A 4UX9A 3C5IA 3C9WA 4UWYA 1B38A 4WG4A 3TG1A 3WARA 4X3JA 2OZAB 2PYWA 5DA3A 3UE4A 2GNJA 2OXDA 3QC4A 5EFQA 4N4SA 5C8MA 3CBLA 3ZBXA 2IVVA 3BQRA 4QQ5A 5HVJA 4AOJA 2QOFA 4YJUA 3C51A 5M07A 4LUEA 1U5QA 3C4XA 3FC2A 2VGPA 5HESA 3WF5A 3RZBA 3SRVB 3F9NA 4G3GA 3CY3A 4GUBA 4F7NA 2ZFYA 1GIIA 4RZWA 5CEKA 4LGDA 3VBQA 5HLNA 2ETMA 3VVHA 1U54B 2YM5A 3MIAA 2Y7JA 4QO9A 1H25A 1PMVA 4FKGA 5E1SA 5J7HA 3DBEA 4PL4A 5J9YA 1HOWA 2XBAA 3IDCA 4AXEA 2HZNA 1GZNA 2I40A 1H1RA 3R1NA 5AP4A 5IEYA 2CLXA 4MVFA 3ZFXA 4LRMA 2UZOA 3G5DA 2PZYA 4QP4A 3WOWA 3UGCA 4DGNA 3P4KA 1ZY4A 2YLFA 3EQBA 1OM1A 4RIWB 2XIKA 2RFDA 2XK3A 1MQ4A 2E9OA 5FTQA 4YJPA 1M2PA 4GIIA 4QT1A 4CV8A 3D4QA 3QRUA 3D7TB 4BWPA 4P90A 5C26A 4IVBA 3EN9A 3G90X 4GV1A 4MD7E 5CU2A 4O82A 2E2BA 4CKIA 2C6EA 3TNHA 2FVDA 3FLYA 3KA0A 3OOMA 3ODZX 4MCVA 1G8AA 5E91A 1OGYA 5HBJA 4O96A 3GU6A 1V1KA 3A60A 4RJ6A 3V5WA 3DK6A 3V01A 5HVKA 5FXSA 5AR3A 4CCBA 1P2AA 3BYMA 2R3GA 2O5KA 1OUKA 3DNEA 4F99A 5BYLA 3JYAA 3QHWA 5CEOA 2X0GA 4L00A 1J91A 5CZIA 2YERA 3CR0A 5EI2A 4CG9A 4A06A 2XRUA 1APME 3EFLA 3NCGA 4ZOGA 5HD7A 4USEA 2B0QA 3DFCB 4W8EA 5IA2A 1BI8A 4BDAA 1QPJA 5HCXA 5M4FA 4L52A 1ZOEA 3DY7A 2BAJA 2I7QA 3OUNB 2JBPA 3CGFA 4S30A 2X1NA 4YU2A 4AE6A 3GENA 5EYMA 2R3OA 4AA5A 3OC1A 4RA4A 5JRSA 4A4OA 2WU6A 3OD6X 4C59A 3TYKA 1PXMA 3TZMA 4ERKA 3GNIB 5EDRA 3UZPA 3K2LA 4EH2A 4GG7A 2C1AA 5J9LA 4FTLA 4IW0A 4EZ5A 2VTIA 5DWRA 2QOHA 3GCVA 4MQ1A 4XV9A 5BVWA 5AIRA 3ORKA 3ZZEA 3IOPA 4IDTA 5C8NA 4DEBA 1Q61A 2WQMA 5IUHA 2IZUA 2UW3A 4LYNA 1PF8A 4CT1A 4C4HA 2A1AB 3QGYA 2DQ7X 3CE3A 2QR8A 3R7OA 4FZ6A 4AAYA 4EYJA 4UMPA 5LCKA 4RGJA 3CQEA 4M0YA 4IBMA 4YJRA 3RAKA 3EYGA 1GNGA 4EOIA 4TRLA 4JS8A 3A7FA 1PW2A 3KRXA 4I6QA 2XK6A 2IW6A 4EOSA 5D7VA 1T45A 4PTCA 4R7HA 2WGJA 4O0SA 3UPZA 2GNFA 3OY3A 1UNGA 5AP3A 4XCUA 2CGUA 5DFPA 3QL8A 4RIYB 4XV1A 4DFBA 3O8PA 2PVRA 2YAKA 3QLFA 4CYIA 3BU3A 2NO3A 5HEZA 3ZSIA 2EXCX