2JKQA

Focal adhesion kinase catalytic domain in complex with bis-anilino pyrimidine inhibitor
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
273
structure length
258
Chain Sequence
DYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of the Fak Kinase in Complex with Tae226 and Related Bis-Anilino Pyrimidine Inhibitors Reveal a Helical Dfg Conformation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
total genus 79
structure length 258
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jkqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jkqA01
5DGZA 1NVRA 2F7ZE 3K5VA 5M4IA 4FTKA 3LXKA 3FSKA 3UP7A 4G1WA 2XEZA 4YBKA 4F9BA 1WBVA 3IO7A 5H3QA 4QPAA 3OEZA 1BMKA 4AFEA 1SZMA 4PTCA 1MP8A 2C5OA 2WQBA 3D83A 1ZOEA 3ATTA 2C5VA 3GC0A 3TZ9A 3W2QA 5IF1A 4MXOA 5FDPA 5CZIA 3C4ZA 4HCTA 4ITHA 5GZ8A 3QZGA 3MY5A 3Q4UA 4QMTA 4BDHA 4AOJA 2QONA 2WMQA 4D2TA 4E5WA 2XK7A 1XO2B 1CSNA 2A4LA 2QI8A 2W17A 4M0YA 4HW7A 3BE2A 1FINA 3BGQA 4CFMA 5C4KA 1V1KA 3GC7A 3OW3A 3Q5ZA 2IN6A 2R3GA 4K33A 5DI1A 5DNRA 3T9TA 2GTMA 3L9MA 4QP2A 1LEZA 4OUCA 3WBLA 3ITZA 4CQGA 5IQIA 3QLFA 4G5PA 4BI1A 2FVDA 4FK3A 4GMYA 4EOJA 2PUPA 2EB3A 1IR3A 2BVAA 2C6EA 2DUVA 3CGFA 4OTHA 4ZIMA 2I7QA 5CQUA 2HXQA 4TTHB 4LQMA 4N0SA 3UO6A 4DFXE 4DH3A 5IQFA 2PE1A 2FYSA 2PMLX 3ZRLA 2BTRA 3S0OA 3LXLA 1GZKA 2X9EA 1O6LA 3BPRA 4JRNA 4DHFA 1GIIA 4FEXA 1YWRA 3I60A 4OLIA 1YXTA 5F9EA 3FEGA 1UKIA 3E3BX 3P7CA 2QOIA 3QUDA 4W4WA 3W18A 5LVOA 1PYXA 5C03A 1PMNA 4JT3A 5I9UA 4DLIA 2J2IB 3HMMA 3ORMA 4F1MA 3C0GA 4M68A 3TUDA 3L8SA 3EQDA 1KE5A 4OBOA 3QCSA 5HI2A 4D0WA 2Y9QA 3KREA 3EFWA 3LJ1A 5AAEA 4RPVA 2QVSE 3QX4A 4LV5A 1Q8TA 3R7IA 2BHEA 2BRGA 3C4XA 4EJ7A 2BAQA 4DLJA 4PV0A 4W8EA 2BUJA 2CLXA 2Y0AA 3BYMA 1RQQA 3AD4A 1ATPE 3IKAA 5EK7A 2J0LA 2R3FA 5IA5A 1UNLA 5I4NA 4BF2A 3QGYA 4D2VA 3HMPA 3CR0A 3MPTA 4CQEA 3DFAA 3LLAA 5AJQA 2WQEA 1YDSE 2C6KA 3RKBA 2VGOA 4X2NA 4FTCA 3HV5A 4PDPA 3LFQA 3DBQA 4IW0A 4DFYA 2RFSA 3WE4A 3G0EA 3U4UA 3IPHA 4FTAA 4H05A 2BRNA 4IZYA 1H1QA 3UO4A 3DT1A 2IVSA 3VIDA 4FV7A 2UVYA 5EM6A 1K2PA 3EQCA 1G8SA 2RKUA 4NFNA 1WAKA 3MY0A 4GL9A 4Q9SA 5DR9A 5EQYA 2QO2A 4L9IA 4TT7A 2PZPA 3O7LB 3QQJA 3RALA 4O7ZA 5FP6A 5FUTA 2ZV7A 5ACKA 1JKKA 3FMLA 5L8LA 2JITA 3QQFA 4X6RA 3A99A 4NFMA 3U51A 3FZPA 4O82A 1PXLA 3FV8A 3SA0A 3DDQA 2GS7A 4IAIA 2OZAB 4RJ8A 4C61A 3DNEA 3MYGA 3R8LA 3D14A 5DR2A 1SMHA 4RFZA 5AEPA 3LCKA 4U5JA 3NYVA 3TNWA 3FLZA 2OF2A 3F88A 1JKTA 1YWVA 2WELA 2YM3A 4O7RA 2EU9A 2ITQA 4ITJA 5KZIA 2XIYA 2Y7JA 4MWIA 3FDNA 4BWKA 4ZLZA 1WVWA 2PVLA 2R7IA 1TQPA 5FTOA 5IEVA 2P4IA 1KUTA 4FG9A 4XLIA 1GZOA 2G15A 5EOBA 2OGVA 4C38A 4XOYA 4NL0A 4GU6A 2QG5A 2H34A 4GUEA 2JDVA 3GVUA 4FIEA 4IX4A 4UWCA 3ZCLA 1YXSA 2BCJA 2OJGA 2XVDA 3OS3A 4IAKA 5M4UA 4GS6A 4HVIA 3V5LA 2WQNA 2YIXA 4KS8A 5LCKA 2OJFE 2CN8A 4FSQA 3G33A 1H0WA 2PE0A 4HNFA 3V6SA 4DG0E 5AAGA 3R9HA 4KD1A 4AT3A 3DJ7A 4NTTA 4YNEA 5EHOA 3UJGA 5HNIX 4CFWA 4USFA 4ZSGA 4LL0A 4S30A 4YJNA 4ENXA 2HY81 4CZYB 4QMLA 5AP4A 1WVYA 2YM4A 3VJOA 3D4QA 3OCTA 3D2KA 4NKSA 4CKRA 3DAKA 4L7FA 3UIBA 3W33A 4IANA 2C69A 3MTLA 3PIZA 2VTSA 4FK6A 2KTYA 3A2CA 1WBWA 2XYNA 3KRXA 4MBIA 4O38A 4ZTNA 3AD5A 3O17A 4CMTA 2PYWA 3HAMA 2PVKA 3DBFA 5HVJA 3E8EA 4DGNA 5JH6A 3ZM9A 2XNEA 4ZTSA 3ZSIA 3QCYA 4JDHA 4U3ZA 4N70A 4CKIA 4IVAA 4U9AA 3DZOA 4GIHA 1JKSA 4DEIA 4A9UA 1OM1A 3FMKA 1YOMA 2OG8A 4JXFA 4EK4A 3ZMMA 3UZPA 4O7NA 1YKRA 1CKIA 1BI7A 2LGCA 2VTAA 3ULIA 3RCJA 4UMTA 3MTFA 4FTUA 4G6LA 3R1YA 3R8PA 4XG8A 3HGKA 2ZAZA 2W1FA 4GU9A 4Z9LA 3EL7A 4LOPA 2A27A 5CSXA 3PE1A 2GNFA 4NH1A 4FEQA 4NIFB 3C4WA 3K3JA 2O8YA 4QMZA 2W05A 4Z16A 5DIAA 2JBOA 5M4FA 2VTRA 4ASDA 4AZSA 2VX1A 4Y5QA 4QP8A 3R2YA 4II5A 5AP1A 2PMNX 1LR4A 1OUKA 3A4OX 4WNOA 2HENA 1GOLA 2OIQA 4U43A 5BX0A 2HW6A 4FV0A 4FV5A 3CLYA 1H00A 5FWKK 3QKLA 3V51A 3MN3A 3OUKA 4EOOA 4E7WA 3GOKA 4IZ5A 4NJ3A 3UDBA 3VBYA 1PHKA 2XP2A 3QZIA 1QPDA 3EJ1A 3ZLYA 1V0BA 2GNGA 2OU7A 3R83A 2PVHA 2W4OA 4GKHA 2CKEA 4L3JA 3DK3A 3GI3A 3VS5A 3TG1A 3VUMA 2HCKA 3BCEA 3IOKA 3QZFA 4XRLA 2VTPA 4YZMA 3A61A 3JVSA 3PA4A 4FV4A 3F5XA 4FT5A 4R7BA 2X8IA 2PULA 2O0UA 2W5HA 4TWPA 2WTIA 4U0IA 4FVQA 3UODA 4HVSA 3MFUA 3PE2A 3NW5A 4OGRA 4UZHA 2OF4A 2R3HA 5HNBA 4KINA 3SVVA 4QQCA 5H8EA 4E3CA 4ZS4A 3BLQA 3ZOSA 3LOKA 1YRPA 4QMYA 3QCQA 5KHWA 4LUEA 1PXJA 2XH5A 3WZEA 3QWKA 4H3QA 1IAJA 3ZLWA 1MQ4A 3COHA 5HO6A 4C4EA 4QMSA 4EQUA 5TE0A 2PHKA 3HV4A 3I5NA 2F9GA 4HGEA 1OB3A 4ORKA 3DU8A 3AT3A 3EN6A 2FB8A 3KCFA 5J1VA 2QNJA 3SDJA 2HZNA 1Q24A 2QODA 2WMBA 1MRYA 2UUEA 3LFNA 3KVXA 4AZWA 2H8HA 3DAJA 4XCUA 4H3PA 2JDOA 2UZTA 2JEDA 4YLJA 2WOTA 5ANEA 2VTOA 2FO0A 2OSCA 4FIFA 5HTIA 2C3IB 2WTKB 3GU8A 4FSTA 4TYHA 4JQEA 5BVWA 3G15A 1M7QA 5ANGA 3Q6UA 4KIPA 1PXKA 3VF9A 5FXRA 3LXPA 4U3YA 2EXCX 5CSHA 4FV1A 4I20A 4MTAA 2G01A 2JKQA 3MIAA 3FI2A 4PUZA 4ERWA 4IADA 4PMMA 4R3RA 3UNKA 4D2PA 1B39A 3LCOA 4BBMA 5K5NA 3F5UA 4BY9E 4E4LA 5CVHA 5DRDA 3E63A 2CNVA 4ZTHA 3VO3A 5M51A 3ZYAA 4YZBA 4YJQA 3UOHA 4I6FA 4KKGA 1M2QA 1R78A 4FTLA 4L42A 2BZHB 1FMOE 2PZRA 4BDKA 1Z57A 4ZJJA 4F0IA 3EFKA 4CLIA 4GK3A 4EWHA 4QRCA 5E8UA 2B9HA 4IVDA 2UV2A 3L8VA 5C1QB 2V22A 3IS5A 2QOOA 3ALNA 1M2PA 4FSUA 5HG8A 1QPJA 3DCVA 3P4KA 1BKXA 5TOZA 3U55A 2I0YA 5GIOE 3SAYA 2W9ZB 4IWOA 4FKOA 4D5KA 3E8CA 3WE8A 4D4SA 5D1JA 4K1BA 4L44A 3CGOA 3KF4A 3V8WA 3L8XA 2WOUA 2PE2A 4J98A 4LYNA 2X1NA 4YZDA 3LMGA 2JFMA 5FLFA 3F2RA 2GNJA 5HGIA 3VUIA 3MPMA 4DEEA 2WTCA 3H3CA 4BCOA 1OBDA 3QKMA 2R7BA 3G6HA 3GC9A 4CG8A 4C34A 2YCFA 4KSQA 3FHRA 4IFGA 1WBNA 3EQFA 4IAYA 3LFFA 4PRJA 3THBA 4PL5A 3G9LX 1XR1A 4FL3A 4CTBA 3F9NA 1LPUA 3FMNA 5FTQA 1OPJA 2GQGA 3ORZA 2QR8A 3H0YA 4ZMEA 4JG8A 3ORNA 4P7EA 3HYHA 4FTJA 4A07A 5IZFA 2HZIA 1H8FA 3LFSA 3SW4A 3AC8A 4M69A 3QFVA 2REIA 5CLPA 5AUZA 2VTHA 4PTGA 2WNTA 3LLTA 4KB8A 4IWDA 4NM5A 1URCA 5LCJA 3V6RA 2C0IA 1MRVA 4Y72A 4RRVA 4EK8A 2OI4X 2JIVA 2ETMA 3Q3BA 3IQ7A 4PMPA 5IPJA 4O6EA 1JQHA 5EW9A 4G6NA 4M12A 2PUNA 3R9OA 4W4VA 3ZBFA 5HLNA 2J4ZA 4FODA 4XP3A 3NVMB 4DEAA 4C37A 4DGOA 4FBXA 4GJ2A 1H28A 1APME 3RAKA 4DN5A 5KE0A 4CD0A 5CAPA 3EQGA 2DYLA 5IDPA 4AXAA 5L2WA 4RLKA 2PU8A 3SG8A 3JVRA 4I5MA 5AV1A 3ZZWA 4R77A 2Q0NA 4E4MA 3R7UA 4RIYB 2E9NA 3HP2A 2YIYA 2ETRA 3K5UA 5K5XA 2Z02A 4A4OA 4Z3VA 2GNHA 4UEUA 4I6BA 3MVHA 3D5VA 4KBAA 4RWIA 2XBAA 3GT8A 3E8NA 3NW7A 4E93A 3VW6A 4RLLA 2HY0A 3VVHA 4YLKA 4DGMA 4IVBA 5IISA 3OXZA 5KHXA 4GVJA 2HWOA 4XG4A 5D10A 5D11A 2HELA 1OL6A 4X6QC 4ZY6A 4A4XA 5AP7A 2OK1A 2JAMA 2CJMA 4IEBA 1G8AA 3E93A 4R8QA 4TYIA 3MB7A 4AAAA 4D4RA 4XOZA 4MH7A 3VBVA 3W8LA 1CDKA 1XBCA 4AA5A 4JBPA 5CVGA 3CEKA 4OR5A 2CKOA 4BTKA 4CCUA 2W1GA 3C0HA 4IAFA 4IB1A 1SVEA 3UYTA 1ZY5A 2WGJA 3LPBA 5LMKC 4CVAA 3LXNA 2ETKA 5D9HA 4X2FA 3PLSA 4JX3A 4OTPA 5L8JA 5L3AA 2C68A 2X4FA 2PL0A 3V01A 4MD9E 3F3UA 1XQZA 3BX5A 2GDOA 5EW8A 2CCHA 5ANJA 4CMOA 4GJ3A 2J50A 2R2PA 2VN9A 5IUIA 3BYOA 5TO8A 4BCQA 5HTCA 2DQ7X 3HDMA 4DG2E 4YJUA 4ALUA 5CF6A 2CKQA 5FD2A 4WNPA 3PIYA 3CTQA 1AQ1A 3R8MA 5CI7A 4HYIA 2IO6A 3NX8A 5EOLA 4P5ZA 4FIGA 4K2RA 4G3CA 4EOMA 4E5AX 3JS2A 3QD0A 2WKMA 2YM8A 3MSSA 2C6OA 4KRCA 1G3NA 5GJDA 5FRIA 4FG8A 4ARKA 4ANLA 4RIXA 4XG3A 5IQGA 2OFUA 3E92A 4FGBA 1YXUA 4MXXA 4ENYA 3P23A 4EHGA 5JQ8A 2QOQA 3ZO3A 5CT0A 3IONA 4QD6A 4UYNA 3ZUVA 3CCNA 5TF9A 5DMZA 4WG4A 3DKCA 3RHKA 4EC8A 1IA9A 3DJ6A 1TQIA 3RNIA 2UW4A 1O9UA 2QR7A 4AGUA 5CAUA 5JRQA 2B9IA 1K3AA 2GHLA 3DOGA 2HZ0A 2JGZA 3CSVA 3H9OA 3OP5A 3T3VA 4ZK5A 3RP9A 1OKWA 4F6SA 2JDSA 2QHMA 3NS9A 5K4JA 2B4SB 2C1BA 1R39A 2X2LA 3NDMA 3QX2A 1JOWB 3DB6A 5FEQA 4ALWA 3FYKX 3RAIA 1ZY4A 1Q5KA 3PPJA 4FT7A 2WZJA 2B7AA 5HE1A 3GEQA 4BDIA 4RX8A 5KBRA 4XHKB 2ACXA 3WZDA 3PY3A 5EDRA 1IEPA 5AWMA 4YMJA 2ZM3A 3N51A 5J95A 4XG9A 5L2SA 4MXCA 4O22A 1H26A 4DT8A 1DI8A 2NRUA 3BBTB 5AA9A 3CTHA 3OZ6A 3RZFA 5I9VA 2VU3A 4DEDA 5BVDA 3NNUA 1REJA 2B9FA 1VEBA 2GFCA 3QRIA 4IJ9A 4F9YA 4RC2A 4BC6A 3Q9XA 4EL9A 5CASA 2NNWB 4EBWA 3ZXTA 3QZHA 5CF4A 5HX6A 3GU5A 3IOPA 4QTCA 5CAOA 1ZYJA 4DTAA 5FP5A 3Q4CA 4E1ZA 3FE3A 5G1XA 3LM0A 2WD1A 4IB0A 4HYUA 3V8SA 5M4CA 4C62A 5CXHA 4U8ZA 2W99B 1ZARA 3TL8A 5HLWA 4BDAA 2CDZA 4KIQA 2HYYA 3ZDUA 3MVLA 2W0JA 3OY3A 3VS1A 3NNVA 4EOLA 4QYHA 4O2ZA 5FDXA 3TKIA 3HUCA 4X0MA 4CLJA 4PMSA 5KMLA 4S31A 1JSTA 3NNWA 4C7TA 3HZTA 2YDJA 3KCKA 4PPAA 5H8GA 3EB0A 4MNFA 4TYJA 5TR6A 2Q83A 2X2KA 3HRFA 3QL8A 4HCUA 2WTKC 3IGOA 5HBEA 4BCHA 5GIPE 1W84A 1BL6A 3F2NA 3COMA 4ASEA 4NUSA 4BCKA 4CGAA 4AZEA 2W1EA 3F7ZA 2O65A 3DBEA 4LM5A 3PSDA 5ANDA 4FEWA 4D5HA 2VX0A 3FKOA 5EM7A 4S32A 3VS4A 5J9ZA 4X7QA 2XIKA 5GJFA 4JDIA 4BCJA 4BTMA 4AW2A 3A7IA 2Z7RA 1G5SA 1Z5MA 4BCIA 3BYVA 5D7AA 1B38A 4B99A 4O91A 1R1WA 3TNIA 4HJOA 3NCGA 4F6UA 3WYXA 2GS6A 3LZBA 2FSMX 5HICA 3OEFX 5AIKA 4ZJVA 5FG8A 3B2TA 3CJGA 4XV1A 4BDGA 1PMVA 3QTWA 4RA5A 4PPBA 3VAPA 5CQWA 4ZTQA 1KV2A 3D5WA 3LKMA 3FLNC 4E6DA 3BYSA 5E8WA 4J52A 3QTUA 5I3OA 4FV3A 3OOMA 4RJ3A 4QQTA 3R04A 2F49A 3L9PA 1W7HA 2BDWA 3II5A 3C5UA 4IZ7A 4UMRA 4FL1A 1ZYSA 5CEOA 5J5SA 4D2WA 5CF8A 2OICA 4ZP5A 5E1EA 2X0GA 2YJSA 3KK8A 3P78A 1M2RA 2QOCA 4NJDA 4TWNA 5EDQA 1PKDA 1UU9A 4CXAA 4D4VA 5HESA 2Y4IB 2R5TA 4ZZNA 4TWOA 3RM6A 4OW8A 3HKOA 4IAZA 3G90X 2ZM4A 3VS3A 2HZ4A 4MKCA 3NGAA 4NW6A 1XH8A 1YW2A 5M09A 3GCQA 4FMQA 4YC3A 4RX9A 4C59A 4CZTA 2IW9A 4EHZA 4GVAA 4IDTA 5ITAA 5JEBA 5H9BA 5IA2A 5LQFA 4FNYA 4W9WA 4MQ2A 4A4LA 5KMKA 5DWRA 4ZZOA 2C4GA 5A4EA 5CEQA 3CE3A 4DGLC 4ZLOA 3ORIA 4QNYA 3VN9A 4CTCA 2I0EA 2W4KA 3RAWA 5IH4A 3FXXA 4KA3A 2VZ6A 5DA3A 1H1WA 1E1XA 3UO5A 5A9UA 3R8ZA 4JX7A 2OWBA 1ZMVA 4QMNA 2X6EA 2Z7LA 4PPCA 4RWKA 1QPEA 2IW6A 3QAME 2WMTA 4EKKA 5GNKA 4DTBA 4WO5A 4I5CA 1ZYCA 5J9LA 3B2WA 3DKFA 3RPYA 4Q5EA 3RGFA 4FKRA 4TPTA 3DDPA 4FTOA 4L6QA 3EMGA 3QQGA 4FKIA 5KX8A 4MK0A 2OZOA 3F69A 4U81A 3FZRA 5IUGA 2PMOX 5CAQA 4E20A 4AWIA 2J5FA 3NUAA 2ZB0A 3DY7A 2QC6A 4QMMA 3D9VA 4R1VA 5HIDA 3UVPA 3R9RA 3R2BA 4I6QA 3NUYA 3UC3A 4S33A 2YJRA 4RVLA 3AMBA 4DYMA 1VYZA 1M17A 1SM2A 2YFXA 3C50A 5E1SA 3KXGA 1H08A 3UBDA 4JBOA 3F3WA 2XMYA 3L8PA 5D12A 2WMRA 3LFDA 2WTVA 2O2UA 3DFCB 4QMWA 5DPVA 5L8KA 2XK6A 5E92A 4HGSA 4J97A 2XK9A 3K2LA 4AS0A 5IQBA 1REKA 3CXWA 4FKQA 4JDJA 3QRJA 3E5AA 3QRTA 3OBJA 4G3EA 4AZVA 3Q96A 4X2JA 3BGPA 4C4HA 2OH0E 2YIRA 4G17A 4ANBA 3FWQA 4QTAA 3IW7A 4JAJA 2BAJA 4YTIA 2C5YA 3R7GA 4QTDA 4AACA 5A14A 4PWNA 1S9IA 3DKGA 3OROA 2RFEA 4WG3A 4YLLA 3ZONA 3TACA 4Q9ZA 3R8VA 4RIWB 3FUPA 4B9DA 3GU6A 4FTIA 3ID6C 1CM8A 3KXHA 3BEAA 4AN2A 4UX9A 3CD8A 3FZ1A 2AC3A 5HHWA 4JG7A 3TZ8A 5I9ZA 2C6IA 3R73A 3S2PA 3CKXA 2ONLA 4LOOA 2YCSA 2BROA 2G1TA 2XF0A 3FL4A 4U6RA 4RC4A 4RJ4A 1W83A 4MX9A 5HQ0A 3UOKA 2C47A 4RX7A 4IWPA 2G2IA 1ZMUA 4RVMA 4EH5A 4F9CA 2OXXA 4Z7HA 5DT4A 4NTSA 3UMXA 3OMVA 3OT8A 3D7TA 4F9WA 1JAMA 1Q62A 4K6ZA 2WFYA 5F94A 3W2RA 1O6YA 3FMMA 5JFWA 4B4LA 3V5WA 3R28A 4EH6A 4BHZA 4C35A 2BRBA 4O0RA 3ZSGA 1Q99A 1W8CA 3QTIA 4AUAA 2BKKA 1J3HA 3KB7A 2ITZA 5DYJA 3VS7A 4R3PA 4O7TA 2J9MA 2XK4A 1YOJA 1SVHA 3QCXA 4ACHA 4IXPA 2OIDA 3LW0A 2VNYA 4FF8A 4Y85A 1XBBA 4AF3A 5JRSA 4QYGA 3U8WA 4E6CA 4IB5A 5EKOA 2GHMA 4IDVA 4UWBA 4BVUA 5GINE 2QU6A 4LRMA 1VJYA 4YU2A 3C4FA 4H1JA 4BGHA 4NSTA 3HX4A 1RDQE 2PVFA 4TNBA 4IBMA 4YTFA 1YXVA 4PL3A 3RBWA 3E62A 2JKOA 3PXZA 4YHFA 4HNIA 3R7EA 5IEXA 1CTPE 3AGMA 3RZBA 4BKJA 5DT3A 3DQXA 4BCPA 1WZYA 4FYOA 5EM8A 3D94A 2C6TA 2WTJA 4EH8A 2XNOA 2PY3A 4ANMA 3AT4A 3L9NA 4JS8A 4XUFA 4EH9A 5EYKA 3MY1A 1P14A 4GIIA 4QTEA 4RC3A 5E7RA 5CEMA 3F2AA 2XUUA 4BICA 2O63A 4IC8A 4AGDA 4C58A 5AR7A 4O21A 4KIKA 4C3RA 2BTSA 3FQSA 3EOCA 3OF0A 1H1RA 2J51A 4XV3A 3SRVA 4CYJA 5C9CA 3SV0A 2YCQA 1JNKA 4J96A 3W10A 4I0RA 5BQ0A 3U6IA 2OJ9A 2BKZA 4FTNA 3LIJA 4EZ5A 1V0PA 5FQDC 4OBPA 4CCBA 2GCDA 2I0HA 2VTQA 3HUBA 5FGKA 2HWPA 4GCJA 5AA8A 2VWYA 2V5QA 2E9UA 4BDBA 4XH6A 3PY0A 4EK5A 1KOAA 4V05A 3EQIA 3UP2A 2W1ZA 4XRJA 3EWHA 3OWLA 4DEBA 5JZJA 2R3JA 4CMUA 1WMKA 2VWVA 3VHKA 3OW4A 4EZ3A 2CSNA 1J7UA 3UTOA 4O96A 4AP7A 2X7GA 3PUPA 2DWBA 1JPAA 1ZMWA 3QD3A 3QTZA 4QP9A 4MNEA 3W2OA 4F0FA 2WMVA 3Q9ZA 5K3YA 3R63A 3PXRA 3PG1A 5IH5A 3HMNA 4L01A 3F5PA 1U59A 1RJBA 3FMHA 4ID7A 2GNIA 4FTTA 3GB2A 3VJNA 4F1OA 1P4OA 4GEOA 5IKWA 4TL0A 2NP8A 3TKHA 3UZRA 4ACCA 3TEIA 4NZWB 2FH9A 4DH5A 4UZDA 1WBTA 4P90A 1HCKA 2WXVA 5CENA 3MIYA 5I5ZA 4D55A 4FKPA 3PZHA 4KWPA 3TTJA 4M3QA 4XG2A 2B52A 3KXXA 4G16A 3NUSA 2RL5A 4PQNA 3UG2A 2QO7A 3IDCA 1JSVA 1YWNA 4CZUA 3TUCA 4S34A 4DITA 5HTBA 4MXAA 1XKKA 4E26A 3A4PA 5JT2A 3SD0A 4EOKA 2ZM1A 3MH2A 1GZNA 4XJ0A 4BZDA 2E9OA 3ZFMA 4ANOA 2XZSA 3OTVA 2QD9A 3FC1X 3MFSA 3SOAA 2XKCA 4BR3A 4G3FA 4CKJA 3I6WA 5IQCA 3ORXA 4FVRA 2QG7A 4TKSA 5EQEA 4ZEGA 3R6XA 4MAOA 4BDFA 3UQFA 2W5AA 5GJGA 3IGGA 2YZAA 2ITUA 3BHHA 3VW8A 5EHLA 3E3PA 4R6VA 4RMZA 4L8MA 4GH2A 5L2IA 2PZ5A 2WQOA 1YHVA 2R64A 4AZFA 3AC4A 4I24A 2E2BA 3VC4A 4W4XA 4DH8A 3POZA 3PXKA 4FIHA 5LVMA 1RW8A 3E8DA 3QQKA 1ZOGA 3KULB 4J53A 3ZZEA 3MH3A 4UYAA 5CU0A 4O7YA 3NYXA 3WF6A 4FR4A 3NZ0A 2BIYA 4GSBA 4L43A 4LGHA 5M55A 3TTIA 1NW1A 2CNUA 4TYHB 3SG9A 3TDWA 3GQLA 1H25A 2X9FA 4DEHA 5LOHA 2BFXA 2YCRA 4ITIA 4FKVA 4W9XA 2ITPA 5J5TA 2VAGA 4CT2A 4RIYA 2R9SA 3ODZX 5ETAA 3F3VA 4O6LA 3FHIA 4F4PA 4YJSA 5HU9A 3TM0A 5LXMA 4GW8A 4M67A 3ET7A 2IWIA 4BCGA 3RVGA 5EKNA 4M97A 3NYNA 2OJJA 4F7JA 4UBAA 4CFUA 3QHRA 4PDSA 4FZFB 4DBNA 1H1PA 2W7XA 1Q8YA 5T6KA 1BYGA 3TN8A 1NY3A 1E1VA 4HGTA 4A7CA 1URWA 4AN3A 2PVNA 5AAFA 4ZSAA 1YI3A 2GSFA 3A7GA 2J6MA 4O86A 1S9JA 5E9EA 5L6PA 3VBTA 3O7LD 2C3KA 4EOPA 4FL2A 1Q97A 3UOJA 5C8MA 1KE6A 2B9JA 5M56A 1SYKA 4IM0A 1B6CB 3JY9A 4XG6A 3SKCA 5M44A 4RVTA 4XG7A 2VO3A 5E91A 2GS2A 4XBRA 4XV9A 5FBOA 4EUTA 1JSUA 2VWIA 4M15A 1FGKA 1OL1A 3P7BA 4WD5A 4JJRA 2IVUA 3IDBA 5AX9A 4WBOA 4EOIA 2R0UA 2PUUA 3MV5A 2XNMA 1P4FA 4G6OA 3ORTA 3FY0A 1OIRA 4NT4A 4O0VA 1OECA 5CEIA 2UZEA 5HO8A 5BMSA 4QYEA 3I6UA 4LFIA 3TJDA 3D2IA 4L45A 2YISA 2Y6OA 2YN8A 3RI1A 1OL5A 2QLQA 4FUXA 3OUNB 5IQEA 5BYZA 3C51A 3PRIA 5H2UA 2UW0A 5A4LA 5JZNA 5K9IA 3WZJA 3VULA 3TXOA 3ENMA 4RIWA 5HU3A 3B8RA 3NVKI 4G2FA 4L52A 3EQHA 3LFAA 2LAVA 4QP1A 1Q61A 3BU5A 2R3QA 2VO6A 4MEDA 2P2IA 1P2AA 2PMIA 4EZ7A 4Z55A 3AOXA 4EYJA 3OFMA 4E6QA 3DBCA 3C0IA 4RVKA 4H1MA 4CEGA 3V04A 4UXLA 3GCSA 1BUHA 3ROCA 3IW4A 1T45A 4WUNA 2QOLA 3NWWA 3R02A 3KF7A 4HVHA 5IMEA 2GTNA 4K11A 2ERZE 1XHAA 4DFZE 3H10A 3AC3A 3G2FA 1PMEA 3FKNA 4QP4A 3A62A 3NMUF 5CI6A 5CY3A 1KWPA 5B0XA 4FKGA 4O27B 3ZO1A 4FV9A 1GIHA 4YTHA 1CKPA 2RFDA 4JVGA 3EYGA 1U5QA 3EYHA 4F9AA 4YJVA 4Y46A 4OT6A 4DT9A 3WF9A 3NIEA 3PXYA 1L3RE 5LVNA 3SQQA 4C33A 1SVGA 4FZ6A 5GZAA 3QD2B 3UYSA 4JBVA 5BYYA 4UY9A 3OT3A 3PY1A 3L9LA 3R71A 3TIYA 4Q5HA 2CPKE 3GFWA 4O2PA 4LMNA 2UVZA 3R9NA 5BYLA 3A8WA 5IMXA 4BIBA 4PDYA 4DH1A 3AMYA 5AUTA 1ERKA 3I79A 2UVXA 2YLEA 5I3RA 5DR6A 2ZOQA 5DEYA 4LL5A 2V0DA 4IVCA 2V7AA 1R0EA 4L3PA 1OITA 2H9VA 5AUWA 3ZO4A 2X4ZA 2JBPA 4NKAA 2VGPA 4F65A 2W4JA 4QMOA 5ETIA 4U44A 1TKIA 4ASXA 1YQJA 2ITXA 4FIJA 4F99A 5L2TA 1H1SA 1ZRZA 5ANIA 4HOKA 3ANQA 4AG8A 5G6VA 4AT4A 4GT5A 4BI0A 3BRBA 4MXYA 4O0TA 4MXZA 3FI4A 1DM2A 3R7OA 5J79A 3KN6A 5CTPA 1GIJA 4MQ1A 1OL2A 3O8PA 3CQEA 3PXFA 4X3FA 4ASZA 2XEYA 1U54B 1SNUA 1TVOA 3TUBA 2G2HA 5C01A 5JFSA 5AM7A 1NVSA 4RJ6A 3RPOA 5HBJA 3I7CA 4KIKB 1ZZ2A 4E8AA 4AE6A 3WZUA 2WMSA 2R3IA 3F6XA 4ZOGA 4RJ7A 5HG7A 3OOGA 4FI1A 1OPKA 4F1TA 3ACJA 3PJCA 4DTKA 4N4SA 4NCTC 1JWHA 3PFQA 4IJPA 3U6HA 2IPXA 5FTGA 3FLWA 4U79A 4YR8A 3QF9A 3QTRA 5CAVA 3Q4TA 4UXQA 5J7HA 3GC8A 5CWZA 3Q6WA 4W8DA 3KXZA 4AW0A 3CD3A 1XWSA 2GMXA 4GYGA 4AT5A 1PXNA 3HVCA 2XIXA 5F95A 3ZSHA 3WARA 4V04A 4ZAUA 3UIUA 3E64A 1GAGA 4MF1A 3IW5A 3VWAA 5AMNA 5K4IA 3HL7A 1R3CA 4O7VA 4YO6A 2XIRA 5A4QA 1J7LA 2VUWA 3ZUTA 4FNZA 2JDRA 4IH8A 1FQ1B 5EQPA 5L2QA 3VUHA 3C9WA 3IDPA 2XNNA 1WVXA 3PP1A 4CRLA 4MNEB 2IG7A 4D1XA 4UN0C 3UQCA 5CSPA 5FXSA 4J8MA 2Z8CA 4FV8A 4CV9A 1FPUA 5HE3A 5EYDA 4DAWA 1PF8A 2B0QA 5E8VA 5CANA 4FKTA 4NM0A 2DS1A 4ZJIA 2XKEA 2ZV8A 5AADA 2PTKA 5JKGA 3ZH8A 4C02A 5BPYA 5E90A 1W82A 4C4GA 4WKQA 4KRDA 1BLXA 2VD5A 3GOPA 2XKFA 4JR7A 2XM9A 4K0YA 1XJDA 2XIZA 4OTIA 3LCDA 3FLYA 4KABA 5TKDA 1LEWA 2VX3A 3ZFXA 2IVTA 4L67A 4JAIA 3UIXA 4AOTA 3KRWA 2QLUA 1DAWA 3QKKA 4D0XA 4BBEA 5IA0A 3UNJA 2RFNA 1M7NA 3AGLA 3UPZA 3BELA 4IX3A 4EYMA 4F6WA 3LFCA 1OIQA 3OWPA 3I1AA 3G6GA 3CBLA 3LMHA 5B2LA 4OBQA 5E8TA 4L3LA 2A1AB 3NW6A 2QOFA 1Y8YA 3QHWA 3VUKA 1I44A 2W5BA 3BIZA 3OD6X 4EBVA 4Y95A 3KA0A 4HGLA 4EKLA 4BKYA 2NPQA 1UU3A 1T46A 3LFBA 4NCTA 4HPTE 2VTNA 4TXCA 3G51A 1J1BA 3LVPA 2CNQA 2OLCA 1BL7A 3WYYA 3AC1A 5LWMA 3F61A 4XP0A 2JIIA 3SGCA 4FKLA 5HG5A 4KS7A 4FV6A 4IFCA 1FOTA 2ZDTA 2VTTA 5JSMA 4I5HA 4ZSJA 3BBWA 3QYZA 3FBVA 3A7HA 1PYEA 3FPQA 4B6LA 2CKPA 4YPDA 4X2GA 3PYYA 4O84A 2XKDA 4D9UA 3UZTA 1OKZA 1UWHA 4QP3A 4PNKA 3WF5A 5KUPA 3AC5A 4WSYA 4DCAA 2BDJA 4V0GB 3FKLA 4BCNA 2WHBA 3WILA 4I0SA 2BR1A 3TV7A 4UMUA 3QTQA 4BI2A 2RF9A 4NIFA 4ANQA 4JLCA 3O71A 4U7ZA 3EN9A 3NUPA 3DKOA 3E7VA 3RNYA 3SXRA 4ACMA 5L4QA 3S00A 3W16A 1UWJA 4RA4A 3R1NA 4H58A 4APPA 2QOHA 3KMUA 3NSZA 3TDVA 3DB8A 2YZLA 3QRUA 4J7BA 1KE9A 3VBXA 4O7LA 3PP0A 2PUIA 3VS6A 3H30A 3PWDA 3VS2A 3GXLA 5HVYA 4QTBA 5CU3A 3TCPA 4PP9A 2ZMDA 3TNQB 1M52A 3FJQE 3GNIB 1OUYA 3QTXA 2PVMA 4FSWA 4AE9A 5BUEA 3UE4A 5M08A 2I6LA 2QHNA 3MJ1A 4I4FA 4MYGA 4EK6A 1Q3DA 2UZDA 4WNMA 2BILB 4HYHA 1Q4LA 1TQMA 4ZSEA 4B7TA 2VO0A 1OL7A 3FZSA 4WA9A 4GKIA 4FSNA 3VRYA 3GU7A 2GQSA 4FT3A 2B53A 1Y8GA 1P5EA 3SC1A 5LVPA 2AYPA 2V55A 3BKBA 4KKHA 1H07A 2GFSA 2XBJA 4EQCA 2F7XE 2WAJA 3R22A 3OBGA 3ZEWA 3TZMA 4L53A 4B0GA 1IASA 1H0VA 4DBXA 1PJKA 5FXQA 4HCVA 4C2VA 2V62A 2C3LA 2EXMA 4Z7GA 5A3XA 1BI8A 3HEGA 3TV4A 2X7FA 5A46A 4RJ5A 3BV3A 5M57A 4WIHA 3JYAA 3NPCA 5T3QA 2XNGA 4FV2A 3BE9A 5IA3A 4U97A 1XH5A 2VWXA 5HLPA 3BWFA 3CP9A 3NLBA 1V0OA 3KKVA 2UW9A 1LP4A 2XA4A 4V01A 5HE2A 2RGPA 3FQEA 4XLVA 2R3PA 4OTRA 3QGWA 4A9SA 4BRXA 1J1CA 3DZQA 3DJ5A 4JRVA 4JG6A 2BFYA 4CYIA 4QP7A 4GV1A 1XH9A 5KKRC 3JR1A 5DVRA 4F7NA 2FSTX 2QKWB 3UPXA 4Y5HA 5ETFA 4MD8E 1QCFA 3H9FA 4FIIA 1ZZLA 3KL8A 4OTWA 3FZOA 2SRCA 3PRFA 2F57A 5J8IA 5JN2A 3RK9A 2UZWE 2OW3A 4P5QA 1ZLTA 2FA2A 5FEEA 4OAUC 1NA7A 2R4BA 2HXLA 5JGDA 3VHEA 4C4JA 3F66A 4DGGA 3GBZA 5HNGA 4DEGA 3RCDA 2PK9A 3FYJX 5ANKA 2ZVAA 3EQBA 3LAUA 4M7IA 2ITTA 5AR2A 3RINA 4EH4A 5AP0A 2CCIA 4USDA 5DFPA 3KY2A 2J7TA 4RX5A 3CIKA 4UALA 4UV0A 4BWXA 4K77A 3TNPC 3BZ3A 3ZXZA 4QOXA 5AR4A 2E9PA 3MESA 5KMMA 2H6DA 4EUUA 4B8LA 2PVRA 3HECA 3OVVA 5ETCA 5I9YA 2ZMCA 4QYYA 4A9RA 5HO7A 3NYOA 3ZDIA 4EONA 5CSWA 3SXFA 5LWNA 4FUYA 4YP8A 4FOBA 5IQDA 1K9AA 4I94A 4QMQA 4GG5A 2XCKA 3Q9WA 4L7SA 4O0XA 4C4IA 1UKHA 1OMWA 1VYWA 2GPHA 4FT0A 4YBJA 3WF8A 4JL9A 1F3MC 3FC2A 3TIZA 4LUDA 5AV4A 3OCBA 1U54A 4O1PA 3TWJA 1LUFA 2BRHA 3HA8A 1VR2A 2UW3A 3FMEA 5AM6A 2Z2WA 5DLSA 3BHVA 4I93A 4XV2A 4ZY4A 4FVPA 3R01A 2F2CB 2YDKA 5AV0A 4OTGA 2YAKA 3D7ZA 3FI8A 1JLUE 1IA8A 4NWMA 4E73A 4LMUA 3F5GA 5LMAA 5C8NA 4OAVB 2YDIA 3BGZA 3UNZA 3NR9A 5IEYA 5IH6A 3C5IA 4N57A 3Q4ZA 2YM5A 3O8TA 5KNJA 3VUGA 4RWLA 5LARA 4FSMA 4KKEA 5I0BA 5HD7A 1PRYA 5DOSA 3DBDA 3I0QA 4WRSA 3ZTXA 4D9TA 2YLFA 4IE9A 5B2MA 3LM5A 2C6MA 4QPSA 3PTGA 4PX6A 2ZV2A 4I5PA 5J1WA 3MPAA 1IRKA 2A19B 3SRVB 4PP7A 1OIUA 3L1SA 5L6WL 4EWQA 4Y73A 2B55A 3BI6A 2C5XA 5IQAA 5M53A 3UVQA 1OVEA 2J0KA 2BRMA 4M69B 3NUXA 4HZRA 3DK6A 4R3CA 2WTDA 1Y57A 3HMOA 3OCGA 3PJ1A 4I4EA 4D4YA 3B8QA 4BB4A 4I6HA 4MBJA 4ACDA 2X8EA 3D5XA 4O1OA 5CEPA 2WMAA 2RIOA 3CY2A 3QUPA 4X3FC 4BCMA 2UZLA 4OTFA 3R21A 4FSZA 3JY0A 2P3GX 2B1PA 3P9JA 2C6DA 2PVYA 3DNDA 3S95A 5B2KA 5HD4A 3U6JA 2EUFB 3BLRA 3NUNA 2I1MA 2JFLA 3RWQA 3PPZA 5D41A 4WG5A 3PJ2A 5AR8A 5LMBA 3QXPA 4BFMA 4LGDA 3GCUA 4TY1A 2HW7A 2UZBA 3V8TA 3KMWA 3K3IA 1FVVA 3MH0A 3HRBA 3LJ0A 3ZLXA 4BTFA 3VNTA 2YABA 2W1DA 2OO8X 4QMVA 2VTMA 2VO7A 3MH1A 5AP2A 3U54A 4NM3A 3ORLA 3LQ8A 4AQCA 4IZAA 4N6ZA 3Q2JA 4KAOA 1SNXA 3NEWA 4IHPA 1E9HA 1Q8WA 4UB7A 1OPLA 4YZNA 4CT1A 4GFOA 2ITWA 4BBFA 3OG7A 4U42A 3HV7A 3R1SA 1NXKA 4YJRA 5CX9A 3U4WA 2OH4A 2AC5A 1ZYLA 1PXIA 2RG5A 4OT5A 1CKJA 2VWBA 3A7FA 3H9RA 3AD6A 3EQRA 5HCYA 4EI4A 5A4CA 3P08A 2EXEA 1XH7A 2JIUA 4TN6A 2VWUA 2VTIA 1QPCA 2P33A 4I0TA 3DLZA 4FYNA 1UNHA 3G5DA 3T3UA 4O7SA 4FZDB 4ZLYA 1J91A 4EC9A 2YWVA 3K54A 4MWHA 4R78A 4KBCA 1H24A 1F0QA 5BUIA 1YI4A 4CG9A 3GU4A 1CMKE 4DFUA 3VUDA 4AW1A 4BDJA 2PVJA 2X7OA 3BHYA 2WTWA 2W1CA 2ZJWA 5A6NA 3HNGA 4GT4A 1Q8UA 4EOQA 5CALA 1YVJA 4TZRA 1Y6AA 1GJOA 4KSPA 2JD5A 3WIGA 3TV6A 4MD7E 2W1IA 5KMIA 3CJFA 2HAKA 3F3ZA 2BDFA 3LE6A 4J95A 4C57A 2VNWA 4AW5A 5JGAA 3LQ3A 4O0SA 5JQ5A 3KEXA 1GNGA 2CN5A 4TNDA 3ZC6A 5GHVA 4GUBA 2J0JA 3ZFYA 3DA6A 5HKMA 4EORA 2J0IA 4UWYA 5IA4A 3Q32A 4GYIA 3ZHPC 4IWQA 5J9YA 5KCVA 2X39A 4A9YA 3OTUA 3V3VA 4GK2A 2YACA 3RMFA 1JKLA 2Z60A 3KQ7A 4APCA 4JQ8A 4DFNA 3DS6A 3RPRA 2XYUA 2YAAA 2J0MB 4WOVA 3O8UA 4RZWA 2IVVA 2OIBA 3FL5A 3C7QA 3GCPA 3LQ5A 4DE4A 2QO9A 4XX9A 2XNPA 4HVDA 5JFXA 3R00A 4CFXA 3GP0A 2BIKB 4LRJA 3PVWA 2ZB1A 5CU4A 4MF0A 4N6YA 3M1SA 4JOAA 3ZM4A 3EKNA 4FSRA 3VUTA 4A06A 1OKVA 3QC9A 3EL8A 2GQRA 1HCLA 4QQJA 5AUUA 3DLSA 3HMIA 4BDDA 3AT2A 3BU3A 5AIRA 1J7IA 2PPQA 1STCE 1VZOA 3P7AA 1AD5A 3ZRMA 1Q41A 5CYIA 2OZAA 3P79A 3GGFA 3W2SA 3QTSA 1A9UA 4HZSA 4YSJA 5JFVA 2YWPA 2WIHA 5C27A 1GY3A 5HEZA 3FLQA 4E4NA 4AOIA 3HV6A 4RG0A 3RTPA 4F70A 4JIKA 5CT7A 2X81A 2XCHA 2QOKA 3KVWA 2QKRA 2V7OA 4LRKA 4KUJA 4YPSA 3I7BA 5IU2A 3NRMA 5CS6A 4KIOA 3MFTA 4RIXB 2BZKB 4G34A 5J87A 3SX9A 4BN1A 1X8BA 3ROYA 3GENA 4QO9A 4G9RA 3UC4A 3W8QA 4C8BA 5BUJA 5GZ9A 4BGGA 2BAKA 1H01A 3DTWA 4NYEA 3BQRA 5JK3A 4ERKA 4PTEA 2CGXA 3QQLA 3ERKA 3MA6A 4FSYA 1PXMA 5C8KA 2C30A 4RIOA 3W2PA 4C4FA 2FUMA 2YIWA 4HPUE 4O0WA 3DXNA 4MVFA 5E4HA 5FEDA 3RK5A 3FXZA 3HA6A 1QMZA 3KC3A 3PA3A 5KMNA 5L6OA 3JUHA 5EFQA 4BL1A 5BVEA 4GK4A 4ZY5A 3ACKA 5CU2A 2IZRA 5TT7A 3IW8A 4H39A 3Q9YA 3GUBA 4E5BA 4BTJA 4YC6A 2YA9A 2JDTA 3VF8A 5HX8A 2JC6A 4L00A 3N4VA 3S1HA 3T9IA 5DH3A 5B7VA 2PZIA 5ANOA 3N9XA 3RJCA 3KGAA 4ZTMA 3KRJA 2I0VA 3GQIA 4D2RA 2CLQA 4JNWA 3PG3A 5HOAA 2PSQA 4AZTA 5F1ZA 2VTJA 2X6DA 2P55A 3Q60A 4CNHA 3HRCA 5JGBA 3R1QA 3NNXA 1EH4A 2VRXA 5DG5A 2ONLC 3KXMA 3V5TA 3ZO2A 4RFYA 4J8NA 2PZYA 1Y91A 2QOBA 4YNOA 1MQBA 5H8BA 1UNGA 2WPAA 3M11A 3FI3A 3S4QA 4IX6A 2JKMA 2UZNA 4XYFA 1XH6A 2ZDUA 5AV2A 4PMTA 5HBHA 3ZBXA 4BZNA 3N4TA 5BVFA 3D5UA 4NU1A 2WEVA 3PPKA 3BU6A 4H3BA 3NAYA 4U41A 4DA5A 2NO3A 4GRBA 4BDEA 4GT3A 4ZSLA 4ZTRA 3M2WA 2A2AA 2HIWA 3ORKA 3VQUA 1MUOA 3DV3A 4GFGA 4ZTLA 4AU8A 3LMIA 2UW6A 3MS9A 5EH0A 4I3ZA 3DTCA 3PVBA 5BVKA 3WZKA 4O83A 4ONAA 1AGWA 3IK3A 3ZC5A 4FA2A 2F4JA 5CF5A 2QU5A 2WMXA 4OTDA 1XH4A 5C26A 4NM7A 2EWAA 3KN5A 3FSFA 1WBOA 3QBNA 5DN3A 3ZS5A 1U5RA 3UOLA 3CQUA 4G9CA 5I9XA 3ODYX 3DPKA 4DCEA 4AA4A 5AUYA 4RQKA 2WO6A 3UIMA 3KFAA 3MA3A 3MW1A 4FKWA 5KKRB 4S2ZA 3F7WA 3UMWA 2G2FA 3WF7A 3QUEA 3U9CA 3FMDA 2O64A 4WHZA 4AN9A 5KBQA 1WBSA 4XS2A 1BX6A 4A9TA 4M66A 4K18A 4FTRA 4TRLA 4WUAA 3ZEPA 4D1SA 1R0PA 4WBBB 3C13A 4E4XA 5IUHA 3RK7A 1OKYA 4RQVA 1L8TA 1ND4A 1ZWSA 3T8OA 4DFLA 2Z7SA 3JPVA 3JXWA 4YC8A 4YURA 2IZTA 4BIEA 3FXWA 4IAAA 4IACA 4ALVA 5EHYA 4K8AA 4YZ9A 1W0XC 5FM2A 3QQUA 4JR3A 3BLHA 5BMMA 1UA2A 4J71A 4P2KA 4RBLA 3VBQA 1A48A 4Y8DA 2G9XA 4G3GA 1FVTA 4FE2A 2W1HA 4X3FB 4CFFA 4C2WA 2CGUA 4QMXA 1PXPA 4XNEA 3FMJA 4RSSA 4WNKA 4YHJA 4QP6A 3OWJA 5BVOA 4FNXA 3MVMA 2BPMA 3IG7A 4DG3E 2XJ1A 1U46A 2R3OA 3O2MA 5HZNA 3BV2A 5AFVA 2XRWA 1UU7A 4F09A 3O96A 3FPMA 2WU7A 4YHTA 4ZXTA 4FX3A 4RGJA 4WSQA 5A6OA 3DAEA 3LCSA 4R7HA 1Q8ZA 1OI9A 2YITA 3SHEA 3IW6A 3P1AA 3EHAA 4AGWA 3MWUA 4P4CA 4UMPA 3KRLA 3TNHA 5CEKA 3G9NA 4G3DA 4PY1A 3PLAE 4OTQA 3UGCA 3W1FA 3R0TA 3FZTA 1A06A 3M42A 4G31A 4MBLA 2XK8A 4QT1A 4X3JA 4CFNA 4ANNA 3DXPA 4YGAA 4YSMA 3Q5IA 4YJTA 4DF3A 5ICPA 3ULZA 2JKKA 2R3LA 3TZ7A 2YM7A 4FNWA 4BYJA 3HDNA 2OBJA 4YJPA 5AV3A 5CU6A 4C36A 5BVNA 2IZSA 2WMWA 5DEWA 1HOWA 4DH7A 4F63A 4FG7A 5C4LA 3R7YA 4BGQA 2XB7A 4XEYA 3A60A 4H36A 3ETAA 4USEA 2NRYA 1YHWA 4RT7A 3DQWA 3OC1A 1O6KA 3EKKA 4PF4A 4TW9A 4TWCA 4F08A 2YEXA 1UVRA 3BYUA 3PA5A 2GU8A 4YUQA 1NVQA 1YXXA 2C1AA 2QURA 5KMJA 2GNLA 2VWWA 4FZ7A 3TI1A 4ANSA 3ANRA 1OBGA 4D28A 1Q3WA 4BWPA 3PVGA 2FSOX 1PMUA 2PWLA 2Y4PA 3KXNA 3P86A 4WT6A 5EM5A 4F64A 3O51A 4BYIA 3CPCA 1H27A 2F2UA 4RWJA 4FICA 5EI2A 3BHUA 2H96A 2IW8A 5A4TA 2VWZA 3VBWA 2C5NA 3SW7A 3GCVA 1DAYA 2FSLX 2XJ2A 4EJNA 5I9WA 3OHTA 2Q0BA 5F20A 3V5QA 5HVKA 1OGUA 4BHNA 5AP6A 4CSVA 2R3KA 2X8DA 4KNBA 4HVGA 3COKA 2ITYA 3UVRA 5AP3A 3EFLA 3E87A 5CNNA 3WIKA 5HE0A 4I1ZA 2XNBA 4FTMA 2RG6A 3EFJA 4U40A 4Q2AA 4EHVA 3HAVA 1Z9XA 3EN7A 3V5PA 2QCSA 3QLGA 3EN5A 3BQCA 5K0XA 3HV3A 3QRKA 3PDTA 3EH9A 1U4DA 5K0KA 3PWYA 1FGIA 4IIRA 3BWJA 4RFMA 5CXZA 1F5QA 5D7VA 4IM2A 3VS0A 1ZYDA 2C3JA 5DHJA 5AR5A 2JAVA 1GZ8A 2XM8A 5HCZA 2O3PA 3QYWA 4M84A 1KOBA 2EB2A 1W98A 2ZYBA 3ALOA 3QU0A 4EH2A 3MVJA 3MDYA 4NW5A 3U9NA 2HK5A 4V0GA 4DFBA 3MI9A 5AX3A 3V5JA 3P5KA 3QA0A 3HP5A 3AMAA 1YI6A 3SLSA 3ZLSA 3POOA 3DXQA 5M06A 2R3NA 1UV5A 4M13A 3VRZA 3D7TB 2UW7A 3PJ8A 1I09A 4IMYA 1KSWA 4C0TA 2XJ0A 1JBPE 4HYSA 4I22A 1KV1A 3PXQA 1OZ1A 4JQ7A 5IDNA 4W4YA 4FEVA 2UZUE 4D2SA 4E6AA 2AUHA 2YIQA 3DGKA 3WI6A 3FLSA 3O0GA 5JMSA 4CRSA 2XRUA 3NIZA 2UZVA 3RAHA 3KRRA 3QWJA 5E8ZA 4ZZMA 5ACBC 3TJCA 3ZU7A 4U45A 2ZV9A 2BZIB 3F82A 3MGYA 3I5ZA 3QQHA 2Z7QA 2BALA 2O5KA 4PNIA 3W2CA 4BCFA 3UG1A 3FAAA 3G0FA 1ZAOA 4FKUA 4I41A 5E8SA 5AUXA 3CY3A 3QALE 4AA0A 4I92A 3KMMA 4R7IA 3ENHA 5HCXA 2R3MA 2OJIA 2XS0A 2XK3A 2W9FB 3R7VA 3KULA 2W96B 3MB6A 3C4CA 4QMUA 4RZVA 4L46A 3ELJA 1YDRE 3QC4A 3HLLA 4J1RA 4ACGA 2JLDA 2WQMA 3CKWA 2KULA 2P2HA 5LJJA 1QL6A 3P0MA 3ZUUA 4X21A 3LFEA 3RPSA 3TKUA 2F7EE 3AQVA 5HG9A 1KE7A 5CNOA 4R5SA 1M14A 2WMUA 4PL4A 1IAHA 4FKSA 2FGIA 2VV9A 4O81A 2Y6MA 3RHXA 4EQMA 5CVFA 3DK7A 3S3IA 2BZJA 4EH7A 5E8YA 4M14A 2CHLA 4FZAB 3RWPA 3O23A 3EIDA 4F7SA 3D15A 1WCCA 2HOGA 2UW5A 3CS9A 4JIAA 3Q53A 4EH3A 2WB8A 5DBXA 5EI6A 2ESMA 3C4EA 2C0TA 2X2MA 2CGVA 4NK9A 5AP5A 3OXIA 5EYMA 3NUUA 5FM3A 4BDCA 1FBNA 4LGGA 3FQHA 5DRBA 3EZRA 3E88A 5HORA 5DE2A 5E8XA 3RPVA 5M07A 4F7LA 4KBKA 5T68A 5HIEA 5KZ0A 1DS5A 3AC2A 4I23A 2ITOA 4O0UA 4C3PA 1NT2A 3MJ2A 4MHAA 4Y83A 3E7OA 1PKGA 2QQ7A 4FGRA 4EOSA 3FY2A 2ERKA 4YO4A 4AFJA 4D1ZA 2R3RA 4FTQA 4GG7A 3ORPA 3AG9A 2OXYA 2R0IA 4EHEA 1PXOA 4YTCA 4IB3A 4XP2A 3F3TA 3R8UA 1MRUA 2B54A 5HIBA 3I4BA 3TT0A 1WFCA 5KO1A 3EN4A 4B8MA 3OXTA 2BMCA 4M0ZA 5AR3A 4LV8A 4G5JA 3SXSA 2J5EA 4ZS0A 5AUVA 3OCSA 3VQHA 2WIPA 4X2KA 5LMKA 3EZVA 2IZUA 3COIA 3QA8A 1PY5A 3IECA 4U80A 5IA1A 2CMWA 4LG4A 2E9VA 4QNAA 5EYCA 3O50A 3MBLA 5CSVA 3I81A 4TYGA 2OXDA 2WU6A 4XBUA 3R30A 3ATSA 3KK9A 5F4NA 1YHSA 5J7BA 3PVUA 5BNJA 2UW8A 4NEUA 1Y6BA 1UU8A 3CC6A 3MFRA 3W55A 3WOWA 1IG1A 3CPBA 4WRGA 4FC0A 4J99A 3NAXA 2P0CA 3U87A 3SOCA 2IJMA 3AXWA 4BZOA 4F0GA 3LHJA 4YJOA 4R1YA 3D0EA 4K9YA 2Y4IC 4YZCA 1WBPA 4AX8A 3QXOA 2CGWA 3LJ2A 3EQPA 2RSVA 5DT0A 2WEIA 3QD4A 3CQWA 4C3FA 4EK3A 1JVPP 4QPMA 5CZHA 3OWKA 1KE8A 5FBNC 5LVLA 4ZMFA 3NCZA 1OIYA 4AGCA 2YM6A 5EW3A 1XBAA 3BHTA 4I21A 3A7JA 3PSBA 1ZXEA 1H4LA 4BKZA 3N4UA 4FEUA 3PJ3A 4R5YA 4FKJA 5IG1A 3RM7A 3H0ZA 4QYFA 4JBQA 4DINA 3BEGA 3R9DA 5IQHA 3GFEA 4PDOA 4UMQA 3PIXA 4IM3A 1RE8A 4TYEA 3OY1A 4CV8A 4LOQA 3UQGA 4M8TA 4O0YA 4O7WA 4IQ6A 2J90A 4CFVA 3Q2MA 3Q52A 4D58A 2UZOA 2OFVA 3Q04A 3REPA 1FMKA 4LI5A 4MCVA 4QMPA 5A54A 4FOCA 4GFMA 4XMOA 2GHGA 2A0CX 3ZRKA 3A8XA 1YOLA 2W06A 2OKRA 3C1XA 3PZEA 4EEVA 1PW2A 4DC2A 2BHHA 2C6LA 2VTLA 2ITNA 2ITVA 5EDPA 4JI9A 2I40A 3CTJA 3KU2A 4L68A 4BIDA 5KMOA 1FVRA 1ZOHA 3LCTA 4IX5A 3I0OA 2EVAA 3PSCA 4QQ5A 5EG3A 4JDKA 3H4JA 1DI9A 3W32A 4IC7A 2YERA 1YDTE 5EI8A 2C0OA 2YHVA 2Y8OA 4FT9A
chains in the Genus database with same CATH superfamily
5DGZA 1NVRA 2F7ZE 3K5VA 5M4IA 4FTKA 3LXKA 3FSKA 3UP7A 4G1WA 2XEZA 4YBKA 4F9BA 1WBVA 3IO7A 5H3QA 4QPAA 3OEZA 1BMKA 4AFEA 1SZMA 4PTCA 1MP8A 2C5OA 2WQBA 3D83A 1ZOEA 3ATTA 2C5VA 3GC0A 3TZ9A 3W2QA 5IF1A 4MXOA 5FDPA 5CZIA 4O4CA 3C4ZA 4HCTA 4ITHA 5GZ8A 3QZGA 3MY5A 3Q4UA 4QMTA 4BDHA 4AOJA 2QONA 2WMQA 4D2TA 4E5WA 2XK7A 1XO2B 1CSNA 2A4LA 2QI8A 2W17A 4M0YA 4HW7A 3BE2A 1FINA 3BGQA 4CFMA 5C4KA 1V1KA 3GC7A 3OW3A 3Q5ZA 2IN6A 2R3GA 4K33A 5DI1A 5DNRA 3T9TA 2GTMA 3L9MA 4QP2A 1LEZA 4OUCA 3WBLA 3ITZA 4CQGA 5IQIA 3QLFA 4G5PA 4BI1A 2FVDA 4FK3A 4GMYA 4EOJA 2PUPA 2EB3A 1IR3A 2BVAA 2C6EA 2DUVA 3CGFA 4OTHA 4ZIMA 2I7QA 5CQUA 2HXQA 4TTHB 4LQMA 4N0SA 3UO6A 4DFXE 4DH3A 5IQFA 2PE1A 2FYSA 2PMLX 3ZRLA 2BTRA 3S0OA 3LXLA 1GZKA 2X9EA 1O6LA 3BPRA 4JRNA 4DHFA 1GIIA 4FEXA 1YWRA 3I60A 4OLIA 3NFGB 1YXTA 5F9EA 3FEGA 1UKIA 3E3BX 3P7CA 2QOIA 3QUDA 4W4WA 3W18A 5LVOA 1PYXA 5C03A 1PMNA 4JT3A 5I9UA 4DLIA 2J2IB 3HMMA 3ORMA 4F1MA 3C0GA 4M68A 3TUDA 3L8SA 3EQDA 1KE5A 4OBOA 3QCSA 5HI2A 4D0WA 2Y9QA 3KREA 3EFWA 3LJ1A 5AAEA 4RPVA 2QVSE 3QX4A 4LV5A 1Q8TA 3R7IA 2BHEA 2BRGA 3C4XA 4EJ7A 2BAQA 4DLJA 4PV0A 4W8EA 2BUJA 2CLXA 2Y0AA 3BYMA 1RQQA 3AD4A 1ATPE 3IKAA 5EK7A 2J0LA 2R3FA 5IA5A 1UNLA 5I4NA 4BF2A 3QGYA 4D2VA 3HMPA 3CR0A 3MPTA 4CQEA 3DFAA 3LLAA 5AJQA 2WQEA 1YDSE 2C6KA 3RKBA 2VGOA 4X2NA 4FTCA 3HV5A 4PDPA 3LFQA 3DBQA 4IW0A 4DFYA 2RFSA 3WE4A 3G0EA 3U4UA 3IPHA 4FTAA 4H05A 2BRNA 4IZYA 1H1QA 3UO4A 3DT1A 2IVSA 3VIDA 4FV7A 2UVYA 5EM6A 1K2PA 3EQCA 1G8SA 2RKUA 4NFNA 1WAKA 3MY0A 4GL9A 4Q9SA 5DR9A 5EQYA 2QO2A 4L9IA 4TT7A 2PZPA 3O7LB 3QQJA 4O4DA 3RALA 4O7ZA 5FP6A 2ZFYA 5FUTA 2ZV7A 5ACKA 1JKKA 3FMLA 5L8LA 2JITA 3QQFA 4X6RA 3A99A 4NFMA 3U51A 3FZPA 4O82A 1PXLA 3FV8A 3SA0A 3DDQA 2GS7A 4IAIA 2OZAB 4RJ8A 4C61A 3DNEA 3MYGA 3R8LA 3D14A 5DR2A 1SMHA 4RFZA 5AEPA 3LCKA 4U5JA 3NYVA 3TNWA 3FLZA 2OF2A 3F88A 1JKTA 1YWVA 2WELA 3UDZA 2YM3A 4O7RA 2EU9A 2ITQA 4ITJA 5KZIA 2XIYA 2Y7JA 4MWIA 3FDNA 4BWKA 4ZLZA 1WVWA 2PVLA 2R7IA 1TQPA 5FTOA 5IEVA 2P4IA 1KUTA 1XMLA 4FG9A 4XLIA 1GZOA 2G15A 5EOBA 2OGVA 4C38A 4XOYA 4NL0A 4GU6A 2QG5A 2H34A 4GUEA 2JDVA 3GVUA 4FIEA 4IX4A 4UWCA 3ZCLA 1YXSA 2BCJA 2OJGA 2XVDA 3OS3A 4IAKA 5M4UA 4GS6A 4HVIA 3V5LA 2WQNA 2YIXA 4KS8A 5LCKA 2OJFE 2CN8A 4FSQA 3G33A 1H0WA 2PE0A 4HNFA 3V6SA 4DG0E 5AAGA 3R9HA 4KD1A 4AT3A 3DJ7A 4NTTA 4YNEA 5EHOA 3UJGA 5HNIX 4CFWA 4USFA 4ZSGA 4LL0A 4S30A 4YJNA 4ENXA 2HY81 4CZYB 4QMLA 5AP4A 1WVYA 2YM4A 3VJOA 3NFFB 3D4QA 3OCTA 3D2KA 4NKSA 4CKRA 3DAKA 4L7FA 3UIBA 3W33A 4IANA 2C69A 3MTLA 3PIZA 2VTSA 4FK6A 2KTYA 3W0PA 3A2CA 1WBWA 2XYNA 3KRXA 4MBIA 4O38A 4ZTNA 3AD5A 3O17A 4CMTA 2PYWA 3HAMA 2PVKA 3DBFA 5HVJA 3E8EA 4DGNA 5JH6A 3ZM9A 2XNEA 4ZTSA 3ZSIA 3QCYA 4JDHA 4U3ZA 4N70A 4CKIA 4IVAA 4U9AA 3DZOA 4GIHA 1JKSA 4DEIA 4A9UA 1OM1A 3FMKA 1YOMA 2OG8A 4JXFA 4EK4A 3ZMMA 3UZPA 4O7NA 1YKRA 1CKIA 1BI7A 2LGCA 2VTAA 3ULIA 3RCJA 4UMTA 3MTFA 4FTUA 4G6LA 3R1YA 3R8PA 4XG8A 3HGKA 2ZAZA 2W1FA 4GU9A 4Z9LA 3EL7A 4LOPA 2A27A 5CSXA 3PE1A 2GNFA 4NH1A 4FEQA 4NIFB 3C4WA 3K3JA 2O8YA 4QMZA 2W05A 4Z16A 5DIAA 2JBOA 5M4FA 2VTRA 4ASDA 4AZSA 2VX1A 4Y5QA 4QP8A 3R2YA 4II5A 5AP1A 2PMNX 1LR4A 1OUKA 3A4OX 4WNOA 2HENA 1GOLA 2OIQA 4U43A 5BX0A 2HW6A 4FV0A 4FV5A 3CLYA 1H00A 5FWKK 3QKLA 3V51A 3MN3A 3OUKA 4EOOA 4E7WA 3GOKA 4IZ5A 4NJ3A 3UDBA 3VBYA 1PHKA 2XP2A 3QZIA 1QPDA 3EJ1A 3ZLYA 1V0BA 2GNGA 2OU7A 3R83A 2PVHA 2W4OA 4GKHA 2CKEA 4L3JA 3DK3A 3GI3A 3VS5A 3TG1A 3VUMA 2HCKA 3BCEA 3IOKA 3QZFA 4XRLA 2VTPA 4YZMA 3A61A 3JVSA 3PA4A 4FV4A 3F5XA 4FT5A 4R7BA 2X8IA 2PULA 2O0UA 2W5HA 4TWPA 2WTIA 4U0IA 4FVQA 3UODA 4HVSA 3MFUA 3PE2A 3NW5A 4OGRA 4UZHA 2OF4A 2R3HA 5HNBA 4KINA 3SVVA 4QQCA 5H8EA 4E3CA 4ZS4A 3BLQA 3ZOSA 3LOKA 1YRPA 4QMYA 3QCQA 5KHWA 4LUEA 1PXJA 2XH5A 3WZEA 3QWKA 4H3QA 1IAJA 3ZLWA 1MQ4A 3COHA 5HO6A 4C4EA 4QMSA 4EQUA 5TE0A 2PHKA 3HV4A 3I5NA 2F9GA 4HGEA 1OB3A 4ORKA 3DU8A 3AT3A 3EN6A 2FB8A 3KCFA 5J1VA 2QNJA 3SDJA 2HZNA 1Q24A 2QODA 2WMBA 1MRYA 2UUEA 3LFNA 4DHIB 3KVXA 4AZWA 2H8HA 3DAJA 4XCUA 3W0NA 4H3PA 2JDOA 2UZTA 2JEDA 4YLJA 2WOTA 5ANEA 2VTOA 2FO0A 2OSCA 4FIFA 5HTIA 2C3IB 2WTKB 3GU8A 4FSTA 4TYHA 4JQEA 5BVWA 2X0PA 1M7QA 5ANGA 3Q6UA 4KIPA 1PXKA 3VF9A 5FXRA 3G15A 3LXPA 4U3YA 2EXCX 5CSHA 4FV1A 4I20A 4MTAA 2G01A 2JKQA 3MIAA 3FI2A 4PUZA 4ERWA 4IADA 4PMMA 4R3RA 3UNKA 4D2PA 1B39A 3LCOA 4BBMA 5K5NA 3F5UA 4BY9E 4E4LA 5CVHA 5DRDA 3E63A 2CNVA 4ZTHA 3VO3A 5M51A 3ZYAA 4YZBA 4YJQA 3UOHA 4I6FA 4KKGA 1M2QA 1R78A 4FTLA 4L42A 2BZHB 1FMOE 2PZRA 4BDKA 1Z57A 4ZJJA 4F0IA 3EFKA 4CLIA 4GK3A 4EWHA 4QRCA 5E8UA 2B9HA 4IVDA 2UV2A 3L8VA 5C1QB 2V22A 3IS5A 2QOOA 3ALNA 1M2PA 4FSUA 5HG8A 1QPJA 3DCVA 3P4KA 1BKXA 5TOZA 3U55A 2I0YA 5GIOE 3SAYA 2W9ZB 4IWOA 4FKOA 4D5KA 3E8CA 3WE8A 4D4SA 5D1JA 4K1BA 4L44A 3CGOA 3KF4A 3V8WA 3L8XA 2WOUA 2AQXA 2PE2A 4J98A 4LYNA 2X1NA 4YZDA 3LMGA 2JFMA 5FLFA 3F2RA 2GNJA 5HGIA 3VUIA 3MPMA 4DEEA 2WTCA 3H3CA 4BCOA 1OBDA 3QKMA 2R7BA 3G6HA 3GC9A 4CG8A 4C34A 2YCFA 4KSQA 3FHRA 4IFGA 1WBNA 3EQFA 4IAYA 3LFFA 4PRJA 3THBA 4PL5A 3G9LX 1XR1A 4FL3A 4CTBA 3F9NA 1LPUA 3FMNA 3PFYA 5FTQA 1OPJA 2GQGA 3ORZA 2QR8A 3H0YA 4ZMEA 4JG8A 3ORNA 4P7EA 3HYHA 4FTJA 4A07A 5IZFA 4AQKA 2HZIA 1H8FA 3LFSA 3SW4A 3AC8A 4M69A 3QFVA 2REIA 5CLPA 5AUZA 2VTHA 4PTGA 2WNTA 3LLTA 4KB8A 4IWDA 4NM5A 3KIOC 1URCA 5LCJA 3V6RA 2C0IA 1MRVA 4Y72A 4RRVA 4EK8A 2OI4X 2JIVA 2ETMA 3Q3BA 3IQ7A 4PMPA 5IPJA 4O6EA 1JQHA 5EW9A 4G6NA 4M12A 2PUNA 3R9OA 4W4VA 3ZBFA 5HLNA 2J4ZA 4FODA 4XP3A 3NVMB 4DEAA 4C37A 4DGOA 4FBXA 4GJ2A 1H28A 1APME 3RAKA 4DN5A 5KE0A 4CD0A 5CAPA 3EQGA 2DYLA 5IDPA 4AXAA 5L2WA 4RLKA 2PU8A 3SG8A 3JVRA 4I5MA 5AV1A 3ZZWA 4R77A 2Q0NA 4E4MA 3R7UA 4RIYB 2E9NA 3HP2A 2YIYA 2ETRA 3K5UA 5K5XA 2Z02A 4A4OA 4Z3VA 2GNHA 4UEUA 4I6BA 3MVHA 3D5VA 4KBAA 4RWIA 2XBAA 3GT8A 3E8NA 3NW7A 4E93A 3VW6A 4RLLA 2HY0A 3VVHA 4YLKA 4DGMA 4IVBA 5IISA 3OXZA 5KHXA 4GVJA 2HWOA 4XG4A 5D10A 5D11A 2HELA 1OL6A 4X6QC 4ZY6A 4A4XA 5AP7A 2OK1A 2JAMA 2CJMA 4IEBA 1G8AA 3E93A 4R8QA 4TYIA 3MB7A 4AAAA 4D4RA 4XOZA 4MH7A 3VBVA 3W8LA 1CDKA 1XBCA 4AA5A 4JBPA 5CVGA 3CEKA 4OR5A 2CKOA 4BTKA 4CCUA 2W1GA 3C0HA 4IAFA 4IB1A 1SVEA 3UYTA 1ZY5A 2WGJA 3LPBA 5LMKC 4CVAA 3LXNA 2ETKA 5D9HA 4X2FA 3PLSA 4JX3A 4OTPA 5L8JA 5L3AA 2C68A 3PUFC 2X4FA 2PL0A 3V01A 4MD9E 3F3UA 1XQZA 3BX5A 2GDOA 5EW8A 2CCHA 5ANJA 4CMOA 4GJ3A 2J50A 2R2PA 2VN9A 5IUIA 3BYOA 5TO8A 4BCQA 5HTCA 2DQ7X 3HDMA 4DG2E 4YJUA 4ALUA 5CF6A 2CKQA 5FD2A 4WNPA 3PIYA 3CTQA 1AQ1A 3R8MA 5CI7A 4HYIA 2IO6A 3NX8A 5EOLA 4P5ZA 4FIGA 4K2RA 4G3CA 4EOMA 4E5AX 3JS2A 3QD0A 2WKMA 2YM8A 3MSSA 2C6OA 4KRCA 1G3NA 5GJDA 5FRIA 4FG8A 4ARKA 4ANLA 4RIXA 4XG3A 5IQGA 2OFUA 3E92A 4FGBA 1YXUA 4MXXA 4ENYA 3P23A 4EHGA 5JQ8A 2QOQA 3ZO3A 5CT0A 3IONA 4QD6A 4UYNA 3ZUVA 3CCNA 5TF9A 5DMZA 4WG4A 3BLAA 3DKCA 3RHKA 4EC8A 1IA9A 3DJ6A 1TQIA 3W0SA 3RNIA 2UW4A 1O9UA 2QR7A 4AGUA 5CAUA 5JRQA 2B9IA 1K3AA 2GHLA 3DOGA 2HZ0A 2JGZA 3CSVA 3H9OA 3OP5A 3T3VA 4ZK5A 3RP9A 1OKWA 4F6SA 2JDSA 2QHMA 3NS9A 5K4JA 2B4SB 2C1BA 1R39A 2X2LA 3NDMA 3QX2A 1JOWB 3DB6A 5FEQA 4ALWA 3FYKX 3RAIA 1ZY4A 1Q5KA 3PPJA 4FT7A 2WZJA 2B7AA 5HE1A 3GEQA 4BDIA 4RX8A 5KBRA 4XHKB 2ACXA 3WZDA 3PY3A 5EDRA 1IEPA 5AWMA 4YMJA 2ZM3A 3N51A 5J95A 4XG9A 5L2SA 4MXCA 4O22A 1H26A 4DT8A 1DI8A 2NRUA 3BBTB 5AA9A 3CTHA 3OZ6A 3RZFA 5I9VA 2VU3A 4DEDA 5BVDA 3NNUA 1REJA 2B9FA 1VEBA 2GFCA 3QRIA 4IJ9A 4F9YA 4RC2A 4BC6A 3Q9XA 4EL9A 5CASA 2NNWB 4EBWA 3ZXTA 3QZHA 5CF4A 5HX6A 3GU5A 3IOPA 4QTCA 5CAOA 1ZYJA 4DTAA 5FP5A 4MUQA 3Q4CA 4E1ZA 3FE3A 5G1XA 3LM0A 2WD1A 4IB0A 4HYUA 3V8SA 5M4CA 4C62A 5CXHA 4U8ZA 2W99B 1ZARA 3TL8A 5HLWA 1ST4A 4BDAA 2CDZA 4KIQA 2HYYA 3ZDUA 3MVLA 2W0JA 3OY3A 3VS1A 3NNVA 4EOLA 4QYHA 4O2ZA 5FDXA 3TKIA 3HUCA 4X0MA 4CLJA 4PMSA 5KMLA 4S31A 4FJVA 1JSTA 3NNWA 4C7TA 3HZTA 2YDJA 3KCKA 4PPAA 5H8GA 3EB0A 4MNFA 4TYJA 5TR6A 2Q83A 2X2KA 3HRFA 3QL8A 4HCUA 2WTKC 3IGOA 5HBEA 4BCHA 5GIPE 1W84A 1BL6A 3F2NA 3COMA 4ASEA 4NUSA 4BCKA 4CGAA 4AZEA 2W1EA 3F7ZA 2O65A 3DBEA 4LM5A 3PSDA 5ANDA 4FEWA 4D5HA 2VX0A 3FKOA 5EM7A 4S32A 3VS4A 5J9ZA 4X7QA 2XIKA 5GJFA 4JDIA 4BCJA 4BTMA 4AW2A 3A7IA 2Z7RA 1G5SA 1Z5MA 4BCIA 3BYVA 5D7AA 1B38A 4B99A 4O91A 1R1WA 3TNIA 4HJOA 3NCGA 4F6UA 3WYXA 2GS6A 3LZBA 2FSMX 5HICA 3OEFX 5AIKA 4ZJVA 5FG8A 3B2TA 3CJGA 4XV1A 4BDGA 1PMVA 3QTWA 4RA5A 4PPBA 3VAPA 5CQWA 4ZTQA 1KV2A 3D5WA 3LKMA 3FLNC 4E6DA 3BYSA 5E8WA 4J52A 3QTUA 5I3OA 4FV3A 3OOMA 4RJ3A 4QQTA 3R04A 2F49A 3L9PA 1W7HA 2BDWA 3II5A 3C5UA 4IZ7A 4UMRA 4FL1A 1ZYSA 5CEOA 5J5SA 4D2WA 5CF8A 2OICA 4ZP5A 5E1EA 2X0GA 2YJSA 3KK8A 3P78A 1M2RA 2QOCA 4BJJA 4NJDA 4TWNA 5EDQA 1PKDA 1UU9A 4CXAA 4D4VA 5HESA 2Y4IB 2R5TA 4ZZNA 4TWOA 4I6LA 3RM6A 4OW8A 3HKOA 4IAZA 3G90X 2ZM4A 3VS3A 2HZ4A 4MKCA 3NGAA 4NW6A 1XH8A 1YW2A 5M09A 3GCQA 4FMQA 4YC3A 4RX9A 4C59A 4CZTA 2IW9A 4EHZA 4GVAA 4IDTA 5ITAA 5JEBA 5H9BA 5IA2A 5LQFA 4FNYA 4W9WA 4MQ2A 4A4LA 5KMKA 5DWRA 4ZZOA 2C4GA 5A4EA 5CEQA 3CE3A 4DGLC 4ZLOA 3ORIA 4QNYA 3VN9A 4CTCA 2I0EA 2W4KA 3RAWA 5IH4A 3FXXA 4KA3A 2VZ6A 5DA3A 1H1WA 1E1XA 3UO5A 5A9UA 3R8ZA 4JX7A 2OWBA 1ZMVA 4QMNA 2X6EA 2Z7LA 4PPCA 4RWKA 1QPEA 2IW6A 3QAME 2WMTA 4EKKA 5GNKA 4DTBA 4WO5A 3O5AA 2A98A 4I5CA 1ZYCA 5J9LA 3B2WA 3DKFA 3RPYA 4Q5EA 3RGFA 4FKRA 4TPTA 3DDPA 4FTOA 4L6QA 3EMGA 3QQGA 4FKIA 5KX8A 4MK0A 2OZOA 3F69A 4U81A 3FZRA 5IUGA 2PMOX 5CAQA 4E20A 4AWIA 2J5FA 3NUAA 2ZB0A 3DY7A 2QC6A 4QMMA 3D9VA 4R1VA 5HIDA 3UVPA 3R9RA 3R2BA 4I6QA 3NUYA 3UC3A 4S33A 2YJRA 4RVLA 3AMBA 4DYMA 1VYZA 1ST0A 1M17A 1SM2A 2YFXA 3C50A 5E1SA 3KXGA 1H08A 3UBDA 4JBOA 3F3WA 2XMYA 3L8PA 5D12A 2WMRA 3LFDA 2WTVA 2O2UA 3DFCB 4QMWA 5DPVA 5L8KA 2XK6A 5E92A 4HGSA 4J97A 2XK9A 3K2LA 4AS0A 5IQBA 1REKA 3CXWA 4FKQA 4JDJA 3QRJA 3E5AA 3QRTA 3OBJA 4G3EA 4AZVA 3Q96A 4X2JA 3BGPA 4C4HA 2OH0E 2YIRA 4G17A 4ANBA 4F78A 3FWQA 4QTAA 3IW7A 4JAJA 2BAJA 4YTIA 2C5YA 3R7GA 4QTDA 4AACA 5A14A 4PWNA 1S9IA 3DKGA 3OROA 2RFEA 4WG3A 4YLLA 3ZONA 3TACA 4Q9ZA 3R8VA 4RIWB 3FUPA 4B9DA 3GU6A 4FTIA 3ID6C 1CM8A 3KXHA 3BEAA 4AN2A 4UX9A 3CD8A 3FZ1A 2AC3A 5HHWA 4JG7A 3TZ8A 5I9ZA 2C6IA 3R73A 3S2PA 3CKXA 2ONLA 4LOOA 2YCSA 2BROA 2G1TA 2XF0A 3FL4A 4U6RA 4RC4A 4RJ4A 1W83A 4MX9A 5HQ0A 3UOKA 2C47A 4RX7A 4IWPA 2G2IA 1ZMUA 4RVMA 4EH5A 4F9CA 2OXXA 4Z7HA 5DT4A 4NTSA 3UMXA 3OMVA 3OT8A 3D7TA 4F9WA 1JAMA 1Q62A 4K6ZA 2WFYA 5F94A 3W2RA 1O6YA 3FMMA 5JFWA 4B4LA 3V5WA 3R28A 4EH6A 4BHZA 4C35A 2BRBA 4O0RA 3ZSGA 1Q99A 1W8CA 3QTIA 4AUAA 2BKKA 1J3HA 3KB7A 2ITZA 5DYJA 3VS7A 4R3PA 4O7TA 2J9MA 2XK4A 1YOJA 1SVHA 3QCXA 4ACHA 4IXPA 2OIDA 3LW0A 2VNYA 4FF8A 4Y85A 1XBBA 4AF3A 5JRSA 4QYGA 3U8WA 4E6CA 4IB5A 5EKOA 2GHMA 4IDVA 4UWBA 4BVUA 5GINE 2QU6A 4LRMA 1VJYA 4YU2A 3C4FA 4H1JA 4BGHA 4NSTA 3HX4A 1RDQE 2PVFA 4TNBA 4IBMA 4YTFA 1YXVA 4PL3A 3RBWA 3E62A 2JKOA 3PXZA 4YHFA 4HNIA 3R7EA 5IEXA 1CTPE 3AGMA 3RZBA 4BKJA 5DT3A 3DQXA 4BCPA 1WZYA 4FYOA 5EM8A 3D94A 2C6TA 2WTJA 4EH8A 2XNOA 2PY3A 4ANMA 3AT4A 3L9NA 4JS8A 4XUFA 4EH9A 5EYKA 3MY1A 1P14A 4GIIA 4QTEA 4RC3A 5E7RA 5CEMA 3F2AA 2XUUA 4BICA 2O63A 4IC8A 4AGDA 4C58A 5AR7A 4O21A 4KIKA 4C3RA 2BTSA 3FQSA 3EOCA 3OF0A 1H1RA 2J51A 4XV3A 3SRVA 4CYJA 5C9CA 3SV0A 2YCQA 1JNKA 4J96A 3W10A 4I0RA 5BQ0A 3U6IA 2OJ9A 2BKZA 4FTNA 3LIJA 4EZ5A 1V0PA 5FQDC 4OBPA 4CCBA 2GCDA 2I0HA 2VTQA 3HUBA 5FGKA 2HWPA 4GCJA 5AA8A 2VWYA 2V5QA 4LDTA 2E9UA 4BDBA 4XH6A 3PY0A 4EK5A 1KOAA 4V05A 3EQIA 3UP2A 2W1ZA 4XRJA 3EWHA 3OWLA 4DEBA 5JZJA 2R3JA 4CMUA 1WMKA 2VWVA 3VHKA 3OW4A 4EZ3A 2CSNA 1J7UA 3UTOA 4O96A 4AP7A 2X7GA 3PUPA 2DWBA 1JPAA 1ZMWA 3QD3A 3QTZA 4QP9A 4MNEA 3W2OA 4F0FA 2WMVA 3Q9ZA 5K3YA 3R63A 3PXRA 3PG1A 5IH5A 3HMNA 4L01A 3F5PA 1U59A 1RJBA 3FMHA 4ID7A 2GNIA 4FTTA 3GB2A 3VJNA 4F1OA 1P4OA 4GEOA 5IKWA 4TL0A 2NP8A 3TKHA 3UZRA 4ACCA 4DDGA 3TEIA 4NZWB 2FH9A 4DH5A 4UZDA 1WBTA 4P90A 1HCKA 2WXVA 5CENA 3MIYA 5I5ZA 4D55A 4FKPA 3PZHA 4KWPA 3TTJA 4M3QA 4XG2A 2B52A 3KXXA 4G16A 3NUSA 2RL5A 4PQNA 3UG2A 2QO7A 3IDCA 1JSVA 1YWNA 4CZUA 3TUCA 4S34A 4DITA 5HTBA 4MXAA 1XKKA 4E26A 3A4PA 5JT2A 3SD0A 4EOKA 2ZM1A 3MH2A 1GZNA 4XJ0A 4BZDA 2E9OA 3ZFMA 4ANOA 4FRFA 2XZSA 3OTVA 2QD9A 3FC1X 3MFSA 3SOAA 2XKCA 4BR3A 4G3FA 4CKJA 3I6WA 5IQCA 3ORXA 4FVRA 2QG7A 4TKSA 3P5JC 5EQEA 4ZEGA 3R6XA 4MAOA 4BDFA 3UQFA 2W5AA 5GJGA 3IGGA 2YZAA 2ITUA 3BHHA 3VW8A 5EHLA 3E3PA 4R6VA 4RMZA 4L8MA 4GH2A 5L2IA 2PZ5A 2WQOA 1YHVA 2R64A 4AZFA 3AC4A 4I24A 2E2BA 3VC4A 4W4XA 4DH8A 3POZA 3PXKA 4FIHA 5LVMA 1RW8A 3E8DA 3QQKA 4QEBA 1ZOGA 3KULB 4J53A 3ZZEA 3MH3A 4UYAA 5CU0A 4O7YA 3NYXA 3WF6A 4FR4A 3NZ0A 2BIYA 4GSBA 4L43A 4LGHA 5M55A 3TTIA 1NW1A 2CNUA 4TYHB 3SG9A 3TDWA 3GQLA 1H25A 2X9FA 4DEHA 5LOHA 2BFXA 2YCRA 4ITIA 4FKVA 4W9XA 2ITPA 5J5TA 2VAGA 4CT2A 4RIYA 2R9SA 3ODZX 5ETAA 3F3VA 4O6LA 3FHIA 4F4PA 4YJSA 5HU9A 3TM0A 5LXMA 4GW8A 4M67A 3ET7A 2IWIA 4BCGA 3RVGA 5EKNA 4M97A 3NYNA 2OJJA 4F7JA 4UBAA 4CFUA 3QHRA 4PDSA 4FZFB 3W0RA 4DBNA 4AXFA 1H1PA 2W7XA 1Q8YA 5T6KA 1BYGA 3TN8A 1NY3A 1E1VA 4HGTA 4A7CA 1URWA 4AN3A 2PVNA 5AAFA 4ZSAA 1YI3A 2GSFA 3A7GA 2J6MA 4O86A 1S9JA 5E9EA 5L6PA 3VBTA 3O7LD 2C3KA 2IF8A 4FL2A 1Q97A 4EOPA 5C8MA 3UOJA 1KE6A 2B9JA 5M56A 1SYKA 4IM0A 1B6CB 3JY9A 4XG6A 3SKCA 5M44A 4RVTA 4XG7A 2VO3A 5E91A 2GS2A 4XBRA 4XV9A 5FBOA 4EUTA 1JSUA 2VWIA 4M15A 1FGKA 1OL1A 3P7BA 4WD5A 4JJRA 2IVUA 3IDBA 5AX9A 4WBOA 4EOIA 2R0UA 2PUUA 3MV5A 2XNMA 1P4FA 4G6OA 3ORTA 3FY0A 1OIRA 4NT4A 4O0VA 1OECA 5CEIA 2UZEA 5HO8A 5BMSA 4QYEA 3I6UA 4LFIA 3TJDA 3D2IA 4L45A 4DHZA 2YISA 2Y6OA 2YN8A 3RI1A 1OL5A 2QLQA 4FUXA 3OUNB 5IQEA 5BYZA 3C51A 3PRIA 5H2UA 2UW0A 5A4LA 5JZNA 5K9IA 3WZJA 3VULA 3TXOA 4LV7A 3ENMA 4RIWA 5HU3A 3B8RA 3NVKI 4G2FA 4L52A 3EQHA 3LFAA 2LAVA 4QP1A 1Q61A 3BU5A 2R3QA 2VO6A 4MEDA 2P2IA 1P2AA 2PMIA 4EZ7A 4Z55A 3AOXA 4EYJA 3OFMA 4E6QA 3DBCA 3C0IA 4RVKA 4H1MA 4CEGA 3V04A 4UXLA 3GCSA 1BUHA 3ROCA 3IW4A 1T45A 3UDSA 4WUNA 2QOLA 3NWWA 3R02A 3KF7A 4HVHA 5IMEA 2GTNA 4K11A 2ERZE 1XHAA 4DFZE 3H10A 3AC3A 3G2FA 1PMEA 3FKNA 4QP4A 3A62A 3W0QA 3NMUF 5CI6A 5CY3A 1KWPA 5B0XA 4FKGA 4O27B 3ZO1A 4FV9A 1GIHA 4YTHA 1CKPA 2RFDA 4JVGA 3EYGA 1U5QA 3EYHA 4F9AA