4C37A

Pka-s6k1 chimera with compound 21a (cct196539) bound
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
338
structure length
335
Chain Sequence
ESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSYGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVLEYLPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title The Discovery of Potent Ribosomal S6 Kinase Inhibitors by High-Throughput Screening and Structure-Guided Drug Design.
pubmed rcsb
source organism Bos taurus
total genus 112
structure length 335
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c37A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c37A02
3QRUA 4MCVA 3FMMA 4C35A 2ITTA 3IKAA 3RHKA 3PDTA 2F2CB 3JYAA 3F6XA 3R71A 1CKJA 4KKEA 4CV8A 4DA5A 4E4XA 2HZ0A 1XH7A 2OKRA 4B99A 4XCUA 5HU9A 4Y73A 3R73A 5CALA 2ITQA 5A6OA 5AR2A 3MJ1A 5GIPE 3MYGA 2I7QA 1XKKA 5H8BA 2V55A 3K2LA 4CRSA 2GFSA 5GJGA 3MS9A 4AW0A 5C1QB 4UMTA 2ITPA 4EQUA 1J7IA 5KX8A 2FH9A 3PYYA 4S30A 4WG3A 1XH5A 4LL5A 5D7AA 1S9JA 2YCSA 3FLYA 2C0TA 4K11A 4MTAA 5K9IA 5LVMA 2B53A 3TKHA 3NX8A 4ZTLA 4E4MA 4UXQA 3G6GA 5HNGA 4S2ZA 5I9WA 3AC3A 4G5PA 3EWHA 3NLBA 4FF8A 4XG9A 5HI2A 4NUSA 4R7IA 4WKQA 3GC0A 4YUQA 3QTQA 2C6IA 3EQPA 3I6UA 1WFCA 3OY1A 2BHEA 3EN6A 2X39A 5EKOA 2WQMA 2X81A 4MVFA 3AT3A 3EN4A 2OJ9A 2CGUA 4H58A 3VS1A 4D4VA 4DEBA 2W0JA 4IAIA 4EOJA 1XH9A 3AMBA 3BE9A 4DGGA 3ZRMA 3BYSA 3FXWA 5K0KA 4IQ6A 1B39A 3OZ6A 3BQCA 3ELJA 2X9EA 5D11A 1YWRA 3PG1A 3SDJA 3GU8A 3SRVA 5AUUA 2XCKA 5M56A 3CSVA 3CTJA 2QC6A 4QPMA 4AW2A 1BI8A 2OG8A 2GDOA 4RT7A 4BKZA 1KE7A 5AA9A 2OSCA 2YCFA 4I41A 4GMYA 1JKKA 5CU4A 5EYDA 4DG2E 2VGPA 4ENXA 1KV1A 2I0YA 3EKKA 4E8AA 4KNBA 3OXIA 4MD7E 4XG4A 2PVHA 4H3QA 4ASXA 5KMMA 1OL1A 1MRYA 4NEUA 4KD1A 4KBCA 3E7VA 3KRLA 3PRFA 3MH2A 3PVUA 4OTHA 4PV0A 3A2CA 4E93A 4G3CA 4RJ7A 3P4KA 2X7FA 3FSFA 3O0GA 1HOWA 3QCQA 4YZBA 5EW8A 4I23A 2GNHA 4YPDA 4C3RA 3PY3A 5J9YA 2OI4X 3GT8A 2ZB1A 2YM4A 3A7HA 4WNMA 4EC8A 2F57A 3F7ZA 2FA2A 3CKXA 2PVMA 1H01A 2PZIA 2HIWA 5AR3A 4Q5HA 5DLSA 4L43A 4FOBA 3DY7A 5ANKA 3R8VA 4FT7A 2FVDA 2HK5A 4M8TA 4QMUA 1ZYCA 2RL5A 3K5VA 3ZXZA 2X4ZA 4QYHA 1IRKA 1M2PA 5EFQA 3G33A 2WQNA 1Z5MA 3F9NA 3FMDA 2BZKB 2QNJA 5FD2A 4FIIA 4AA5A 3HDNA 3LQ8A 4U0IA 3I79A 4NIFB 2VD5A 4S33A 3VRYA 1CSNA 4UALA 2Y6MA 5DEYA 5I9UA 3CJFA 2YJRA 3E88A 4C62A 5BVWA 4WRSA 5AP1A 1R3CA 5M4FA 4O7VA 4I93A 4DYMA 4ZTMA 2Q0NA 1W7HA 4LI5A 4F6UA 5HLWA 2REIA 5EG3A 5L6WL 3C4FA 3VS7A 4J96A 2FB8A 2ZMCA 4YU2A 3QHRA 4M68A 1UU7A 3FZRA 3R1YA 1NVRA 4EI4A 2WTKB 4DEEA 2QCSA 4DLIA 5CAPA 3NVKI 4GG5A 4BCJA 3QX4A 4RLKA 4XLVA 2BCJA 2WGJA 4KUJA 3W32A 4UMPA 3DLZA 3HVCA 4U45A 4D2TA 1YOLA 4EYJA 2BR1A 1XHAA 2QO7A 3OCSA 4ZJIA 5TT7A 5D10A 4YJRA 2A19B 3D2IA 4O0SA 3PXKA 4FEWA 3TJDA 1T45A 4L6QA 5FTOA 4QP2A 3BGZA 1H07A 2J0JA 4IAAA 4TNDA 5I5ZA 4ZY6A 4UXLA 1JPAA 4G34A 3R21A 2FO0A 3P86A 4RQKA 3TL8A 4XG3A 3EQFA 3F5XA 3WZEA 5IQFA 1H24A 4PPAA 1WBTA 2VWBA 2Y4IC 4EQMA 5J7HA 1O9UA 2C3KA 5DH3A 3WARA 2WOUA 3FAAA 3R04A 3ENMA 4GL9A 5ETFA 3RNIA 3L8PA 2FUMA 4EWHA 4IX3A 4WIHA 2GNFA 2IVSA 3FC1X 3P78A 2CGXA 3TTIA 3AQVA 3I4BA 3ZS5A 5J5TA 3LOKA 2WMWA 4JQ7A 5AUWA 4V05A 1Q8WA 3OOMA 3W8LA 3U55A 4H36A 1F0QA 2IN6A 3SXFA 4WD5A 3LFCA 5ETCA 2G9XA 3KULB 2WNTA 2R2PA 2ZB0A 4NYEA 3AGMA 4GIIA 4UY9A 3WIKA 4EOPA 5DPVA 2QQ7A 3G6HA 3ZFXA 5HVKA 1URCA 3TDWA 5G1XA 5ICPA 1SNUA 2YM6A 1B38A 3UOLA 3OVVA 3ZCLA 4QMZA 4YBKA 4OTDA 5LMBA 4I0TA 4PMMA 4GT3A 3MDYA 2ZAZA 4NCTA 2ITVA 4RRVA 3Q04A 4MKCA 2CKPA 3BU6A 3L8XA 3PIXA 3R01A 2ITZA 2P33A 2PE1A 3FLQA 5HESA 1J7LA 3SA0A 4YLLA 4K1BA 5AMNA 3QA8A 2Y0AA 1JSTA 3LMGA 5M57A 2ZM3A 4FV7A 4JAJA 3R7VA 5E4HA 5ANDA 4X2KA 1ZXEA 4FL1A 4XEYA 3KXNA 4O22A 2GSFA 4JX7A 4HCVA 3V6RA 4AOIA 1OIQA 4E4LA 2PYWA 4ZTQA 3BPRA 1FMKA 3R2YA 3SHEA 5A46A 5L8LA 5LWNA 2GFCA 3V5PA 4RZWA 2W9FB 1PW2A 1ZMVA 3HL7A 4NU1A 5I0BA 3QGYA 2DS1A 2UZOA 5CSXA 4YNEA 4JDIA 2YN8A 3F66A 5EK7A 4C2VA 5LVOA 3JPVA 4FZDB 4KINA 2J6MA 4CCUA 4AN3A 4AUAA 3P0MA 3A60A 2P2IA 3UOJA 1Q8TA 4FV5A 3RM7A 1UKIA 3FL4A 5JZNA 4DH5A 4F70A 5CAUA 4FEQA 4RIXB 1H0VA 4O6LA 3BLRA 2W4OA 2PPQA 4ORKA 3HX4A 5TO8A 4UX9A 2Q83A 3QCSA 5L8KA 1R0PA 2YIRA 3QTXA 2NPQA 4BYJA 2CMWA 4GFMA 3DLSA 3ZLXA 5DI1A 2QO9A 2HENA 3DAKA 4HCUA 2F49A 3QTIA 4GJ3A 4K18A 3ZLSA 5BUJA 1SM2A 3PVBA 4FTRA 2YM5A 3CC6A 1Y57A 3KREA 4LL0A 5DEWA 3ZM4A 3AT4A 2JAMA 5CF5A 3U4UA 1BMKA 4XOYA 3TUBA 2KTYA 1WBNA 1EH4A 4O1PA 4L3PA 1MQBA 2Z7RA 2WU7A 4Y95A 2VTAA 3A7JA 3T8OA 3AC5A 2FSLX 4MBLA 2OU7A 4OT6A 5BMSA 4DT9A 3F2AA 1REJA 2Y9QA 5FTQA 2EB2A 1BYGA 3FXXA 2C5XA 2W17A 5GJFA 4QOXA 3NYVA 4FT3A 1NXKA 3W10A 4RJ3A 5E8TA 1H08A 4E5WA 5J95A 4H3BA 3RBWA 4DC2A 5IDPA 3C50A 4AS0A 4IX5A 3IW8A 2VTLA 5HBHA 2IW8A 5E9EA 4BIDA 4AT3A 2JC6A 5CI6A 4LV5A 4F1TA 3N9XA 4FICA 3OWKA 4ANNA 2ZV2A 4FK6A 3T9TA 2OGVA 4PPCA 4U80A 3H4JA 2WOTA 3FMHA 4G9CA 1ZRZA 5KHXA 2XF0A 4ZEGA 3D83A 3R7YA 3L8VA 4AZVA 5M06A 4FOCA 5J8IA 4EOKA 2RFSA 2W06A 4QP6A 4PTEA 2VZ6A 2WMRA 2F2UA 2XNPA 4DCEA 4E1ZA 2BTRA 3G9LX 4YURA 4IVCA 4FNYA 4XBRA 3U6HA 3L9PA 1CTPE 4JG8A 1OKYA 4OTWA 4FSYA 1YHWA 4BCIA 3ZMMA 4YZ9A 4R7BA 2J5EA 4IX6A 4YC3A 4ZXTA 4V0GB 3QYWA 4Y46A 4UB7A 5CZIA 3M11A 2GU8A 2IVTA 3P7AA 4N70A 1TQMA 5AP7A 4ACMA 4O0RA 4AGDA 4AOTA 3OCBA 3ORMA 5F20A 4CFVA 4MQ2A 1J1BA 4YZDA 1Y91A 3R02A 4IFCA 3A4PA 4E7WA 5KMLA 3P23A 2OIQA 2G01A 1OGUA 3KVWA 3PPJA 3UNZA 3FY2A 3ZDIA 5GZ8A 5M51A 5DYJA 2RFNA 4QRCA 4FUXA 4NIFA 5EOLA 5HQ0A 1PF8A 4RX5A 2B7AA 5CVHA 5F1ZA 2VTSA 1R1WA 3JVRA 4FTMA 4HGTA 1V0BA 3GU7A 2OZOA 3LFSA 1GAGA 5C27A 2PY3A 3O2MA 3QRTA 4I21A 3UP2A 4DG3E 3OCGA 3OROA 4JAIA 4NFMA 3RHXA 1WBOA 3RK9A 1PJKA 3U87A 5JRSA 4JIKA 2E9NA 2R4BA 4D58A 2OF4A 1YW2A 2VNYA 3EQHA 3WOWA 3HUCA 4O83A 4NW6A 4BGGA 4EZ5A 3PE2A 3R63A 4MNFA 5C01A 4JQEA 5AUYA 2OLCA 3RGFA 5EOBA 4DITA 3F3VA 4TT7A 4XYFA 4QTCA 3OS3A 4DN5A 4GYGA 2UZLA 3DTCA 4ACCA 5IQIA 1NY3A 2R3MA 3DBEA 4LRKA 4PDSA 4X2JA 4BFMA 4EOSA 3F7WA 4PL3A 3HMOA 5GINE 2XA4A 1H1PA 1XR1A 2O5KA 1DAWA 1Q61A 3E8EA 3O51A 4FKSA 4B6LA 4BWPA 2XKEA 1JKLA 3FLSA 3QQUA 4HGSA 5HBEA 5IA1A 3W55A 3F88A 5HE0A 1CM8A 3MPAA 2VTQA 3IGGA 2GNLA 3QTZA 1OUYA 4JBVA 4FGBA 5DT4A 4M67A 2V7OA 4ERWA 3DBDA 3VHKA 2O64A 2W4JA 3DGKA 5FG8A 5IA3A 1YXUA 1Y8GA 4I94A 1LEZA 4R3CA 3VAPA 1UNHA 3GOPA 4L3JA 5ANOA 4DH8A 5G6VA 3GB2A 5HZNA 3SVVA 2BTSA 4AE9A 3DA6A 2PZ5A 5J9ZA 2I6LA 3PVGA 3S0OA 4YZCA 4K8AA 4PDOA 5CZHA 5C03A 5IQCA 4FKWA 3R8PA 5AV2A 2QR7A 4B0GA 5AM7A 3KULA 1UU8A 2IVUA 4DGNA 3B2TA 3DV3A 1W84A 3FZPA 3NZ0A 3E87A 4HCTA 4IFGA 3EL7A 4GU9A 4U41A 5DBXA 3R8UA 4BTKA 2ZV9A 3R0TA 1RDQE 3F3ZA 1TQPA 3NUSA 1CKPA 3BCEA 3CCNA 3F5UA 3G9NA 5AX3A 4YJUA 3RPRA 3V04A 5CU2A 3R1QA 3SC1A 5GZAA 3R9RA 3W8QA 3T3UA 2XIKA 4MBJA 4ANBA 2BDJA 2NRYA 3EQCA 4KA3A 5HG8A 1JVPP 2WTKC 5IQHA 5BVKA 2OIBA 4YTCA 2UZBA 4RMZA 4XRLA 2QHMA 2X8DA 3LZBA 2GQGA 3TNQB 2PUUA 2OFUA 3PSCA 2OJFE 3IW6A 1MQ4A 4TYHB 3UOHA 4DINA 4EYMA 4IADA 2WMBA 4AGCA 3VO3A 2QOFA 4J8MA 3W2OA 1IR3A 4UYAA 1U5RA 4I5MA 2XCHA 1P5EA 2W9ZB 3DQWA 1BUHA 4ACDA 3E5AA 3ZBFA 4IM0A 3W2CA 3IONA 2ZM1A 3FE3A 4FIHA 3PJ8A 3CKWA 4CFUA 3CE3A 1DAYA 1TQIA 2BAKA 4RJ5A 4L7FA 5KBQA 1IASA 5CI7A 2XK6A 3O23A 2VTJA 1WBSA 2XK9A 3BGPA 2ETMA 3IPHA 5AEPA 4CLJA 4NK9A 5HX6A 5C4KA 3R30A 2YACA 3F61A 1OL5A 1QPCA 2YM7A 1KSWA 4F1OA 5BUEA 4E6QA 1MRVA 3QC4A 2X6EA 3HA8A 3BX5A 3CP9A 2W1FA 3AD5A 3ALOA 3OY3A 1FVVA 3QZGA 4BY9E 3G5DA 3TWJA 4AW5A 1GY3A 1P4FA 4MF1A 4RIXA 3W2QA 5L4QA 1NT2A 2PTKA 4EKLA 5JSMA 2C30A 3MWUA 2UZUE 3H9FA 4FYNA 3VBXA 4QTEA 5LOHA 2BFYA 5AV0A 4F9YA 4X0MA 2YWVA 4Z3VA 5EM6A 4TWOA 4G3FA 3DFCB 2E9VA 3BEGA 3W2RA 2FSOX 4E6DA 2BRMA 1Y6BA 3GU5A 3OUKA 4LFIA 3O8TA 3HLLA 4A4XA 2A4LA 2PZYA 2UVYA 4YC6A 4DH7A 5EHLA 4G9RA 5ETAA 4ZAUA 5A4TA 4QTAA 3CQUA 3Q9YA 3UQFA 4ASDA 2C0IA 4WNPA 4ENYA 5AFVA 2YABA 4Y8DA 4R7HA 3CJGA 2C5VA 2HWPA 1PKGA 4W9XA 3HRBA 2Z7QA 4XNEA 2WO6A 4YJNA 4LRJA 3Q5IA 3RWPA 5IQGA 3VS4A 5A6NA 1RW8A 3UOKA 3N51A 2WMAA 2JDRA 4I22A 2HY0A 4C33A 1BX6A 2CNUA 5C8NA 4RJ4A 4J1RA 4YGAA 3AT2A 2JDVA 1GZOA 5BMMA 3RM6A 4O7RA 5KCVA 3TZ8A 5BUIA 4BCPA 3RALA 3C0GA 3FKNA 3U51A 5CNOA 4C36A 2VN9A 3HZTA 4R77A 3ZFYA 2LGCA 1FINA 4FSMA 4MEDA 1IAHA 3OWJA 1H1QA 2C5NA 1BLXA 4NL0A 2BALA 5E8UA 4ZSAA 3TZ7A 4KIPA 2I0EA 3F69A 2XUUA 3HDMA 4AN2A 2VNWA 3NWWA 2W7XA 4D1SA 3FQEA 3C4CA 3FMLA 3NUUA 4IMYA 3ZRKA 4QMLA 4GYIA 5J1VA 4AZSA 2YDKA 4NZWB 4ASZA 1WMKA 2W4KA 2O0UA 2QOCA 4EKKA 4WT6A 3DZQA 5HTBA 2JLDA 4XV1A 1SVGA 4OR5A 4PP9A 4ONAA 2X7GA 3VW6A 3V5QA 4KRDA 2JFMA 3EH9A 5T3QA 4L52A 4A9SA 3R22A 5HIEA 2HWOA 4O38A 4YNOA 3MPTA 3Q9XA 5AP0A 5AV3A 3AC2A 3ZXTA 3D4QA 1E9HA 3E93A 3GCUA 4YJQA 4BCNA 2GS6A 3I0QA 3NIZA 4TWNA 4CYJA 5HORA 3LCOA 3GCQA 1P2AA 2UZNA 2UZVA 2JBPA 3BZ3A 3CPCA 4RFYA 4XBUA 4AW1A 4DFZE 4EBWA 4HVIA 4YLKA 1O6YA 2RG5A 2UZEA 3FI3A 3MFRA 3KK9A 5FWKK 3VWAA 3KRJA 3R9DA 3OD6X 5HCYA 1VEBA 2VAGA 1SNXA 3S2PA 4QMTA 3BYOA 3UNKA 4CFNA 4HVGA 3OCTA 1VR2A 4M12A 3M1SA 4RA5A 5CNNA 1ERKA 4EK8A 4IB5A 4RPVA 3QF9A 3H10A 4C59A 1M7QA 4QMYA 2W1IA 5FBOA 5AR8A 1JAMA 3HMIA 3KC3A 1HCKA 5AJQA 1K2PA 3LFAA 1M2RA 2QI8A 3UVQA 3C51A 3F3UA 1IA8A 2DYLA 4DE4A 4FZFB 4YJTA 4QQCA 5CAOA 5EM8A 5E8XA 4QP9A 3EJ1A 5FUTA 2OXYA 3MFSA 3HMMA 2AC5A 4D9TA 4IWQA 1A9UA 4OGRA 3PWYA 3THBA 3DNDA 2QOOA 3F82A 5AIKA 4KWPA 4EL9A 5FDPA 4BDCA 2YCRA 3RKBA 3JY0A 4WRGA 3EQIA 1VJYA 3WYXA 3HEGA 2VGOA 4JDKA 3VIDA 4BCOA 5BX0A 4CG9A 3LXKA 3TUCA 2J90A 1G8AA 3L9MA 4R5YA 5HD7A 3RPOA 1FBNA 3GU6A 1OUKA 2UW8A 5IH4A 3KF4A 4L68A 5CX9A 5ACKA 3NUNA 4K6ZA 2UV2A 2BZJA 5CXZA 4XG2A 2OO8X 3V6SA 1I09A 4BC6A 2C69A 3VBQA 2B4SB 5HVYA 4EHVA 5JT2A 3DZOA 4OBPA 3NUPA 4UN0C 1Q8ZA 2C6LA 2OXDA 4Q5EA 4FNZA 4RVTA 2B0QA 3LMHA 2XK8A 4EHGA 2ITYA 3RCJA 4BRXA 3DBQA 4APPA 3GQIA 4PTGA 2QVSE 4CFXA 3R8MA 5HTCA 3FI4A 1WCCA 4X7QA 2ITUA 3P08A 3DT1A 1Q62A 4LYNA 1W83A 5H8EA 3S95A 5J79A 3V5JA 2Z7SA 2HZNA 5HG5A 1YOJA 3A7GA 1DM2A 3R00A 4M97A 2JGZA 4TYHA 4UMQA 3FXZA 2ZVAA 3EQDA 2GHGA 2PHKA 3OBGA 2AYPA 5AIRA 4YPSA 2B9JA 5FBNC 1OI9A 3VJNA 3MESA 4BDFA 3NW7A 4CFFA 4IWDA 5IQEA 2XYUA 5EHYA 2E2BA 4W8DA 3E8DA 1UU9A 3WILA 4J7BA 4BBMA 1WBPA 4I6FA 4BCHA 5D41A 3MBLA 3O71A 3P7BA 4XV2A 2R3NA 3ZLYA 4FYOA 5EW3A 4EZ3A 4FKJA 3QQLA 4X21A 3SAYA 1R0EA 3WZJA 4GS6A 1U59A 3O96A 3ZH8A 4L46A 1JKSA 2ERKA 4W4VA 3BHHA 4FKQA 4YTHA 5DGZA 2XK3A 4EOOA 2OBJA 4Z55A 4O7TA 2XZSA 3O17A 2C6DA 2QONA 1OL2A 2F4JA 4U81A 3UIUA 4C4GA 2W99B 2GQSA 5EQPA 2WMUA 2CLXA 3BLHA 2W1DA 2XH5A 3F3TA 1ZYSA 2WIPA 2PE0A 4LGDA 5HLPA 4C38A 4NJDA 5CT7A 1GJOA 1PMUA 2C1AA 2OW3A 4CMOA 4AN9A 2R3GA 1YQJA 2OFVA 3QAME 4ZIMA 3IW5A 1E1XA 3LE6A 4JDHA 1J3HA 4X2NA 4IDTA 4Q2AA 2P4IA 2Y7JA 5EYKA 3WZKA 3D14A 4XHKB 1XBBA 2V0DA 5JMSA 5LMKA 2YZAA 5LWMA 1MUOA 4DTKA 4C0TA 3PXQA 5LVLA 4I5PA 1K3AA 2PVNA 2UW6A 3W18A 2W05A 3BLQA 4W9WA 3FYJX 4MNEB 3CR0A 5I3OA 4BB4A 3NRMA 3BQRA 4M84A 1ZARA 1CMKE 3M2WA 4G2FA 3FKOA 2JDSA 3AD6A 3ODYX 5KZ0A 5TKDA 4U8ZA 3CD8A 3QQJA 2VWIA 3QRIA 4AZEA 1FGKA 3R7IA 4O0YA 2Z7LA 3C13A 4RVMA 4F09A 4LGGA 3OHTA 4NKAA 5KE0A 5JQ8A 3FYKX 5IQBA 4RX7A 4Z7HA 3UPXA 2BPMA 4JNWA 3R7EA 1XWSA 4BDKA 4JS8A 4QMNA 3UPZA 4TL0A 4HYSA 5KKRB 2A2AA 3GBZA 3GNIB 3TEIA 4O6EA 2BHHA 4CKJA 3DQXA 4DEIA 3CGFA 3UIXA 4Z7GA 4ACHA 4FG9A 4O86A 5K4JA 3DXNA 3MN3A 5KMJA 5JFSA 3MY0A 1UNGA 3QC9A 3E3PA 2P0CA 2OF2A 3RNYA 3DFAA 2WKMA 2V7AA 3Q52A 4FSZA 4YJSA 3RMFA 4ZOGA 2ONLA 4PWNA 1G5SA 1PXLA 4WBBB 3VUHA 5AAFA 3VUKA 5L2SA 2YIQA 3DKGA 3V5LA 4U9AA 2GNIA 3ZO1A 4NTTA 4XP3A 5CF6A 4WNOA 5LMKC 2PL0A 4FSRA 3QGWA 2WXVA 4UMRA 3RK7A 3QKLA 4DH1A 4Y5QA 3OW4A 3FLNC 2YDJA 4HZRA 5HTIA 3QYZA 4IE9A 1YI6A 4JDJA 5FRIA 5J87A 4FC0A 3R1SA 1UA2A 2I1MA 3GC9A 4HJOA 5DOSA 3PZEA 4EORA 4F1MA 2PU8A 2WQOA 1NW1A 4WBOA 4XH6A 2QLUA 3COKA 3AGLA 4FBXA 5HE3A 2LAVA 2PVKA 2YM8A 4P5QA 2Z2WA 2W1CA 4I0RA 5EDRA 5L3AA 4IZ7A 3LQ5A 4WUNA 5BYZA 3EFWA 4AG8A 5CLPA 4CYIA 5EDQA 3LHJA 3L8SA 4FR4A 3RCDA 2PULA 4P90A 4ZZNA 5IEXA 3ORKA 4DTBA 2VTMA 4EH7A 1PXOA 2WTVA 1ZMWA 3ACJA 2XVDA 3GC8A 4AA4A 4IACA 1VYWA 5HO7A 1J1CA 2GPHA 3VS3A 4CCBA 1Q99A 3R1NA 1U54A 2B1PA 5CSWA 4FSUA 4PY1A 1M14A 1SZMA 2CLQA 3DKFA 4O7NA 3IGOA 3CIKA 4C34A 2VU3A 3TNPC 4ID7A 4AGWA 3FPMA 4ZS0A 1OKVA 4ZSEA 4X3FB 3QX2A 2VX1A 4D28A 1JOWB 3ACKA 4USFA 2ONLC 3MFTA 5LQFA 4DBXA 4MF0A 3MB7A 1UKHA 4P7EA 5AUZA 2YLFA 1QMZA 5EM5A 2QOHA 5BVEA 2BFXA 5HCXA 2F9GA 5KZIA 4RC4A 3ORZA 2VO0A 3ZBXA 3NYNA 5A3XA 5LMAA 4IVAA 2GNJA 3AC8A 2QOQA 3E62A 3FZ1A 3HUBA 4ALVA 2WAJA 4FEVA 4LMNA 4O2ZA 2WTDA 3A99A 3EQGA 4EK5A 3Q53A 2C0OA 2JEDA 4GVAA 4NM7A 3NW6A 5L2TA 3VBVA 2NNWB 3NAYA 3EOCA 4G3DA 2QOKA 4RGJA 2CJMA 3PXZA 3PLAE 1H8FA 3PP0A 4K2RA 1F5QA 5HD4A 3I7CA 5CEQA 4CRLA 3I5ZA 3DU8A 4RA4A 4AXAA 5TOZA 2IZRA 5BVNA 4S32A 3C4WA 3IECA 2YAAA 4KBAA 4IW0A 3V3VA 1PRYA 3PSBA 3H0ZA 1CDKA 2AUHA 3H9RA 4DEAA 4PMTA 5L2WA 2H6DA 3QBNA 4H1MA 4U3YA 2QODA 3QCXA 2F7XE 2ACXA 3NNVA 4C4EA 4RJ8A 4EOLA 1ZZ2A 3KK8A 4QMMA 4RIWB 4RX8A 5AP2A 5EYCA 3VS0A 4CLIA 5FM2A 3I1AA 4K77A 2XNEA 4ZTSA 4F9WA 4JBQA 3IS5A 5I9XA 3VUMA 4GIHA 4I5CA 4EQCA 4F4PA 3ZZEA 3IDPA 4QYYA 3JVSA 5FEDA 3WYYA 1LPUA 3QWJA 2B9FA 3OXTA 4PL5A 4XJ0A 3KMUA 3V51A 3E92A 4C4IA 3WBLA 1A06A 2IWIA 1G8SA 1IEPA 3FWQA 4FZAB 3LXNA 4IM3A 4AZFA 2EXCX 3LCDA 5HNIX 1LEWA 2C5YA 2QU5A 3DKOA 4XX9A 4BKYA 3MTFA 4ACGA 4ANSA 4NCTC 4RLLA 2RGPA 4LGHA 3BU5A 1S9IA 3QTWA 3WE4A 3WF7A 4YSMA 2GS7A 3DDPA 4TN6A 4BZNA 5KUPA 4BDJA 4XRJA 4HVDA 4TYIA 5IU2A 1PXIA 2IG7A 3UO5A 5CSVA 2CHLA 2XP2A 2ZDTA 4YO4A 2CNVA 1WAKA 2C68A 4O7ZA 1LUFA 5AM6A 3KEXA 3LLTA 4BWXA 3W1FA 4QT1A 1OITA 1PYEA 4UZDA 4FV2A 4IAFA 4FKLA 5KMNA 3ZDUA 4QP1A 2J4ZA 3ZYAA 2BAQA 3ZC6A 2B55A 3ORTA 4BGHA 3BRBA 2DUVA 2HXQA 3B8QA 2YISA 3SW4A 2WFYA 2J51A 4BCQA 3R2BA 3HV3A 4L42A 4YZMA 5LARA 4EUUA 3DOGA 4JG6A 3ZONA 5BVFA 2XK7A 1UU3A 4U6RA 4U43A 1W0XC 4FKTA 3EYGA 1KOAA 4YP8A 4EWQA 4MXZA 2YIWA 4RG0A 5M4IA 4ZTRA 3GFEA 4O27B 4MNEA 3DPKA 1ZY4A 4XLIA 5FEEA 3ID6C 1P14A 3G90X 1YXXA 4KIOA 4EH5A 2BIYA 2R3QA 4YMJA 2X9FA 4CMTA 5JFWA 4RFZA 5JK3A 3R7UA 3SLSA 2VV9A 3ANRA 3OOGA 3PA4A 4D1XA 4EJ7A 2R0UA 3PIYA 4H39A 3FKLA 4JG7A 2R3JA 1VZOA 4C37A 4DHFA 4FTNA 2YZLA 5ANGA 3U9NA 2BKKA 3VUIA 3KU2A 2PSQA 3RVGA 5A54A 2C1BA 5A14A 2P3GX 1UNLA 2R7IA 2VTNA 1H1RA 3LLAA 4H1JA 2PWLA 2R5TA 4AGUA 3NPCA 1YWNA 4NH1A 3ZZWA 3LFQA 3FEGA 4R8QA 2UW9A 3GCSA 3OEZA 4QP4A 2FSMX 3V01A 4RIOA 3DCVA 3KCKA 4R6VA 3BBWA 5CSHA 5BYYA 1YI4A 4FI1A 4G6NA 5DRDA 4CFWA 4HGEA 4BZDA 3FMJA 1OB3A 3NSZA 5FDXA 5I4NA 3I0OA 2Y4PA 4ZSLA 2CDZA 3VN9A 4D0WA 4AACA 4FKGA 4FV8A 3D5VA 2YM3A 3PFQA 4PDPA 2IW9A 4FG7A 4GW8A 2UW3A 4XG7A 3SXSA 2XRUA 4F6SA 1YHVA 4TW9A 4KSQA 5CANA 2R3FA 3VNTA 3NW5A 4LUDA 2CPKE 4CVAA 4EEVA 2C6TA 3PSDA 1PXMA 2WEVA 1GIIA 4MH7A 3CPBA 2UUEA 4J98A 4E73A 3NCGA 4L45A 3DK3A 4ANLA 2ITWA 4IB0A 1FVRA 5HNBA 4D0XA 1YDRE 4U79A 5AAGA 5JQ5A 5B0XA 5B2MA 3HAMA 4LOQA 2OH4A 3LFFA 5IG1A 5LXMA 5TR6A 5M08A 5GIOE 1B6CB 4XMOA 4DCAA 3ET7A 4M0YA 2ZDUA 2OH0E 1R78A 4RIYB 4K9YA 2WU6A 2HXLA 5D12A 3B8RA 1PXNA 1H25A 2XS0A 3PXRA 3AMAA 4G5JA 4RSSA 4U44A 1Q8YA 2WIHA 3OBJA 5C8MA 2FYSA 5HG7A 5GNKA 4Z16A 3QUDA 3IDBA 5E92A 4CZYB 4OBQA 5T6KA 2CSNA 4IZ5A 4OLIA 5DIAA 3ZSGA 4BWKA 4QMOA 3MY5A 3TTJA 5EQEA 2J7TA 2OK1A 2NP8A 3CY2A 5IISA 3C4XA 4RZVA 5E1SA 4H05A 2R3PA 3L1SA 4BCMA 4BR3A 3NUYA 4FIJA 4CV9A 1IG1A 2R0IA 4KRCA 5IQAA 1YDSE 3TV6A 1U46A 3H9OA 2QOBA 4X3FA 2C4GA 4ZSGA 4E6CA 3KQ7A 3LCSA 5CS6A 5CTPA 1DI8A 5AAEA 5KMOA 3MPMA 4F7NA 3LJ2A 2GNGA 3Q4CA 3ETAA 3LM5A 3POZA 5DE2A 4ERKA 1APME 4L7SA 3GC7A 5AP5A 5F95A 2XEZA 1IAJA 3D5XA 3QQGA 5LVPA 3EKNA 1R39A 3GEQA 3JR1A 5EI8A 3DBCA 4BHNA 2YERA 3MH1A 4S31A 1M52A 5GHVA 1KE9A 3WF5A 1O6KA 3PA3A 1NVQA 3JXWA 3SX9A 4YSJA 3VJOA 1IA9A 3Q2JA 3UO6A 4YHTA 3PZHA 4BYIA 4JL9A 4BDEA 5B7VA 2QG5A 4FL3A 1J91A 3OWLA 3C0HA 4L67A 5HHWA 4FKPA 3DXQA 5IUHA 5L2QA 2PVRA 4FL2A 3DKCA 5HG9A 4D55A 5I9ZA 2ZOQA 4CTBA 4ZMEA 3ZM9A 3ORIA 2GQRA 2C3JA 3CQWA 4KS8A 5H9BA 3TM0A 3II5A 4MXOA 2J9MA 2W5BA 3FI8A 4OAUC 4BZOA 4JJRA 5J5SA 3PP1A 2WMSA 3O7LD 5FTGA 1OPKA 5EHOA 5B2LA 4C4HA 3QUPA 1UV5A 4NTSA 2C6MA 3W16A 4D2RA 2XJ1A 3ZUVA 4EK6A 3ZTXA 4UWCA 4BKJA 3HMPA 2BILB 4QMSA 3HRFA 4EHEA 1M17A 2OZAB 4PQNA 5H3QA 3GU4A 3EQRA 4EH3A 4KKGA 1FOTA 3E8NA 4RIWA 5JGAA 5M07A 5ACBC 4RVKA 4C57A 2YIXA 3JUHA 4O1OA 5CEKA 1DS5A 2HZ4A 4ZS4A 2XIYA 3I6WA 4I6BA 4UZHA 3RINA 2J0LA 4R3PA 4X3FC 5C9CA 2YHVA 3NIEA 3PJ2A 3ZUUA 3MH3A 3QUEA 3BBTB 4FV6A 2QO2A 1SYKA 3ORNA 3Q4UA 5I9VA 5EKNA 3TKUA 5CQWA 2I0VA 4AT5A 4HYHA 1ZYDA 2GCDA 3GOKA 3QU0A 3CQEA 1JKTA 5H2UA 2UVZA 4BVUA 5BPYA 4MX9A 5IEVA 2W1GA 4TZRA 1JQHA 5IEYA 3BWFA 5IMEA 3ZO3A 4BGQA 2B54A 3KMMA 5KHWA 4UV0A 2VO7A 5JKGA 4FIGA 3NVMB 5E8WA 4EOMA 3D2KA 4N4SA 3VUDA 4ZZMA 5HCZA 3FHRA 3U9CA 4QYFA 4KKHA 4UMUA 4GK3A 1STCE 4E6AA 4I24A 4NSTA 1XH4A 3TZMA 3LCKA 2BKZA 4O0VA 5E91A 3QQHA 2JIUA 4HYIA 4MXYA 1FQ1B 4BIBA 3W2PA 1PXPA 3KF7A 4GU6A 2VUWA 2XKDA 4F9AA 4FKIA 1ZWSA 3HV5A 2HCKA 3CTQA 3OUNB 3Q60A 4C2WA 4FKUA 1KUTA 5DR9A 3TNWA 5HIBA 4KBKA 2VTOA 3DK7A 4I6HA 3LXPA 1PXKA 4PDYA 3LFBA 1M7NA 3D5UA 2O65A 3TUDA 4AQCA 2V5QA 4O0UA 4HYUA 3A7IA 2BRHA 5D7VA 2BAJA 4O0WA 4YJOA 4IBMA 2Y4IB 4JXFA 3AOXA 2R7BA 4RQVA 4GVJA 3WF8A 2GHMA 1WVYA 1I44A 4XOZA 4Y72A 2RF9A 3DS6A 4BF2A 3HGKA 5M44A 1X8BA 2IZTA 2QU6A 2R9SA 3TG1A 2J2IB 2XB7A 2G15A 4QMXA 4EH6A 4R1YA 2Q0BA 1O6LA 1OIRA 2C6OA 3EL8A 4TNBA 5D1JA 1H0WA 5FP6A 1ZOGA 1JLUE 3WI6A 5K0XA 1XJDA 3UMXA 4XP2A 2QLQA 3PVWA 5IH6A 5CVGA 3IK3A 1OECA 1CKIA 5ANIA 3W33A 2PK9A 5CEPA 3GXLA 4D4SA 2JDOA 1BKXA 1FVTA 3DJ5A 3K54A 4ITJA 1XH6A 4NW5A 3T3VA 2A0CX 4NT4A 5IUGA 5D9HA 1RJBA 4RWIA 4F7SA 2VX3A 2IJMA 4KABA 2EWAA 4QP3A 5EH0A 1ND4A 2H8HA 4OTPA 3LFNA 5IA4A 3SKCA 3OG7A 2QKRA 4U42A 4BN1A 5J1WA 4AZWA 2ESMA 3HYHA 3QXPA 2I40A 3GCVA 3UVRA 1OMWA 3PY0A 5DR6A 4P2KA 3NS9A 4CQEA 4OT5A 4F0IA 3UQGA 3WF6A 2X8IA 2X1NA 4FX3A 2A1AB 4RWKA 2WPAA 4HZSA 2CN8A 2J50A 1SMHA 4TPTA 5DR2A 1U54B 1Z9XA 3KCFA 3A4OX 4O84A 4FEXA 5K5XA 5M4CA 2CN5A 4QYGA 4O7SA 4WNKA 2JBOA 1W8CA 2YIYA 4GSBA 4K0YA 4O7WA 4J52A 1OL7A 2WMQA 4RWJA 4U7ZA 1PKDA 2PMNX 2RG6A 3OP5A 3OXZA 4NFNA 3HV4A 5CEMA 4QNYA 3BI6A 3PRIA 3SOAA 5EDPA 3UJGA 2H96A 3LCTA 3I60A 4FEUA 1UVRA 4F9CA 5FP5A 5ANJA 4D5HA 3JY9A 5HGIA 5F9EA 1ZLTA 4GKHA 4RIYA 4ASEA 4CG8A 2GMXA 4JRNA 5BVDA 3MFUA 4EUTA 4N6ZA 5JN2A 1M2QA 4M0ZA 5GZ9A 5A4CA 2WTIA 4FTQA 4FT5A 3QD4A 1KE6A 4FSTA 4FTJA 1H26A 4GCJA 4GUBA 4ZK5A 3PLSA 3PUPA 2WTWA 3TIYA 2X7OA 1KE8A 4GFGA 4HW7A 4YR8A 3DAJA 2UVXA 4JQ8A 4QNAA 3AMYA 3AC1A 4TWPA 4O0XA 3SGCA 3TV4A 3D5WA 1PMVA 3TJCA 2JIVA 4E5BA 4X2GA 5E90A 3EIDA 5DFPA 1ZAOA 1H4LA 2Z60A 4LMUA 4QP7A 5IA5A 2GHLA 5E7RA 3RAHA 4CQGA 4DH3A 3IW7A 3QTSA 5LCKA 2ERZE 3N4VA 2BDFA 4GEOA 3ZU7A 3QD0A 2HYYA 1AQ1A 5A4EA 1FMOE 3LIJA 5DWRA 3ZOSA 1BI7A 4IEBA 5HE1A 4MBIA 4F65A 4Q9ZA 2B9HA 3FV8A 4YJPA 4BHZA 4H3PA 3FY0A 3OFMA 2OICA 4TYGA 5EI6A 3CTHA 2HELA 3R83A 4ANOA 3NNWA 2CCHA 3TKIA 3DB8A 4IJ9A 4LQMA 3UDBA 3GI3A 4PPBA 4PNIA 3NCZA 2XJ0A 3ANQA 5FGKA 2VWVA 2QR8A 2VX0A 4CD0A 5AUTA 4YZNA 5GJDA 3WE8A 4CT2A 3BYUA 3QRJA 4FNWA 3COMA 3VUTA 4ALWA 3PJ3A 5HE2A 1L8TA 4ZTHA 3KRRA 4ZJJA 4HNIA 3A62A 2WEIA 4IAZA 4PTCA 4CNHA 3D15A 4YBJA 5DVRA 5I9YA 1GZNA 4O81A 4E26A 1OIUA 3E3BX 5E8YA 4KS7A 2UW0A 3FI2A 5CVFA 4FKRA 5E1EA 5CWZA 1KV2A 5J9LA 2G2HA 3TI1A 3C4ZA 3G0FA 3LFDA 1AGWA 2OZAA 4W4XA 2XBAA 5AX9A 3NNUA 3QFVA 4LV8A 4DEGA 4A4LA 3R9NA 4IVBA 4YC8A 4D9UA 2QURA 3LJ1A 2X8EA 4YO6A 2XMYA 4TKSA 4U5JA 5LJJA 3CD3A 3FSKA 3PG3A 3ODZX 4LOPA 4OBOA 4QTBA 4N0SA 4NM5A 3AXWA 2V62A 3PWDA 3SXRA 2P2HA 3KRXA 3TNIA 4C4FA 5AADA 3F2RA 4MXXA 4AFEA 4UBAA 4FTAA 1YOMA 4EC9A 4MK0A 4QMVA 4N57A 3HP2A 3ALNA 2EXEA 3BYVA 5DRBA 1H27A 3KXHA 4BIEA 5CT0A 2PZPA 3UVPA 4ALUA 3SV0A 3LW0A 2G2FA 4R3RA 4K33A 5CYIA 5E8VA 3NYOA 1WBVA 3Q4TA 1Q4LA 1ZZLA 4J95A 5DT3A 4BCFA 5I3RA 2XRWA 4XV3A 3QLFA 1K9AA 3HV6A 4FKVA 4U40A 4UWBA 2WMXA 4QQJA 4QYEA 3QTRA 5M55A 3L9NA 3WIGA 4EZ7A 5K4IA 3ZEWA 4CXAA 3MVLA 4J99A 5IMXA 5IDNA 4FODA 3G51A 2VWXA 4M15A 4M66A 2PMLX 1AD5A 3G15A 5L6PA 2J0MB 2R3KA 3F3WA 3DAEA 3BU3A 1PXJA 3FHIA 3VUGA 3CGOA 2IO6A 2C3LA 3HECA 2OIDA 2ZM4A 4O91A 4YJVA 4GK4A 4IH8A 1WVWA 4FG8A 2W5HA 3RAWA 4FMQA 5JGBA 5CEOA 4II5A 4X6QC 4EK4A 4HVSA 4CZUA 2VTTA 4DBNA 4MAOA 4RC2A 4FT9A 2ZV7A 3UP7A 4A9YA 5L6OA 4JX3A 4DFNA 3ERKA 3UZTA 4JOAA 1OBGA 2BUJA 3D7ZA 2NRUA 4J97A 3UE4A 2XKCA 3MA6A 4DEHA 3C5IA 5EW9A 3NR9A 2R64A 3KN6A 4I6QA 1HCLA 5EI2A 3EZRA 3RJCA 4GV1A 2UZDA 3VBWA 4BI0A 5M53A 3U4WA 1V1KA 2IZSA 3BHUA 3TN8A 4LRMA 5HBJA 4O96A 1G3NA 4V04A 3MB6A 4GRBA 3R8ZA 4ZMFA 3WF9A 5IA2A 3UYTA 4A9TA 3EYHA 4D1ZA 3ORPA 3L9LA 4NM3A 4F6WA 4GT5A 2HOGA 3GP0A 5KMIA 4EHZA 5BYLA 1KOBA 3TNHA 4F08A 1NVSA 1XBCA 3IW4A 3V8SA 3UMWA 4E5AX 4AE6A 2RIOA 3QQFA 4FNXA 1H28A 2XIXA 3KXXA 2ZJWA 4JLCA 4HPUE 3E7OA 3EN9A 4DFLA 1YWVA 3FQSA 1OZ1A 4Q9SA 4GJ2A 3Q96A 3QL8A 4CGAA 1TVOA 2PUPA 5K3YA 3COHA 2PVJA 4KAOA 3SD0A 5K5NA 5TE0A 5E8SA 2BMCA 2CGWA 4I4EA 1OM1A 2PVLA 3IG7A 4C02A 4OAVB 2RFDA 2Z02A 3P5KA 4ZLZA 3P7CA 3EHAA 2A27A 2AC3A 3MTLA 3CEKA 3FDNA 4GK2A 5CU6A 3BWJA 4L01A 4BDDA 5JFVA 5HEZA 4OTGA 3N4UA 2O3PA 2EXMA 1WVXA 3PJ1A 2NO3A 3DBFA 4BDAA 4CSVA 2XEYA 4IZYA 4KB8A 4L9IA 4ZSJA 2CKQA 4XV9A 3VF8A 3TV7A 4PMPA 2HW7A 5FXQA 1MRUA 1Q3DA 3FQHA 4YLJA 3ITZA 3R7OA 3Q4ZA 4O21A 2J0KA 3NYXA 1OPJA 1Q97A 3MH0A 5FM3A 4EBVA 2O63A 4WOVA 2BIKB 4WG4A 4FVRA 3GQLA 4AU8A 2IPXA 3O50A 3PTGA 3W2SA 4LG4A 4DFYA 2P55A 3AD4A 4M3QA 5CQUA 4FTKA 4RVLA 2BRBA 4OTQA 3MIAA 2UW4A 3LMIA 2Y8OA 1GIHA 5AR7A 4J8NA 1Q8UA 4DG0E 4G1WA 5F4NA 3ZLWA 3CXWA 4DGMA 4KIKB 4DAWA 4RFMA 1YI3A 3REPA 2BVAA 3S00A 3VQHA 4NJ3A 4F9BA 4DFXE 2XJ2A 2WZJA 5A9UA 5ANEA 2WTCA 4FSWA 3SQQA 2VWZA 2C47A 4D4RA 2VWYA 3V5WA 3IQ7A 5CEIA 4JI9A 4ANQA 3R8LA 3ROCA 3MVMA 2W1EA 4I5HA 3FMKA 4FVPA 2WELA 5ITAA 1QL6A 2PE2A 3LQ3A 4MD9E 4Y85A 3VBYA 4BCKA 3BYMA 3MY1A 5CF8A 1J7UA 2RFEA 2X2MA 1H1SA 3DB6A 3OT3A 2OJGA 4XG6A 4D2VA 5DA3A 1XO2B 4WSQA 3PY1A 4B7TA 4D2WA 4ZZOA 2R3HA 3VS5A 4PNKA 2W1ZA 1RE8A 4G6LA 3KL8A 3C4EA 2X4FA 1OL6A 4USEA 2OJIA 5JFXA 3HA6A 4FUYA 4IVDA 4OTFA 4BBFA 2BZIB 2VTIA 1VYZA 2IVVA 3O8PA 1LR4A 3P79A 4MYGA 2G1TA 2VO3A 4WUAA 4Y83A 4AF3A 2BRNA 5C4LA 4QMQA 4CKIA 4AFJA 2YITA 4CT1A 1H1WA 3PXFA 4TWCA 3ZO4A 3S3IA 4PRJA 1Z57A 3LAUA 2JIIA 4JT3A 5CASA 5CU0A 4BTFA 5CSPA 2PUIA 2H34A 5EQYA 5JEBA 4IWOA 1GOLA 1W82A 3TACA 2BDWA 5HO6A 5DNRA 3GCPA 3VULA 3BHYA 3NDMA 4KIQA 3ZSIA 3D7TB 4GUEA 4LM5A 3FC2A 2CNQA 3QZFA 1PYXA 4FV4A 4PX6A 2EUFB 4J53A 2ZYBA 2JD5A 4F63A 2C3IB 3DNEA 3G2FA 4F0GA 4QQTA 4V01A 5CAVA 3LKMA 4FK3A 4D5KA 2GS2A 3VHEA 4DGOA 4DT8A 5EYMA 4ITHA 1ZY5A 4APCA 3ULZA 3EN7A 2VTPA 3O7LB 3UNJA 2W5AA 2CGVA 1OKZA 2J5FA 3BE2A 4JRVA 3ZEPA 4C3PA 3VVHA 3LXLA 2YA9A 4IDVA 4CZTA 3NNXA 2KULA 4D2SA 1MP8A 2XM8A 2QD9A 1UWHA 3UG2A 3HP5A 1QPEA 2QG7A 2B52A 2X2KA 2YEXA 3SG8A 3KA0A 5LCJA 3IOPA 3E8CA 3ORLA 3MW1A 3QKKA 4DGLC 5AR4A 4W4YA 5JRQA 2XNBA 5IPJA 4FA2A 3RP9A 5AR5A 4NWMA 4ZLYA 3EFKA 3UO4A 2X2LA 3MVJA 3R9OA 4ZP5A 4JR7A 3UC3A 5IH5A 4ARKA 4OTIA 3QXOA 5HVJA 4E20A 3ATSA 5DT0A 5E8ZA 4DTAA 4IB3A 3U6IA 4IXPA 3CLYA 3UZPA 4L00A 3DJ7A 3ROYA 2EB3A 2JKQA 3A61A 1RQQA 4YTFA 2YFXA 3I5NA 3GVUA 4KSPA 3H30A 3TCPA 4C4JA 4CMUA 1ZYJA 4EOIA 3PXYA 1OIYA 4BI1A 4EONA 5AA8A 3MVHA 4ZJVA 2CKEA 5CAQA 5IQDA 2DWBA 2H9VA 2YCQA 1U5QA 2EVAA 3MV5A 2CCIA 3RZBA 2J0IA 4A9UA 3QLGA 4MWHA 3UC4A 1QCFA 3BV3A 2O2UA 4X6RA 3D9VA 2UZTA 4G17A 4U3ZA 3RWQA 5AWMA 3VF9A 5BVOA 4QO9A 2OWBA 3MGYA 2WQEA 4FV3A 4IHPA 3PA5A 4OUCA 4HGLA 2XBJA 3H3CA 1DI9A 5HLNA 4RC3A 3B2WA 5IUIA 5DG5A 4A06A 5CENA 4P4CA 2HW6A 5L2IA 3ZSHA 3GFWA 3OEFX 2ETRA 2W96B 2CKOA 1GZKA 3Q5ZA 1KE5A 1H00A 4AP7A 1REKA 2YAKA 4XP0A 3RPVA 2UW5A 3FJQE 4O7YA 4O7LA 5M4UA 3U54A 3HRCA 3GUBA 3KN5A 3VRZA 4IANA 4BICA 2XYNA 3EB0A 4FT0A 3F2NA 5KNJA 2UW7A 3KXGA 5AUVA 3S1HA 2WTJA 4LOOA 4M69B 4FIFA 4FSQA 4W8EA 1YRPA 4FTIA 3KVXA 2QOLA 4DFUA 4D2PA 3HAVA 3MA3A 3OTUA 4ZY4A 2VWUA 2GTNA 3M42A 3PPKA 3Q9WA 4IIRA 4F64A 4XS2A 5ETIA 3R9HA 1OKWA 3FZTA 2IZUA 4TXCA 2XNOA 2HY81 3VW8A 3UZRA 2WMTA 3VQUA 3Q6WA 3MSSA 5F94A 5AP3A 5KKRC 1A48A 4IWPA 3ZFMA 3QCYA 3I7BA 3PIZA 1GZ8A 4HVHA 3TT0A 3VS2A 4BDHA 5J7BA 1GIJA 2O8YA 5JGDA 4ITIA 3CBLA 5HU3A 3RPYA 5DN3A 4E3CA 3UIBA 3BV2A 4ZTNA 5CY3A 1V0PA 3KFAA 4I92A 5HOAA 3D94A 2JFLA 4EH9A 3T9IA 3AG9A 3KGAA 4EK3A 1PY5A 3NUXA 4PMSA 3RTPA 2R3LA 1YXTA 3E64A 2PVYA 3FMNA 5HX8A 3KY2A 5M09A 3FMEA 3FPQA 4C58A 3P1AA 1PMNA 3K5UA 3C1XA 3NUAA 2HZIA 1QPJA 4NKSA 4A9RA 3AC4A 4AAAA 4TTHB 2DQ7X 3IOKA 3U6JA 4DFBA 4EH4A 5A4LA 3ATTA 4AA0A 3DK6A 1YDTE 2R3RA 3LVPA 4KIKA 4QPSA 4IM2A 3U8WA 1LP4A 2BROA 4TY1A 3UQCA 3FBVA 5IKWA 4MD8E 2QOIA 3HKOA 2I0HA 4G3EA 4J71A 5EM7A 1YHSA 1L3RE 1KWPA 3KXZA 1XBAA 3NAXA 4NM0A 1WBWA 4S34A 3EQBA 2G2IA 3OWPA 4RWLA 3UTOA 2JKMA 2V22A 3ULIA 5BQ0A 4R78A 2RKUA 4DF3A 2JDTA 3UYSA 5JZJA 3BEAA 4G31A 3MI9A 3PJCA 1BL7A 1XQZA 2F7EE 4AX8A 3OW3A 3C0IA 4A07A 4X2FA 5AV1A 4O82A 4WSYA 4QPAA 3G0EA 4OW8A 2GTMA 3KMWA 2WB8A 5CF4A 5H8GA 4QQ5A 4O0TA 3BKBA 1ATPE 2W1HA 4YHFA 4PUZA 3Q6UA 5A4QA 4N6YA 4MQ1A 3LPBA 3IDCA 4QMWA 5HIDA 4C3FA 4QMPA 4TYEA 4JBPA 2ZMDA 3MJ2A 1YXSA 3H0YA 1BL6A 1ZYLA 4BI2A 5JH6A 4GFOA 2VTRA 3VBTA 1Q3WA 4MHAA 2QKWB 5HO8A 3UODA 2HAKA 1Q24A 2F7ZE 4WG5A 5IA0A 1OVEA 4R5SA 3DJ6A 1ZOEA 4DLJA 1FPUA 1YXVA 3DTWA 3GGFA 4MWIA 4EJNA 3FLWA 4F7LA 3DXPA 3DDQA 2YWPA 3EFJA 4GT4A 3S4QA 4BBEA 4JVGA 3KKVA 4L53A 3SRVB 4BL1A 5DHJA 2BRGA 3D7TA 4IX4A 3UBDA 2FGIA 2XK4A 5CU3A 2PVFA 2ITNA 2QHNA 4QTDA 3ENHA 4FIEA 2Y6OA 4OTRA 3A8WA 1Y8YA 4E4NA 5KBRA 3NEWA 4GH2A 2JITA 4R1VA 4M13A 3QALE 4U97A 3QD2B 1NA7A 3TZ9A 1U4DA 4L44A 3C7QA 4FVQA 1SVEA 2SRCA 2XIRA 5HKMA 3WZDA 2JAVA 3OF0A 3QZIA 4BDGA 2XNMA 2XKFA 4FZ7A 4I3ZA 3RK5A 4FGRA 4F7JA 4FV1A 3QZHA 2PUNA 1ZMUA 1OBDA 2ITXA 3BHTA 1Q41A 4C61A 1JWHA 3QKMA 4GG7A 5FXSA 3ZHPC 4A7CA 5AP4A 2WMVA 3MIYA 4G3GA 3EN5A 4Z9LA 5AV4A 4EH8A 3POOA 4IAKA 3FZSA 5B2KA 3R7GA 4AT4A 3A7FA 2Z8CA 1SVHA 4JBOA 4X3JA 4GKIA 3SG9A 4C8BA 3R28A 5FEQA 3ZUTA 3OT8A 4UWYA 2WD1A 2B9IA 2IW6A 2R3OA 3Q3BA 4IJPA 4XUFA 1FGIA 4AZTA 1YKRA 2YLEA 4TYJA 4PP7A 3PPZA 1P4OA 4M14A 4CKRA 4M7IA 3RI1A 4W4WA 5KO1A 3RZFA 4I4FA 3WZUA 2WQBA 4BDIA 3ZO2A 4USDA 2ZV8A 4BDBA 3HNGA 2VRXA 3BHVA 4FZ6A 3RAKA 2JKOA 3SOCA 1PHKA 2XNNA 3VC4A 4CEGA 5IF1A 2PMIA 2E9UA 1QPDA 1XH8A 2E9OA 4EOQA 5T68A 3E63A 4TRLA 3QQKA 4C7TA 1PMEA 3R6XA 3Q2MA 1TKIA 3K3IA 1T46A 3QHWA 2C6EA 3LJ0A 3SW7A 4B8LA 4PL4A 3F5GA 2XIZA 4FTCA 4DEDA 5C8KA 3RPSA 2ITOA 3COIA 3BELA 2XM9A 3CS9A 3O8UA 3QA0A 2R3IA 3CY3A 1Y6AA 3NGAA 4F0FA 4JR3A 2YJSA 2FSTX 3HV7A 4UYNA 2C6KA 4V0GA 3OTVA 3VS6A 2JKKA 1W98A 3PE1A 3TIZA 4FE2A 4BTJA 2C5OA 2OJJA 4FTUA 1ZOHA 4BTMA 4F99A 4IAYA 4IB1A 4WO5A 4FTOA 3LFEA 4AWIA 2ETKA 2X6DA 4MXAA 5IZFA 2XNGA 4CTCA 4FTLA 1JSVA 4IC8A 4JIAA 3BGQA 4YHJA 4HNFA 3FUPA 4I20A 3GENA 3HMNA 2X0GA 1OPLA 4RJ6A 1URWA 2UZWE 2VWWA 3EZVA 4G16A 3V8WA 4UEUA 4QP8A 4Y5HA 5CXHA 4B8MA 3KB7A 3I81A 4O2PA 3QTUA 4M69A 4EH2A 4FSNA 3FL5A 3UIMA 3OMVA 3KRWA 3KXMA 1JBPE 5L8JA 5LVNA 5AP6A 1JSUA 5DMZA 3IO7A 3P9JA 3EMGA 5C26A 2VO6A 5HICA 4G6OA 3N4TA 5KMKA 4IC7A 3D0EA 3ZRLA 3FLZA 4PF4A 2E9PA 5FQDC 4QD6A 2RSVA 3TXOA 4HPTE 4I1ZA 3LM0A 4AOJA 4B4LA 5BNJA 3QD3A 4B9DA 3NMUF 3EFLA 4FTTA 4FV0A 1F3MC 4WA9A 3C9WA 4P5ZA 5TF9A 4CFMA 4MXCA 2PZRA 4D4YA 3Q32A 5FXRA 3F5PA 3V8TA 4ZY5A 3BIZA 4L8MA 2EU9A 2PMOX 5FLFA 3A8XA 1Q5KA 3FZOA 4I0SA 3OC1A 3QWKA 1JNKA 3K3JA 4A4OA 3Q9ZA 4L3LA 2BZHB 2VTHA 1YVJA 4FV9A 4HOKA 1WZYA 3QRKA 3UG1A 4ZLOA 4RX9A 3TDVA 1V0OA 1E1VA 4WHZA 4XG8A 1GNGA 4FKOA 3UGCA 3ORXA 4RBLA 2YDIA 4IZAA 3V5TA 4BCGA 3RAIA 4LUEA 3C5UA 5AUXA 3ZC5A 4ANMA 3JS2A 2WHBA 4YTIA 1UWJA 2OXXA
chains in the Genus database with same CATH superfamily
3QRUA 4MCVA 3FMMA 4C35A 2ITTA 3IKAA 3RHKA 3PDTA 2F2CB 3JYAA 3F6XA 3R71A 1CKJA 4KKEA 4CV8A 4DA5A 4E4XA 2HZ0A 1XH7A 2OKRA 4B99A 1W2DA 4XCUA 5HU9A 4Y73A 3R73A 5CALA 2ITQA 5A6OA 5AR2A 3MJ1A 5GIPE 3MYGA 2I7QA 1XKKA 5H8BA 2V55A 3K2LA 4CRSA 2GFSA 5GJGA 3MS9A 4AW0A 5C1QB 4UMTA 2ITPA 4EQUA 1J7IA 5KX8A 2FH9A 3PYYA 4S30A 4WG3A 1XH5A 4LL5A 5D7AA 1S9JA 2YCSA 3FLYA 2C0TA 4K11A 4MTAA 5K9IA 5LVMA 2B53A 3TKHA 3NX8A 4ZTLA 4E4MA 4UXQA 3G6GA 5HNGA 4S2ZA 5I9WA 3AC3A 4G5PA 3EWHA 3NLBA 4FF8A 4XG9A 5HI2A 4NUSA 4R7IA 4WKQA 3GC0A 4YUQA 3QTQA 2C6IA 3EQPA 3I6UA 1WFCA 3OY1A 2BHEA 3EN6A 2X39A 5EKOA 2WQMA 2X81A 4MVFA 3AT3A 3EN4A 2OJ9A 2CGUA 4H58A 3VS1A 4D4VA 4DEBA 2W0JA 4IAIA 4EOJA 1XH9A 3AMBA 3BE9A 4DGGA 3ZRMA 3BYSA 3FXWA 5K0KA 2XANA 4IQ6A 1B39A 3OZ6A 3BQCA 3ELJA 2X9EA 5D11A 1YWRA 3PG1A 3SDJA 3GU8A 3SRVA 5AUUA 2XCKA 5M56A 3CSVA 3CTJA 2QC6A 4QPMA 4AW2A 1BI8A 2OG8A 2GDOA 4RT7A 4BKZA 1KE7A 5AA9A 2OSCA 2YCFA 4I41A 4GMYA 1JKKA 5CU4A 5EYDA 4DG2E 2VGPA 4ENXA 1KV1A 2I0YA 3EKKA 4E8AA 4KNBA 3OXIA 4MD7E 4XG4A 2PVHA 4H3QA 4ASXA 5KMMA 1OL1A 1MRYA 4NEUA 4KD1A 4KBCA 3E7VA 3KRLA 3PRFA 3MH2A 3PVUA 4OTHA 4PV0A 3A2CA 4E93A 4G3CA 4RJ7A 3P4KA 2X7FA 3FSFA 3O0GA 1HOWA 3QCQA 4YZBA 5EW8A 4I23A 2GNHA 4YPDA 4C3RA 3PY3A 5J9YA 2OI4X 3GT8A 2ZB1A 2YM4A 3A7HA 4WNMA 4EC8A 2F57A 3F7ZA 4AXEA 2FA2A 3CKXA 2PVMA 1H01A 2PZIA 2HIWA 5AR3A 4Q5HA 2X0OA 5DLSA 4L43A 4FOBA 3DY7A 5ANKA 3R8VA 4FT7A 2FVDA 2HK5A 4M8TA 4QMUA 1ZYCA 2RL5A 3K5VA 3ZXZA 2X4ZA 4QYHA 1IRKA 1M2PA 5EFQA 3G33A 2WQNA 1Z5MA 3F9NA 3FMDA 2BZKB 2QNJA 5FD2A 4FIIA 4AA5A 3HDNA 3LQ8A 4U0IA 3I79A 4NIFB 2VD5A 4S33A 3VRYA 1CSNA 4UALA 2Y6MA 5DEYA 5I9UA 3CJFA 2YJRA 3E88A 4C62A 2AQXA 5BVWA 4WRSA 5AP1A 1R3CA 5M4FA 4O7VA 4I93A 4DYMA 4ZTMA 2Q0NA 1W7HA 4LI5A 4F6UA 5HLWA 2REIA 5EG3A 5L6WL 3C4FA 3VS7A 4J96A 2FB8A 2ZMCA 4YU2A 3QHRA 4M68A 1UU7A 3FZRA 3R1YA 1NVRA 4EI4A 2WTKB 4DEEA 2QCSA 4DLIA 5CAPA 3NVKI 4GG5A 4BCJA 3QX4A 4RLKA 4XLVA 2BCJA 2WGJA 4KUJA 3W32A 4UMPA 3DLZA 3HVCA 4U45A 4D2TA 1YOLA 4EYJA 2BR1A 1XHAA 2QO7A 3OCSA 4ZJIA 5TT7A 5D10A 4YJRA 2A19B 3D2IA 4O0SA 3PXKA 4FEWA 3TJDA 1T45A 4L6QA 5FTOA 4QP2A 3BGZA 1H07A 2J0JA 4IAAA 4TNDA 5I5ZA 4ZY6A 4UXLA 1JPAA 2A98A 3R21A 2FO0A 3P86A 4G34A 4RQKA 4XG3A 3EQFA 3F5XA 3TL8A 3WZEA 1H24A 5IQFA 4PPAA 1WBTA 2VWBA 2Y4IC 4EQMA 5J7HA 1O9UA 2C3KA 5DH3A 3WARA 2WOUA 3FAAA 3R04A 3ENMA 4GL9A 5ETFA 3RNIA 3L8PA 2FUMA 4EWHA 4IX3A 4WIHA 2GNFA 2IVSA 3FC1X 3P78A 2CGXA 3TTIA 3AQVA 3I4BA 3ZS5A 5J5TA 3LOKA 2WMWA 4JQ7A 5AUWA 4V05A 1Q8WA 3OOMA 3W8LA 3U55A 4H36A 1F0QA 2IN6A 3SXFA 4WD5A 3LFCA 5ETCA 2G9XA 3KULB 2WNTA 2R2PA 2ZB0A 4NYEA 3AGMA 4GIIA 4UY9A 3WIKA 4EOPA 5DPVA 2QQ7A 3G6HA 3ZFXA 5HVKA 1URCA 3TDWA 5G1XA 5ICPA 1SNUA 4LV7A 2YM6A 1B38A 3UOLA 3OVVA 3ZCLA 4QMZA 4YBKA 4OTDA 5LMBA 4I0TA 4PMMA 4GT3A 3MDYA 2ZAZA 4NCTA 2ITVA 4RRVA 3Q04A 4MKCA 2CKPA 3BU6A 3L8XA 3PIXA 3R01A 2ITZA 2P33A 2PE1A 3FLQA 5HESA 1J7LA 3SA0A 4YLLA 4K1BA 5AMNA 3QA8A 2Y0AA 1JSTA 3LMGA 5M57A 2ZM3A 4FV7A 4JAJA 3R7VA 5E4HA 5ANDA 4X2KA 1ZXEA 4FL1A 4XEYA 3KXNA 4O22A 2GSFA 4JX7A 4HCVA 3V6RA 4AOIA 1OIQA 4E4LA 2PYWA 4ZTQA 3BPRA 1FMKA 3R2YA 3SHEA 5A46A 5L8LA 5LWNA 3BL9A 2GFCA 3V5PA 4RZWA 2W9FB 1PW2A 1ZMVA 3HL7A 4NU1A 5I0BA 3QGYA 2DS1A 2UZOA 5CSXA 4YNEA 4JDIA 2YN8A 3F66A 5EK7A 4C2VA 5LVOA 3JPVA 4FZDB 4KINA 1TFFA 2J6MA 4CCUA 4AN3A 4AUAA 3P0MA 3A60A 2P2IA 3UOJA 1Q8TA 4FV5A 3RM7A 1UKIA 3FL4A 5JZNA 4DH5A 4F70A 5CAUA 4FEQA 4RIXB 1H0VA 4O6LA 3BLRA 2W4OA 2PPQA 4ORKA 3HX4A 5TO8A 4UX9A 2Q83A 3QCSA 5L8KA 1R0PA 2YIRA 3QTXA 2NPQA 4BYJA 2CMWA 4GFMA 3DLSA 3ZLXA 5DI1A 2QO9A 2HENA 3DAKA 4HCUA 2F49A 3QTIA 4GJ3A 4K18A 3ZLSA 5BUJA 1SM2A 3P5JC 3PVBA 4FTRA 2YM5A 3CC6A 1Y57A 3KREA 4LL0A 5DEWA 3ZM4A 3AT4A 2JAMA 5CF5A 3U4UA 1BMKA 4QDEA 4XOYA 3TUBA 2KTYA 1WBNA 1EH4A 4O1PA 4L3PA 1MQBA 2Z7RA 2WU7A 4Y95A 2VTAA 3A7JA 3T8OA 3AC5A 2FSLX 4MBLA 2OU7A 4OT6A 5BMSA 3AKKA 3F2AA 1REJA 2Y9QA 5FTQA 2EB2A 1BYGA 3FXXA 2C5XA 2W17A 5GJFA 4QOXA 3NYVA 4FT3A 1NXKA 3W10A 4RJ3A 5E8TA 1H08A 4E5WA 5J95A 4H3BA 3RBWA 4DC2A 5IDPA 3C50A 4AS0A 4IX5A 4DDGA 3IW8A 2VTLA 5HBHA 2IW8A 5E9EA 4BIDA 4AT3A 2JC6A 5CI6A 4LV5A 4F1TA 3N9XA 4FICA 3OWKA 1ST0A 4ANNA 2ZV2A 4FK6A 3T9TA 2OGVA 4PPCA 4U80A 3H4JA 2WOTA 3FMHA 4G9CA 1ZRZA 5KHXA 2XF0A 4ZEGA 3D83A 3R7YA 3L8VA 4AZVA 5M06A 4FOCA 5J8IA 4EOKA 2RFSA 2W06A 4QP6A 4PTEA 2VZ6A 2WMRA 2F2UA 2XNPA 4DCEA 4E1ZA 2BTRA 3G9LX 4YURA 4IVCA 4FNYA 4XBRA 3U6HA 3L9PA 1CTPE 4JG8A 1OKYA 4OTWA 4FSYA 1YHWA 4BCIA 3ZMMA 4YZ9A 4R7BA 2J5EA 4IX6A 4YC3A 4ZXTA 4V0GB 3QYWA 4Y46A 4UB7A 5CZIA 3M11A 2GU8A 2IVTA 3P7AA 4N70A 1TQMA 5AP7A 4ACMA 4O0RA 4AGDA 4AOTA 3OCBA 3ORMA 5F20A 4CFVA 4MQ2A 1J1BA 4YZDA 1Y91A 3R02A 4IFCA 3A4PA 4E7WA 5KMLA 3P23A 2OIQA 2G01A 1OGUA 3KVWA 3PPJA 3UNZA 3FY2A 3ZDIA 5GZ8A 5M51A 5DYJA 2RFNA 4QRCA 4FUXA 4NIFA 5EOLA 5HQ0A 1PF8A 4RX5A 2B7AA 5CVHA 5F1ZA 2VTSA 1R1WA 3JVRA 4FTMA 4HGTA 1V0BA 3GU7A 2OZOA 3LFSA 1GAGA 5C27A 2PY3A 3O2MA 3QRTA 4I21A 3UP2A 4DG3E 3OCGA 3OROA 4JAIA 4NFMA 3RHXA 1WBOA 3RK9A 1PJKA 3U87A 5JRSA 4JIKA 2E9NA 2R4BA 4D58A 2OF4A 1YW2A 2VNYA 3EQHA 3WOWA 3HUCA 4O83A 4NW6A 4BGGA 4EZ5A 3PE2A 3R63A 4MNFA 5C01A 4JQEA 5AUYA 2OLCA 3RGFA 5EOBA 4DITA 3F3VA 4TT7A 4XYFA 4QTCA 3OS3A 4DN5A 4GYGA 2UZLA 3DTCA 4ACCA 5IQIA 1NY3A 2R3MA 3DBEA 4LRKA 4PDSA 4X2JA 4BFMA 4EOSA 3F7WA 4PL3A 3HMOA 5GINE 2XA4A 1H1PA 1XR1A 2O5KA 1DAWA 1Q61A 3E8EA 3O51A 4FKSA 4B6LA 4BWPA 2XKEA 1JKLA 3FLSA 3QQUA 4HGSA 5HBEA 5IA1A 3W55A 3F88A 5HE0A 1CM8A 3MPAA 2VTQA 3IGGA 2GNLA 3QTZA 1OUYA 4JBVA 4FGBA 5DT4A 4M67A 2V7OA 4ERWA 3DBDA 3VHKA 2O64A 3BL7A 2W4JA 3DGKA 5FG8A 5IA3A 1YXUA 1Y8GA 4I94A 1LEZA 2IEWA 4R3CA 3VAPA 1UNHA 3GOPA 4L3JA 5ANOA 4DH8A 5G6VA 3GB2A 5HZNA 3SVVA 2BTSA 4AE9A 3DA6A 2PZ5A 5J9ZA 2I6LA 3PVGA 3S0OA 4YZCA 4K8AA 4PDOA 5CZHA 5C03A 5IQCA 4FKWA 3R8PA 5AV2A 2QR7A 4B0GA 5AM7A 3KULA 1UU8A 4F78A 2IVUA 4DGNA 3B2TA 3DV3A 1W84A 3FZPA 3NZ0A 3E87A 4HCTA 4IFGA 3EL7A 4GU9A 4U41A 5DBXA 3R8UA 4BTKA 2ZV9A 3R0TA 1RDQE 3F3ZA 1TQPA 3NUSA 1CKPA 3BCEA 3CCNA 3F5UA 3G9NA 5AX3A 4YJUA 3RPRA 3V04A 5CU2A 3R1QA 3SC1A 5GZAA 3R9RA 3W8QA 3T3UA 2XIKA 4MBJA 4ANBA 2BDJA 2NRYA 3EQCA 4KA3A 5HG8A 1JVPP 2WTKC 5IQHA 5BVKA 2OIBA 4YTCA 2UZBA 4RMZA 4XRLA 2QHMA 2X8DA 3LZBA 2GQGA 3TNQB 2PUUA 2OFUA 3PSCA 2OJFE 3IW6A 1MQ4A 4TYHB 3UOHA 4DINA 4EYMA 4IADA 2WMBA 4AGCA 3VO3A 2QOFA 4J8MA 3W2OA 1IR3A 4UYAA 1U5RA 4I5MA 2XCHA 1P5EA 2W9ZB 3DQWA 1BUHA 4ACDA 3E5AA 3ZBFA 4AAYA 4IM0A 3W2CA 3IONA 2ZM1A 3FE3A 4FIHA 3PJ8A 3CKWA 4CFUA 3CE3A 1DAYA 1TQIA 2BAKA 4RJ5A 4L7FA 5KBQA 3NFGB 1IASA 5CI7A 2XK6A 3O23A 2VTJA 1WBSA 2XK9A 3BGPA 2ETMA 3IPHA 5AEPA 4CLJA 4NK9A 5HX6A 5C4KA 3NFFB 3R30A 2YACA 3F61A 1OL5A 1QPCA 2YM7A 1KSWA 4F1OA 5BUEA 4E6QA 1MRVA 3QC4A 2X6EA 3HA8A 3BX5A 3CP9A 2W1FA 3AD5A 3ALOA 3OY3A 1FVVA 3QZGA 4BY9E 3G5DA 3TWJA 4AW5A 1GY3A 1P4FA 4MF1A 4RIXA 3W2QA 5L4QA 1NT2A 2PTKA 4EKLA 5JSMA 2C30A 1XMLA 3MWUA 4DT9A 2UZUE 3H9FA 4FYNA 3VBXA 4QTEA 5LOHA 2BFYA 5AV0A 4F9YA 4X0MA 2YWVA 4Z3VA 5EM6A 4TWOA 4G3FA 3DFCB 2E9VA 3BEGA 3W2RA 2FSOX 4E6DA 2BRMA 1Y6BA 3GU5A 3OUKA 4LFIA 3O8TA 3HLLA 4A4XA 2A4LA 2PZYA 2UVYA 4YC6A 4DH7A 5EHLA 4G9RA 5ETAA 4ZAUA 5A4TA 4QTAA 3CQUA 3Q9YA 3UQFA 4ASDA 2C0IA 4WNPA 4ENYA 5AFVA 2YABA 4Y8DA 4R7HA 3CJGA 2C5VA 2HWPA 1PKGA 4W9XA 3HRBA 2Z7QA 4XNEA 2WO6A 4YJNA 4LRJA 3Q5IA 3RWPA 5IQGA 3VS4A 5A6NA 1RW8A 3UOKA 3N51A 2WMAA 2JDRA 4I22A 2HY0A 4C33A 1BX6A 2CNUA 5C8NA 4RJ4A 4J1RA 4YGAA 3AT2A 2JDVA 1GZOA 5BMMA 3RM6A 4O7RA 5KCVA 3TZ8A 5BUIA 4BCPA 3RALA 3C0GA 3FKNA 3U51A 5CNOA 4C36A 2VN9A 3HZTA 4R77A 3ZFYA 2LGCA 1FINA 4FSMA 4MEDA 1IAHA 3OWJA 1H1QA 2C5NA 1BLXA 4NL0A 2BALA 5E8UA 2XAOA 4ZSAA 3TZ7A 4KIPA 2I0EA 3F69A 2XUUA 3HDMA 4AN2A 2VNWA 3NWWA 2W7XA 4D1SA 3FQEA 3C4CA 3FMLA 3NUUA 4IMYA 3ZRKA 4QMLA 4GYIA 5J1VA 4AZSA 2YDKA 4NZWB 4ASZA 1WMKA 2W4KA 2O0UA 1W2CA 2QOCA 4EKKA 4WT6A 3DZQA 5HTBA 2JLDA 4XV1A 1SVGA 4OR5A 4PP9A 4ONAA 2X7GA 3VW6A 3V5QA 4KRDA 3O5AA 2JFMA 3EH9A 5T3QA 4L52A 4A9SA 3R22A 5HIEA 2HWOA 4O38A 1G8KA 4YNOA 3MPTA 3Q9XA 5AP0A 5AV3A 3AC2A 3ZXTA 3D4QA 1E9HA 3E93A 3GCUA 4YJQA 4BCNA 2GS6A 3I0QA 3NIZA 4TWNA 4CYJA 5HORA 3LCOA 3GCQA 1P2AA 2UZNA 2UZVA 2JBPA 3BZ3A 3CPCA 4RFYA 4XBUA 4AW1A 4DFZE 4EBWA 4HVIA 3W0SA 4YLKA 1O6YA 2RG5A 2UZEA 3FI3A 3MFRA 3KK9A 5FWKK 3VWAA 3W0MA 3KRJA 3R9DA 3OD6X 5HCYA 1VEBA 2VAGA 1SNXA 3S2PA 4QMTA 3BYOA 3UNKA 4CFNA 4HVGA 3OCTA 1VR2A 4M12A 3M1SA 4RA5A 5CNNA 1ERKA 4EK8A 4IB5A 4RPVA 3QF9A 3H10A 4C59A 1M7QA 4QMYA 2W1IA 5FBOA 5AR8A 1JAMA 3HMIA 3KC3A 1HCKA 5AJQA 1K2PA 3LFAA 1M2RA 2QI8A 3UVQA 3C51A 3F3UA 1IA8A 2DYLA 4DE4A 4FZFB 4YJTA 4QQCA 5CAOA 5EM8A 5E8XA 4QP9A 3EJ1A 5FUTA 2OXYA 3MFSA 3HMMA 2AC5A 4D9TA 4IWQA 1A9UA 4OGRA 3PWYA 3THBA 3DNDA 2QOOA 3F82A 5AIKA 4KWPA 4EL9A 5FDPA 4BDCA 2YCRA 3RKBA 3JY0A 4WRGA 3EQIA 1VJYA 3WYXA 3HEGA 2VGOA 4JDKA 3VIDA 4BCOA 5BX0A 4CG9A 3LXKA 3TUCA 2J90A 1G8AA 3L9MA 4R5YA 5HD7A 3RPOA 1FBNA 3GU6A 1OUKA 2UW8A 5IH4A 3KF4A 4L68A 5CX9A 5ACKA 3NUNA 4K6ZA 2UV2A 2BZJA 5CXZA 4XG2A 2OO8X 3V6SA 1I09A 4BC6A 2C69A 3VBQA 2B4SB 5HVYA 4EHVA 5JT2A 3DZOA 4OBPA 3NUPA 4UN0C 1Q8ZA 2C6LA 2OXDA 4Q5EA 4FNZA 4RVTA 2B0QA 3LMHA 2XK8A 4EHGA 2ITYA 3RCJA 4BRXA 3DBQA 4APPA 3GQIA 4PTGA 2QVSE 4CFXA 3R8MA 5HTCA 3FI4A 1WCCA 4X7QA 2ITUA 3P08A 3DT1A 1Q62A 4LYNA 1W83A 5H8EA 3S95A 5J79A 3V5JA 2Z7SA 2HZNA 5HG5A 1YOJA 3A7GA 1DM2A 3R00A 4M97A 2JGZA 4TYHA 4UMQA 3FXZA 2ZVAA 3EQDA 2GHGA 2PHKA 3OBGA 2AYPA 5AIRA 4YPSA 2B9JA 5FBNC 1OI9A 3VJNA 3MESA 4BDFA 3NW7A 4CFFA 4IWDA 2XALA 2XYUA 5EHYA 5IQEA 2E2BA 4W8DA 3E8DA 1UU9A 3WILA 4J7BA 4BBMA 1WBPA 4I6FA 4BCHA 5D41A 3MBLA 3O71A 3P7BA 4XV2A 2R3NA 3ZLYA 4FYOA 5EW3A 4EZ3A 4FKJA 3QQLA 4X21A 3SAYA 1R0EA 3WZJA 4GS6A 1U59A 3O96A 3ZH8A 4L46A 1JKSA 2ERKA 4W4VA 3BHHA 4FKQA 4YTHA 5DGZA 2XK3A 4EOOA 2OBJA 4Z55A 4O7TA 2XZSA 3O17A 2C6DA 2QONA 1OL2A 2F4JA 4U81A 3UIUA 4C4GA 2W99B 2GQSA 5EQPA 2WMUA 2CLXA 3BLHA 2W1DA 2XH5A 3F3TA 1ZYSA 2WIPA 2PE0A 4LGDA 5HLPA 4C38A 4NJDA 5CT7A 1GJOA 1PMUA 2C1AA 2OW3A 4CMOA 4AN9A 2R3GA 1YQJA 2OFVA 3QAME 4ZIMA 3IW5A 1E1XA 3LE6A 4JDHA 1J3HA 4X2NA 4IDTA 4Q2AA 2P4IA 2Y7JA 5EYKA 3WZKA 3D14A 4XHKB 1XBBA 2V0DA 5JMSA 5LMKA 2YZAA 5LWMA 1MUOA 4DTKA 4C0TA 3PXQA 5LVLA 4I5PA 1K3AA 2PVNA 2UW6A 3W18A 2W05A 3BLQA 4W9WA 3FYJX 4MNEB 3CR0A 5I3OA 4BB4A 3NRMA 3BQRA 4M84A 1ZARA 1CMKE 3M2WA 4G2FA 3FKOA 2JDSA 3AD6A 3ODYX 5KZ0A 5TKDA 4U8ZA 3CD8A 3QQJA 2VWIA 3QRIA 4AZEA 1FGKA 3R7IA 4O0YA 2Z7LA 3C13A 4RVMA 4F09A 4LGGA 3OHTA 4NKAA 5KE0A 5JQ8A 3FYKX 5IQBA 4RX7A 4Z7HA 3UPXA 2BPMA 4JNWA 3R7EA 1XWSA 4BDKA 4JS8A 4QMNA 3UPZA 4TL0A 4HYSA 5KKRB 2A2AA 3GBZA 3GNIB 3TEIA 4O6EA 2BHHA 4CKJA 3ML1A 3DQXA 4DEIA 3CGFA 3UIXA 4Z7GA 4ACHA 4FG9A 4O86A 5K4JA 3DXNA 3MN3A 5KMJA 5JFSA 3MY0A 1UNGA 3QC9A 3E3PA 2P0CA 2OF2A 3RNYA 3DFAA 2WKMA 2V7AA 3Q52A 4FSZA 4YJSA 3RMFA 4ZOGA 2ONLA 3AKJA 4PWNA 1G5SA 1PXLA 4WBBB 3VUHA 5AAFA 3VUKA 5L2SA 2YIQA 3DKGA 3V5LA 4U9AA 2GNIA 3ZO1A 4NTTA 4XP3A 5CF6A 4WNOA 5LMKC 2PL0A 4FSRA 3QGWA 2WXVA 4UMRA 3RK7A 3QKLA 4DH1A 4Y5QA 3OW4A 3FLNC 2YDJA 4HZRA 5HTIA 3QYZA 4IE9A 1YI6A 4JDJA 5FRIA 5J87A 4FC0A 3R1SA 1UA2A 2I1MA 3GC9A 4HJOA 5DOSA 3PZEA 4EORA 4F1MA 2PU8A 3TMOA 2WQOA 1NW1A 4WBOA 4XH6A 2QLUA 3COKA 3AGLA 4FBXA 5HE3A 2LAVA 2PVKA 2YM8A 4P5QA 2Z2WA 2W1CA 4I0RA 5EDRA 5L3AA 4IZ7A 3LQ5A 4WUNA 5BYZA 3EFWA 4AG8A 5CLPA 4CYIA 5EDQA 3LHJA 3L8SA 4FR4A 3RCDA 2PULA 4P90A 4ZZNA 5IEXA 3ORKA 4DTBA 2VTMA 4EH7A 1PXOA 2WTVA 1ZMWA 3ACJA 2XVDA 3GC8A 4AA4A 4IACA 1VYWA 5HO7A 1J1CA 2GPHA 3VS3A 4CCBA 1Q99A 3R1NA 1U54A 2B1PA 5CSWA 4FSUA 4PY1A 1M14A 1SZMA 2CLQA 3DKFA 4O7NA 3IGOA 3CIKA 4C34A 2VU3A 3TNPC 4ID7A 4AGWA 3FPMA 4ZS0A 1OKVA 4ZSEA 4X3FB 3QX2A 2VX1A 4D28A 1JOWB 3ACKA 4USFA 2ONLC 3MFTA 5LQFA 4DBXA 4MF0A 3MB7A 1UKHA 4P7EA 5AUZA 2YLFA 1QMZA 5EM5A 1VLRA 2QOHA 5BVEA 2BFXA 5HCXA 2F9GA 5KZIA 4RC4A 3ORZA 2VO0A 3ZBXA 3NYNA 5A3XA 5LMAA 4IVAA 2GNJA 3AC8A 2QOQA 3E62A 3FZ1A 3HUBA 4ALVA 2WAJA 4FEVA 4LMNA 4O2ZA 2WTDA 3A99A 3EQGA 4EK5A 3Q53A 2C0OA 2JEDA 4GVAA 4NM7A 3NW6A 5L2TA 3VBVA 1XMMA 2NNWB 3NAYA 3EOCA 4G3DA 2QOKA 4RGJA 2CJMA 3PXZA 3PLAE 1H8FA 3PP0A 4K2RA 1F5QA 5HD4A 3I7CA 5CEQA 4CRLA 3I5ZA 3DU8A 4RA4A 4AXAA 5TOZA 2IZRA 5BVNA 4S32A 3C4WA 3IECA 2YAAA 4KBAA 4IW0A 3V3VA 1PRYA 3PSBA 3H0ZA 1CDKA 2AUHA 3H9RA 4DEAA 4PMTA 5L2WA 2H6DA 3QBNA 4H1MA 4U3YA 2QODA 3QCXA 2F7XE 2ACXA 3NNVA 4C4EA 4RJ8A 4EOLA 1ZZ2A 3KK8A 4QMMA 4RIWB 4RX8A 5AP2A 5EYCA 3VS0A 4CLIA 5FM2A 4DDIA 3I1AA 4K77A 2XNEA 4ZTSA 4F9WA 4JBQA 3IS5A 5I9XA 3VUMA 4GIHA 4I5CA 4EQCA 4F4PA 3ZZEA 3IDPA 4QYYA 3JVSA 5FEDA 3WYYA 1LPUA 3QWJA 2B9FA 3OXTA 4PL5A 4XJ0A 3KMUA 3PUFC 3V51A 3E92A 4C4IA 3WBLA 1A06A 2IWIA 1G8SA 1IEPA 3FWQA 4FZAB 3LXNA 4IM3A 4AZFA 2EXCX 3LCDA 5HNIX 1LEWA 2C5YA 2QU5A 3DKOA 4XX9A 4BKYA 3MTFA 4ACGA 4ANSA 4NCTC 4RLLA 2RGPA 4LGHA 3BU5A 1S9IA 3QTWA 3WE4A 3WF7A 4YSMA 2GS7A 3DDPA 4TN6A 4BZNA 5KUPA 4BDJA 4XRJA 4HVDA 4TYIA 5IU2A 1PXIA 2IG7A 3UO5A 5CSVA 2CHLA 2XP2A 2ZDTA 4YO4A 2CNVA 1WAKA 2C68A 4O7ZA 1LUFA 5AM6A 3KEXA 3LLTA 4BWXA 3W1FA 4QT1A 1OITA 1PYEA 4UZDA 4FV2A 4IAFA 4FKLA 5KMNA 3ZDUA 2XARA 4QP1A 2J4ZA 4AQKA 3ZYAA 2BAQA 3ZC6A 2B55A 3ORTA 4BGHA 3BRBA 2DUVA 2HXQA 3B8QA 2YISA 3SW4A 2WFYA 2J51A 4BCQA 3R2BA 3HV3A 4L42A 4YZMA 5LARA 4EUUA 3DOGA 4JG6A 3ZONA 5BVFA 2XK7A 1UU3A 4U6RA 4U43A 1W0XC 4FKTA 3EYGA 1KOAA 4YP8A 4EWQA 4MXZA 2YIWA 4RG0A 5M4IA 4ZTRA 3GFEA 4O27B 4MNEA 3DPKA 1ZY4A 4XLIA 5FEEA 3ID6C 1P14A 3G90X 1YXXA 4KIOA 4EH5A 2BIYA 2R3QA 4YMJA 2X9FA 4CMTA 5JFWA 4RFZA 5JK3A 3R7UA 3SLSA 2VV9A 3ANRA 3OOGA 3PA4A 4D1XA 4EJ7A 2R0UA 3PIYA 4H39A 3FKLA 4JG7A 2R3JA 1VZOA 4C37A 4DHFA 4FTNA 2YZLA 5ANGA 3U9NA 2BKKA 3VUIA 3KU2A 2PSQA 3RVGA 5A54A 2C1BA 5A14A 2P3GX 1UNLA 2R7IA 2VTNA 1H1RA 3LLAA 4H1JA 3UDTA 2PWLA 2R5TA 4AGUA 3NPCA 1YWNA 4NH1A 3ZZWA 3LFQA 3FEGA 4R8QA 2UW9A 3GCSA 3OEZA 4QP4A 2FSMX 3V01A 3PFYA 4RIOA 3W0OA 3DCVA 3KCKA 4R6VA 3BBWA 5CSHA 5BYYA 1YI4A 4FI1A 4G6NA