4C37A

Pka-s6k1 chimera with compound 21a (cct196539) bound
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
338
structure length
335
Chain Sequence
ESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSYGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVLEYLPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title The Discovery of Potent Ribosomal S6 Kinase Inhibitors by High-Throughput Screening and Structure-Guided Drug Design.
pubmed rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
total genus 112
structure length 335
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c37A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c37A02
1FMOE 2I40A 1KSWA 3CIKA 3DK3A 1H0VA 3ZO1A 2CCIA 4CFWA 3GXLA 4GUBA 3EQBA 2QLQA 4YPSA 2ETRA 2RF9A 2C47A 1SNXA 3I81A 4TWOA 5DMZA 3VQUA 4A9SA 4ZSAA 3K2LA 4DFUA 3DJ6A 4M84A 4O7VA 3OUKA 5HIEA 5IUIA 5I9XA 3ZO2A 5LJJA 5AV4A 3ORNA 4C59A 1Q41A 4HYUA 4JQEA 1AGWA 4BB4A 1YKRA 4RWIA 2C5OA 4W4YA 2UZNA 4D5HA 5CEQA 5KKRC 2W4OA 5CALA 3NWWA 5KNJA 1SVHA 1YI4A 4FT0A 4FT7A 2OJJA 2WMTA 4XP3A 1REKA 4YSJA 3SGCA 4BN1A 1UU9A 5IG1A 2ZV7A 4EYJA 3CSVA 3KXXA 4IQ6A 2W17A 5M56A 3IPHA 2WOUA 3LQ5A 4DEEA 4W4VA 3QKLA 5IISA 4R3CA 3N4UA 4B8LA 3OZ6A 2OZAB 3O71A 3TUBA 4GK2A 2XB7A 3F6XA 1K9AA 4U9AA 5BVDA 5EQYA 1XH9A 3UODA 5JN2A 4ANSA 3EMGA 5DN3A 4BI2A 4DTKA 3UNZA 4MWHA 3POOA 4AQCA 2F49A 1GIHA 3Q04A 2YACA 3BYSA 5CEOA 1ZYSA 3PA3A 3FEGA 5AUVA 4E26A 1ZY4A 3LFDA 4KD1A 3KK8A 1G5SA 4FNWA 3G0FA 4S31A 5JFXA 4L6QA 2GNGA 3DQWA 3EL7A 3PLSA 4GYIA 3ZLYA 3MS9A 4FV0A 4EH7A 4DBXA 3ERKA 5CF6A 3LM5A 5JZJA 1J7UA 5DH3A 2OK1A 3UOJA 4IC8A 2J51A 1OUKA 1VZOA 3FYJX 5FQDC 4IAKA 3TV7A 4NZWB 5FG8A 3U51A 3TG1A 2GQSA 1GIJA 3DDPA 4RMZA 1U5RA 1OIYA 3QD2B 3KN6A 4FG7A 4IACA 3R9DA 4XG2A 4MF0A 4FSNA 3NUNA 3R9NA 2GTMA 4BF2A 4M67A 4YU2A 3RINA 3FLSA 5BQ0A 3Q2JA 4BCIA 4NM3A 5BPYA 2XRUA 3TJDA 1U46A 4IFGA 5HU9A 5DG5A 2P0CA 4M12A 3U9NA 4ITJA 2C5VA 5FTQA 5C03A 3LE6A 4ZLOA 5KX8A 2AUHA 3UJGA 2WQMA 4GYGA 1OPKA 2C30A 2R3GA 2R3FA 3OCGA 4FSUA 1H01A 2QURA 4C38A 4MXAA 3C5IA 2YCFA 2BALA 5F4NA 3VS3A 2OO8X 4FKVA 4V01A 3VUTA 5CZIA 4UV0A 2Z2WA 5AUXA 5DT0A 4ACGA 4CV9A 1W98A 4EOKA 5DHJA 4PPCA 4NEUA 4O0TA 3RP9A 4U0IA 4AZSA 5CYIA 3FC1X 4BDAA 3E62A 3SXFA 2ZJWA 3BV2A 5AUZA 3V51A 4DH1A 3QZGA 3T9IA 4S2ZA 2OIDA 4D2PA 2Y8OA 4UYAA 4TW9A 5HD4A 4F1TA 3KXHA 4RC3A 5AP5A 2JDSA 3IGOA 4F7SA 4M69A 3QZHA 1V1KA 4PPAA 5FDPA 4D4RA 2VD5A 2XMYA 2YLFA 3MI9A 4Z9LA 3ZS5A 5AFVA 5AP6A 4HYIA 4X6QC 3E92A 3GFEA 3I0OA 4C3PA 2J0IA 3UDBA 2F7ZE 3TJCA 4IX4A 4FSYA 2XK3A 2ZV9A 3PVGA 3UOHA 5DEWA 2UW9A 2PUUA 4BHZA 5IQAA 4G5PA 4QP4A 4C4EA 4FSQA 4K33A 2W0JA 1OL1A 2ITTA 3CCNA 4NT4A 3HYHA 4U44A 3NS9A 4YJTA 1WBTA 4A9RA 4EUUA 2NP8A 1W83A 2IN6A 3CTJA 4OGRA 5KMIA 4DF3A 2RFSA 4IE9A 4WNOA 3BX5A 4OTRA 3MW1A 4M7IA 4QTBA 4A9TA 5GZAA 2A0CX 2X8DA 3CQUA 1RW8A 4F6SA 3TN8A 3AC5A 3QXOA 5HG9A 5M55A 4GU9A 5FXSA 5AUUA 4FKOA 4RJ3A 5CAQA 4FG9A 5IQIA 4H1MA 3LXPA 4XG7A 4FK3A 3RAWA 2WPAA 3MFTA 3LCKA 3NYOA 4MTAA 3OEFX 3E7OA 4FV2A 2J0MB 4BCNA 4A4OA 2QOCA 1FOTA 4CMTA 4U81A 4ZEGA 2X2LA 3I5NA 3A7IA 5KZ0A 4JDIA 1ZYDA 4W4WA 5DVRA 4C3FA 2GS7A 2RG5A 4FIIA 4J97A 4WG3A 4WNMA 1M7QA 4AZVA 5K0XA 5H8BA 3KXZA 3VBQA 3UO6A 5AV2A 3DY7A 4DEGA 2IZTA 4NIFA 4QQ5A 4EL9A 4QP3A 2JKKA 3QZIA 3QYZA 3O51A 2W4JA 3QKMA 4MXYA 2FSLX 1AQ1A 4TWCA 2A2AA 1E9HA 5LVPA 2CJMA 3C5UA 2R4BA 4Q9ZA 2Y4IC 4ANNA 1Z9XA 3RHXA 5M08A 2VUWA 3FI4A 3KVWA 3U6HA 4BWKA 3R1NA 4GEOA 3TXOA 4FSZA 4BZOA 2NPQA 4JRVA 3GU4A 4R78A 4DFZE 3FZRA 1T46A 4FYNA 3F5PA 5LVOA 4A7CA 4WKQA 1DI9A 4U3YA 5LMAA 4BC6A 1PXNA 4LGHA 2X81A 2QOQA 4M0ZA 3Q9XA 3FQSA 3FKOA 4LRJA 4AOIA 2X9EA 4C61A 3S1HA 5CI6A 3TZMA 1PY5A 4WT6A 4DT8A 5ANJA 4FKSA 4TNDA 3A60A 3DDQA 4TYEA 3PA4A 3UQGA 3KRJA 4YJRA 2RSVA 3MFUA 3LCOA 4U45A 3KRRA 2W1IA 3ZRLA 4HVGA 4YTCA 3D9VA 4TZRA 5AUTA 2X2KA 4RVLA 2Y4IB 4N6ZA 5IQCA 3W8LA 2C68A 3IKAA 4FKPA 4AFJA 4W8DA 4UWBA 5E1SA 4YLKA 5EM6A 4YP8A 3NYVA 3Q4TA 2R3PA 3EFLA 1JPAA 4Q9SA 3FZTA 1DAYA 1S9JA 2BDJA 2ETKA 4FUXA 5ANOA 5AP3A 4ZSGA 3TKIA 4HVDA 2ITPA 5C26A 3A4OX 4FKLA 4OTHA 4FTMA 5AX9A 5BUIA 2XKEA 3GI3A 4JAIA 5FD2A 2CSNA 1GIIA 4OTGA 3RPVA 4D1SA 4CGAA 1MQ4A 3GENA 3EN9A 4KRDA 3DK7A 4E5WA 2LGCA 3PPJA 4BCMA 2I0EA 4MWIA 2QD9A 4I4EA 4FEVA 4W9XA 5E8TA 3GOKA 1W8CA 3E3BX 5A6OA 5LCKA 3DU8A 3ACJA 4JR7A 4EBVA 3KRXA 3RWQA 4L43A 1PXPA 3SKCA 4C33A 5E8VA 4IWDA 2IJMA 3KEXA 4N4SA 4YPDA 5B0XA 3RAHA 4QTDA 4RSSA 4C37A 5EYCA 2QC6A 4RA5A 2J0LA 3AT3A 2R3RA 1PHKA 3OOMA 3CPBA 4HPTE 4F0GA 2CGXA 2PVRA 2VTMA 3HV3A 3EN7A 3ETAA 3MY0A 3QCXA 4DG3E 4BFMA 5CAPA 5M51A 2OKRA 3GC7A 4ZTHA 5G1XA 4PNKA 4P7EA 2JKQA 4O1OA 2VWWA 2UW5A 2UZOA 3OXZA 5IU2A 5CXZA 1CKIA 3OF0A 3BYVA 3ZM4A 2PE1A 3FLWA 3QRTA 5GIOE 2JAMA 4KNBA 1SVEA 3Q60A 2DQ7X 4D28A 4G1WA 3AD4A 4CQGA 4CD0A 3O50A 1F0QA 4K8AA 4RX9A 4XG8A 5T3QA 3VBWA 4AA4A 2Z7LA 3BU6A 5JGBA 2QKWB 2XNNA 3H4JA 3PJ1A 1NVQA 1OBGA 3A7JA 2UZVA 3QUPA 4FK6A 2CNVA 3SG8A 1L3RE 1XBBA 3W2RA 4C2VA 4S30A 3ZTXA 2JDTA 2YLEA 5KCVA 2J5FA 5I9ZA 5EQEA 1M2PA 2X8EA 4BDIA 4ALUA 4BYJA 4BBFA 2VTTA 3Q32A 4EK4A 1M52A 2GNFA 4E20A 4E6QA 4L53A 3ZZWA 3LHJA 5JEBA 4FTKA 2PULA 2W1CA 1B6CB 5KBRA 1WVYA 3ZSIA 1HCLA 2CN5A 4JBOA 4YBJA 4GS6A 3JXWA 1OBDA 5GHVA 2AYPA 2B9JA 3HUCA 2PZYA 2C3LA 3VJNA 3BBTB 4RT7A 4ZS0A 1XH7A 3NUPA 2C69A 2UW8A 3CLYA 3FDNA 3M2WA 2OW3A 4C35A 3REPA 2R3KA 4JVGA 1GY3A 1PJKA 4ENYA 2VTJA 3RPOA 3VRZA 3QU0A 3E7VA 2OJIA 2Z02A 2ZMDA 3NLBA 5DPVA 4APPA 4I6BA 2CN8A 3CY3A 3PIXA 4FG8A 4FZDB 3F9NA 4CMUA 5D41A 2OJFE 4QMTA 3BYUA 1Q5KA 1WBOA 5AEPA 4AU8A 4Q5HA 4O81A 3NSZA 1P14A 5L4QA 2EUFB 2WHBA 3R7EA 3VW8A 4DITA 3UVQA 2YDIA 1Q3DA 4GG5A 5HLNA 2IVTA 4FV6A 4RG0A 4CTCA 4Y46A 4YZ9A 1BL7A 3D2IA 3A99A 3BBWA 3LFCA 4JI9A 3PY0A 4QMZA 2GHLA 4DC2A 4KSQA 4MCVA 5HTBA 4FVPA 4NM0A 3DB8A 4O0SA 3ULIA 4EUTA 3EIDA 3VUKA 5HE0A 3EYHA 5B7VA 2PVMA 3BHHA 4P4CA 4I6HA 4IWQA 2OGVA 4G2FA 4IX6A 4BZNA 3BHUA 4NH1A 1H08A 5JK3A 3H9FA 4R8QA 3LFQA 4RJ5A 4E8AA 4DTAA 4O21A 4ZLYA 4F08A 5C9CA 4C7TA 4E6CA 5CQUA 5LARA 1J1BA 2ONLA 4QQCA 1NXKA 5CSXA 2W7XA 4D5KA 1WBWA 1KE5A 4YZDA 1OKZA 3UP7A 2F2UA 3ANQA 5JKGA 2WQBA 5JRSA 3F5XA 2WEIA 4PL3A 1G3NA 3QHWA 3NAXA 4IB3A 1Y6BA 3AMYA 1Q8WA 3QUEA 4EH6A 4ZZMA 4BDHA 3QTUA 4KS8A 3JYAA 5HNBA 5FDXA 2OLCA 4DGOA 2WMQA 4L7FA 2IW6A 3NMUF 3RTPA 5F94A 4MD9E 4LGDA 4Q2AA 4ZTLA 5BVKA 3RBWA 4AGCA 2PVLA 3DK6A 4NTSA 2C3KA 3DLSA 5DYJA 1DAWA 2QKRA 4FTIA 1CM8A 5HVKA 1ND4A 2VO3A 3VO3A 3DBEA 4X6RA 1H0WA 4GW8A 1Q8YA 2XH5A 3S3IA 4BCHA 3V5PA 2G2HA 4N0SA 5E4HA 2XNEA 1IAHA 3EQRA 3QTQA 4GKIA 2UVYA 2GHMA 4O7SA 4XX9A 4QTCA 4XNEA 3HZTA 4TTHB 5E8ZA 2QG5A 5TKDA 2IG7A 4TYJA 4AGUA 5IA1A 3GCVA 3OBGA 5J1VA 4BKYA 4NTTA 4S34A 1JKKA 5TF9A 4QTEA 5HNIX 5L8JA 3UQCA 3Q2MA 3S95A 4LRKA 5D11A 4EOLA 3SVVA 4UX9A 1UV5A 2H8HA 3A7GA 4RFZA 5EHYA 4PV0A 2ITUA 2PE2A 3VQHA 4EYMA 3E5AA 4HPUE 4NKAA 4UN0C 5IH5A 5IPJA 5LQFA 2YWPA 4FT5A 1YOLA 3PG1A 4RWLA 4F0IA 4PDPA 5LMKA 3MB6A 2PMNX 2PVNA 2QOBA 3UQFA 3U54A 3E8EA 1RDQE 2IZSA 3DQXA 3P7CA 4HOKA 3L9PA 4DFLA 3NZ0A 4FTLA 3V8WA 3AGMA 3C9WA 3JPVA 2O2UA 3MSSA 3GUBA 3PJ8A 1TVOA 4FT9A 5FP5A 4X2JA 3S2PA 2W1FA 4F70A 4G6NA 3FV8A 4YLJA 1LR4A 1NW1A 3VBXA 3PP1A 4G34A 4GVJA 1YHVA 1PXKA 4OT6A 2Y6OA 4N6YA 2X7FA 4CYIA 4UXQA 4NSTA 4AX8A 1PW2A 4EBWA 3R30A 3I5ZA 4L67A 4MYGA 1CDKA 3QF9A 3FLQA 4DEBA 3P4KA 4LMUA 2C3IB 2ERKA 3RPSA 4MBIA 4IX5A 3RNYA 3UMWA 4RLKA 2B0QA 5KZIA 3OBJA 4D1XA 2IVUA 4ACMA 2DUVA 4DFYA 4O0YA 3HRFA 3JUHA 3GGFA 4XYFA 4QNAA 5M53A 4OLIA 5F9EA 4OTPA 4KINA 3T3VA 5HZNA 5LOHA 3L1SA 3OXIA 4O2PA 2XP2A 4FNXA 3HEGA 2BHHA 3DPKA 4C4FA 1ZZ2A 3HMPA 2WFYA 3KRLA 3O0GA 3OD6X 5D10A 2QI8A 3ALOA 4RVTA 3FL5A 3HRCA 5A14A 4Y85A 3OFMA 2R64A 3TNQB 5JFVA 2NRUA 3VC4A 3FXXA 5BYLA 4QYEA 2C6TA 2W1ZA 3E64A 4Y73A 3WBLA 5IEVA 5IMEA 1H28A 1H07A 4I23A 3TNPC 4KIQA 1H1WA 4IAZA 4FTNA 5E92A 1KWPA 2YIYA 2YZAA 3KXMA 4TYGA 3I6WA 4LGGA 5AV1A 3DAEA 2PVJA 3HGKA 1J3HA 4ONAA 1VR2A 1OZ1A 3U6JA 3TNHA 2GU8A 4FT3A 4NW6A 2FH9A 2QHNA 3QX4A 2C6LA 2R2PA 2YIWA 4C36A 5ICPA 4RGJA 4J98A 3EQIA 3IW4A 4DINA 4IAAA 2IPXA 4QMWA 2F9GA 4PWNA 1H24A 2VWZA 3TDVA 3QQJA 4I0TA 2XIKA 4QT1A 2YCSA 5D9HA 5L8KA 4X3FA 2O63A 3NIZA 2SRCA 4JL9A 3I4BA 5GIPE 2JBOA 3MJ1A 2BAQA 4OTQA 3UP2A 2BZJA 4WUNA 4XG4A 4GT5A 3FI3A 4BI0A 4O0RA 2PU8A 1QL6A 1E1VA 2IWIA 3R21A 2V55A 5CSPA 4NU1A 3F3VA 3LW0A 5C4LA 4I20A 4K2RA 5CSVA 2WMWA 5AIRA 4RVMA 1JNKA 3UYSA 1ATPE 1ZWSA 1PYXA 4Y72A 3ZMMA 4B8MA 4ERKA 4EOIA 5ETFA 3RJCA 2OFVA 3VS0A 2XF0A 5HBHA 5CF8A 2HWOA 1P4FA 4OT5A 4QP9A 3V6RA 3VWAA 4NUSA 1QCFA 3QA0A 5D12A 4EOPA 4QMNA 5HTCA 2NO3A 4CRLA 2CGWA 1YXTA 3RK9A 4IM0A 2XIXA 1ZOHA 2H96A 2ZM3A 3RKBA 4USEA 4HCUA 5BVNA 3WARA 2QU6A 3F69A 3W8QA 3F3WA 5CU0A 1P2AA 2XIRA 4MK0A 2YAAA 4G3FA 3KMWA 4LMNA 3PLAE 2B53A 5EHLA 2YWVA 5LCJA 1BYGA 3VUIA 2CGUA 4FTOA 4I0SA 5CU2A 4DEIA 1RE8A 3VJOA 4CLJA 3ENHA 4FICA 3W32A 1R1WA 4FNZA 5LWNA 4V04A 3EFWA 4UZHA 5ANKA 3OW3A 3E3PA 3ZONA 4LYNA 2G9XA 1XBAA 4IADA 2F7EE 2VX3A 2R3MA 3KXNA 4RWJA 5D7AA 4BCFA 4HZSA 5IKWA 4O7LA 3THBA 2UZDA 3TTIA 2ZDTA 2FA2A 3DJ7A 4H58A 4UB7A 1BKXA 4F6UA 1MUOA 3VS7A 3VUMA 4O7WA 3EWHA 5I9YA 2JFLA 2PE0A 4FV4A 1Q8TA 2BDWA 4YLLA 5FXQA 3QBNA 5E8SA 1W82A 3CEKA 1K3AA 3BLQA 4WD5A 3RM6A 1WZYA 4ZMFA 4GFGA 4IBMA 3OTUA 4NJ3A 3VF9A 3VS1A 1L8TA 2NNWB 2G2FA 4EOSA 3F66A 2EXCX 4FSRA 5L2QA 4Y8DA 5IQFA 1HCKA 3MN3A 1JSUA 4YTIA 3BV3A 3MVJA 2YABA 3M11A 3PJ2A 5FLFA 3R9OA 3ORMA 3DB6A 3KREA 3V5LA 2OF2A 5DIAA 5CZHA 5HLWA 5AIKA 1UNHA 5J95A 3S4QA 3WILA 4FVRA 4X2FA 4U41A 4I21A 4ZSJA 3V01A 3EQPA 4D9TA 2C3JA 1OPJA 2PVFA 4C8BA 4FKQA 4OW8A 3AT2A 3UZTA 4S32A 5BVWA 2H9VA 2AC3A 3UG1A 4QMMA 3FPQA 3QQUA 3QQFA 1ZXEA 1ZMUA 3L8XA 1O6LA 4AA5A 4DGLC 2Q0BA 4G31A 5C1QB 2ITNA 4HGTA 4BDEA 4NM7A 5LVMA 5EW9A 3AOXA 3UBDA 4WA9A 5DOSA 3UOLA 3BGQA 1XH6A 3F61A 4M69B 4P2KA 4QMUA 2IVSA 3FXZA 3VULA 3FMMA 4O7ZA 1TKIA 2UZEA 3GVUA 4C34A 3Q53A 2W06A 2ZM1A 2OXXA 3DCVA 4RJ4A 2CPKE 5EK7A 5JGDA 3FY0A 3ZM9A 2VNWA 3OHTA 4MAOA 4B6LA 1I09A 4A9YA 4RIXA 4ARKA 3PPZA 4PPBA 5EG3A 5JSMA 2C5YA 2PMOX 2PZ5A 3GCUA 3LFBA 5CAVA 5HD7A 4X3JA 4F9CA 3FKNA 3I7BA 3PJ3A 2BMCA 5CX9A 1XH5A 2ZYBA 3QKKA 4FKTA 5L2TA 1Y91A 3GCSA 4W4XA 1WBNA 4ANQA 4M14A 4RA4A 1FMKA 3R7VA 3UVPA 3HV6A 3VHKA 4D4YA 1ZMVA 3LFNA 4GJ3A 4EQUA 4ZAUA 5AP0A 4H36A 2VTHA 3DAJA 3SXSA 5KKRB 5AM6A 5JQ5A 3C0IA 1WBPA 3EQGA 5JMSA 1Q24A 5A4EA 2X39A 2XKFA 3DKOA 4IM2A 4UMPA 3FXWA 3Q5ZA 1CTPE 2CNQA 5AWMA 2E9UA 5I0BA 4XLVA 4NYEA 4DCEA 2VU3A 5GJFA 5CT0A 2VWYA 3CQWA 4O96A 2XIZA 1KOAA 4CKJA 1SMHA 3ZDUA 1PYEA 1WVWA 2RL5A 4DA5A 2YHVA 3D14A 3FLNC 1WAKA 4YUQA 3AC4A 3LXLA 3U87A 4WOVA 4AT4A 5AA9A 1U54A 4NIFB 3MY1A 1ZOGA 3E63A 3NUXA 5CTPA 2OI4X 2XA4A 2XK9A 3A61A 3P7BA 3CPCA 3O96A 4IDVA 4MQ1A 4DEDA 5GNKA 1IA8A 2O8YA 2QOFA 5DR2A 2VZ6A 2XNBA 3G5DA 2HY0A 3LM0A 4HGEA 3F3ZA 1ZRZA 4FOBA 5L6WL 3SV0A 3OY3A 3KF7A 4FKIA 1OM1A 2VO0A 4ZP5A 1JAMA 5EOLA 4YMJA 3HV5A 3ITZA 5BMMA 2BRMA 1PMUA 3Q4UA 4UZDA 4UWCA 3N4TA 2UW6A 2EB3A 3BEAA 2GQGA 5AP4A 1UU3A 2UW0A 3OW4A 1UKIA 4PNIA 3ZUTA 2XKDA 4BCOA 3PZHA 5C8KA 5L3AA 4WG5A 2FYSA 3NYXA 4EZ5A 4FV9A 3BQRA 3R22A 3HMIA 3C7QA 1OKYA 2GPHA 2VTPA 4ALWA 3R1YA 3KVXA 1GZKA 4FTJA 2XNPA 2BVAA 2WB8A 2YFXA 2JDRA 4GT4A 4G3GA 4L7SA 4UMQA 4YJOA 3SOCA 4Z7GA 4RJ6A 4O27B 1BUHA 3OP5A 1G8SA 3BWJA 4FEWA 3NW6A 4USFA 1O9UA 3CGOA 3MESA 1MRYA 2J7TA 5I9VA 2E2BA 3LJ0A 2OWBA 4M3QA 5HG8A 3D7TB 4NCTA 4GK4A 4R6VA 2CLQA 3JY0A 4F0FA 1FGIA 2XIYA 4L01A 2P55A 3DKGA 3ID6C 4ZZOA 2EVAA 4MXZA 5J7HA 5B2MA 2YM6A 3W10A 5CAUA 1KE8A 4A06A 4MD8E 3BQCA 4NFMA 3O8TA 3ZXTA 4W9WA 2R5TA 4BDDA 2QG7A 4QMLA 1R78A 5JH6A 2Q0NA 3G90X 2I0VA 2ITQA 3KK9A 5DT4A 4AP7A 2HZIA 5H2UA 4ZIMA 3LMGA 3OC1A 1IAJA 1JKTA 3DJ5A 4R7HA 2X6EA 4OBOA 3FMKA 3KXGA 4FSWA 5EI2A 4EK8A 5GJDA 4YO4A 4R3PA 4FEQA 1B39A 4UXLA 4FTRA 2OZAA 3C4EA 5H3QA 5AUWA 2OF4A 5E90A 4BI1A 5AA8A 3C13A 3BYOA 3LIJA 3OOGA 3QALE 4FV8A 2XK6A 4IX3A 4N70A 1FINA 5F1ZA 3ZLWA 4ANOA 4CTBA 5A9UA 1YWRA 5I9WA 1VYWA 1KE9A 2BRBA 3SDJA 4QYGA 2UZUE 2WELA 1M2QA 1WVXA 1BMKA 1CMKE 4PDSA 2X7OA 4RJ7A 1O6YA 3UNKA 2R7BA 3FHIA 4M97A 2GFCA 3O17A 4QOXA 5HO7A 2BHEA 4I0RA 3UC3A 3PA5A 3K3IA 1BL6A 3IOPA 3ZC6A 4BWPA 3ZU7A 4XCUA 4YJQA 5DFPA 4AW1A 3A7HA 4G5JA 4XS2A 3ELJA 3JS2A 3RK5A 4LV8A 1UNLA 1OKWA 3V6SA 5ITAA 2B55A 4KBKA 3HUBA 4FTTA 3PZEA 3FY2A 4YZMA 3EL8A 5C01A 4F1OA 1LEZA 3G2FA 4PL4A 3G0EA 4TKSA 2YERA 4U5JA 3WI6A 4CFXA 1QMZA 1GZ8A 2QQ7A 3E88A 4RIOA 3TEIA 3W2OA 4NK9A 4TYHB 3H10A 3R7IA 3CR0A 4EHGA 3AQVA 3OS3A 1OIRA 3E8CA 2VGPA 4BIDA 5M07A 3VVHA 3KU2A 4K6ZA 3KRWA 3GCQA 4NFNA 4K0YA 3FKLA 5ANIA 3RZBA 4JLCA 4H3QA 5HE2A 5IUGA 3F2AA 2VNYA 4JX3A 5HICA 5IEXA 5HESA 4DLJA 5JFSA 4EORA 3K3JA 4O38A 2YIQA 4BTFA 2ITVA 3OEZA 4DAWA 4AZWA 3BIZA 3UO5A 4RIYB 3IQ7A 4J53A 3OWKA 1G8AA 3LVPA 3TZ9A 1RQQA 4IVBA 2Z8CA 3TACA 4O22A 5C8MA 4LFIA 3VHEA 3TTJA 1YQJA 3F2NA 3TWJA 4JJRA 4Z3VA 4CRSA 2GTNA 3TM0A 4QP7A 3FSKA 3P9JA 5HE1A 3R7YA 2WIHA 4RC2A 3V04A 4PDOA 1Q97A 2W99B 2YM8A 5J79A 4TN6A 1NY3A 5HCZA 4D2TA 3R8LA 4WUAA 4F6WA 2A4LA 5CENA 4PTCA 4NWMA 3SW4A 2PSQA 1BX6A 4QMPA 1Q4LA 2QO7A 2VTNA 3H30A 4KAOA 3V5QA 5BYYA 2ONLC 4FIHA 4JS8A 5CSHA 5FM2A 4F64A 4EJ7A 2BR1A 3VAPA 5CVHA 5DE2A 3QAME 4DGNA 2QO2A 3VS4A 3ODYX 4TNBA 4B9DA 4HVSA 4RFMA 3RVGA 4G3EA 4FUYA 1JSVA 3GC0A 2WQNA 1H26A 4HZRA 3PXZA 4GUEA 3GC8A 1YOJA 2R3JA 2LAVA 5M4CA 2GFSA 2WTDA 4AOJA 5J9YA 4PTGA 3SD0A 5K9IA 4FZFB 4WBBB 1OVEA 2JC6A 5L2WA 4LQMA 5IDPA 3CQEA 4F7JA 1YVJA 2QU5A 4YZBA 4C0TA 5KHWA 2BAKA 2VTAA 1URCA 3BI6A 5HO6A 3HL7A 5AM7A 3QLFA 3GU8A 3NIEA 4O2ZA 4PY1A 4FVQA 4QD6A 5IH6A 4D1ZA 3GB2A 3KCFA 2XKCA 3KB7A 3DXPA 3I6UA 2BTSA 5CY3A 5A46A 4WNKA 4FE2A 1Y8YA 1JSTA 3V5WA 3UIUA 1UWHA 5DRDA 5E7RA 1LUFA 5ETCA 4ALVA 4K9YA 2EU9A 2WO6A 4I4FA 4DCAA 3PXKA 3EKNA 3HMMA 3KQ7A 1LEWA 4KIKB 4RQKA 5FXRA 4RJ8A 4E1ZA 3WZKA 3WIKA 2GSFA 1AD5A 2RKUA 2WOTA 4PX6A 3PSCA 4WIHA 3P08A 2P33A 2C4GA 4BTJA 4DGMA 2JEDA 3ZFYA 4YR8A 5J9LA 5H8GA 3QQLA 1ZYLA 4MEDA 3R8UA 1X8BA 2PYWA 1MQBA 3WF5A 4RIWB 2PMLX 3EN4A 3FZOA 3F5UA 2P3GX 1IR3A 3PXFA 4U40A 2Y7JA 2WMUA 4PMMA 5FP6A 2WTVA 5G6VA 4EK5A 4QMQA 1IA9A 2OSCA 2UZLA 4IIRA 5H8EA 4BIBA 2HYYA 1Z57A 5LMKC 3A2CA 3RGFA 4JT3A 2BIYA 2UZTA 3Q3BA 3RK7A 2YJSA 2YA9A 3ZLXA 4QO9A 5CNNA 3S00A 5KMNA 4BR3A 1DM2A 3KGAA 3V5TA 2BFXA 2QNJA 4M66A 5HOAA 4JX7A 4FKUA 5DA3A 5IQHA 3PWYA 4DE4A 1XH8A 3U9CA 1WFCA 4AW0A 4RRVA 1ZYJA 3BHVA 2WAJA 3I79A 2UW7A 1IRKA 3KKVA 3C51A 5HBEA 3UGCA 2CHLA 4XOYA 3K54A 3RMFA 3R8ZA 5FEEA 3DFAA 1LPUA 4FV5A 3ET7A 4L3JA 3GQIA 4ZJIA 3AD6A 5I9UA 5J7BA 4BTMA 4GG7A 4LM5A 4MXCA 2BKZA 4QP8A 4Y95A 4CEGA 1PMVA 4YJUA 4DH3A 2GDOA 4DLIA 4DH7A 3QD4A 2JFMA 5K5NA 1CKJA 4QYYA 2BZKB 2PVKA 3G51A 3H0ZA 4O0WA 4DEHA 4I92A 4QMSA 2OJGA 1BLXA 3COHA 3QZFA 2P2IA 2W05A 4YJVA 2V22A 3R7UA 5KO1A 3TL8A 3LJ2A 3CTQA 5EH0A 2WD1A 4OTDA 4OAVB 4TL0A 1H8FA 3W2SA 3ZC5A 1YXVA 5TO8A 4UMRA 1FGKA 5FEDA 4ZTSA 4CZTA 3MFRA 1M17A 3NPCA 4FL3A 2Q83A 4X21A 4YJPA 1NVSA 2P4IA 2CKEA 2W1HA 2REIA 2UW4A 3PTGA 3PIZA 3SRVA 3NNXA 4BBMA 4U6RA 4PP7A 2RG6A 3R9HA 3ZEPA 4CNHA 1R3CA 5HX8A 3ORXA 5CI7A 4KIPA 5HTIA 4AZFA 2YM4A 2YISA 2W9FB 3TKUA 2HW6A 4E4LA 4UMUA 1UU7A 2QLUA 2GHGA 3ZRMA 2Z7QA 4BHNA 3II5A 5CSWA 5IQEA 3AC8A 1XHAA 2VTQA 2BZHB 3GC9A 1SM2A 5AR3A 4O1PA 5EYDA 2J4ZA 4TPTA 3W2CA 1YDSE 2QO9A 4EOQA 4JG8A 5BYZA 2HZNA 3I7CA 3RCJA 4ASZA 4PMPA 4QQTA 1JOWB 3NUYA 1QPDA 3Q9WA 5AR8A 5EYMA 5BVEA 2ITXA 2WNTA 3DZQA 3SXRA 4C2WA 3CJFA 2IZUA 4CFFA 5ANGA 2GQRA 2DS1A 4X3FC 4JXFA 1OGUA 4YHTA 4LUEA 2UW3A 1Q8ZA 4FR4A 3UIXA 4MF1A 3RWPA 2VWVA 1YRPA 5KMJA 2CNUA 2XS0A 4M8TA 4HNFA 3U55A 5CF5A 3KL8A 4OTIA 1YI6A 1YDTE 5E8XA 2JGZA 4L42A 1DS5A 5KHXA 4ZMEA 4K1BA 3M1SA 1UNGA 3FMJA 1YDRE 5CAOA 3UPZA 2UV2A 4QNYA 2VTSA 3HA6A 3QQGA 5E9EA 3HMNA 3WF7A 4C4HA 1BI7A 2DYLA 4XLIA 2VTIA 2WQEA 4BVUA 3QD0A 3D5WA 4C3RA 4IWOA 4O83A 2YCRA 4FTUA 3ZEWA 4F1MA 4CVAA 4X3FB 2X2MA 4O6EA 3R63A 3HV4A 2R7IA 3FMLA 3H3CA 4FNYA 4GSBA 5HI2A 5A4LA 4KB8A 4NW5A 5J5SA 3JY9A 1B38A 3GQLA 3D5UA 4C02A 2BPMA 4BKJA 2A27A 4H1JA 4YZCA 5DRBA 3FL4A 2PUPA 3IOKA 4FGBA 3QXPA 4QYHA 3FC2A 2EXEA 3BZ3A 3FUPA 3L9LA 4GL9A 4M13A 3MPAA 5HIDA 3MH1A 4EOJA 1OITA 4BCJA 5EW3A 1JVPP 2OJ9A 2XNGA 4IWPA 3TT0A 4F9BA 4CZYB 4X2KA 1JQHA 5EM5A 3PVUA 4RZVA 3W2PA 2FSMX 4I5MA 2YN8A 2CKOA 1OL2A 3HP5A 4ZY5A 2PL0A 4IZ5A 5HO8A 4FEUA 4XV1A 4J8MA 3ZBXA 3W1FA 4FZAB 5CU3A 4IVAA 4AWIA 3QTWA 3U6IA 3O7LD 3HLLA 4OBPA 3D94A 3R2BA 5CQWA 3S0OA 4AZEA 4WSYA 3EZVA 3QGWA 3VF8A 4C4IA 2B9IA 3BHYA 1KOBA 4WBOA 3QCQA 3D2KA 3R00A 2OBJA 1ZMWA 3BE2A 3F88A 3QA8A 4O91A 4PTEA 4R1YA 3ZXZA 4CYJA 3MPTA 4E5AX 2WMVA 2IVVA 3GT8A 2OIBA 1GJOA 4DHFA 4OTFA 4P5QA 3MIAA 3QX2A 4HCTA 3VUGA 4ZJJA 2ETMA 4AN2A 4G6LA 4KKEA 3WZEA 2R0IA 4QQJA 3H9OA 3D15A 3K5UA 5EKOA 3GFWA 3R83A 4EOMA 3CXWA 4XH6A 4MD7E 2HAKA 2BUJA 3KN5A 4G3CA 5M4IA 3QTRA 2O5KA 3FYKX 5H9BA 3ORIA 1A9UA 3KMUA 5J8IA 4HCVA 3LXNA 1J91A 3PYYA 3PY3A 2B4SB 3KULA 3WE4A 3R1SA 4JDHA 4ASDA 4D58A 3B2TA 2OIQA 4V0GA 4C62A 4F9WA 2HCKA 3OY1A 4U97A 4IB5A 3NYNA 4CFNA 1OL7A 2QVSE 2YDKA 4IVCA 2WKMA 4EH2A 5M4FA 4DN5A 4U43A 1XBCA 3MH0A 2CKPA 4L46A 1LP4A 3LFAA 4AXAA 1OIQA 4Z16A 5B2LA 2X7GA 5CF4A 2XK4A 3EH9A 2HY81 1YI3A 4MNEA 3UZRA 2CCHA 4FTCA 4BWXA 3WZDA 4DEAA 2PK9A 3ZBFA 2F57A 3QTSA 4KS7A 5IA2A 4FSMA 2PUIA 2OH0E 3NVMB 3A8XA 3P5KA 4I22A 2NRYA 3QQKA 2WTWA 2KTYA 3OT3A 5BVOA 2OFUA 4X2NA 5C8NA 4QTAA 3LCDA 3ZYAA 3Q96A 3TNIA 4AGDA 5IZFA 4TWPA 3NUSA 1RJBA 1Q3WA 4FI1A 3ZSHA 2W1GA 4FTAA 2BDFA 2QHMA 1PKGA 2I1MA 3I1AA 4ID7A 5A4CA 3CP9A 1R0PA 2VWXA 2G2IA 3UYTA 3CTHA 4ANMA 4XRJA 2XCHA 3QC4A 4BYIA 5DWRA 4IC7A 2R3QA 4EJNA 1ZAOA 4DFNA 4G6OA 1Q62A 5DR6A 4OUCA 4WNPA 1VYZA 2EWAA 5IDNA 1UA2A 1V0OA 4QPAA 2E9PA 2QR7A 2W5BA 5JT2A 3OROA 2X1NA 1TQPA 4MQ2A 2JKOA 2HW7A 3MTLA 3AMBA 3PRIA 4UYNA 1YHWA 2QOHA 3BLRA 3CD3A 3COMA 2G15A 3R28A 4PRJA 5FM3A 3W16A 3PY1A 2QONA 3W33A 4GCJA 5CEPA 1WBSA 2P2HA 2B54A 3BKBA 5CNOA 4B99A 2PWLA 5HBJA 4AW5A 5IMXA 3LXKA 4D0XA 2HELA 2KULA 4IANA 4JG7A 4AZTA 5F95A 5HE3A 4NJDA 4AA0A 4IEBA 3DA6A 3POZA 4GFOA 4Y83A 3RPRA 3Q9ZA 1JBPE 2BROA 2BRNA 3HP2A 4RFYA 4GJ2A 4BL1A 3E87A 3SQQA 2WU6A 3HAMA 2QCSA 2UUEA 5AR5A 4AUAA 2ZOQA 1MRUA 4XUFA 2ZVAA 3VIDA 4CCBA 5KMMA 1UVRA 2OXYA 3C4FA 1MRVA 2XEYA 5L6OA 1W7HA 4F65A 3ACKA 3LKMA 1IASA 5FBNC 5CVGA 1V0PA 2QODA 1FQ1B 3VBVA 5DEYA 1OL5A 1FBNA 5HGIA 3F82A 2R9SA 5AAGA 4FA2A 3T3UA 1P4OA 4RVKA 3FHRA 1YW2A 3DBDA 4HVHA 5IQBA 4FIGA 5ETAA 4FIFA 5ACBC 4ZZNA 5IA5A 4EHEA 4WG4A 4NKSA 1A06A 2C0IA 2VX0A 4MBJA 4L45A 2C5NA 3F3UA 3UNJA 4JBPA 4O0XA 4PUZA 5A54A 4U8ZA 3VW6A 1GNGA 5M4UA 3D4QA 4D55A 4NCTC 1YWVA 3BLHA 3OXTA 3QTXA 1S9IA 2B1PA 2QOKA 2XK8A 3CE3A 2CGVA 2EB2A 4HYSA 4ZTRA 1URWA 2ZV2A 3OUNB 2J0JA 1E1XA 3Q9YA 3W2QA 5JZNA 4XHKB 3BGZA 4R5YA 4EONA 4R1VA 3UIBA 4W8EA 5HKMA 3RAIA 3LQ8A 4GK3A 3HA8A 3FLZA 3LZBA 5AX3A 3R0TA 2W5AA 4JBVA 4XEYA 2C6OA 2XVDA 4GIHA 5EFQA 3L9NA 5GINE 3AMAA 1Q8UA 3P7AA 2VO6A 3FLYA 3MVMA 2PTKA 5BX0A 1ZLTA 5JRQA 3NUAA 3TKHA 3WIGA 3KCKA 4ENXA 3LQ3A 4CFVA 4H05A 2XZSA 2JLDA 4AS0A 4M0YA 4ZTNA 2V7AA 4XV3A 4JQ8A 3TZ8A 3ORKA 1OPLA 3UTOA 2FSOX 3PPKA 3R04A 3TUDA 4FYOA 3PDTA 3C0GA 3EFKA 3FAAA 4FV3A 4B7TA 4KRCA 5CXHA 3JVSA 1PRYA 1H27A 2Z7RA 3OWLA 4IAFA 4JQ7A 4QYFA 4L9IA 4EZ3A 2XYNA 2UZBA 5IA0A 3HMOA 4KKHA 4GIIA 3OWJA 4EH5A 5A3XA 3ATTA 3R7GA 3FMDA 1TQMA 4KIOA 5AJQA 3ZUVA 4AW2A 4BDFA 3SX9A 4EC9A 1F3MC 3EJ1A 3PSDA 2BRGA 4O82A 5AV0A 2GNLA 1FVTA 1SNUA 4MX9A 2FO0A 2Y6MA 4F4PA 3IDBA 2YAKA 2R0UA 4A9UA 2IZRA 4JIKA 2WMBA 5EM7A 1KE6A 3RAKA 4CG8A 3MIYA 4B4LA 4R77A 2E9VA 3HX4A 3MVHA 4XV9A 3N51A 3PP0A 2YM7A 4TYIA 2J2IB 3ORZA 2WTKC 3BU3A 3FWQA 3FMHA 3OG7A 5KMKA 5IUHA 3C0HA 5FBOA 2HWPA 2B9HA 4IZYA 5LVLA 4TT7A 5IH4A 2XRWA 5IQDA 3TI1A 3ZZEA 2R3OA 3V8SA 3DS6A 1Z5MA 3EB0A 3V3VA 4JNWA 4OAUC 1YWNA 1W84A 1Y8GA 4XRLA 3EN5A 4F9AA 3FJQE 4EH3A 3R8MA 2JIIA 5I3RA 5HQ0A 3FZ1A 2XM8A 3DGKA 3IW7A 2BIKB 4LOOA 4PQNA 5FRIA 4EWQA 4L3LA 4QMOA 3IW8A 3IDPA 1A48A 2PUNA 1R0EA 1KE7A 3D0EA 1OIUA 2ZB0A 3HDMA 2WTKB 3O8PA 3HRBA 2YDJA 3PWDA 5E1EA 5AUYA 3G33A 5K4IA 4E3CA 3NNUA 3R73A 4OBQA 2PZRA 3P86A 3ANRA 1GZNA 2JKMA 4KWPA 5EQPA 3B8RA 2O3PA 4CSVA 4G16A 2G01A 3AC1A 4ACCA 2BRHA 3AGLA 3C1XA 5BNJA 4BY9E 4AOTA 3DXQA 3HECA 2IW9A 2ITYA 2ZMCA 2OXDA 2WIPA 4UY9A 5C4KA 3MTFA 2XJ2A 3PJCA 5M06A 1NA7A 5K3YA 5LXMA 2JIVA 3MPMA 3R01A 3TUCA 1PXLA 2ITOA 3QRJA 4O7NA 4FL1A 4APCA 3BELA 1GAGA 1KUTA 1OMWA 3DV3A 3HNGA 4GV1A 3MDYA 4AT3A 4EHVA 3DAKA 5EDRA 1U5QA 3QL8A 4CCUA 4L68A 2X0GA 1OB3A 4FC0A 4KKGA 4XV2A 4YTHA 2YZLA 3F7ZA 3P78A 2ITWA 3MWUA 5EYKA 4O0VA 4RPVA 4UEUA 4GU6A 4E5BA 2GS6A 2JIUA 5E8YA 3BRBA 1PXIA 3ATSA 3MH3A 3KFAA 1PKDA 3DZOA 4QMVA 1YXUA 3NR9A 2C6KA 2B7AA 3JVRA 4RZWA 5HU3A 2ESMA 3R8VA 2J6MA 3KF4A 3DBCA 1YHSA 2F4JA 3Q4ZA 4LOQA 4NM5A 2C0OA 4YC3A 5KMLA 1Y6AA 2HENA 3QYWA 1J1CA 3BPRA 3DT1A 4UBAA 4BZDA 3FPMA 3CKWA 5TOZA 1XR1A 3NNVA 3DFCB 4DH8A 3ZFXA 2W5HA 3IGGA 4G3DA 1SVGA 3DBQA 1FVVA 3E93A 4EH9A 1GOLA 3PXRA 3VUHA 2I7QA 3E8DA 4EI4A 3GNIB 5AAFA 4AFEA 3GU6A 2HIWA 4MXOA 5IEYA 2JDOA 4ZTMA 5M44A 4LOPA 4IW0A 4R7IA 2GNIA 1ZOEA 4CFMA 1O6KA 4XMOA 1P5EA 3FSFA 5IA3A 3R9RA 1XKKA 3QLGA 3COIA 5EOBA 4JR3A 3ORPA 3OMVA 2VWIA 4EK6A 3DKFA 4I24A 4Z55A 3PXYA 4I6FA 4O7YA 3RPYA 5CANA 4D9UA 5EDPA 4BDCA 4BRXA 2W4KA 4IJPA 4EH4A 3VBYA 5CEMA 1JWHA 4LRMA 3DKCA 4ZJVA 3A4PA 4X0MA 3ENMA 3MVLA 3O7LB 3GOPA 4I1ZA 4PMSA 4ORKA 4E4XA 4FKWA 1GZOA 1EH4A 1H1RA 1PXMA 3RALA 3ZSGA 2ACXA 2A1AB 4L00A 5LMBA 3Q6WA 2GNJA 4CV8A 4N57A 3TZ7A 2V62A 3SW7A 2HOGA 3EQDA 3KC3A 5HORA 3DLZA 3EQHA 4FIJA 5A4TA 5I5ZA 5DT3A 3PVBA 3LAUA 2GS2A 4D2SA 4XBUA 5CU4A 5D1JA 2WMRA 2ZV8A 3R1QA 2GMXA 3IO7A 3WYXA 4FKRA 5I3OA 4Q5EA 3LMIA 3WE8A 4YNOA 5M09A 3NEWA 3G9NA 4GKHA 2PHKA 4IHPA 4IAYA 4GMYA 4YC8A 2WMAA 3VS2A 3MH2A 4X7QA 4F99A 3DOGA 1VJYA 1UKHA 2C1AA 2H34A 3H0YA 3NW7A 3QCSA 3EHAA 4IAIA 2VTOA 4QPMA 4BGHA 4RX8A 4GFMA 4YHJA 4OTWA 3F3TA 2GCDA 2RFNA 1XJDA 2FGIA 2QR8A 3A8WA 5TE0A 3ULZA 4J71A 3O8UA 4YNEA 3PE1A 3ORLA 4BCPA 2RFDA 4JBQA 4ACDA 3D7TA 4CT2A 3KA0A 2CLXA 3LCSA 4IXPA 4UMTA 2V5QA 2WMXA 4BICA 5GJGA 3D7ZA 3QUDA 3RI1A 3VRYA 5T6KA 5TT7A 4XP0A 2W96B 5AR7A 2J90A 3QGYA 2WMSA 3C4ZA 2WTIA 4XG6A 4FTQA 4E6DA 1Q99A 5DR9A 5AV3A 4XOZA 3M42A 3SRVB 4FZ6A 4L52A 4ITHA 4DG2E 3HAVA 3C4WA 4YSMA 1KV2A 4D2VA 1CKPA 1YXXA 4YJNA 4BDJA 4C4GA 4EKLA 2PPQA 1PMNA 4L8MA 2EXMA 2C0TA 4I94A 3RCDA 3EN6A 4GRBA 3LFFA 4MVFA 4MH7A 4WHZA 5AAEA 5C27A 2PZPA 3MB7A 2HK5A 2C1BA 5LWMA 2BCJA 3PSBA 4II5A 4S33A 2YJRA 3ODZX 3PG3A 3SOAA 4PMTA 4C4JA 4OR5A 3P1AA 1NT2A 4ZY6A 5J87A 2JDVA 3F7WA 4Y5HA 3NGAA 3EKKA 3Q5IA 5JGAA 3TDWA 3ZHPC 3KY2A 5CU6A 3BU5A 3QRIA 4RX7A 3I60A 2JBPA 4YC6A 2J0KA 3CY2A 5HLPA 4K18A 4ASEA 4E4MA 4FIEA 4IZAA 4RWKA 2WGJA 5AP2A 3NVKI 2YIXA 1XO2B 4D4SA 4ASXA 5FWKK 1OECA 2BKKA 3Q4CA 3EQFA 4L3PA 3SA0A 3OWPA 4ZOGA 2J5EA 4EQMA 1FPUA 1M2RA 2BAJA 1JLUE 4JRNA 4TRLA 3ROYA 4C57A 4LUDA 4KUJA 5CWZA 3IG7A 4GH2A 4H3PA 1DI8A 5E8UA 2VAGA 3T9TA 4I3ZA 4TYHA 3ZCLA 4AG8A 4FEXA 2YCQA 1I44A 4FKGA 2Y9QA 3IW6A 3NX8A 2C5XA 2VN9A 4D2RA 4F63A 5A4QA 3TNWA 4U80A 2PVHA 1OKVA 4P90A 3R71A 5FGKA 4CLIA 2VX1A 5AP1A 4CZUA 4YBKA 4E73A 2R3LA 4FGRA 4V05A 2XJ1A 4Y5QA 5E91A 5HIBA 2X8IA 3G6HA 3V5JA 3W18A 3DBFA 4WRGA 4EHZA 3ZFMA 4RIYA 2IW8A 3COKA 3K5VA 5HX6A 1FVRA 1SYKA 1YXSA 4YGAA 5DLSA 2OZOA 4CKRA 4I5HA 4H3BA 2V7OA 4U7ZA 2Y0AA 1HOWA 3GU7A 2XNMA 2XCKA 3HVCA 3AXWA 3LCTA 3WZUA 4AF3A 2C6IA 3AG9A 4QP2A 4QP1A 3T8OA 3IW5A 3QWKA 3G15A 1F5QA 3LLTA 1IG1A 5K5XA 4YURA 3CJGA 3FZPA 3PFQA 4BGQA 3R2YA 1QPEA 3DNEA 4G17A 4MBLA 4PL5A 3SC1A 3VS6A 4F09A 3B8QA 5KBQA 4TY1A 2R3NA 1H1QA 1ZARA 3TIYA 3PRFA 4J95A 4J1RA 2XBJA 4RLLA 4L44A 4GVAA 4I5CA 5FTOA 1ZY5A 4JG6A 4CXAA 3JR1A 4EWHA 3QC9A 4AACA 4CQEA 3ZO4A 2X9FA 3BGPA 4IB1A 2WZJA 2RGPA 5BVFA 5DGZA 3A7FA 4BTKA 4MHAA 5ANDA 4DH5A 5CEKA 4KBAA 3HDNA 1M14A 4BIEA 2A19B 2BZIB 2VWBA 3FQEA 2W1DA 2GNHA 2UVXA 3OT8A 5E8WA 3WYYA 5AADA 3DXNA 4DFXE 4FKJA 4YHFA 4R3RA 4XJ0A 3O2MA 5HCYA 3MGYA 4ANBA 5L2SA 5AR2A 4ITIA 1STCE 4ZLZA 4AT5A 4FV7A 3SLSA 1OI9A 3TIZA 2BILB 4NL0A 3NCGA 2YEXA 4EZ7A 4FF8A 3KULB 3UG2A 3D83A 2XM9A 2VRXA 5K4JA 5M57A 3ZOSA 4KIKA 2VGOA 1IEPA 2IO6A 2Y4PA 2VWUA 5EKNA 5FUTA 2OG8A 4QMYA 3LOKA 4LG4A 4V0GB 3TV4A 2C6EA 5CVFA 3GU5A 3L8VA 1WCCA 3MJ2A 3P23A 3ZRKA 2X4ZA 3NUUA 3QRUA 1H1SA 3PE2A 5KUPA 3WF9A 4BKZA 2HXQA 4G9CA 4RBLA 5HVJA 4ZSEA 4RIWA 3UPXA 3WZJA 3VBTA 3FI8A 4MNEB 3BHTA 4DYMA 5DI1A 2WEVA 3MFSA 3OCSA 3VN9A 4IDTA 3R8PA 5JFWA 2G1TA 4FMQA 3ALNA 4MKCA 5CLPA 1CSNA 3PIYA 5CEIA 4RX5A 3L9MA 3LJ1A 4E4NA 4DBNA 3L8SA 4LL0A 4ZS4A 4BCGA 4ERWA 4IFCA 3FI2A 1W0XC 4EOOA 3AC3A 4IVDA 4QP6A 2O64A 4AN3A 3E8NA 2XEZA 2XYUA 3QRKA 3V8TA 4FOCA 3GP0A 4Z7HA 1H25A 4BDKA 3NNWA 4HW7A 1H1PA 3MA6A 4XP2A 5L6PA 4DTBA 4BDBA 3AT4A 3GCPA 4USDA 4ZK5A 3LLAA 1XH4A 2OU7A 4ZXTA 5KE0A 5GZ8A 5CT7A 2CMWA 2YITA 3I0QA 2C6DA 2JITA 3HKOA 4O6LA 5HCXA 4CFUA 5I4NA 4DGGA 4EH8A 2B9FA 4HNIA 3H9RA 2J50A 3OCBA 4EQCA 5CASA 4R7BA 2CKQA 3IDCA 3EYGA 4FSTA 3MBLA 2W9ZB 4HGSA 4J96A 2CDZA 5J9ZA 2O0UA 3GEQA 2O65A 2B52A 3RNIA 4J99A 3WF8A 5IA4A 3RZFA 3DNDA 4ZTQA 4F9YA 3CGFA 3BEGA 2E9OA 3NCZA 3SHEA 3D5VA 1SZMA 4CT1A 4PF4A 4ZY4A 5HNGA 1QPCA 3O23A 5JQ8A 5BUEA 1VEBA 2YM5A 3AC2A 3NDMA 4A4XA 1OUYA 3R02A 3N4VA 3FBVA 2I6LA 1WBVA 2BFYA 4EC8A 5J1WA 3C50A 4TWNA 3QCYA 3HV7A 5CS6A 5L8LA 2XUUA 4I41A 4E7WA 4BCKA 3LPBA 1APME 2RFEA 4O84A 1JKLA 1PMEA 3PUPA 3L8PA 3QWJA 4U3ZA 2I0HA 3BWFA 3WF6A 2ZAZA 5F20A 3EOCA 3R7OA 2VTRA 4O7TA 3LFEA 5IF1A 2QOOA 2JD5A 2PZIA 2VTLA 2HZ0A 4EKKA 1PXJA 3FMNA 3LMHA 2FUMA 2XK7A 2WXVA 5EI6A 2UVZA 3NAYA 4IB0A 4AN9A 3QQHA 4CMOA 4E6AA 4MNFA 4QRCA 3FQHA 3SAYA 4JOAA 4B0GA 3F2RA 3GBZA 4I93A 3DTCA 5HG5A 4H39A 3ZLSA 1K2PA 3MA3A 2AC5A 5HEZA 4UALA 4O7RA 1R39A 1ZZLA 2F7XE 1XQZA 2V0DA 4KBCA 4XBRA 3EZRA 2H6DA 1NVRA 2R3IA 1OL6A 1UU8A 3CBLA 3BYMA 3ZDIA 4ANLA 4DT9A 3QTIA 4JDJA 2WTJA 4EK3A 2BTRA 4BDGA 5HVYA 3W55A 5ETIA 3ZUUA 2W1EA 4PDYA 1TQIA 1H4LA 4FL2A 5EM8A 5EW8A 4AE6A 4F7LA 3UVRA 5B2KA 2YM3A 4KSPA 5DBXA 3WOWA 2ZDUA 4O86A 4QMXA 4XG9A 3ZH8A 3EFJA 4WSQA 1J7IA 5K0KA 1V0BA 4C58A 3A62A 3C4XA 5EHOA 4EEVA 5AMNA 4GT3A 2XNOA 4HVIA 3SG9A 2XJ0A 2PMIA 4ACHA 3OCTA 3B2WA 3Q6UA 3QD3A 5ANEA 4CG9A 2E9NA 2VO7A 3QHRA 2I0YA 5AR4A 3QTZA 2QOLA 4F7NA 2PY3A 5FTGA 3DTWA 1M7NA 3LFSA 4LL5A 2QOIA 4RC4A 1KV1A 4K77A 3G6GA 4HYHA 1UWJA 4RIXB 3UOKA 3IK3A 3N9XA 4QPSA 2YIRA 4TXCA 4G9RA 4JAJA 2WU7A 3FMEA 1ZYCA 4D0WA 3R6XA 4K11A 3OTVA 1U59A 4HJOA 4BGGA 3U8WA 4CKIA 4E93A 1JKSA 4FV1A 3VUDA 4MXXA 4YTFA 2WQOA 3QFVA 2OH4A 4FZ7A 5KMOA 4IM3A 3IECA 3MV5A 3TCPA 3UO4A 4O0UA 5BUJA 4M68A 5LVNA 2F2CB 2FSTX 2RIOA 2WTCA 1YOMA 4ZSLA 4AAAA 4XG3A 4FX3A 5HG7A 2X4FA 2UZWE 1WMKA 4I6QA 4IZ7A 2HXLA 3AD5A 1PXOA 4U42A 4P5ZA 2OICA 5BMSA 3RHKA 3VS5A 4WO5A 4R5SA 3NW5A 4FODA 4YO6A 3F5GA 4RQVA 4IJ9A 5ACKA 3FE3A 5EDQA 2C6MA 1BI8A 3P79A 4UWYA 2ZB1A 3FZSA 2ERZE 2DWBA 3OVVA 4AGWA 2PVYA 3KMMA 1QPJA 3BE9A 3CC6A 3ROCA 1Q61A 1U54B 3ZO3A 3IS5A 2FVDA 3UIMA 2J9MA 2ZM4A 3RM7A 5HHWA 3ORTA 4YZNA 5AP7A 4LI5A 5L2IA 3MY5A 2R3HA 5GZ9A 5DNRA 2JAVA 2XBAA 4J8NA 3UC4A 3C4CA 4KA3A 1Y57A 2Z7SA 5A6NA 3TV6A 5T68A 4WRSA 5EI8A 3BCEA 4DG0E 4JDKA 2FB8A 3UMXA 3UZPA 3PVWA 4J52A 4FBXA 4JIAA 3D5XA 3IONA 4KABA 4LV5A 4D4VA 4X2GA 3P0MA 3U4WA 4A4LA 4YJSA 2Z60A 3CKXA 4DFBA 1ERKA 1MP8A 3G9LX 2VV9A 3PXQA 3UE4A 2HZ4A 1REJA 1U4DA 4I5PA 4PP9A 5TR6A 3NRMA 4BCQA 3CD8A 5J5TA 3VNTA 3MYGA 3U4UA 1XWSA 4IMYA 2ITZA 4HGLA 4U79A 1J7LA 4IH8A 4AE9A 3Q52A 4M15A 5FEQA 1H00A 4J7BA 1T45A 4BBEA 3EQCA 3CS9A 5D7VA 4D2WA 5IQGA 1PF8A 2X6DA 4A07A
chains in the Genus database with same CATH superfamily
1FMOE 2I40A 1KSWA 3CIKA 3DK3A 1H0VA 3ZO1A 2CCIA 4CFWA 3GXLA 4GUBA 3EQBA 2QLQA 4YPSA 2ETRA 2RF9A 2C47A 1SNXA 3I81A 4O4FA 4TWOA 5DMZA 3VQUA 4A9SA 4ZSAA 3K2LA 4DFUA 3DJ6A 4M84A 4O7VA 3OUKA 5HIEA 5IUIA 5I9XA 3ZO2A 5LJJA 5AV4A 3ORNA 4C59A 1Q41A 4HYUA 4JQEA 1AGWA 4BB4A 1YKRA 4RWIA 2C5OA 4W4YA 2UZNA 4D5HA 5CEQA 5KKRC 2W4OA 5CALA 3NWWA 5KNJA 1SVHA 1YI4A 4FT0A 4FT7A 2OJJA 2WMTA 4XP3A 1REKA 4YSJA 3SGCA 4BN1A 1UU9A 5IG1A 2ZV7A 4EYJA 3CSVA 3KXXA 4IQ6A 2W17A 5M56A 3IPHA 2WOUA 3LQ5A 4DEEA 4W4VA 3QKLA 5IISA 4R3CA 3N4UA 4B8LA 3OZ6A 2OZAB 1W2DA 3O71A 4GK2A 2XB7A 3F6XA 1K9AA 3TUBA 4U9AA 5BVDA 5EQYA 1XH9A 3UODA 5JN2A 4ANSA 3EMGA 5DN3A 4BI2A 4DTKA 3UNZA 4MWHA 3POOA 4AQCA 2F49A 1GIHA 3Q04A 3W0MA 2YACA 3BYSA 5CEOA 1ZYSA 3PA3A 3FEGA 5AUVA 4E26A 1ZY4A 3LFDA 4KD1A 3KK8A 1G5SA 4FNWA 3G0FA 4S31A 5JFXA 4L6QA 2GNGA 3DQWA 3EL7A 3PLSA 4GYIA 3ZLYA 3MS9A 4FV0A 4EH7A 4DBXA 3ERKA 5CF6A 3LM5A 5JZJA 1J7UA 5DH3A 2OK1A 3UOJA 4IC8A 2J51A 1OUKA 1VZOA 3FYJX 5FQDC 4IAKA 3TV7A 4NZWB 5FG8A 3U51A 3TG1A 2GQSA 1GIJA 3DDPA 4RMZA 1U5RA 1OIYA 3QD2B 3KN6A 4FG7A 4IACA 3R9DA 4XG2A 4MF0A 4FSNA 3NUNA 3R9NA 2GTMA 4BF2A 4M67A 4YU2A 3RINA 3FLSA 5BQ0A 3Q2JA 4BCIA 4NM3A 5BPYA 2XRUA 3TJDA 1U46A 4IFGA 5HU9A 5DG5A 2P0CA 4M12A 3U9NA 4ITJA 2C5VA 5FTQA 5C03A 3LE6A 4ZLOA 5KX8A 2AUHA 3UJGA 2WQMA 4GYGA 1OPKA 2C30A 2R3GA 2R3FA 3OCGA 4FSUA 1H01A 2QURA 4C38A 4MXAA 3C5IA 2YCFA 2BALA 5F4NA 3VS3A 2OO8X 4FKVA 4V01A 3VUTA 5CZIA 3KIOC 4UV0A 2Z2WA 5AUXA 5DT0A 4ACGA 4CV9A 1W98A 4EOKA 5DHJA 4PPCA 4NEUA 4O0TA 3RP9A 4U0IA 4AZSA 5CYIA 3FC1X 4BDAA 3E62A 3SXFA 2ZJWA 3BV2A 5AUZA 3V51A 4DH1A 3QZGA 3T9IA 4S2ZA 2OIDA 4D2PA 4O4CA 2Y8OA 4UYAA 4TW9A 5HD4A 4F1TA 3W0NA 3KXHA 4RC3A 5AP5A 2JDSA 3IGOA 4F7SA 4M69A 3QZHA 1V1KA 4PPAA 5FDPA 4D4RA 2VD5A 2XMYA 2YLFA 3MI9A 4Z9LA 3ZS5A 5AFVA 5AP6A 4HYIA 4X6QC 3E92A 3GFEA 3I0OA 4C3PA 2J0IA 3UDBA 2F7ZE 3TJCA 4IX4A 4FSYA 2XK3A 2ZV9A 3PVGA 3UOHA 5DEWA 2UW9A 2PUUA 4BHZA 5IQAA 4G5PA 4QP4A 4C4EA 4FSQA 4K33A 2W0JA 1OL1A 2ITTA 3CCNA 4NT4A 3HYHA 4U44A 3NS9A 4YJTA 1WBTA 4A9RA 4EUUA 2NP8A 1W83A 2IN6A 3CTJA 4OGRA 5KMIA 4DF3A 2RFSA 4IE9A 4WNOA 3BX5A 4OTRA 3MW1A 4M7IA 4QTBA 4A9TA 5GZAA 2A0CX 2X8DA 3CQUA 1RW8A 4F6SA 3TN8A 3AC5A 3QXOA 5HG9A 5M55A 4GU9A 5FXSA 5AUUA 4FKOA 4RJ3A 5CAQA 4FG9A 5IQIA 4LDTA 4H1MA 3LXPA 4XG7A 4FK3A 3RAWA 2WPAA 3MFTA 3LCKA 3NYOA 4MTAA 3OEFX 3E7OA 4FV2A 2J0MB 4BCNA 4A4OA 2QOCA 1FOTA 4CMTA 4U81A 4ZEGA 2X2LA 3I5NA 3A7IA 5KZ0A 4JDIA 1ZYDA 4W4WA 5DVRA 4C3FA 2GS7A 2RG5A 4FIIA 4J97A 4WG3A 4WNMA 1M7QA 4AZVA 5K0XA 5H8BA 3KXZA 3VBQA 3UO6A 5AV2A 3DY7A 4DEGA 2IZTA 4NIFA 4QQ5A 4EL9A 4QP3A 2JKKA 3QZIA 3QYZA 3O51A 2W4JA 3QKMA 4MXYA 2FSLX 1AQ1A 4TWCA 2A2AA 1E9HA 5LVPA 2CJMA 3C5UA 3UDTA 2R4BA 4Q9ZA 2Y4IC 4ANNA 3PUFC 1Z9XA 3RHXA 5M08A 2VUWA 3FI4A 3KVWA 3U6HA 4BWKA 3R1NA 4GEOA 3TXOA 4FSZA 4BZOA 2NPQA 4JRVA 3GU4A 4R78A 4DFZE 3FZRA 1T46A 4FYNA 3F5PA 5LVOA 4A7CA 4WKQA 1DI9A 4U3YA 5LMAA 4BC6A 1PXNA 4LGHA 2X81A 2QOQA 4M0ZA 3Q9XA 3FQSA 3FKOA 4LRJA 4AOIA 2X9EA 4C61A 3S1HA 5CI6A 3TZMA 1PY5A 4WT6A 4DT8A 5ANJA 4FKSA 4TNDA 3A60A 3DDQA 4TYEA 3PA4A 3UQGA 3KRJA 4YJRA 2RSVA 3MFUA 3LCOA 4U45A 3KRRA 2W1IA 3ZRLA 4HVGA 4YTCA 3D9VA 4TZRA 5AUTA 2X2KA 4RVLA 2Y4IB 4N6ZA 5IQCA 3W8LA 2C68A 3IKAA 4FKPA 4AFJA 4W8DA 4UWBA 5E1SA 4YLKA 5EM6A 4YP8A 3NYVA 3Q4TA 2R3PA 3EFLA 1JPAA 4Q9SA 3FZTA 1DAYA 1S9JA 2BDJA 2ETKA 4FUXA 5ANOA 5AP3A 4ZSGA 3TKIA 4HVDA 3BL9A 2ITPA 5C26A 3A4OX 4FKLA 4OTHA 4FTMA 5AX9A 5BUIA 2XKEA 3GI3A 4JAIA 5FD2A 2CSNA 1GIIA 4OTGA 3RPVA 4D1SA 4CGAA 1MQ4A 3GENA 3EN9A 4KRDA 3DK7A 4E5WA 2LGCA 3PPJA 4BCMA 2I0EA 4MWIA 2QD9A 4I4EA 4FEVA 4W9XA 5E8TA 3GOKA 1W8CA 3E3BX 5A6OA 5LCKA 3DU8A 3ACJA 4JR7A 4EBVA 3KRXA 3RWQA 4L43A 1PXPA 3SKCA 4C33A 5E8VA 4IWDA 2IJMA 3KEXA 4N4SA 4YPDA 5B0XA 3RAHA 4QTDA 4RSSA 4C37A 5EYCA 2QC6A 4RA5A 2J0LA 3AT3A 2R3RA 1PHKA 3OOMA 3CPBA 4HPTE 4F0GA 2CGXA 2PVRA 2VTMA 3HV3A 3EN7A 3ETAA 3MY0A 3QCXA 4DG3E 4BFMA 5CAPA 5M51A 2OKRA 3GC7A 4ZTHA 5G1XA 4PNKA 4P7EA 2JKQA 4O1OA 2VWWA 2UW5A 2UZOA 3OXZA 5IU2A 5CXZA 1CKIA 3OF0A 3BYVA 3ZM4A 4BJJB 2PE1A 3FLWA 3QRTA 5GIOE 2JAMA 4KNBA 3BL7A 1SVEA 3Q60A 2DQ7X 4D28A 4G1WA 3AD4A 4CQGA 4CD0A 3O50A 1F0QA 4K8AA 4RX9A 4XG8A 5T3QA 3VBWA 4AA4A 2Z7LA 3BU6A 5JGBA 2QKWB 2XNNA 3H4JA 3PJ1A 1NVQA 1OBGA 3A7JA 2UZVA 3QUPA 4FK6A 2CNVA 3SG8A 1L3RE 1XBBA 3W2RA 4C2VA 4S30A 3ZTXA 2JDTA 2YLEA 5KCVA 2J5FA 5I9ZA 5EQEA 1M2PA 2X8EA 4BDIA 4ALUA 4LV7A 4BYJA 4BBFA 2VTTA 3Q32A 4EK4A 1M52A 2GNFA 4E20A 4E6QA 4L53A 3ZZWA 3LHJA 5JEBA 4FTKA 2PULA 2W1CA 1B6CB 5KBRA 1WVYA 3ZSIA 1HCLA 2CN5A 4JBOA 4YBJA 4GS6A 3JXWA 1OBDA 5GHVA 2AYPA 2B9JA 3HUCA 2PZYA 2C3LA 3VJNA 3BBTB 4RT7A 4ZS0A 1XH7A 3NUPA 2C69A 2UW8A 3CLYA 3FDNA 3M2WA 2OW3A 4C35A 3REPA 2R3KA 4JVGA 1GY3A 1PJKA 4ENYA 2VTJA 3RPOA 3VRZA 3QU0A 3E7VA 2OJIA 2Z02A 2ZMDA 3NLBA 5DPVA 4APPA 4I6BA 2CN8A 3CY3A 3PIXA 4FG8A 4FZDB 3F9NA 4CMUA 5D41A 2OJFE 4QMTA 3BYUA 1Q5KA 1WBOA 5AEPA 4AU8A 4Q5HA 4O81A 3NSZA 1P14A 5L4QA 2EUFB 2WHBA 3R7EA 3VW8A 4DITA 3UVQA 2YDIA 1Q3DA 4GG5A 5HLNA 2IVTA 4FV6A 4RG0A 4CTCA 4Y46A 4YZ9A 1BL7A 3D2IA 3A99A 3BBWA 3LFCA 4JI9A 3PY0A 4QMZA 3O5AA 2GHLA 4DC2A 4KSQA 4MCVA 5HTBA 4FVPA 4NM0A 3DB8A 4O0SA 3ULIA 4EUTA 3EIDA 3VUKA 5HE0A 3TYKA 3EYHA 5B7VA 2PVMA 3BHHA 4P4CA 4I6HA 4IWQA 2OGVA 4G2FA 4IX6A 4BZNA 3BHUA 4NH1A 1H08A 5JK3A 3H9FA 4R8QA 3LFQA 4RJ5A 4E8AA 4DTAA 4O21A 4ZLYA 4F08A 5C9CA 4C7TA 4E6CA 5CQUA 5LARA 1J1BA 2ONLA 4QQCA 1NXKA 5CSXA 2W7XA 4D5KA 1WBWA 1KE5A 4YZDA 1OKZA 3UP7A 2F2UA 3ANQA 5JKGA 2WQBA 5JRSA 3F5XA 2WEIA 4PL3A 1G3NA 3QHWA 3NAXA 4IB3A 1Y6BA 3AMYA 1Q8WA 3QUEA 4EH6A 4ZZMA 4BDHA 3QTUA 4KS8A 3JYAA 5HNBA 2XAOA 5FDXA 2OLCA 4DGOA 2WMQA 4L7FA 2IW6A 3NMUF 3RTPA 5F94A 4MD9E 4LGDA 4Q2AA 4ZTLA 5BVKA 3RBWA 4AGCA 2PVLA 3DK6A 4NTSA 2C3KA 3DLSA 5DYJA 1DAWA 2QKRA 4FTIA 1CM8A 5HVKA 1ND4A 2VO3A 3VO3A 3DBEA 4X6RA 1H0WA 4GW8A 1Q8YA 2XH5A 3S3IA 4BCHA 3V5PA 2G2HA 4N0SA 5E4HA 2XNEA 1IAHA 3EQRA 3QTQA 4GKIA 2UVYA 2GHMA 4O7SA 4XX9A 4QTCA 4XNEA 3HZTA 4TTHB 5E8ZA 2QG5A 5TKDA 2IG7A 4TYJA 4AGUA 5IA1A 3GCVA 3OBGA 5J1VA 4BKYA 4NTTA 4S34A 1JKKA 5TF9A 4QTEA 5HNIX 5L8JA 3UQCA 3Q2MA 3S95A 4LRKA 5D11A 4EOLA 3SVVA 4UX9A 1UV5A 2H8HA 3A7GA 4RFZA 1XMMA 5EHYA 4PV0A 2ITUA 2PE2A 3VQHA 4EYMA 3E5AA 4HPUE 4NKAA 4UN0C 5IH5A 5IPJA 5LQFA 2YWPA 4FT5A 3ML1A 1YOLA 3PG1A 4RWLA 4F0IA 4PDPA 5LMKA 3MB6A 2PMNX 2PVNA 2QOBA 3UQFA 3U54A 3E8EA 1RDQE 2IZSA 3DQXA 3P7CA 4HOKA 3L9PA 4DFLA 3NZ0A 4FTLA 3V8WA 3AGMA 3C9WA 3JPVA 2O2UA 3MSSA 3GUBA 3PJ8A 1TVOA 4FT9A 5FP5A 4X2JA 3S2PA 2W1FA 4F70A 4G6NA 3FV8A 4YLJA 1LR4A 1NW1A 3VBXA 3PP1A 4G34A 4GVJA 1YHVA 1PXKA 4OT6A 2Y6OA 4N6YA 2X7FA 4CYIA 4UXQA 4NSTA 4AX8A 1PW2A 4EBWA 3R30A 3I5ZA 4L67A 4MYGA 1CDKA 3QF9A 3FLQA 4DEBA 3P4KA 4LMUA 2C3IB 2ERKA 3RPSA 4MBIA 4IX5A 3RNYA 3UMWA 4RLKA 2B0QA 5KZIA 3OBJA 4D1XA 2IVUA 4ACMA 1OGYA 2DUVA 4DFYA 4O0YA 3HRFA 3JUHA 3GGFA 4XYFA 4QNAA 5M53A 4OLIA 5F9EA 4OTPA 4KINA 3T3VA 5HZNA 5LOHA 3L1SA 3OXIA 4O2PA 2XP2A 4FNXA 3HEGA 2BHHA 3DPKA 4C4FA 1ZZ2A 3HMPA 2WFYA 3KRLA 3O0GA 3OD6X 5D10A 2QI8A 3ALOA 4RVTA 3FL5A 3HRCA 5A14A 4Y85A 3OFMA 2R64A 3TNQB 5JFVA 2NRUA 3VC4A 3FXXA 5BYLA 4QYEA 2C6TA 2W1ZA 3E64A 4Y73A 3WBLA 5IEVA 5IMEA 1H28A 1H07A 4I23A 3TNPC 4KIQA 1H1WA 4IAZA 4FTNA 5E92A 1KWPA 2YIYA 2YZAA 3KXMA 4TYGA 3I6WA 4LGGA 3BLAA 5AV1A 3DAEA 2PVJA 3HGKA 1J3HA 4ONAA 2AEGA 1VR2A 1OZ1A 3U6JA 3TNHA 2GU8A 4FT3A 4NW6A 2FH9A 2QHNA 3QX4A 2C6LA 2R2PA 2YIWA 4C36A 5ICPA 4RGJA 4J98A 3EQIA 3IW4A 4DINA 4IAAA 2IPXA 4QMWA 2F9GA 4PWNA 1H24A 2VWZA 3TDVA 3QQJA 4I0TA 2XIKA 4QT1A 2YCSA 5D9HA 5L8KA 4X3FA 2O63A 3NIZA 2SRCA 4JL9A 3I4BA 5GIPE 2JBOA 4FRFA 4F78A 3MJ1A 2BAQA 4OTQA 3UP2A 2BZJA 4WUNA 4XG4A 4GT5A 3FI3A 4BI0A 4O0RA 2PU8A 1QL6A 1E1VA 2IWIA 3R21A 2V55A 5CSPA 4NU1A 3F3VA 3LW0A 5C4LA 4I20A 4K2RA 5CSVA 2WMWA 5AIRA 4RVMA 1JNKA 3UYSA 1ATPE 1ZWSA 1PYXA 4Y72A 3ZMMA 4B8MA 4ERKA 4EOIA 5ETFA 3RJCA 2OFVA 3VS0A 2XF0A 5HBHA 5CF8A 2HWOA 1P4FA 4OT5A 4QP9A 3V6RA 3VWAA 4NUSA 1QCFA 3QA0A 5D12A 4EOPA 4QMNA 5HTCA 2NO3A 4CRLA 2CGWA 1YXTA 3RK9A 4IM0A 2XIXA 1ZOHA 2H96A 2ZM3A 3RKBA 4USEA 4HCUA 5BVNA 3WARA 2QU6A 3F69A 3W8QA 3F3WA 5CU0A 1P2AA 2XIRA 4MK0A 2YAAA 4G3FA 3KMWA 1ST0A 4LMNA 4QDEA 2B53A 3PLAE 5EHLA 2YWVA 5LCJA 1BYGA 3VUIA 2CGUA 4FTOA 4I0SA 5CU2A 4DEIA 1RE8A 3VJOA 4CLJA 3ENHA 4FICA 3W32A 1R1WA 4FNZA 5LWNA 4V04A 3EFWA 4UZHA 5ANKA 3OW3A 3E3PA 3ZONA 4LYNA 2G9XA 1XBAA 4IADA 2F7EE 2VX3A 2R3MA 3KXNA 4RWJA 5D7AA 4BCFA 4HZSA 5IKWA 4O7LA 3THBA 2UZDA 3TTIA 2ZDTA 2FA2A 3DJ7A 4H58A 4UB7A 1BKXA 4F6UA 1MUOA 3VS7A 3VUMA 4O7WA 3EWHA 5I9YA 2JFLA 2PE0A 4FV4A 1Q8TA 2BDWA 4YLLA 5FXQA 3QBNA 5E8SA 1W82A 3CEKA 1K3AA 3BLQA 4WD5A 3RM6A 1WZYA 4ZMFA 4GFGA 4IBMA 3OTUA 4NJ3A 3VF9A 3VS1A 1L8TA 2NNWB 2G2FA 4EOSA 3F66A 2EXCX 4FSRA 5L2QA 4Y8DA 5IQFA 1HCKA 3MN3A 1JSUA 4YTIA 3BV3A 3MVJA 2YABA 3M11A 3PJ2A 5FLFA 3R9OA 3ORMA 3DB6A 3KREA 3V5LA 2OF2A 5DIAA 5CZHA 5HLWA 5AIKA 1UNHA 5J95A 3S4QA 3WILA 4FVRA 4X2FA 4U41A 4I21A 4ZSJA 3V01A 3EQPA 4D9TA 2C3JA 1OPJA 2PVFA 4C8BA 4FKQA 4OW8A 3AT2A 3UZTA 4S32A 5BVWA 2H9VA 2AC3A 3UG1A 4QMMA 3FPQA 3QQUA 3QQFA 1ZXEA 1ZMUA 3L8XA 1O6LA 4AA5A 4DGLC 2Q0BA 4G31A 5C1QB 2ITNA 4HGTA 4BDEA 4NM7A 5LVMA 5EW9A 3AOXA 3UBDA 4WA9A 5DOSA 3UOLA 3BGQA 1XH6A 3F61A 4M69B 4P2KA 4QMUA 2IVSA 3FXZA 3VULA 3FMMA 4O7ZA 1TKIA 2UZEA 3GVUA 4C34A 3Q53A 2W06A 2ZM1A 2OXXA 3DCVA 4RJ4A 2CPKE 5EK7A 5JGDA 3FY0A 3ZM9A 2VNWA 3OHTA 4MAOA 4B6LA 1I09A 4A9YA 4RIXA 4ARKA 3PPZA 4PPBA 5EG3A 5JSMA 2C5YA 2PMOX 2PZ5A 3GCUA 3LFBA 5CAVA 5HD7A 4X3JA 4F9CA 3FKNA 3I7BA 3PJ3A 2BMCA 5CX9A 1XH5A 2ZYBA 3QKKA 4FKTA 5L2TA 1Y91A 3GCSA 4W4XA 1WBNA 4ANQA 4M14A 4RA4A 1FMKA 3R7VA 3UVPA 3HV6A 3VHKA 4D4YA 1ZMVA 3LFNA 4GJ3A 4EQUA 4ZAUA 5AP0A 4H36A 2VTHA 3DAJA 3SXSA 5KKRB 5AM6A 5JQ5A 3C0IA 1WBPA 3EQGA 5JMSA 1Q24A 5A4EA 2X39A 2XKFA 3DKOA 4IM2A 4UMPA 3FXWA 3Q5ZA 1CTPE 2CNQA 5AWMA 2E9UA 5I0BA 4XLVA 3AKJA 4NYEA 4DCEA 2VU3A 5GJFA 5CT0A 2VWYA 3CQWA 4O96A 2XIZA 1KOAA 4CKJA 1SMHA 3ZDUA 1PYEA 1WVWA 2RL5A 4DA5A 2YHVA 3D14A 3FLNC 1WAKA 4YUQA 3AC4A 3LXLA 3U87A 4WOVA 4AT4A 5AA9A 1U54A 4NIFB 3MY1A 1ZOGA 3E63A 3NUXA 5CTPA 2OI4X 2XA4A 2XK9A 3A61A 3P7BA 3CPCA 3O96A 4IDVA 4MQ1A 4DEDA 4AXEA 5GNKA 1IA8A 2O8YA 2QOFA 5DR2A 2VZ6A 2XNBA 3G5DA 2HY0A 3LM0A 4HGEA 3F3ZA 1ZRZA 4FOBA 5L6WL 3SV0A 3OY3A 3KF7A 4FKIA 1OM1A 2VO0A 4ZP5A 1JAMA 5EOLA 4YMJA 3HV5A 3ITZA 5BMMA 2BRMA 1PMUA 3Q4UA 4UZDA 4UWCA 3N4TA 2UW6A 2EB3A 3BEAA 4AXFA 2GQGA 5AP4A 1UU3A 2UW0A 3OW4A 1UKIA 4PNIA 3ZUTA 2XKDA 4BCOA 3PZHA 5C8KA 5L3AA 4WG5A 2FYSA 3NYXA 4EZ5A 4FV9A 3BQRA 3R22A 3HMIA 3C7QA 1OKYA 2GPHA 2VTPA 4ALWA 3R1YA 3KVXA 1GZKA 4FTJA 2XNPA 2BVAA 2WB8A 2YFXA 2JDRA 4GT4A 4G3GA 4L7SA 4UMQA 4YJOA 3SOCA 4Z7GA 4RJ6A 4O27B 1BUHA 3OP5A 1G8SA 3BWJA 4FEWA 3NW6A 4USFA 1O9UA 3CGOA 3MESA 1MRYA 2J7TA 5I9VA 2E2BA 3LJ0A 2OWBA 4M3QA 5HG8A 3D7TB 4NCTA 4GK4A 4R6VA 2CLQA 3JY0A 4F0FA 1FGIA 2XIYA 4L01A 2P55A 3DKGA 3ID6C 4ZZOA 2EVAA 4MXZA 5J7HA 5B2MA 2YM6A 3W10A 5CAUA 1KE8A 4A06A 2IF8A 3BQCA 4MD8E 4NFMA 3O8TA 3ZXTA 4W9WA 2R5TA 4BDDA 2QG7A 4QMLA 1R78A 5JH6A 2Q0NA 3G90X 2I0VA 2ITQA 3KK9A 5DT4A 4AP7A 2HZIA 5H2UA 4ZIMA 3LMGA 3OC1A 1IAJA 1JKTA 3DJ5A 4R7HA 2X6EA 4OBOA 3FMKA 3KXGA 4FSWA 5EI2A 4EK8A 5GJDA 4YO4A 4R3PA 4FEQA 1B39A 4UXLA 4FTRA 2OZAA 3C4EA 5H3QA 5AUWA 2OF4A 5E90A 4BI1A 5AA8A 3C13A 3BYOA 3LIJA 3OOGA 3QALE 4FV8A 2XK6A 4IX3A 4N70A 1FINA 5F1ZA 3ZLWA 4ANOA 4CTBA 5A9UA 1YWRA 5I9WA 1VYWA 1KE9A 2BRBA 3SDJA 4QYGA 2UZUE 2WELA 1M2QA 1WVXA 1BMKA 1CMKE 4PDSA 4QEBA 2X7OA 4RJ7A 1O6YA 3UNKA 2R7BA 3FHIA 4M97A 2GFCA 3O17A 4QOXA 5HO7A 2BHEA 4I0RA 3UC3A 3PA5A 3K3IA 1BL6A 3IOPA 3ZC6A 4QDVA 4BWPA 3ZU7A 4XCUA 4YJQA 5DFPA 4AW1A 3A7HA 4G5JA 4XS2A 3ELJA 3JS2A 3RK5A 2X0OA 4LV8A 1UNLA 1OKWA 3V6SA 5ITAA 2B55A 4KBKA 3HUBA 4FTTA 3PZEA 3FY2A 4YZMA 3EL8A 5C01A 4F1OA 3NFGB 1LEZA 3G2FA 4PL4A 3G0EA 4TKSA 2YERA 4U5JA 3WI6A 4CFXA 1QMZA 1GZ8A 2QQ7A 3E88A 4RIOA 3TEIA 3W2OA 4NK9A 4TYHB 3H10A 3R7IA 3CR0A 4EHGA 3AQVA 3OS3A 1OIRA 3E8CA 2VGPA 4BIDA 5M07A 3VVHA 3KU2A 4K6ZA 3KRWA 3GCQA 4NFNA 4K0YA 3FKLA 5ANIA 3RZBA 4JLCA 3UDSA 4H3QA 5HE2A 5IUGA 3F2AA 2VNYA 4JX3A 5HICA 5IEXA 5HESA 4DLJA 5JFSA 4DHIB 4EORA 3K3JA 4O38A 2YIQA 4BTFA 2ITVA 3OEZA 4DAWA 4AZWA 3BIZA 3UO5A 4RIYB 3IQ7A 4J53A 3OWKA 1G8AA 1G8KA 3LVPA 3TZ9A 1RQQA 4IVBA 3W0SA 2Z8CA 3TACA 2X0QA 4O22A 5C8MA 4LFIA 3VHEA 3TTJA 1YQJA 3F2NA 3TWJA 4JJRA 4Z3VA 4CRSA 2GTNA 3TM0A 4QP7A 3FSKA 3P9JA 5HE1A 3R7YA 2WIHA 4RC2A 3V04A 4PDOA 1Q97A 2W99B 2YM8A 5J79A 4TN6A 1NY3A 5HCZA 4D2TA 4DHJA 3R8LA 4WUAA 4F6WA 2A4LA 5CENA 4PTCA 4NWMA 3SW4A 2PSQA 1BX6A 4QMPA 4JMQA 1Q4LA 2QO7A 2VTNA 3H30A 4KAOA 3V5QA 5BYYA 2ONLC 4FIHA 4JS8A 5CSHA 5FM2A 4F64A 4EJ7A 2BR1A 3VAPA 5CVHA 5DE2A 3QAME 4DGNA 2QO2A 3VS4A 3ODYX 4TNBA 4B9DA 4HVSA 4RFMA 3RVGA 4G3EA 3W0RA 4FUYA 1JSVA 3GC0A 2WQNA 1H26A 4HZRA 3PXZA 4GUEA 3GC8A 1YOJA 2R3JA 2LAVA 5M4CA 2GFSA 2WTDA 4AOJA 5J9YA 4PTGA 3SD0A 5K9IA 4FZFB 4WBBB 1OVEA 2JC6A 5L2WA 4LQMA 5IDPA 3CQEA 4F7JA 1YVJA 2QU5A 4YZBA 4C0TA 5KHWA 2BAKA 2VTAA 1URCA 3BI6A 5HO6A 3HL7A 5AM7A 3QLFA 2A98A 3GU8A 3NIEA 4O2ZA 4PY1A 4FVQA 4QD6A 5IH6A 4D1ZA 3GB2A 3KCFA 2XKCA 3KB7A 3DXPA 3I6UA 2BTSA 5CY3A 5A46A 4WNKA 4FE2A 1Y8YA 1JSTA 3V5WA 3UIUA 1UWHA 5DRDA 5E7RA 1LUFA 5ETCA 4ALVA 4K9YA 2XANA 2EU9A 2WO6A 4I4FA 4DCAA 3PXKA 3EKNA 3HMMA 3KQ7A 1LEWA 4KIKB 4RQKA 5FXRA 4RJ8A 4E1ZA 3WZKA 3WIKA 2GSFA 1AD5A 2RKUA 2WOTA 4PX6A 3PSCA 4WIHA 3P08A 2P33A 2C4GA 4BTJA 4DGMA 2JEDA 3ZFYA 4YR8A 5J9LA 3UDZA 5H8GA 3QQLA 1ZYLA 4MEDA 3R8UA 1X8BA 2PYWA 1MQBA 3WF5A 4RIWB 3W0PA 2PMLX 3EN4A 3FZOA 3F5UA 2P3GX 1IR3A 3PXFA 4U40A 2Y7JA 2WMUA 4PMMA 5FP6A 2WTVA 5G6VA 4EK5A 4QMQA 1IA9A 2OSCA 2UZLA 4IIRA 5H8EA 4BIBA 2HYYA 1Z57A 5LMKC 3A2CA 3RGFA 4JT3A 2BIYA 2UZTA 3Q3BA 3RK7A 2YJSA 2YA9A 3ZLXA 4QO9A 5CNNA 3S00A 5KMNA 4BR3A 1DM2A 3KGAA 3V5TA 2BFXA 2QNJA 4M66A 5HOAA 4JX7A 4FKUA 5DA3A 5IQHA 3P