4C37A

Pka-s6k1 chimera with compound 21a (cct196539) bound
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
338
structure length
335
Chain Sequence
ESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSYGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVLEYLPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Discovery of Potent Ribosomal S6 Kinase Inhibitors by High-Throughput Screening and Structure-Guided Drug Design.
pubmed rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
total genus 112
structure length 335
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c37A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c37A02
3CD8A 4ZIMA 1MRVA 4HVGA 2XK4A 4RG0A 2VNYA 2J7TA 3DXNA 4LUEA 4PL3A 4PMMA 5LVLA 3IGOA 2Z8CA 3GU4A 4M0YA 4ACDA 4BCFA 2CKPA 1W0XC 2XJ1A 1FMKA 2R3RA 3FXXA 4D2TA 1EH4A 1FPUA 3FI2A 3HZTA 3D83A 3IW4A 4NKSA 4OLIA 4FZFB 4YC6A 4AU8A 4HYHA 4PDYA 3TZ7A 2PE1A 2CNQA 1JQHA 4I23A 4QMNA 3QQJA 4ZMEA 4QO9A 3M1SA 1U5RA 3QWJA 1SYKA 3NX8A 4R7HA 5FD2A 2C6DA 2ACXA 3JVSA 4ZP5A 4C58A 2A4LA 2HOGA 3QA0A 1PXNA 4EL9A 2Y7JA 3W2PA 3MJ2A 3I0OA 1OL1A 3GXLA 3BBTB 3I5NA 5CT7A 5C4LA 4FKRA 5AUZA 4CFFA 4A9SA 5BVDA 4WNMA 2WMBA 3CD3A 5JH6A 2YAAA 4ZSAA 2V22A 4F99A 4FKTA 2Y8OA 2ZJWA 3BWJA 4FT5A 3RHXA 5EQPA 3NUSA 4L01A 3QHRA 2YJSA 3PSDA 5BYYA 2YISA 3MH3A 4GFMA 2BRHA 2PZYA 4U79A 2C47A 5KZ0A 5DA3A 3NRMA 4AZTA 3D14A 2ZB1A 3PG3A 4TTHB 2WMRA 1U54B 5K0XA 2REIA 3QLGA 3ENHA 1QCFA 3E7OA 2G01A 3F5PA 3MV5A 4FK6A 4QD6A 3BLHA 2R3OA 1G8AA 3MSSA 1YI6A 3K54A 3QL8A 4X3JA 4ALWA 4IX4A 3C0HA 4FKGA 2PK9A 4JX3A 2WU7A 4FGBA 1NA7A 2BIKB 3CY3A 4O6LA 4AXAA 3CTJA 3D5XA 4BWPA 5CAPA 4DF3A 1ZYCA 4EZ5A 2WTCA 4NUSA 5IA1A 1MRYA 4NM5A 2IW9A 4DT9A 4WG3A 3P4KA 5B7VA 2R3JA 5IQHA 2XCKA 4D9TA 4BDGA 4YJTA 2VWIA 3QQUA 4D5HA 5M07A 3GP0A 3LIJA 2PVFA 3E5AA 3SRVB 1PMVA 4TKSA 5GNKA 4BHZA 1UNLA 3KXGA 4JVGA 3S0OA 3JY9A 5DR6A 4YJUA 4BCKA 1IA8A 3KVXA 1GZ8A 2BTRA 4EOIA 3FLYA 3COMA 4L3PA 1M7QA 4EHGA 3DFCB 2FUMA 2W06A 3AC3A 3TZ8A 2F2CB 4H05A 3G9LX 1H1QA 5EI6A 3DAJA 4M12A 3AMYA 4WBOA 3R7YA 3V5PA 4D4YA 5LOHA 4LV8A 4G31A 4O7ZA 1KE5A 2VTMA 3Q04A 2PL0A 3S95A 4M14A 4NYEA 4L44A 5FM2A 3R7GA 5EQYA 2X7OA 3BELA 4DG0E 1DI9A 1UNHA 4UMUA 5JFSA 4CCBA 4E6CA 4R77A 3PLSA 2QOLA 2P55A 2QOCA 1XH9A 3CPBA 3FMEA 3OC1A 3LQ8A 4CQEA 5HG8A 4AA0A 2VTNA 5FTGA 2X2KA 2PVRA 4TYIA 1RQQA 4ALVA 4QNYA 4EBVA 4MF0A 4WG5A 4EC9A 3Q3BA 3SXFA 2P33A 2C4GA 3NSZA 3AT2A 2B9IA 3GEQA 5CTPA 3E8EA 4OW8A 4QP2A 2B1PA 2G2IA 3D7ZA 4IADA 4M69A 4EKKA 5HNGA 4GIIA 3GCQA 3ALNA 3R1SA 2X9EA 3WIKA 5JZJA 4BN1A 4FG7A 3UQFA 3HMOA 4E26A 4F0GA 3HP2A 4MHAA 2WIPA 3TJCA 2YLEA 3MN3A 3BYUA 4RSSA 2Z7QA 2OG8A 3BGQA 3FZSA 1XBCA 3QTQA 4IEBA 5G6VA 3QX2A 4MF1A 2VUWA 3QTWA 3UG2A 4E93A 3LFEA 5M06A 4RFYA 3OCTA 3UNJA 3OXIA 4FNYA 3R7VA 4S30A 4YO4A 5CZHA 4IHPA 4O6EA 3KN5A 4FV6A 5TR6A 3LFFA 3RK5A 5DN3A 5EH0A 4IZYA 4NIFA 4P2KA 4IB0A 1WBOA 4M68A 3KXMA 2C5YA 3V8WA 1DM2A 4BFMA 2LAVA 3R8ZA 5DR2A 3BPRA 3R7EA 3W33A 4NM0A 4EOPA 1Q61A 5CF8A 2EVAA 3WILA 2CCHA 3ACJA 2ZM4A 2V62A 4F1TA 5EW3A 3O2MA 4IC8A 1YWVA 3D0EA 4LRMA 1Q3DA 4YHTA 4LV5A 1YDRE 4OTPA 3BEGA 4DGGA 2XYNA 1PMUA 3EQPA 4NU1A 3PJ8A 2XIZA 3HEGA 4DFLA 3SV0A 2EU9A 2EXMA 4RIOA 3IONA 1PMNA 1BX6A 2NRYA 4TYEA 3C4WA 2W4JA 5DT3A 4ACMA 4AS0A 5DFPA 5C1QB 1O9UA 4S31A 3MS9A 2QKWB 3LFBA 4JDHA 3OWKA 4JIKA 4QMTA 2EWAA 4RJ6A 5J95A 4IZ7A 2XA4A 5BVKA 5D11A 1FBNA 4EHZA 2CPKE 2XJ2A 1ZOHA 2YEXA 3VBTA 3GFWA 4GT5A 4FV9A 3P79A 4FTJA 4MYGA 4B6LA 5ANKA 3UNKA 3MY5A 3IKAA 5A46A 3TJDA 5IEXA 3L9NA 3RNIA 5A9UA 3QRTA 3OW4A 1JPAA 2QOHA 1MP8A 1FQ1B 2X0GA 3HNGA 5AP2A 3F9NA 5CAOA 3EHAA 4YBJA 4IW0A 2BZIB 5BYLA 4BZNA 5JRQA 4U81A 5FWKK 3ZFYA 4BICA 2H96A 3ANRA 4WOVA 5J1WA 2BIYA 4YJPA 4YLLA 3ET7A 3NUPA 4BBEA 4ACCA 5GZAA 2H34A 3FSFA 3VHKA 2IVUA 2XEZA 3SOCA 2YITA 2UV2A 3FMDA 5HG9A 2X6EA 4CXAA 4NJDA 5FEQA 3R2BA 4RX8A 3FHIA 3ZO4A 5B2MA 3FMMA 4FVRA 4IM3A 3HKOA 3K5VA 5EM7A 4ANNA 2B53A 2VNWA 5F95A 4ORKA 3FHRA 3MESA 4G6OA 3COHA 5EDRA 1Z57A 3FI8A 3PVBA 4LL0A 2PE2A 2JAMA 3MH1A 4FSRA 4FVQA 3PJ3A 4QP1A 4H3QA 4WA9A 5FP6A 3R8MA 1UVRA 3UC4A 2HZ0A 3MH2A 2ZV9A 5FRIA 5CSVA 2AC5A 2OXXA 3C51A 3FXWA 3OWPA 3DPKA 4FZAB 5CSHA 4F7JA 4ZTMA 3FZ1A 5DMZA 5BMSA 3PSBA 3Q6WA 5FXRA 1UA2A 4DTAA 3EQHA 3ZO2A 2GSFA 3CBLA 3UOKA 4JRNA 2O63A 1M2QA 2XK9A 3QYZA 4AUAA 4D5KA 3ZUVA 1OGUA 3VF8A 3QUPA 5J79A 4IAZA 4BTKA 3NEWA 4RA4A 4UMPA 1H4LA 1W8CA 4WSQA 1LUFA 2ZDTA 2O8YA 5AP7A 3FZTA 4FL2A 3RAWA 2H9VA 4A9UA 4IX6A 1OUYA 4ZTQA 3ZEPA 2OXDA 5ITAA 3RP9A 3HUCA 4O7RA 5KZIA 1KE9A 1SZMA 4R8QA 1CKJA 4FIEA 3DDQA 3KRRA 3CP9A 1X8BA 4YC8A 4BDDA 4WSYA 4FEVA 4O0UA 3DZQA 4V05A 5H8GA 5HKMA 2HCKA 3DKOA 5K5NA 1Q3WA 2R0IA 4G3FA 1A9UA 5CF4A 1W82A 3RPOA 3LXPA 4UY9A 3HGKA 4YJVA 3EFLA 4L3JA 5A4QA 1XJDA 4QMSA 3HLLA 3Q53A 1AGWA 4NJ3A 4M69B 1KSWA 3KQ7A 1JKLA 5FP5A 2WGJA 3D9VA 3HDMA 1CDKA 4L43A 4K11A 4XCUA 2WB8A 4WT6A 3OUKA 4ASXA 4F09A 3VRZA 2YM6A 5F20A 1YVJA 5JRSA 4AN2A 4AT3A 4MXXA 3DXQA 2VTAA 4JDKA 4TYHA 3VS6A 4Y95A 1J1BA 3VUTA 3R00A 2EB3A 4DN5A 4C4EA 1P5EA 3BE2A 2BKKA 3GC0A 3LJ0A 4RLKA 3QCXA 2YWPA 4QRCA 4E5BA 1MRUA 3KXHA 4DFNA 3FLNC 5HBJA 4FT9A 4JNWA 2O65A 3AC1A 3BYSA 4GMYA 4TYJA 3UP2A 5EG3A 2BAQA 5EYKA 1U5QA 5FBOA 5AADA 2W5BA 2VN9A 3MWUA 3TI1A 1JVPP 2YERA 3AG9A 3R83A 2PVHA 3FYJX 2YAKA 3KMUA 4QYFA 4BGQA 4EH7A 4L00A 2WD1A 5JK3A 3LLAA 3WYYA 3CEKA 3DK3A 1W84A 5E1EA 2CN8A 2ITOA 3DK6A 4UB7A 5A6OA 4KWPA 3PY0A 2VWZA 2WO6A 4DEIA 3UODA 1FINA 2VWBA 4IAIA 4BI2A 4H3BA 5FM3A 4C2VA 4RIWB 3D5WA 4YSJA 3NW6A 1OBGA 2VWYA 2ITVA 3WE8A 5JMSA 4F0IA 2OH0E 4W8EA 3MVMA 4XG9A 3Q32A 2I0EA 3VUMA 1M14A 4QYEA 3UIXA 4HZRA 3VF9A 3QD0A 5EDPA 3U9CA 4WD5A 4FF8A 3OW3A 5GJFA 5FEDA 3H9RA 3BU3A 4HPUE 3ANQA 3EKNA 5EK7A 4EK4A 2BHHA 4RWKA 5ANEA 2OJFE 2XIXA 1Q8UA 1Q62A 3D94A 4EK8A 4YZBA 2O5KA 1Y57A 1OZ1A 2JBPA 3EN5A 4TW9A 5IDNA 5C8NA 1NT2A 3MYGA 3VAPA 4CMOA 4GU6A 3Q2JA 3II5A 3P7CA 3JYAA 4FIJA 5I9ZA 4KIKB 4QMWA 1XHAA 2W17A 5HNBA 5LARA 2QODA 3L8XA 3LCKA 2XJ0A 3R21A 4YZDA 5HVJA 3WIGA 2WZJA 2QU5A 4RWJA 4I3ZA 3R1NA 5AP0A 5IQGA 3GQIA 4PMPA 3EQCA 3JY0A 2PTKA 2WPAA 1Q97A 3PE2A 3E93A 4ZY6A 5J7HA 5EFQA 3PSCA 2QLUA 3NVMB 2IZSA 2ZVAA 2YIRA 3ITZA 3A7IA 4DYMA 3P5KA 3Q9YA 4IM2A 5D10A 2WTVA 5D41A 3QA8A 5KKRC 5IDPA 3UDBA 5CX9A 2I6LA 4N57A 5I9YA 3LOKA 1LEWA 1XWSA 3PYYA 4FNWA 3DJ6A 1BUHA 4IVBA 4PPBA 4KA3A 5L3AA 4FEXA 5CU6A 1BYGA 2XNNA 3BHHA 4E8AA 4YP8A 3TKUA 1IG1A 4NFNA 4O0WA 1H0VA 3U87A 3TXOA 1T45A 1Y6BA 3OZ6A 3ATSA 4UWYA 4E7WA 4ZLYA 2VWVA 5C26A 4HVSA 1UNGA 3SLSA 2RGPA 5D12A 3C0GA 4PTEA 3QKKA 4J97A 4F9YA 5KMKA 3DA6A 3DKFA 4DEDA 4CYJA 3NS9A 4FSMA 4CNHA 5JFXA 3LCOA 2PMLX 1JOWB 2BALA 2WMUA 3HV3A 5KMIA 3NCZA 2RKUA 1YI3A 3VS7A 3C5IA 3G6HA 3O51A 4J1RA 3E92A 4A9TA 3CLYA 1RDQE 4J71A 4QTDA 4YO6A 1GZOA 5LWMA 2NPQA 4O84A 1JAMA 3MH0A 3WZKA 1XBBA 2G1TA 5CSPA 4AAAA 3FL4A 2W4KA 2QKRA 3CJFA 1ERKA 4M7IA 3NIZA 4JBPA 2GMXA 2YM7A 3R7OA 4JG6A 4BHNA 4E20A 3R7UA 5IZFA 1JSVA 2YWVA 3EOCA 4OGRA 3A4OX 4TPTA 2FO0A 4E4XA 2ITZA 3VW8A 4ZZOA 2QOQA 4FTLA 2G2FA 4ACGA 5IKWA 3ORIA 3OS3A 4IZ5A 4H58A 1APME 2FH9A 3I6WA 4O96A 4YURA 4FTTA 4U6RA 4FIHA 3TZ9A 2Z60A 1CKPA 4DE4A 5E7RA 5IEVA 5M56A 5GINE 3BE9A 4O0VA 4ALUA 4FKPA 4RVKA 4FSZA 4J96A 4Z3VA 3CTHA 4GJ2A 3IW6A 5TT7A 2FSMX 3A7FA 3DJ5A 1XH5A 4DGLC 1UU9A 3HYHA 4ARKA 3PPKA 4BYJA 3NUAA 3QUEA 4LOOA 3SRVA 2OICA 2C6TA 3IOKA 4HGLA 3LQ5A 4KS8A 3R22A 2R9SA 3BCEA 3KF4A 4BCNA 4DGMA 2YDJA 4WRGA 5IQFA 5HIBA 2HWOA 5L6PA 4Z9LA 2RFNA 3NNUA 4OTWA 3FC2A 4RGJA 5JT2A 5CLPA 1FOTA 2VTLA 2PVYA 4DA5A 3KEXA 4DFZE 1J7LA 5GIOE 2YA9A 2C0TA 5LMKA 3GGFA 3ORMA 4O22A 2O0UA 3MDYA 4HVDA 4AN3A 2QONA 3O96A 1ATPE 3O7LD 4L45A 4DTKA 4F7LA 3BQCA 5EI2A 3UTOA 4JR7A 2XNGA 4RT7A 5K4IA 3MBLA 1BI8A 2XK8A 3L9LA 1OPKA 3RPRA 4I0TA 1WBTA 2WIHA 3IW5A 4FV3A 3UMWA 3THBA 3ZH8A 3TCPA 4ZMFA 2JIUA 4XRLA 5IUIA 1WMKA 5KMOA 4FL1A 2RFEA 2Z7RA 4R5YA 3QTIA 4ZSGA 5CF6A 1GIHA 2CJMA 3PIYA 3SAYA 4XBRA 3PP1A 5BUJA 4QMPA 3OOGA 4QMUA 1PHKA 1H08A 1UKHA 1YDSE 3F66A 4B9DA 3QYWA 3UQGA 3ORNA 3KK9A 3KRXA 4FTCA 3FMJA 2PPQA 5KKRB 2BMCA 4BY9E 3VUKA 2OZOA 4F9BA 2YN8A 1BLXA 4CCUA 2BILB 3FBVA 3GQLA 1IA9A 3AD4A 3RM7A 4HCVA 2C6IA 4M97A 1TQIA 3N51A 3TTIA 5AMNA 3NVKI 3TUBA 1UWJA 1IRKA 3MPMA 1ZOEA 3C0IA 1YKRA 3PJ2A 5AUTA 1WVWA 2BR1A 3C4CA 4Y73A 5KBRA 3KRJA 4B4LA 4E6AA 4MXYA 3OF0A 4I4FA 4TWCA 2J5FA 3ORZA 1U46A 5DLSA 4Y5HA 2ITQA 3RJCA 4FMQA 4FV7A 4R7IA 4QYHA 2C1BA 3LM0A 4FV0A 1PXOA 5LMAA 5ANIA 3EZRA 4OBQA 5KUPA 4U7ZA 5CENA 1ZY4A 4C36A 1QPCA 2J6MA 1H8FA 3QCSA 4KBAA 3VS1A 4EQUA 1Q5KA 4FTIA 2ETKA 1OL5A 3D4QA 4D28A 5CU2A 5BPYA 4BIBA 3KA0A 1M52A 2DYLA 2UZEA 3VBYA 3V5WA 4OBOA 5KE0A 5CQWA 5CU0A 5I9WA 2CNVA 4DAWA 4RBLA 2GFCA 4ANMA 5AM7A 3GOKA 3E64A 3P7AA 4EYJA 3RZFA 2VX0A 5DEYA 3VN9A 3ZUUA 2VTRA 5CZIA 2R3KA 3TNPC 3RTPA 4JOAA 4DH3A 3HRCA 3LFDA 4M66A 5EHOA 2VZ6A 3JS2A 4GVAA 4XRJA 3LXLA 5G1XA 3I79A 5LVNA 5M51A 4IWOA 3TM0A 4AZVA 4UYNA 5DGZA 2FSOX 4FSNA 2WQOA 3MIAA 4C3PA 3OCGA 4CRSA 5K4JA 3QZHA 2WQBA 3BYVA 2HYYA 5DG5A 3ZRMA 3ZZWA 3LLTA 3DZOA 4JQEA 3UMXA 1DI8A 1JSTA 3R9HA 3KULA 4YZCA 1SVEA 3F3TA 2V7AA 2QOOA 2YHVA 3NYOA 3QX4A 4FICA 1QPDA 4Y72A 4YJOA 4J52A 2I1MA 4O86A 4DCAA 2BAJA 2PVNA 3BU5A 4NM7A 4L46A 4MX9A 5HVYA 3T9IA 4A9RA 1YOJA 4G1WA 3VBXA 2BHEA 3I4BA 3KFAA 4FKQA 3ZONA 5M4CA 4E73A 4BIDA 1JWHA 3F7WA 2ZB0A 5HBHA 4GL9A 4U9AA 3WBLA 4MNFA 4CLIA 3PLAE 1H00A 3TDVA 5JFWA 3F5XA 4IDVA 5I9XA 4PPCA 3OWLA 4KSQA 2WMWA 4H36A 1WBSA 3KRWA 2X39A 5HO7A 4EI4A 4DTBA 2GHMA 4MXZA 4ZTRA 4CKJA 4J8NA 2AYPA 4LMUA 4P90A 3OT3A 5DYJA 3AD6A 4RVLA 2EXCX 2FGIA 2R7IA 2XBJA 4EORA 3M11A 4K9YA 2Y6OA 4AE6A 4ZSLA 3PJ1A 2XYUA 3LCDA 2NRUA 2NP8A 2P3GX 4PDSA 4WUAA 3WZEA 1O6KA 1SNUA 5EW9A 4FUXA 4ZS4A 3TKIA 2CKEA 4EONA 4JQ8A 4CG8A 4LRJA 4G5JA 2GNIA 3CE3A 3DS6A 3SA0A 3PG1A 2BUJA 1QMZA 1OPLA 1FVTA 5AP3A 4CV8A 1UU7A 4RX9A 3QQFA 4X2JA 3WF6A 5J9ZA 1YHSA 4KKEA 2QLQA 1P4FA 4XLIA 5JFVA 5T68A 5M4IA 1ZY5A 2H6DA 4OTRA 3S1HA 4ANBA 3EN7A 1KUTA 4HNIA 4D2WA 3HMPA 4MD7E 2YACA 5DOSA 3PIZA 3NNVA 4F70A 2OWBA 2JLDA 3VBVA 4R78A 4DGNA 4M67A 3AC5A 3O71A 4EH9A 4TT7A 4CG9A 2F49A 3CXWA 4W8DA 5L6OA 3GT8A 4AOIA 3AGLA 3PY1A 1OBDA 4IZAA 4RRVA 2LGCA 4YNEA 4YC3A 4FKOA 4I41A 4I22A 3OCSA 1MQBA 5IF1A 3Q4ZA 3QRJA 4I1ZA 4MD8E 1JKKA 4TYGA 3ULIA 3VIDA 5KX8A 4FKSA 3QD4A 2OFUA 3GU6A 5ETIA 3EIDA 2XM9A 3SG9A 4I5CA 4GYGA 1OB3A 4BB4A 4C3FA 1G8SA 2VO0A 2WOUA 3ZXTA 3FY2A 3RCJA 3DKGA 4PV0A 3NNWA 3VBQA 4FG8A 2UZWE 4K33A 4QQ5A 5CQUA 5IA3A 3HAMA 4O0TA 4AW1A 3KREA 4O82A 1PYEA 4FG9A 1Q24A 4AFJA 5L2TA 3S00A 2E9VA 1YWRA 4BKYA 4EWHA 2OO8X 2ZV7A 3R63A 5DBXA 3ZLXA 5DI1A 4EH4A 4I0SA 4BL1A 5JGDA 3SW4A 4IANA 2C6KA 3EB0A 3BGPA 2XZSA 2R3PA 5CAUA 3PWYA 3P7BA 2BDWA 3QTSA 3FMHA 1CTPE 4O7LA 1XQZA 5AJQA 4XJ0A 5E8TA 3MA6A 2B7AA 2E9PA 2RSVA 2BRBA 4HZSA 5H8EA 1IEPA 2E9OA 3MPAA 1UU3A 1PJKA 3N9XA 4F6UA 4H39A 4AGDA 3EFKA 3SG8A 3A62A 4U8ZA 5IH6A 2GNGA 1WZYA 1Z9XA 3CQUA 4XG2A 5AIRA 2CLXA 2P2HA 4F9AA 2QOBA 2WMTA 2IVSA 2ONLA 4ENYA 4D4VA 2OSCA 2W1HA 4X3FA 4JLCA 3R04A 4BCIA 1FVRA 5M4FA 3QLFA 1U4DA 2PVJA 3OEZA 4JIAA 4LUDA 4C4HA 2VWXA 2XUUA 2PMOX 4FUYA 1JNKA 2IJMA 4OBPA 3OTVA 3DBCA 5BVOA 5A6NA 2HWPA 3SKCA 3QWKA 5FEEA 3S4QA 3I6UA 3UVRA 4RFZA 1GY3A 3D5UA 4P5QA 3VS3A 4E4NA 4L6QA 2ZAZA 4ZXTA 2F7ZE 3VQUA 5HICA 2FB8A 2PVKA 3VS2A 4QTAA 2HXLA 3DLZA 3ORTA 3RHKA 2EB2A 3P0MA 2OXYA 4EUUA 5DHJA 3QC9A 2O64A 3VUHA 3AXWA 4F7SA 4OR5A 3T3UA 1B6CB 2Y4IC 1ZMUA 3COIA 2HXQA 2PHKA 2UVZA 3TTJA 4DH8A 3TL8A 2UW8A 3FLWA 2ZM3A 3QF9A 1A48A 4G16A 4WIHA 1W7HA 4C62A 1YHVA 2VRXA 3ZLSA 3NYVA 2R4BA 5FQDC 5H2UA 4FTAA 1VYWA 3G90X 5L2WA 4CTBA 1XH4A 3PXYA 4RA5A 5AUYA 1JLUE 2W99B 5T3QA 3TACA 4GT3A 3EMGA 4ANQA 2VTQA 1XH8A 5H3QA 4B0GA 4Q9ZA 2EXEA 1GIJA 4FKUA 3MJ1A 2OF4A 3GCSA 3JPVA 5ETFA 3KKVA 4A4XA 3HECA 3O8PA 5JGAA 1SNXA 3MFRA 5KHXA 5M44A 3ZHPC 5CSXA 3FI4A 4USFA 4XV2A 3LFNA 3ACKA 4BDCA 2J9MA 1G5SA 2XIKA 2PVMA 3DOGA 5DR9A 4KAOA 5A3XA 5AP6A 4AOJA 1H07A 3RAKA 1VEBA 3WF9A 3NUXA 3DFAA 4BBMA 3MI9A 2JDRA 2V0DA 1K3AA 3IS5A 2J51A 4II5A 2YCFA 4XBUA 4YJNA 5D7AA 3GC8A 3OROA 1GZNA 1B39A 3SVVA 3TNIA 4C4IA 3UOJA 3E8NA 4QP9A 4U42A 4JAIA 2XNBA 3S2PA 4JX7A 4FZ7A 2J5EA 5EM5A 1YXXA 1IASA 3LZBA 3OXTA 4GJ3A 4HCUA 5EDQA 3G9NA 4HOKA 4D0XA 4QOXA 2J0LA 4FC0A 5GZ9A 3KK8A 4L7FA 4JBVA 4CZTA 1S9JA 1H24A 4AW0A 2BVAA 3BRBA 1J91A 3PXKA 4L68A 4CVAA 2XMYA 3G5DA 2JD5A 4G2FA 4IMYA 3NUNA 4R3PA 5HIDA 5HE1A 5K9IA 3NIEA 3CR0A 1OI9A 5JKGA 1WVXA 3RZBA 2UW5A 3TNQB 3ZDIA 1PW2A 2Z7LA 4XV9A 4HGSA 3CTQA 4HGTA 1YW2A 4FYNA 3TWJA 3KMWA 5IH5A 4FBXA 2W1CA 2OGVA 4USDA 4AA5A 4BKJA 4YJQA 3C4ZA 3CQEA 5J87A 2B0QA 3OBGA 3B8RA 3TKHA 3LAUA 1PF8A 3K5UA 5E4HA 4RIYB 5HU3A 5BVEA 3SQQA 3ID6C 4ZZNA 5ANOA 2ESMA 2P0CA 3E8DA 2QCSA 2DQ7X 2EUFB 3IO7A 2GFSA 4IE9A 4LGDA 5EYDA 5TOZA 4QMVA 3FMKA 3ZYAA 5HU9A 5HTBA 4G5PA 3G15A 2V5QA 1GOLA 2VTSA 5IPJA 1SM2A 5JQ8A 3P86A 4G3CA 1OIRA 3PUPA 5AUXA 4A4OA 4BVUA 1J1CA 5E9EA 5IUGA 4MCVA 4D4RA 5AA8A 2XF0A 2JFMA 4FKVA 4X6QC 3DBEA 3GCUA 4QMLA 3VNTA 3T3VA 1BL6A 4AGWA 1KOAA 3A8XA 5C4KA 3G6GA 3FXZA 3IW7A 4XP2A 4XG6A 4GW8A 4CEGA 1M2RA 3HA6A 3H0ZA 1SVGA 2W9FB 3DQXA 3NUUA 2J0MB 4FK3A 2YIXA 4FKLA 4QQCA 4YLKA 5FG8A 3ZTXA 4I6HA 3R30A 5BVWA 2IG7A 2RIOA 4O0RA 5E8UA 5K0KA 2Y6MA 2A0CX 4W4YA 1O6LA 4UWCA 3MY0A 3REPA 1U59A 4FTMA 4K0YA 4I5HA 5CALA 1Q41A 3GVUA 5JGBA 3W16A 4IM0A 4YLJA 1LR4A 4E6DA 3LXKA 4G3DA 4RJ3A 3Q52A 2RG5A 4WBBB 2WTKB 3ORLA 5E8ZA 4OT6A 4RZVA 3WF5A 4NCTA 4DFYA 5EQEA 1Q8WA 2VTTA 4R1VA 4C35A 4JRVA 3DQWA 4YTIA 5BUIA 3QTRA 4FSYA 4I4EA 4PX6A 5LCKA 4RVMA 4FR4A 5AUUA 5LMBA 3QD2B 5L6WL 1RW8A 4PMSA 3F5UA 4ZEGA 2BZKB 4AT5A 4IX3A 4LMNA 3C13A 3C4FA 4FZDB 3AMBA 3KGAA 1KE7A 4R5SA 3QBNA 5F4NA 3R6XA 3VWAA 3EWHA 4AW5A 4OUCA 3HUBA 3UG1A 4JDJA 4TYHB 1H26A 1R78A 5L8KA 3TUCA 1PKDA 3ORKA 3Q4UA 3LFCA 3O8UA 4MWIA 4M84A 4RQVA 1OKWA 4R3CA 4EH6A 5AX3A 5E1SA 1ZXEA 1F0QA 4L67A 3QQKA 2XKDA 4JXFA 3MTFA 2X4FA 4LG4A 3V5TA 3UYTA 5J1VA 2R3NA 4EYMA 4MVFA 3NR9A 3VRYA 2IZRA 3UVQA 3LPBA 4NW6A 5BYZA 4NK9A 5FXQA 2OFVA 4MBLA 1YXTA 3LE6A 3KL8A 3TG1A 5CF5A 4JJRA 4KINA 2XB7A 4JG7A 4KRDA 2ZV2A 2XRUA 3TT0A 4AQCA 4BBFA 3RI1A 5J9LA 4C61A 1YXUA 3RMFA 3QUDA 4YR8A 3TNWA 3U6IA 4EOJA 3G2FA 1J3HA 4EH5A 1F3MC 4U0IA 3ZBXA 3QZIA 3OWJA 2WXVA 3BHTA 4NL0A 5AR8A 3DB6A 3U54A 4Y83A 3MFUA 4F9CA 4CZYB 2BZJA 2OKRA 3WF7A 2RF9A 3BLQA 3FLSA 3VJOA 2WAJA 3G0EA 3PA5A 4HYIA 3PFQA 2GHGA 2B54A 2OLCA 3O50A 4G9RA 2C3JA 3KB7A 3QGYA 4ZK5A 4MEDA 4O27B 3ZM9A 2QO9A 3OFMA 2CSNA 2YJRA 5FTQA 4BDJA 2UZLA 3ZSGA 2UW0A 2PULA 5E8XA 4CLJA 4AACA 3MIYA 4FV8A 2RG6A 5AV0A 3RPVA 2VO6A 3AC2A 4BZOA 4I6BA 4Z55A 2PU8A 4ANOA 3KU2A 2XS0A 4FOBA 3O7LB 4N0SA 2IW6A 5FBNC 4MXCA 5HGIA 2ONLC 4IX5A 4AZSA 5IQAA 4PY1A 2VX1A 2YDIA 3EKKA 2BFYA 1XO2B 3HMIA 4KIKA 5HG7A 3RCDA 3HV6A 1V0OA 4ITJA 3NDMA 4CT1A 2G2HA 3AT4A 3C9WA 4IJPA 4M8TA 3ZZEA 1J7IA 4DT8A 3E63A 4GUBA 4MBIA 3LJ2A 3RK7A 3ULZA 2W4OA 4WKQA 3I0QA 4FZ6A 4BC6A 2VV9A 4BDAA 3RWPA 3W18A 2ERZE 4YHFA 1PXMA 3C5UA 2BTSA 3DTWA 4BCJA 4IWQA 4IWPA 2PUIA 4G6LA 1KE6A 4G6NA 3MGYA 4KIQA 3IPHA 3Q5IA 3IDBA 5HCXA 3SOAA 5C8KA 4YU2A 3EN6A 3EFWA 3IG7A 3O23A 4XP0A 1J7UA 3N4TA 3UGCA 4BDHA 4KABA 2JKOA 5FXSA 5K5XA 3PJCA 3U4WA 1Q8YA 5KMLA 3NW7A 3MPTA 3NNXA 4L9IA 1GJOA 3K3IA 1SMHA 1ZZ2A 2WOTA 4FTNA 4U3YA 2OJ9A 5HLPA 2JIIA 2R3LA 4AA4A 4EQMA 1NY3A 1BKXA 4E1ZA 3L8VA 2IZTA 1OL6A 3ZSIA 5HI2A 1PYXA 4C3RA 4RZWA 3HV7A 4BIEA 1ZRZA 2FYSA 3BGZA 4F9WA 4FV5A 4GFOA 3BHUA 3RAIA 3ZSHA 1RE8A 3ROCA 3RPSA 2X9FA 2C0IA 3SXSA 3N4UA 4MNEA 4U97A 4F65A 4EOSA 4EOQA 1DS5A 4DEAA 2VO3A 3EN9A 3R9NA 4BDEA 3ZUTA 1KOBA 3NWWA 5IEYA 4O91A 4DHFA 3W2QA 2CKOA 3GENA 1TQMA 4AOTA 5I4NA 3GFEA 3DAEA 2GQRA 5AFVA 3B2WA 3COKA 4U45A 2W5AA 4IBMA 4K18A 3FDNA 4I92A 3FAAA 4D2PA 2UZOA 2VAGA 3FC1X 4K6ZA 3TNHA 4MNEB 3ZCLA 3V6RA 4V01A 3R9DA 3E3BX 4O0SA 3MFSA 2RL5A 4APCA 4QP4A 4TY1A 2QU6A 3HA8A 4GS6A 1PY5A 2I0VA 1H1RA 2VD5A 4I94A 5HCYA 4M3QA 4IAAA 2F7EE 4YTHA 5ACKA 5B0XA 4PL5A 5M53A 3QKLA 5I9VA 3OTUA 3BZ3A 3PPJA 3U8WA 4ERWA 1GNGA 5IUHA 3I7CA 4FNZA 1M17A 2HIWA 3P78A 4FOCA 3EN4A 3LMGA 3ETAA 4C38A 2FVDA 5CEMA 3ZOSA 4EHVA 4DFBA 5CU4A 2YM3A 4DITA 5LXMA 3R02A 3OEFX 3UBDA 5AV3A 3BV2A 4PTCA 3S3IA 2Z02A 3QTXA 4F08A 1UWHA 4RQKA 4Y46A 3DBQA 3F6XA 5EOBA 2WNTA 4DEEA 4ZAUA 5A4LA 4CKIA 2YIYA 4I6QA 3WZJA 3W8QA 3H9OA 4MXAA 5IH4A 4W4WA 4D2RA 1P14A 3BQRA 4FSTA 3UOHA 3ELJA 2WU6A 5D7VA 2XH5A 4OTFA 4QQJA 3MB6A 4O1PA 3BKBA 3O0GA 4C33A 4A9YA 2QOFA 3A7HA 3FZOA 5BVFA 1VYZA 4O2PA 3WOWA 2XEYA 5TF9A 5HVKA 4UMTA 4AE9A 4RMZA 4XNEA 1STCE 2UW4A 3ORPA 4M0ZA 1JKSA 4GVJA 4G34A 3M2WA 3ZRKA 3LQ3A 2P2IA 2W9ZB 3JR1A 1ZYLA 5F1ZA 4N70A 1XBAA 3FI3A 4ZTNA 5EW8A 4DH7A 4WO5A 4G9CA 2XNMA 3V3VA 2X7FA 2YZAA 3MVLA 4FYOA 4X3FB 4Z7HA 3DKCA 4HYUA 3TV7A 4U3ZA 5HTCA 2HZNA 5CWZA 5TE0A 4EZ7A 3EL7A 4BCHA 3A60A 4I5MA 3OD6X 1OL2A 2QNJA 2YIQA 2OZAB 4JBOA 2PMNX 4EQCA 3OXZA 3DNDA 4UZDA 2QOKA 2OI4X 3P08A 2QHNA 3FQSA 4GIHA 4IACA 5HBEA 2V7OA 4X7QA 3IDPA 1YWNA 4USEA 4NCTC 4FSQA 2I7QA 2JAVA 2KTYA 4NM3A 2UVXA 4J53A 3ZC5A 2QI8A 3P1AA 4W9XA 4RFMA 5K3YA 4AGUA 4BDBA 3GU5A 3KCKA 4M15A 4RJ8A 4DINA 4S33A 4ZLZA 5GJGA 3BI6A 4OTIA 3F3ZA 3OMVA 4IFCA 3AQVA 4FT0A 4E6QA 5IU2A 2WTWA 3LXNA 3F69A 3FKOA 4OAUC 3QALE 4D58A 4L7SA 2O3PA 3PXQA 3TIYA 1FGKA 2X2MA 3IDCA 3Q2MA 4KBCA 5CEOA 1NW1A 1OIQA 5LMKC 4X21A 2IVTA 3EJ1A 4FNXA 2X1NA 3WZDA 4EC8A 2X8EA 5HX8A 4KS7A 4E3CA 3QTZA 1TVOA 4RLLA 2V55A 1MQ4A 3EQGA 4ZJIA 4A06A 4C59A 1ZMWA 5C03A 3UPXA 4P7EA 4GUEA 4CFMA 2G9XA 4AG8A 4BCOA 3HMNA 3IOPA 2WMXA 4TWPA 2ITUA 4I5PA 5BMMA 4NFMA 3R01A 5D1JA 1PXIA 5E90A 5AR4A 3EQDA 2CMWA 3ZLWA 4C57A 2IWIA 4CFWA 5BQ0A 3FUPA 2X2LA 2R3HA 3QCQA 2BCJA 3NPCA 4QYYA 1GAGA 2ITPA 3JVRA 5JQ5A 4LGGA 1IR3A 4JQ7A 2UZUE 4AZEA 3CCNA 2WMAA 3POOA 4CSVA 3UPZA 1ZYJA 4ASZA 1OKYA 5HZNA 3FKNA 1WAKA 3NW5A 3V5LA 3SXRA 3V6SA 3D15A 3BLRA 4Q2AA 4CD0A 2E9NA 4YPSA 3GU7A 4ANSA 4BGGA 4EK3A 4NSTA 3FZPA 4GKHA 3TIZA 4QQTA 5B2KA 3IECA 4GKIA 5EOLA 3TEIA 3KMMA 5IQCA 2JKKA 1REKA 1JKTA 1RJBA 3DY7A 3CKWA 3UP7A 1H1WA 4PNKA 3TDWA 2R3MA 5J9YA 3VUGA 2OBJA 4D1XA 5LQFA 2IN6A 3PXZA 2YFXA 3L1SA 1FVVA 4RX5A 2WFYA 2QR8A 3EQIA 3ZC6A 5HD4A 4XOZA 5GIPE 2X6DA 5AV1A 5TO8A 4GK2A 4BCQA 3ATTA 4EOMA 3SW7A 5E92A 4N6ZA 3U6JA 2DWBA 4DBNA 4I93A 3CKXA 2UW3A 2BDFA 3QQGA 4J95A 4D4SA 4FE2A 1R1WA 3RGFA 3WI6A 1ZAOA 3CPCA 4YZNA 5H9BA 5HOAA 3CC6A 4WNOA 3H9FA 5B2LA 1ZMVA 3FMLA 4FTQA 4EZ3A 4K1BA 3GCVA 2QC6A 3HRFA 4IC7A 4O0XA 4BWKA 1NVQA 1ZYSA 1YXSA 3OBJA 3RVGA 3NYNA 3ROYA 1L8TA 2W1FA 1ZARA 5EHYA 4I0RA 4IB5A 4J8MA 2ZV8A 1PRYA 5I9UA 1Y8YA 4CMUA 5HE2A 4LOPA 1T46A 2AC3A 5CS6A 2CNUA 2J0KA 5LVOA 3KN6A 5DE2A 3A8WA 4EEVA 1L3RE 4QPSA 3HAVA 4C34A 4EWQA 4AX8A 3QD3A 4NKAA 5ETCA 2PUUA 1K9AA 2J0JA 4G3GA 2C68A 3GCPA 4Q9SA 3PRIA 4PTGA 4X6RA 1M2PA 5A54A 5CASA 3ZO1A 4IH8A 1UKIA 2XKCA 3C50A 3F2NA 3FWQA 5CAQA 5AUWA 5HORA 4JBQA 2F9GA 1M7NA 1R39A 2C3LA 2KULA 4E5WA 1VR2A 3D7TA 4FEQA 5JSMA 1YOMA 4OTHA 3CS9A 4D0WA 3IGGA 2F4JA 3RINA 2DS1A 4FL3A 1LP4A 3UVPA 3FE3A 2C5XA 4IB3A 4QP3A 5ACBC 4B99A 3VS4A 1IAHA 2B9HA 1OECA 4S34A 2C3KA 1Q8TA 1ZZLA 3UIBA 4ZY5A 5IA2A 2PUNA 4K8AA 2E9UA 4TWOA 4S2ZA 4FSUA 4IWDA 2HK5A 5EM8A 1R0EA 5E8YA 3PVGA 5DH3A 5DVRA 3BWFA 2UW9A 2UZDA 4BI0A 4O7YA 4EOKA 2C6MA 4MD9E 4C2WA 2WELA 3R9RA 1JSUA 4PNIA 4XH6A 1H28A 5IMEA 2OK1A 5AP5A 2PY3A 1ZWSA 4DH1A 4DLIA 2W5HA 4FSWA 2QVSE 4YPDA 2OJJA 2R0UA 5AP4A 3QU0A 4DFUA 1PXKA 1BMKA 3MVJA 1WFCA 4UV0A 5AV2A 3O8TA 4FKJA 4IIRA 5ICPA 4HVHA 4Z16A 2IO6A 3JXWA 4RX7A 3DDPA 3UJGA 4N6YA 5BVNA 3CSVA 5CYIA 3R8UA 4XS2A 2HW7A 4QTBA 4FTUA 1HOWA 4NIFB 3DNEA 3OCBA 2UW6A 3FKLA 3PVUA 4ITHA 4A4LA 3SHEA 2CGXA 2Q0BA 4UXLA 4O21A 2PSQA 4AGCA 4ZLOA 3ODYX 4DH5A 4QMZA 4CFVA 3L9MA 2UZTA 4C7TA 2B9FA 2WHBA 5E8VA 4NTTA 4JG8A 2IW8A 4KD1A 3E3PA 4GH2A 4TNDA 4F1OA 1Q8ZA 2C6EA 3FSKA 3VUIA 4OTQA 4C37A 2UW7A 1ZOGA 4FTOA 4YZ9A 4F7NA 4UXQA 3UQCA 2WTDA 1QPJA 4MBJA 4GFGA 3BV3A 4E5AX 3V5QA 4PDOA 5CI7A 4ERKA 2WMSA 3R0TA 2X81A 4GSBA 3EQBA 4NH1A 4W9WA 4WRSA 3V8SA 2PE0A 3R1YA 3UIMA 4LM5A 2IVVA 4GCJA 3PA3A 4FT7A 2VGOA 3HV4A 4L52A 2UZVA 1CMKE 4C02A 2W7XA 3QKMA 2GNHA 1KE8A 4FV4A 2JEDA 1OKVA 4H1JA 4UZHA 3B2TA 4R6VA 3AC4A 4O7SA 2R64A 3C4EA 1CSNA 3OP5A 2XNPA 4BCPA 3FY0A 4CQGA 2CGWA 5AX9A 5C8MA 2RFSA 2C6LA 4IVDA 4APPA 4A07A 4CKRA 4R3RA 4IXPA 3QQLA 2PZ5A 3F82A 3M42A 4PP7A 4AP7A 4F63A 1WBPA 2C5OA 4O7WA 1AD5A 2HW6A 3ALOA 2W1EA 4YBKA 4YUQA 2RFDA 2C5NA 5LVPA 2A2AA 4HYSA 3R8PA 3A7GA 3G33A 3W10A 3EQRA 5BNJA 4RJ5A 3V51A 2YDKA 3FZRA 4F6WA 3F2RA 5DIAA 4K77A 5KNJA 4TNBA 3F3WA 4EJNA 3CGOA 3DAKA 2GS2A 5AR2A 1PXPA 4MXOA 3ZDUA 3CGFA 1IAJA 2JBOA 4FEWA 3KC3A 2JKQA 4IVCA 1Y6AA 3R8VA 5BX0A 2JDOA 4P5ZA 2A19B 4Y8DA 5HNIX 2YLFA 3DGKA 4GG7A 2VX3A 4DLJA 4O83A 3AD5A 3F3UA 3PVWA 2R2PA 4KKGA 2BFXA 5AAFA 2WEVA 2X8DA 4CV9A 2CCIA 5FDXA 2CGVA 2JITA 3RBWA 3ZO3A 3WYXA 4RPVA 2VTJA 5AA9A 2CLQA 4PP9A 5AAGA 4QPAA 4B7TA 3RM6A 3LW0A 3QC4A 2R3IA 2BDJA 3ODZX 3T9TA 3I1AA 4Y85A 2WMQA 5CVFA 2CN5A 4RIYA 3RKBA 2ITNA 2OH4A 4RJ4A 4J99A 4XP3A 2PZRA 3CY2A 4GG5A 1LPUA 4XG8A 3QCYA 3BU6A 5E8SA 3R71A 5AWMA 2R7BA 3A7JA 1TKIA 4KIPA 3FMNA 4EKLA 4U43A 5D9HA 2ZDUA 2R3QA 2W1DA 4UEUA 3EYHA 4QMOA 5ANGA 4BKZA 4FODA 1XH6A 3F61A 2JDVA 2QG7A 5DRDA 3FV8A 1JBPE 2VGPA 1A06A 4GK3A 2GU8A 5CY3A 2FA2A 2HENA 4DG2E 3D5VA 5CI6A 5HE3A 4CRLA 4DEHA 3QXOA 4IJ9A 2QO7A 5CNOA 4L42A 4BWXA 4WHZA 5J5SA 2YZLA 1H0WA 4QMMA 5JEBA 5CEPA 5KHWA 2PZIA 4YHJA 4E4LA 4EH2A 4V04A 3ZU7A 3VQHA 3QGWA 2GQSA 3LM5A 4KIOA 4KRCA 1GZKA 3SC1A 3VW6A 1XH7A 4EK6A 3Q9XA 4C4GA 3AT3A 3ZBFA 2OW3A 4LGHA 4C0TA 4UBAA 3GC7A 4ZY4A 4PPAA 5A4EA 3ENMA 1UV5A 4RC4A 3R9OA 3U9NA 2VWUA 2YABA 4EHEA 2B4SB 5L4QA 4O1OA 4CFXA 3EQFA 2JKMA 2XP2A 2ITYA 3PIXA 3QQHA 5J8IA 5GHVA 4CTCA 4ZJVA 2OZAA 3MVHA 2XKEA 4AN9A 2BPMA 4MK0A 3GI3A 2J2IB 4RC3A 1PMEA 2Y9QA 3U51A 4ITIA 3LCSA 3D7TB 4Y5QA 1V1KA 3RK9A 1CM8A 2B52A 4EUTA 3BEAA 4LFIA 4RWIA 5EYCA 3L8SA 3LJ1A 2YCQA 2VTHA 1QL6A 2JGZA 3BX5A 2W1ZA 4HCTA 4I24A 3CJGA 3BYMA 4O2ZA 3UO4A 3VHEA 3QZGA 2HELA 1V0PA 2OJGA 2UVYA 2GCDA 2XK7A 3LCTA 4J98A 4DFXE 3QRUA 3QHWA 3U6HA 4OTDA 2AUHA 4JR3A 5CSWA 3F3VA 5DT4A 1GIIA 4YNOA 4QP6A 5DEWA 4D1SA 3T8OA 4FEUA 2XRWA 3Q9WA 3WF8A 3DU8A 3HX4A 3QRKA 3PY3A 4L3LA 5CVGA 4CFUA 5AUVA 3Q5ZA 3FPMA 4AT4A 2VTPA 5IMXA 4YZMA 2R3GA 2HY0A 4TL0A 3V5JA 2J90A 2OIDA 3KF7A 2XIRA 3HVCA 1HCLA 3W1FA 5HG5A 3G51A 5I3OA 4F0FA 4NT4A 4OTGA 2IPXA 4FVPA 3PWDA 5AIKA 4FTKA 4FIFA 2QD9A 3D2IA 4HGEA 4GU9A 4D55A 2WQMA 1YOLA 3OT8A 5CEIA 1VJYA 1OPJA 2FSTX 2W1GA 2XIYA 3ERKA 4LRKA 4MTAA 5CU3A 5HLNA 3PDTA 5AR5A 1H27A 4DC2A 4QPMA 3FLZA 1OM1A 1URCA 4IVAA 4XEYA 2ZM1A 3DB8A 4MQ2A 3RNYA 3FLQA 1YI4A 4ZTSA 4CYIA 5LVMA 5IA4A 2QHMA 4IFGA 4LL5A 3TN8A 2DUVA 5KMNA 4HJOA 4XV1A 2W1IA 2HZ4A 3OG7A 5HIEA 4IAYA 5J5TA 4G3EA 2GNLA 4HNFA 1O6YA 2ERKA 1H1PA 3C7QA 4IB1A 2GNJA 2QQ7A 4BCMA 4FT3A 2PWLA 2XNOA 3OVVA 3Q4CA 3NGAA 4QP8A 3ZFMA 3I5ZA 2J4ZA 1WBVA 4UALA 4KNBA 4ZZMA 2X4ZA 3H10A 2P4IA 4ASDA 5ANJA 4PRJA 3K3JA 3ZXZA 3DBDA 4FV1A 2W96B 4XG7A 4PDPA 3HP5A 4L8MA 5CVHA 5GZ8A 4IAFA 3MB7A 2WMVA 4PQNA 5A4TA 4UX9A 4RVTA 1YQJA 1I44A 2JDTA 3PRFA 3GOPA 2YIWA 4S32A 3R28A 4PF4A 5C27A 5L2SA 4ZSEA 1OITA 3UZRA 2BAKA 4FA2A 3ORXA 2XK6A 4LQMA 5HHWA 4C4JA 4CMTA 3NAYA 4QTCA 3VVHA 3PXRA 1OVEA 2J50A 2XK3A 3TV4A 5HX6A 4BDFA 3GBZA 3FQEA 1WBWA 3O17A 3H30A 2JIVA 5IA0A 4NTSA 3Q9ZA 4XHKB 3QRIA 3Q96A 3F88A 4UMRA 4RJ7A 1FMOE 3VC4A 3R73A 3B8QA 4WUNA 5BUEA 3EYGA 3R1QA 4MH7A 3QTUA 2VTOA 3NMUF 4R1YA 1KWPA 4EK5A 4KB8A 4AZWA 4A7CA 1E9HA 3A99A 4L53A 3W8LA 3QXPA 4DCEA 3SD0A 4W4XA 1WVYA 4F6SA 3PXFA 3UC3A 4O7NA 4WNKA 3W2SA 2CKQA 3NCGA 2JC6A 5C01A 2B9JA 4DEGA 4YSMA 1B38A 4LI5A 4PMTA 2GS7A 5IQEA 3BBWA 2Q0NA 4RWLA 4CZUA 3LKMA 2GS6A 3C1XA 3RPYA 5ETAA 3L9PA 1UU8A 3FL5A 1Y8GA 3HMMA 4FIGA 2ZOQA 1H1SA 4PWNA 3LFAA 4O38A 4XV3A 3D2KA 5AP1A 3U55A 4XYFA 2QURA 4AZFA 1YDTE 4U5JA 3PE1A 4EBWA 4BDKA 2I0YA 5KCVA 2A27A 3UE4A 4I6FA 5CNNA 5IISA 5CEKA 3AOXA 3KXZA 4JDIA 1CKIA 4D2VA 2WTKC 2XCHA 2Z2WA 4DBXA 3MA3A 4IDTA 1H01A 3RALA 4NW5A 4FIIA 4EJ7A 5AV4A 4ZTHA 5FLFA 4EOLA 2C5VA 2Z7SA 3OUNB 4GV1A 3WARA 2XVDA 3FEGA 4YJSA 3UZPA 1SVHA 3MTLA 1BL7A 2F2UA 3SDJA 4MKCA 3DXPA 2CDZA 4HPTE 4TXCA 2UZBA 3DTCA 4PL4A 4FX3A 1R0PA 2Y4PA 3V8TA 1PXJA 4X2FA 5HO6A 5M09A 1H25A 4XX9A 3DBFA 5IQIA 4GT4A 3WE4A 4UYAA 3F7ZA 4ONAA 3EFJA 3Q4TA 4YTFA 2R3FA 2R5TA 1V0BA 4YJRA 4U80A 4C8BA 1HCKA 1OMWA 5C9CA 4J7BA 2QOIA 5EYMA 1PKGA 3CQWA 3DK7A 1YRPA 2J0IA 2VO7A 1S9IA 3W55A 3ZEWA 4QP7A 2C6OA 5KMMA 3E62A 3BHVA 5HQ0A 3E7VA 2JFLA 1P2AA 4LOQA 4OAVB 5HEZA 2WQEA 4MAOA 4FV2A 4FI1A 2C1AA 4NWMA 4BTMA 1KV1A 3R7IA 3ZM4A 1OIUA 3PZEA 1ZYDA 3PP0A 3K2LA 3UO5A 4HW7A 1QPEA 2GPHA 4H1MA 3DLSA 2YM4A 4X3FC 5M57A 2C69A 3FPQA 3R8LA 4XMOA 3LMIA 3W2RA 3KCFA 5JZNA 3FYKX 5L8LA 2GDOA 2IZUA 1F5QA 3EL8A 3NAXA 3QFVA 3PA4A 4KSPA 4FKWA 4Q5HA 5E91A 1Z5MA 3VBWA 4BTJA 3N4VA 4O7TA 4UWBA 3P9JA 1W98A 4NEUA 2NNWB 5T6KA 4ZS0A 3TV6A 3W2OA 2ETMA 1OKZA 1G3NA 2OJIA 4I20A 1YHWA 3KXNA 3RAHA 3V04A 4CFNA 4JI9A 5L2IA 2C0OA 2JDSA 5AM6A 4P4CA 3MY1A 2X8IA 2C30A 2G15A 5GJDA 4YTCA 1XKKA 4U40A 1VZOA 4BZDA 3ZS5A 1LEZA 4AWIA 4NZWB 4BDIA 5HO8A 1W83A 3VULA 3SX9A 3DCVA 3HL7A 4X0MA 3Q6UA 5I0BA 4DEBA 3LHJA 3NYXA 1DAWA 4IQ6A 2PVLA 1AQ1A 5IG1A 4QMYA 5KBQA 5KMJA 5CEQA 5HLWA 4WG4A 3A4PA 5DPVA 4BI1A 4JAJA 3TZMA 2O2UA 3DV3A 4RIWA 4AF3A 4ID7A 3W32A 3BIZA 3OHTA 4AFEA 5FTOA 3P23A 3PTGA 3POZA 1TQPA 4UMQA 5CXHA 3AMAA 3H0YA 3HV5A 3I81A 1YXVA 2HAKA 4E4MA 2PZPA 4FKIA 5LCJA 4BCGA 2PUPA 1ND4A 5HESA 3MW1A 5FDPA 2GQGA 4CGAA 4JT3A 1U54A 4MQ1A 5IQBA 4KKHA 3UNZA 2XKFA 4FTRA 3Q60A 4XLVA 5TKDA 3LMHA 4WNPA 4ASEA 3KY2A 4QTEA 2XBAA 2YCRA 4RIXA 1XR1A 5L2QA 4ENXA 3AC8A 5AR3A 3KRLA 4ZTLA 4HVIA 3ZRLA 4BYIA 3QAME 4AW2A 2A1AB 4X2NA 2GHLA 5F94A 3A61A 4GK4A 2WKMA 3VJNA 1KV2A 4DGOA 2BRNA 4U41A 5F9EA 2ZMDA 3LFSA 4EH8A 2Y4IB 2CGUA 3JUHA 1OIYA 2CHLA 3KULB 4H3PA 4RIXB 4BGHA 2ITXA 2NO3A 3GB2A 3F5GA 4CT2A 4F4PA 1Q99A 3SGCA 4XOYA 1I09A 1MUOA 2QR7A 4OT5A 4YGAA 5EI8A 3TUDA 4N4SA 2GTMA 2X7GA 5FGKA 4D9UA 3EZVA 5DT0A 3BYOA 5HCZA 2WTJA 5IA5A 3UO6A 4O7VA 2ZYBA 3WZUA 2PYWA 2YM5A 1WCCA 2BKZA 5EM6A 4D1ZA 2HZIA 2OIQA 2W0JA 5I5ZA 3VUDA 4Z7GA 4QNAA 2Q83A 3F2AA 3LVPA 2ITWA 4TWNA 4XUFA 3VS0A 3MFTA 1Y91A 2BRMA 3FQHA 5AR7A 1FGIA 5CAVA 3RWQA 3IQ7A 4KBKA 2WTIA 4ZSJA 4B8MA 5IQDA 1E1VA 3UYSA 1NXKA 5EKNA 1E1XA 4F1MA 5AEPA 5J7BA 4LYNA 4O0YA 1OL7A 4KUJA 4G17A 4K2RA 3GC9A 5CANA 2H8HA 3UZTA 3L8PA 2QO2A 5DWRA 3U4UA 3V01A 3E87A 2B55A 2F57A 4UN0C 1NVSA 5HTIA 4ANLA 4TZRA 3NZ0A 5JN2A 2Y0AA 4TN6A 4TRLA 1R3CA 3NLBA 3PPZA 2OU7A 4XG4A 3R2YA 4IAKA 5E8WA 5HD7A 2BROA 5LJJA 4C4FA 3BHYA 5LWNA 5ANDA 5DNRA 3A2CA 4XG3A 2ZMCA 3OY3A 2I0HA 5A4CA 3HRBA 2ETRA 5AAEA 3IK3A 4X2GA 3ZLYA 3KVWA 3PZHA 4F64A 1REJA 5M55A 1P4OA 3AGMA 2UUEA 3H4JA 3GU8A 1WBNA 4O81A 2BRGA 2VTIA 4EOOA 1K2PA 1ZLTA 1BI7A 2W05A 3EH9A 3GUBA 4EH3A 2OF2A 4GYIA 4M13A 3OY1A 4I21A 5CXZA 5KO1A 3OOMA 3C4XA 2ITTA 1URWA 5M08A 3CIKA 3VO3A 5FUTA 3IW8A 4QT1A 2OIBA 5EKOA 5DRBA 5I3RA 2HY81 1OUKA 3FJQE 4PUZA 4V0GA 3DT1A 4QMXA 2XNEA 2SRCA 4QMQA 3W2CA 2I40A 3NUYA 3UOLA 3LFQA 4GRBA 1DAYA 2E2BA 2PMIA 2WEIA 5HE0A 4D2SA 1Q4LA 2BZHB 4JS8A 3E88A 4ACHA 4JL9A 2YM8A 3I7BA 4QYGA 5L8JA 4BRXA 4BTFA 2VWWA 5CT0A 4V0GB 4Q5EA 4ZJJA 3HDNA 2WQNA 5H8BA 3G0FA 4GEOA 2QG5A 3E8CA 3GNIB 4RC2A 3ZMMA 2FSLX 2GTNA 4ZOGA 4YMJA 1NVRA 2C3IB 5A14A 5M4UA 4R7BA 2VU3A 2UZNA 3I60A 3KXXA 4BF2A 3H3CA 4X2KA 3ZFXA 4BR3A 2XM8A 2YCSA 2GNFA 3DJ7A 4B8LA 5EHLA 3QZFA 4U44A 4MWHA 1PXLA 4W4VA 3VS5A 2F7XE 4DG3E 3UIUA 4FGRA
chains in the Genus database with same CATH superfamily
3CD8A 4ZIMA 1MRVA 4HVGA 2XK4A 4RG0A 2VNYA 2J7TA 3DXNA 4LUEA 4PL3A 4PMMA 5LVLA 3IGOA 2Z8CA 3GU4A 4M0YA 4ACDA 4BCFA 2CKPA 1W0XC 2XJ1A 1FMKA 2R3RA 3FXXA 4D2TA 1EH4A 1FPUA 3FI2A 3HZTA 3D83A 3IW4A 4NKSA 4OLIA 4FZFB 4YC6A 4AU8A 4HYHA 4PDYA 3TZ7A 2PE1A 2CNQA 1JQHA 4I23A 4QMNA 3QQJA 4ZMEA 4QO9A 3M1SA 1U5RA 3QWJA 1SYKA 3NX8A 4R7HA 5FD2A 2C6DA 2ACXA 3JVSA 4ZP5A 4C58A 2A4LA 2HOGA 3QA0A 1PXNA 4EL9A 2Y7JA 3W2PA 3MJ2A 3I0OA 1OL1A 3GXLA 3BBTB 3I5NA 5CT7A 5C4LA 4FKRA 5AUZA 4CFFA 4A9SA 5BVDA 4WNMA 2WMBA 3CD3A 5JH6A 2YAAA 4ZSAA 2V22A 4F99A 4FKTA 2Y8OA 2ZJWA 3BWJA 4FT5A 3RHXA 5EQPA 3NUSA 4L01A 3QHRA 2YJSA 3PSDA 5BYYA 2YISA 3MH3A 4GFMA 2BRHA 2PZYA 4U79A 2C47A 5KZ0A 5DA3A 3NRMA 4AZTA 3D14A 2ZB1A 3PG3A 4TTHB 2WMRA 2IF8A 1U54B 5K0XA 2REIA 3QLGA 3ENHA 1QCFA 3E7OA 2G01A 3F5PA 3MV5A 4FK6A 4QD6A 3BLHA 2R3OA 1G8AA 3MSSA 1YI6A 3K54A 3QL8A 4X3JA 4ALWA 4IX4A 3C0HA 4FKGA 2PK9A 4QDEA 4JX3A 2WU7A 4FGBA 1NA7A 2BIKB 3CY3A 4O6LA 4AXAA 3CTJA 3D5XA 4BWPA 5CAPA 4DF3A 1ZYCA 4EZ5A 2WTCA 4NUSA 5IA1A 1MRYA 4NM5A 2IW9A 4DT9A 4WG3A 3P4KA 5B7VA 2R3JA 5IQHA 2XCKA 4D9TA 4BDGA 4YJTA 2VWIA 3QQUA 4D5HA 5M07A 3GP0A 3LIJA 2PVFA 3E5AA 3SRVB 1PMVA 4TKSA 5GNKA 4BHZA 1UNLA 3KXGA 4JVGA 3S0OA 3JY9A 5DR6A 4YJUA 4BCKA 1IA8A 3KVXA 1GZ8A 2BTRA 4EOIA 3FLYA 3COMA 4L3PA 1M7QA 4EHGA 3DFCB 2FUMA 2W06A 3AC3A 3TZ8A 2F2CB 4H05A 3G9LX 1H1QA 5EI6A 3DAJA 4M12A 3AMYA 4WBOA 3R7YA 3V5PA 4D4YA 5LOHA 4LV8A 4G31A 4O7ZA 1KE5A 2VTMA 3Q04A 2PL0A 3S95A 4M14A 4NYEA 4L44A 5FM2A 3R7GA 3ML1A 5EQYA 2X7OA 2X0OA 3BELA 3UDZA 4DG0E 1DI9A 1UNHA 4UMUA 5JFSA 4CCBA 4E6CA 4R77A 3PLSA 2QOLA 2P55A 3AKKA 2QOCA 1XH9A 3CPBA 3FMEA 3OC1A 3LQ8A 4CQEA 5HG8A 4AA0A 2VTNA 4QDVA 5FTGA 2X2KA 2PVRA 4TYIA 1RQQA 4ALVA 4QNYA 4EBVA 4MF0A 4WG5A 4EC9A 3Q3BA 3SXFA 2P33A 2C4GA 3NSZA 3AT2A 2B9IA 3GEQA 5CTPA 3E8EA 4OW8A 4QP2A 2B1PA 2G2IA 3D7ZA 4IADA 4M69A 4EKKA 5HNGA 4GIIA 3GCQA 3ALNA 3R1SA 2X9EA 3WIKA 5JZJA 4BN1A 4FG7A 4AXCA 3UQFA 3HMOA 4E26A 4F0GA 3HP2A 4MHAA 2WIPA 3TJCA 2YLEA 3MN3A 3BYUA 4RSSA 2Z7QA 2OG8A 3BGQA 3FZSA 1XBCA 3QTQA 4IEBA 5G6VA 3QX2A 4MF1A 2VUWA 3QTWA 3UG2A 4E93A 3LFEA 5M06A 4RFYA 3OCTA 3UNJA 3OXIA 4FNYA 3R7VA 4S30A 4YO4A 5CZHA 4IHPA 4O6EA 3KN5A 4FV6A 5TR6A 3LFFA 3RK5A 5DN3A 5EH0A 1G8JA 4IZYA 4NIFA 4P2KA 4IB0A 1WBOA 4M68A 3W0PA 3KXMA 2C5YA 3V8WA 1DM2A 4BFMA 2LAVA 3R8ZA 5DR2A 3BPRA 3R7EA 3W33A 4NM0A 4EOPA 4AAYA 1Q61A 5CF8A 2EVAA 3WILA 2CCHA 3ACJA 2ZM4A 2V62A 4F1TA 5EW3A 3O2MA 4IC8A 1YWVA 3D0EA 4LRMA 1Q3DA 4YHTA 4LV5A 1YDRE 4OTPA 3BEGA 4DGGA 4AXFA 2XYNA 1PMUA 3EQPA 4NU1A 3PJ8A 2XIZA 3HEGA 4DFLA 3SV0A 2EU9A 2EXMA 4RIOA 3IONA 1PMNA 1BX6A 2NRYA 4TYEA 3C4WA 2W4JA 5DT3A 4ACMA 4AS0A 5DFPA 5C1QB 1O9UA 4S31A 3MS9A 2QKWB 3LFBA 4JDHA 3OWKA 4JIKA 4QMTA 2EWAA 4RJ6A 5J95A 4IZ7A 2XA4A 5BVKA 5D11A 1FBNA 4EHZA 2CPKE 2XJ2A 1ZOHA 2YEXA 3VBTA 3GFWA 4GT5A 4FV9A 3P79A 4FTJA 4MYGA 4B6LA 5ANKA 3UNKA 3MY5A 3IKAA 5A46A 3TJDA 5IEXA 3L9NA 3RNIA 5A9UA 3QRTA 3OW4A 1JPAA 2QOHA 1MP8A 1FQ1B 2X0GA 3HNGA 5AP2A 3F9NA 5CAOA 3EHAA 4YBJA 4IW0A 2BZIB 5BYLA 4BZNA 5JRQA 4U81A 5FWKK 3ZFYA 4BICA 2H96A 3ANRA 4WOVA 5J1WA 2BIYA 4YJPA 3W0OA 4YLLA 3ET7A 3NUPA 4BBEA 2ZFYA 4ACCA 3UDSA 5GZAA 2H34A 3FSFA 3VHKA 2IVUA 2XEZA 3SOCA 2YITA 2UV2A 3FMDA 5HG9A 2X6EA 4CXAA 4NJDA 5FEQA 3R2BA 4RX8A 3FHIA 3ZO4A 5B2MA 3FMMA 4FVRA 4IM3A 3HKOA 3K5VA 5EM7A 4ANNA 2B53A 2VNWA 5F95A 4ORKA 3FHRA 3MESA 4G6OA 3COHA 3PFYA 5EDRA 1Z57A 3FI8A 3PVBA 4LL0A 2PE2A 2JAMA 3MH1A 4FSRA 4FVQA 3PJ3A 4QP1A 4H3QA 4WA9A 5FP6A 3R8MA 1UVRA 3UC4A 2HZ0A 3MH2A 2ZV9A 5FRIA 5CSVA 2AC5A 2OXXA 3C51A 3FXWA 3OWPA 3DPKA 4FZAB 5CSHA 4F7JA 4ZTMA 3FZ1A 5DMZA 5BMSA 3PSBA 3Q6WA 5FXRA 1UA2A 4DTAA 3EQHA 3ZO2A 2GSFA 3CBLA 3UOKA 4JRNA 2O63A 1M2QA 2XK9A 3QYZA 4AUAA 4D5KA 3ZUVA 1OGUA 3VF8A 3QUPA 5J79A 4IAZA 3PUFC 4BTKA 3NEWA 4RA4A 4UMPA 1H4LA 1W8CA 4WSQA 1LUFA 2ZDTA 2O8YA 5AP7A 3FZTA 4FL2A 3RAWA 2H9VA 4A9UA 4IX6A 1OUYA 4ZTQA 3ZEPA 2OXDA 5ITAA 3RP9A 3HUCA 4O7RA 5KZIA 1KE9A 1SZMA 4R8QA 1CKJA 4FIEA 3DDQA 3KRRA 3CP9A 1X8BA 4YC8A 4BDDA 4WSYA 4FEVA 4O0UA 3DZQA 4V05A 5H8GA 5HKMA 2HCKA 3DKOA 5K5NA 1Q3WA 2R0IA 4G3FA 1A9UA 5CF4A 1W82A 3RPOA 3LXPA 4UY9A 3HGKA 4YJVA 3EFLA 4L3JA 5A4QA 1XJDA 4QMSA 3HLLA 3Q53A 1AGWA 4NJ3A 4M69B 1KSWA 3KQ7A 1JKLA 5FP5A 2WGJA 3D9VA 3HDMA 1CDKA 4L43A 4K11A 4XCUA 2WB8A 4WT6A 3OUKA 4ASXA 4F09A 3VRZA 2YM6A 5F20A 1YVJA 5JRSA 4AN2A 4AT3A 4MXXA 3DXQA 2VTAA 4JDKA 4TYHA 3VS6A 4Y95A 1J1BA 3VUTA 3R00A 2EB3A 4DN5A 4C4EA 1P5EA 3BE2A 2BKKA 3GC0A 3LJ0A 4RLKA 3QCXA 2YWPA 4QRCA 4E5BA 1MRUA 3KXHA 4DFNA 3FLNC 5HBJA 4FT9A 4JNWA 2O65A 3AC1A 3BYSA 4GMYA 4TYJA 3UP2A 5EG3A 2BAQA 5EYKA 1U5QA 5FBOA 5AADA 2W5BA 2VN9A 3MWUA 3TI1A 1JVPP 2YERA 3AG9A 3R83A 2PVHA 3FYJX 2YAKA 3KMUA 4QYFA 4BGQA 4EH7A 4L00A 2WD1A 5JK3A 3LLAA 3WYYA 3CEKA 3DK3A 1W84A 5E1EA 4AQKA 2CN8A 2ITOA 3DK6A 4UB7A 5A6OA 4KWPA 3PY0A 2VWZA 2WO6A 4DEIA 3UODA 1FINA 2VWBA 4IAIA 4BI2A 4H3BA 5FM3A 4C2VA 4RIWB 3D5WA 4YSJA 3NW6A 1OBGA 2VWYA 2ITVA 3WE8A 5JMSA 4F0IA 2OH0E 4W8EA 3MVMA 4XG9A 3Q32A 2A98A 2I0EA 3VUMA 1M14A 4QYEA 3UIXA 4MUQA 4HZRA 3VF9A 3QD0A 5EDPA 3U9CA 4WD5A 4FF8A 3OW3A 5GJFA 5FEDA 3H9RA 3BU3A 4HPUE 3ANQA 3EKNA 5EK7A 4EK4A 2BHHA 4RWKA 5ANEA 2OJFE 2XIXA 1Q8UA 1Q62A 3D94A 4EK8A 4YZBA 2O5KA 1Y57A 1OZ1A 2JBPA 3EN5A 4TW9A 5IDNA 5C8NA 1NT2A 3MYGA 3VAPA 4CMOA 4GU6A 3Q2JA 3II5A 3P7CA 3JYAA 4FIJA 5I9ZA 4KIKB 4QMWA 1XHAA 2W17A 5HNBA 5LARA 2QODA 3L8XA 3LCKA 2XJ0A 3R21A 4YZDA 5HVJA 3WIGA 2WZJA 2QU5A 4RWJA 4I3ZA 3R1NA 5AP0A 5IQGA 3GQIA 4PMPA 3EQCA 3JY0A 2PTKA 2WPAA 1Q97A 3PE2A 3E93A 4ZY6A 5J7HA 5EFQA 3PSCA 2QLUA 3NVMB 2IZSA 2ZVAA 2YIRA 3ITZA 3A7IA 4DYMA 3P5KA 3Q9YA 4IM2A 5D10A 2WTVA 5D41A 3QA8A 5KKRC 5IDPA 3UDBA 5CX9A 2I6LA 4N57A 4BJJA 5I9YA 3LOKA 1LEWA 1XWSA 3PYYA 4FNWA 3DJ6A 1BUHA 4IVBA 4PPBA 4KA3A 5L3AA 4FEXA 5CU6A 1BYGA 2XNNA 3BHHA 4E8AA 4YP8A 4FRFA 3TKUA 1IG1A 4NFNA 4O0WA 1H0VA 3U87A 3TXOA 1T45A 1Y6BA 3OZ6A 3ATSA 4UWYA 4E7WA 4ZLYA 2VWVA 1W2DA 4HVSA 1UNGA 5C26A 3SLSA 2RGPA 5D12A 3C0GA 4PTEA 3QKKA 4J97A 4F9YA 5KMKA 3DA6A 3DKFA 4DEDA 4CYJA 3NS9A 4FSMA 4CNHA 5JFXA 3LCOA 2PMLX 1JOWB 2BALA 2WMUA 3HV3A 5KMIA 3NCZA 2RKUA 1YI3A 3VS7A 3C5IA 3G6HA 3O51A 4J1RA 3E92A 4A9TA 3CLYA 1RDQE 4J71A 4QTDA 4YO6A 1GZOA 5LWMA 2NPQA 4O84A 1JAMA 3MH0A 3WZKA 1XBBA 2G1TA 5CSPA 4AAAA 3FL4A 2W4KA 2QKRA 3CJFA 1ERKA 4M7IA 3NIZA 4JBPA 2GMXA 2YM7A 3R7OA 4JG6A 4BHNA 4E20A 3R7UA 5IZFA 1JSVA 2YWVA 3EOCA 4OGRA 3A4OX 4TPTA 2FO0A 4E4XA 2ITZA 3VW8A 4ZZOA 2QOQA 4FTLA 2G2FA 4ACGA 5IKWA 3ORIA 3OS3A 4IZ5A 4H58A 1APME 2FH9A 3I6WA 4O96A 4YURA 4FTTA 4U6RA 4FIHA 3TZ9A 2Z60A 1CKPA 4DE4A 5E7RA 5IEVA 5M56A 5GINE 3BE9A 4O0VA 4ALUA 4FKPA 4RVKA 4FSZA 4J96A 4Z3VA 3CTHA 4GJ2A 3IW6A 5TT7A 2FSMX 3A7FA 3DJ5A 1XH5A 4DGLC 1UU9A 3HYHA 4ARKA 3PPKA 4BYJA 3NUAA 3QUEA 4LOOA 3SRVA 2OICA 2C6TA 3IOKA 4HGLA 3LQ5A 4KS8A 3R22A 2R9SA 3BCEA 3KF4A 4BCNA 4DGMA 2YDJA 4WRGA 5IQFA 5HIBA 2HWOA 5L6PA 2XARA 4Z9LA 2RFNA 3NNUA 4OTWA 3FC2A 4RGJA 5JT2A 5CLPA 1FOTA 2VTLA 2PVYA 4DA5A 3KEXA 4DFZE 1J7LA 5GIOE 2YA9A 2C0TA 5LMKA 3GGFA 3ORMA 4O22A 2O0UA 3MDYA 4HVDA 4AN3A 2QONA 3O96A 1ATPE 3O7LD 4L45A 4DTKA 4F7LA 3BQCA 5EI2A 3UTOA 4JR7A 2XNGA 4RT7A 5K4IA 3MBLA 1BI8A 2XK8A 3L9LA 1OPKA 3RPRA 4I0TA 1WBTA 2WIHA 3IW5A 4FV3A 3UMWA 3THBA 3ZH8A 3TCPA 4ZMFA 2JIUA 4XRLA 5IUIA 1WMKA 5KMOA 4FL1A 2RFEA 2Z7RA 4R5YA 3KIOC 3QTIA 4ZSGA 5CF6A 1GIHA 2CJMA 3PIYA 3SAYA 4XBRA 3PP1A 5BUJA 4QMPA 3OOGA 4QMUA 1PHKA 1H08A 1UKHA 1YDSE 3F66A 4B9DA 3QYWA 3UQGA 3ORNA 3KK9A 3KRXA 4FTCA 3FMJA 2PPQA 5KKRB 2BMCA 4BY9E 3VUKA 2OZOA 4F9BA 2YN8A 1BLXA 4CCUA 2BILB 3FBVA 3GQLA 1IA9A 3AD4A 3RM7A 4HCVA 2C6IA 4M97A 1TQIA 3N51A 3TTIA 5AMNA 3NVKI 3TUBA 1UWJA 1IRKA 3MPMA 1ZOEA 3C0IA 1YKRA 3PJ2A 4DHJA 5AUTA 1WVWA 2BR1A 3C4CA 4Y73A 5KBRA 3VONA 3KRJA 4B4LA 4E6AA 4MXYA 3OF0A 4I4FA 4TWCA 2J5FA 3ORZA 1U46A 5DLSA 4Y5HA 2ITQA 3RJCA 4FMQA 4FV7A 4R7IA 4QYHA 2C1BA 3LM0A 4FV0A 1PXOA 5LMAA 5ANIA 3EZRA 4OBQA 5KUPA 4U7ZA 5CENA 1ZY4A 4C36A 1QPCA 2J6MA 1H8FA 3QCSA 4KBAA 3VS1A 4EQUA 1Q5KA 4FTIA 2ETKA 1OL5A 3D4QA 4D28A 5CU2A 5BPYA 4BIBA 3KA0A 1M52A 2DYLA 2UZEA 3VBYA 3V5WA 4OBOA 5KE0A 5CQWA 5CU0A 5I9WA 2CNVA 4DAWA 4RBLA 2GFCA 4ANMA 5AM7A 3GOKA 3E64A 3P7AA 4EYJA 3RZFA 2VX0A 5DEYA 3VN9A 3ZUUA 2VTRA 5CZIA 2R3KA 3TNPC 3RTPA 4JOAA 4DH3A 3HRCA 3LFDA 4M66A 5EHOA 2VZ6A 3JS2A 4GVAA 4XRJA 3LXLA 5G1XA 3I79A 5LVNA 5M51A 4IWOA 3TM0A 4AZVA 4UYNA 5DGZA 2FSOX 4FSNA 2WQOA 3MIAA 4C3PA 3OCGA 4CRSA 5K4JA 3QZHA 2WQBA 3BYVA 2HYYA 5DG5A 3ZRMA 3ZZWA 3LLTA 3DZOA 2XAOA 4JQEA 3UMXA 1DI8A 1JSTA 3R9HA 3KULA 4YZCA 2NYAA 1SVEA 3F3TA 2V7AA 2QOOA 2YHVA 3NYOA 3QX4A 4FICA 1QPDA 4Y72A 4YJOA 4J52A 2I1MA 4O86A 4AXDA 4DCAA 2BAJA 2PVNA 3BU5A 4NM7A 4L46A 4MX9A 5HVYA 3T9IA 4A9RA 1YOJA 4G1WA 3VBXA 2BHEA 3I4BA 3KFAA 4FKQA 3ZONA 5M4CA 1XMLA 4E73A 4BIDA 1JWHA 3F7WA 2ZB0A 5HBHA 4GL9A 4U9AA 3WBLA 4MNFA 4CLIA 4BJJB 3PLAE 1H00A 2X0QA 5JFWA 3F5XA 3TDVA 4IDVA 5I9XA 4PPCA 3OWLA 4KSQA 2WMWA 4H36A 1WBSA 3KRWA 2X39A 5HO7A 4EI4A 4DTBA 2GHMA 4MXZA 4ZTRA 4CKJA 4J8NA 2AYPA 4LMUA 4P90A 3OT3A 5DYJA 3AD6A 4RVLA 2EXCX 2FGIA 2R7IA 2XBJA 4EORA 3M11A 4K9YA 2Y6OA 4AE6A 4ZSLA 3PJ1A 2XYUA 3LCDA 2NRUA 2NP8A 2P3GX 4PDSA 4WUAA 3WZEA 1O6KA 1SNUA 5EW9A 4FUXA 4ZS4A 3TKIA 2CKEA 4EONA 4JQ8A 4CG8A 4LRJA 4G5JA 2GNIA 3CE3A 3DS6A 3SA0A 3PG1A 2BUJA 1QMZA 1OPLA 1FVTA 5AP3A 4CV8A 1UU7A 4RX9A 3QQFA 4X2JA 3WF6A 5J9ZA 1YHSA 4KKEA 2QLQA 1P4FA 4XLIA 5JFVA 5T68A 5M4IA 1ZY5A 2H6DA 4OTRA 3S1HA 4ANBA 3EN7A 1KUTA 4HNIA 4D2WA 3HMPA 4O4BB 4MD7E 2YACA 5DOSA 3PIZA 3NNVA 4F70A 2OWBA 2JLDA 3VBVA 4R78A 4DGNA 4M67A 3AC5A 3O71A 4EH9A 4TT7A 4CG9A 2F49A 3CXWA 4W8DA 5L6OA 3GT8A 4AOIA 3AGLA 3PY1A 1OBDA 4IZAA 4RRVA 2LGCA 4YNEA 4YC3A 4FKOA 4I41A 4I22A 3OCSA 1MQBA 5IF1A 3Q4ZA 3QRJA 4I1ZA 4MD8E 1JKKA 4TYGA 3ULIA 3VIDA 5KX8A 4FKSA 3QD4A 2OFUA 3GU6A 5ETIA 3EIDA 2XM9A 3SG9A 4I5CA 4GYGA 1OB3A 4BB4A 4C3FA 1G8SA 2VO0A 2WOUA 3ZXTA 3FY2A 3RCJA 3DKGA 4PV0A 3NNWA 3VBQA 4FG8A 2UZWE 4K33A 4QQ5A 5CQUA 5IA3A 3HAMA 4O0TA 4AW1A 3KREA 3UDTA 4O82A 1PYEA 4FG9A 1Q24A 4AFJA 5L2TA 3S00A 2E9VA 1YWRA 4BKYA 1ST4A 4EWHA 2OO8X 2ZV7A 3R63A 5DBXA 3ZLXA 5DI1A 4EH4A 4I0SA 4BL1A 5JGDA 3SW4A 4IANA 2C6KA 3EB0A 3BGPA 2XZSA 2R3PA 5CAUA 3PWYA 3P7BA 2BDWA 3QTSA 3FMHA 1CTPE 4O7LA 1XQZA 5AJQA 4XJ0A 5E8TA 3MA6A 2B7AA 2E9PA 2RSVA 2BRBA 4HZSA 5H8EA 1IEPA 2E9OA 3MPAA 1UU3A 1PJKA 3N9XA 4F6UA 4H39A 4AGDA 3EFKA 3SG8A 3A62A 4U8ZA 5IH6A 2GNGA 1WZYA 1Z9XA 3CQUA 4XG2A 5AIRA 2CLXA 2P2HA 4F9AA 4DDGA 2QOBA 2WMTA 2IVSA 2ONLA 4ENYA 4D4VA 3NFFB 2OSCA 2W1HA 4X3FA 4JLCA 3R04A 4BCIA 1FVRA 5M4FA 3QLFA 1U4DA 2PVJA 3OEZA 4JIAA 4LUDA 4C4HA 2VWXA 2XUUA 2PMOX 4FUYA 1JNKA 2IJMA 4OBPA 3OTVA 3DBCA 5BVOA 5A6NA 2HWPA 3SKCA 3QWKA 5FEEA 3S4QA 3I6UA 3UVRA 4LV7A 4RFZA 1GY3A 3D5UA 4P5QA 3VS3A 4E4NA 4L6QA 3O5AA 2ZAZA 4ZXTA 2F7ZE 3VQUA 5HICA 2FB8A 2PVKA 3VS2A 4QTAA 2HXLA 3DLZA 3ORTA 3RHKA 2EB2A 3P0MA 2OXYA 4EUUA 5DHJA 3QC9A 2O64A 3VUHA 3AXWA 4F7SA 4OR5A 3T3UA 1B6CB 2Y4IC 1ZMUA 3COIA 2HXQA 2PHKA 2UVZA 3TTJA 4DH8A 3TL8A 2UW8A 3FLWA 2ZM3A 3QF9A 1A48A 4G16A 4WIHA 1W7HA 4C62A 1YHVA 2VRXA 3ZLSA 3NYVA 2R4BA 5FQDC 5H2UA 4FTAA 1VYWA 3G90X 5L2WA 4CTBA 1XH4A 3PXYA 4RA5A 2XALA 5AUYA 1JLUE 2W99B 5T3QA 3TACA 4GT3A 3EMGA 4ANQA 2VTQA 1XH8A 5H3QA 4B0GA 4Q9ZA 2EXEA 1GIJA 4FKUA 3MJ1A 2OF4A 3GCSA 3JPVA 5ETFA 3KKVA 4A4XA 3BL9A 3HECA 3O8PA 5JGAA 1SNXA 3MFRA 5KHXA 5M44A 3ZHPC 5CSXA 3FI4A 4USFA 4XV2A 3LFNA 3ACKA 4BDCA 2J9MA 1W2FA 1G5SA 2XIKA 2PVMA 3DOGA 5DR9A 4KAOA 5A3XA 5AP6A 4AOJA 1H07A 3RAKA 1VEBA 3WF9A 3NUXA 3DFAA 4BBMA 3MI9A 2JDRA 2V0DA 1K3AA 3IS5A 2J51A 4II5A 2YCFA 4XBUA 4YJNA 5D7AA 3GC8A 3OROA 1GZNA 1B39A 3SVVA 3TNIA 4C4IA 3UOJA 3E8NA 4QP9A 4U42A 4JAIA 2XNBA 3S2PA 4JX7A 4FZ7A 2J5EA 5EM5A 1YXXA 1IASA 3LZBA 3OXTA 4GJ3A 4HCUA 5EDQA 3G9NA 4HOKA 4D0XA 4QOXA 2J0LA 4FC0A 5GZ9A 3KK8A 4L7FA 4JBVA 4CZTA 1S9JA 1H24A 4AW0A 1G8KA 2BVAA 3BRBA 1J91A 3PXKA 4L68A 4CVAA 2XMYA 3G5DA 2JD5A 4G2FA 4IMYA 3NUNA 4R3PA 5HIDA 5HE1A 5K9IA 3NIEA 3CR0A 1OI9A 5JKGA 1WVXA 3RZBA 2UW5A 3TNQB 3ZDIA 1PW2A 2Z7LA 4XV9A 4HGSA 3CTQA 4HGTA 1YW2A 4FYNA 3TWJA 3KMWA 5IH5A 4FBXA 2W1CA 2OGVA 4USDA 4AA5A 4BKJA 4YJQA 3C4ZA 3CQEA 5J87A 2B0QA 3OBGA 3B8RA 3TKHA 3LAUA 1PF8A 3K5UA 5E4HA 4RIYB 5HU3A 5BVEA 3SQQA 3ID6C 4ZZNA 5ANOA 2ESMA 2P0CA 3E8DA 2QCSA 2DQ7X 2EUFB 3IO7A 2GFSA 4IE9A 4LGDA 5EYDA 5TOZA 4QMVA 3FMKA 3ZYAA 5HU9A 5HTBA 4G5PA 3G15A 2V5QA 1GOLA 2VTSA 5IPJA 1SM2A 5JQ8A 3P86A 4G3CA 1OIRA 3PUPA 5AUXA 4A4OA 4BVUA 1J1CA 5E9EA 5IUGA 4MCVA 4D4RA 5AA8A 2XF0A 2JFMA 4FKVA 4X6QC 3DBEA 3GCUA 4QMLA 3VNTA 3T3VA 1BL6A 4AGWA 1KOAA 3A8XA 5C4KA 3G6GA 3FXZA 3IW7A 4XP2A 4XG6A 4GW8A 4CEGA 1M2RA 3HA6A 3H0ZA 1SVGA 2W9FB 3DQXA 3NUUA 2J0MB 4FK3A 2YIXA 4FKLA 4QQCA 4YLKA 5FG8A 3ZTXA 4I6HA 3R30A 5BVWA 2IG7A 2RIOA 4O0RA 5E8UA 5K0KA 2Y6MA 2A0CX 4W4YA 1O6LA 4UWCA 3MY0A 3REPA 1U59A 4FTMA 4K0YA 4I5HA 5CALA 1Q41A 3GVUA 5JGBA 3W16A 4IM0A 3W0NA 4YLJA 1LR4A 4E6DA 3LXKA 4G3DA 4RJ3A 3Q52A 2RG5A 2X0PA 4WBBB 2WTKB 3ORLA 5E8ZA 4OT6A 4RZVA 3WF5A 4NCTA 4DFYA 5EQEA 1Q8WA 2VTTA 4R1VA 4C35A 4JRVA 3DQWA 4YTIA 5BUIA 3QTRA 4FSYA 4I4EA 4PX6A 5LCKA 4RVMA 4FR4A 5AUUA 5LMBA 3QD2B 5L6WL 1RW8A 4PMSA 3F5UA 4ZEGA 2BZKB 4AT5A 4IX3A 4LMNA 3C13A 3C4FA 4FZDB 3AMBA 3KGAA 1KE7A 4R5SA 3QBNA 5F4NA 3R6XA 3VWAA 3EWHA 4AW5A 4OUCA 3HUBA 3UG1A 4JDJA 4TYHB 1H26A 1R78A 5L8KA 3TUCA 1PKDA 3ORKA 3Q4UA 3LFCA 3O8UA 4MWIA 4M84A 4RQVA 1OKWA 4R3CA 4EH6A 5AX3A 5E1SA 1ZXEA 1F0QA 4L67A 3QQKA 2XKDA 4JXFA 3MTFA 2X4FA 4LG4A 3V5TA 3UYTA 5J1VA 2R3NA 4EYMA 4MVFA 3NR9A 3VRYA 2IZRA 3UVQA 3LPBA 4NW6A 5BYZA 4NK9A 5FXQA 2OFVA 4MBLA 1YXTA 3LE6A 3KL8A 3TG1A 5CF5A 4JJRA 4KINA 2XB7A 4JG7A 4KRDA 2ZV2A 2XRUA 3TT0A 4AQCA 4BBFA 3RI1A 5J9LA 4C61A 1YXUA 3RMFA 3QUDA 4YR8A 3TNWA 3U6IA 4EOJA 3G2FA 1J3HA 4EH5A 1F3MC 4U0IA 3ZBXA 3QZIA 3OWJA 2WXVA 3BHTA 4NL0A 5AR8A 3DB6A 3U54A 4Y83A 3MFUA 4F9CA 4CZYB 2BZJA