2JKQA

Focal adhesion kinase catalytic domain in complex with bis-anilino pyrimidine inhibitor
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
273
structure length
258
Chain Sequence
DYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
publication title Crystal Structures of the Fak Kinase in Complex with Tae226 and Related Bis-Anilino Pyrimidine Inhibitors Reveal a Helical Dfg Conformation.
pubmed doi rcsb
source organism Gallus gallus
total genus 79
structure length 258
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jkqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jkqA01
3R7EA 1V1KA 3OY1A 4FG7A 4FTJA 2UW5A 1DAYA 3LIJA 3UP7A 4U40A 2PE1A 4ERWA 3QAME 2A1AB 5HLNA 4EOIA 3DLZA 3COMA 3Q53A 5HTCA 4KKEA 3CTJA 4BDDA 5HIBA 4H3QA 3UG1A 2Q0BA 4RX9A 3CPBA 3OBJA 3ZEPA 3OFMA 4M14A 4U41A 2C3KA 2ZAZA 3AC3A 3D9VA 3PJCA 4ZS4A 3JXWA 3A8WA 3DGKA 3UOJA 3R9DA 3ODZX 5BQ0A 3SLSA 1SVEA 1ZYJA 5ETAA 4EQCA 4F1TA 1MQBA 3EOCA 4YZBA 3RHKA 5CAPA 3FMNA 2H96A 3ZMMA 5IQBA 4ANNA 3PJ3A 3B2TA 3HKOA 3RPSA 4R78A 4I5HA 3B8RA 4ANBA 4MQ1A 4X2FA 4IWOA 4ZEGA 3RZBA 4RIOA 1DS5A 5I4NA 2QOLA 5EYDA 3QLFA 5HVYA 5AUTA 4JIAA 3LFNA 4OBQA 4R1VA 4BCHA 3BU5A 4A7CA 5C01A 3ZLSA 3FXZA 1RE8A 4AGUA 1UNGA 1U4DA 5JH6A 3CKWA 4LFIA 2KULA 4IZ7A 2JDSA 5D7AA 3EYGA 3MVJA 2VNYA 3CP9A 1Y6BA 4XP3A 2IG7A 1EH4A 3PZEA 4Y73A 3SX9A 4KKGA 2WGJA 3PE2A 5KBQA 1UU8A 4HYSA 4ZXTA 4GUBA 4ZSGA 4D55A 3EWHA 4ZTQA 5BUJA 1QPDA 2JFLA 1H1QA 4LV8A 2C6EA 3P86A 4YSMA 2OZAB 2QVSE 4IX5A 3DK3A 4U3YA 4QNAA 2FB8A 2DS1A 5FM2A 3ZBXA 4EOPA 4XG6A 2GNJA 4BDIA 3KULA 1H08A 3U9CA 4EOKA 4JAJA 4EH9A 3KL8A 4RWKA 3TI1A 3WE4A 4AUAA 2Y6OA 4FSRA 3G33A 4QYFA 3SG9A 4PY1A 5G6VA 4F1OA 4RFMA 4USDA 2XK9A 3MPTA 2IO6A 1V0BA 4XNEA 3DT1A 3QUPA 4F6UA 4MBLA 4AT3A 2V22A 3EB0A 4QP4A 4RIWA 4USEA 4O91A 2WQOA 4NIFB 1XJDA 3D7TA 1UNLA 3E7VA 3UOKA 2R0IA 2XUUA 3TDWA 1XWSA 5BVFA 4UMPA 2R3IA 1JLUE 1PF8A 2A4LA 3FLQA 5FG8A 2R5TA 3MA6A 3TCPA 3Q6WA 4RVKA 3F5XA 2QOQA 5H8EA 1PXNA 3F7WA 3UQGA 3GCUA 5IH4A 3E8CA 3OOGA 5DR6A 5KX8A 3FQEA 3QRIA 1CSNA 2XP2A 5T3QA 1Q41A 4YUQA 3R1QA 3SVVA 5HHWA 2VO7A 4DH7A 1L8TA 4UALA 4IHPA 4OLIA 4MH7A 4D58A 4ZZOA 4YU2A 3M1SA 4YJUA 3O8UA 3UDBA 1MP8A 3RAWA 3R7OA 4FEVA 1MRYA 3FZTA 5K0KA 4CCBA 5HNIX 1S9JA 4UXQA 5HD4A 4GG5A 2XNGA 3SW7A 4OTFA 5E8ZA 2C0TA 2IZRA 3QZIA 4XV9A 4UB7A 2WMUA 5AR4A 3D2KA 4PMPA 5HIDA 4P5ZA 1OECA 3KU2A 1Q8YA 4S34A 2WTCA 4UXLA 4ZSLA 3QLGA 4KABA 2F9GA 1YQJA 5JZJA 2J2IB 4DEBA 1W83A 5CSVA 2VNWA 4U9AA 5C27A 2UZOA 1SZMA 3W8LA 1H1WA 2VTQA 3HUCA 3LMGA 4F0IA 1OI9A 3U9NA 4WSYA 3R73A 1UKHA 5JRQA 3OTVA 4A9UA 2VWWA 2YDKA 3WF8A 3OHTA 4DAWA 4QYHA 5TT7A 3DJ6A 3HV5A 4JVGA 4TY1A 3P23A 5CU2A 5FEQA 2Z7LA 4HOKA 1BMKA 4DFZE 4EK6A 4C4HA 5KHXA 4KD1A 3NNXA 1L3RE 3P0MA 5F1ZA 3VBYA 4M7IA 4O6EA 4PTCA 1TQPA 1R3CA 2OJFE 2VWIA 4F6WA 1U54B 4BCIA 5BVNA 5J79A 2CGVA 2W5BA 3CD8A 1AD5A 3PDTA 4ALWA 2GCDA 2RG5A 3QTWA 3A8XA 3QD0A 3DJ7A 2XS0A 1XHAA 5FTQA 1WBNA 3V01A 3AQVA 1QPCA 3OWKA 3LOKA 2ESMA 2BTRA 2EWAA 1OPJA 3M2WA 4FV7A 2IZTA 4GJ2A 3MW1A 4TWPA 4YHFA 2LGCA 4IXPA 4M15A 2NRUA 3C0IA 3MH0A 3C13A 4M12A 3K54A 5CSHA 4DH8A 2X9EA 3G9LX 3ZXZA 2E2BA 2HW7A 3EKNA 4QP3A 4N6ZA 2XYNA 3DB6A 4UBAA 2W1ZA 4YC6A 4B99A 5L2SA 1PY5A 2WMXA 3UP2A 3FHIA 2UZUE 3Q5ZA 4EK8A 3GENA 4YJRA 4MNFA 4EK5A 4RWJA 3KK8A 4AN3A 2O63A 3C4ZA 3ACJA 1ND4A 4KBAA 3W2OA 2IVTA 5CANA 3CJGA 3FL5A 3DXPA 3BYVA 4IVDA 1YXTA 4JX3A 5AUVA 5M08A 4CV9A 2BROA 3K5VA 3BZ3A 2ITUA 3HEGA 4NTSA 4C4GA 4RLLA 4J71A 4YMJA 3GGFA 5AUZA 3UO5A 2B55A 1YHVA 4YJOA 1CMKE 1WCCA 4AACA 4ZP5A 5BYYA 1ZZLA 3IG7A 2I0HA 5DEWA 3KVXA 4K6ZA 1A06A 2WD1A 4PF4A 2ETKA 5KMMA 3DCVA 4IEBA 5DR2A 2QOKA 5E4HA 4RZVA 4ASXA 4GT5A 4R1YA 5IA4A 1T46A 4BDHA 4MXAA 2BIYA 3L8SA 2B7AA 4C3RA 4I0TA 4C8BA 5AADA 2XJ2A 4KBCA 2PTKA 2YIRA 3OMVA 1LPUA 1T45A 3OXIA 2B1PA 2UVZA 5HG9A 4FKLA 3PPJA 4EQUA 5AP7A 1SYKA 2GHLA 3QRKA 4CG8A 4U0IA 3DAJA 3KCFA 4O86A 3FY2A 4N6YA 2R7BA 2CJMA 2UVXA 4IACA 5HLPA 4JXFA 4I6QA 1H26A 1BUHA 5IPJA 5AV3A 3WIGA 2PUIA 5I9WA 1FPUA 5CEMA 1AGWA 4EHZA 4DH3A 3PSDA 4CYIA 2QHNA 2CGUA 3NUPA 1H0VA 1JKTA 4M3QA 5LARA 1NVSA 3LQ8A 1ZLTA 3MS9A 4BDGA 4II5A 3FMEA 4FTCA 2PU8A 4OT5A 3BE9A 4U5JA 5KMLA 1WZYA 3PWDA 4XYFA 2F4JA 2PZPA 1YXXA 3BU6A 3QX2A 4TYGA 3FI2A 2X8EA 5HE2A 2YJSA 4CKJA 3VBXA 3WF9A 2B9FA 1OGUA 5CQUA 5D7VA 3FZSA 2WAJA 3E92A 3TTJA 3HZTA 3CIKA 3NZ0A 3ZCLA 4C4IA 2OJIA 2YFXA 3Q52A 1X8BA 4UMUA 1FMKA 2GFCA 1OZ1A 2ZJWA 3HV7A 4HPUE 4PV0A 4Z55A 4AFJA 4PDYA 2BFYA 2CN8A 3BX5A 4I3ZA 5DYJA 1RJBA 4E4LA 4RX5A 3F3UA 3U4UA 3S1HA 1H0WA 4NKAA 4DT9A 3BHUA 2QKRA 3G5DA 2HENA 2I40A 5T68A 3ZO1A 3UJGA 4AOTA 3I7BA 4E6AA 4FGRA 5EOLA 5FD2A 3IO7A 3KRLA 2C3IB 4L7FA 2BZHB 4CTCA 4K11A 2CKQA 2YIYA 2XRWA 3AC1A 4FV6A 2ITNA 4H1JA 4FEWA 4RX8A 3UE4A 3DA6A 2OBJA 3L8VA 3MH1A 2F2CB 2W4JA 3PG1A 4WRGA 4JS8A 5K9IA 4AT4A 2IPXA 4D2RA 2JKMA 3ENMA 4NU1A 3ZLXA 3LFCA 5AMNA 2FSTX 4PDPA 3Q96A 3ORNA 4S30A 4TYHA 5ETCA 3P7BA 1Y57A 4M69B 3FI4A 5A4CA 2CHLA 4GYGA 3ZUTA 3VUIA 4N57A 4FKTA 4FV5A 3O23A 1GIJA 4G9RA 4JRNA 2OJJA 5IQHA 4R7BA 5AUYA 5GIOE 5AUUA 2JIIA 2W9ZB 5FM3A 4BZOA 4MQ2A 4RX7A 3ATSA 2QO9A 1PYEA 3LM0A 3SRVB 3WARA 4MD9E 4ZK5A 5M56A 5ANKA 3TZ8A 2OSCA 3G9NA 4IZYA 3VHKA 4C4FA 1U59A 5CU4A 2GNIA 1WBSA 4ZIMA 2PMNX 5K0XA 4ASEA 4GVAA 1GIIA 2FSOX 3LM5A 5HI2A 3DOGA 2AC5A 2XMYA 4FKGA 4H3BA 4NFNA 4HGSA 4E4NA 4ZTRA 4ZSJA 3RM7A 5D41A 4GG7A 4CEGA 4FKPA 3R7YA 3FZOA 2BRMA 4CKIA 4YO6A 4FE2A 1ZYCA 1Z9XA 4FSYA 4GYIA 4BR3A 2P2HA 2GMXA 5IG1A 4ZS0A 3LCSA 1WMKA 2UW8A 3QKMA 4C2WA 4BFMA 4FI1A 4MNEA 5EDRA 2WQEA 5FUTA 4WG4A 1Y91A 3WYXA 1H00A 5CT0A 3QRTA 3HRCA 5ACBC 4AFEA 2VWYA 5HTBA 1UWJA 5AP6A 5LQFA 3KMUA 1IR3A 1ZOEA 3DZQA 3LFAA 4BHZA 5J87A 5LVLA 2JC6A 3D5XA 3GP0A 1DI8A 4TRLA 3NVKI 3KXXA 3WYYA 3R6XA 2YJRA 4PPCA 5DBXA 4FTLA 4BCNA 3PXQA 2YM7A 4IAAA 3UZPA 4PNIA 4EH5A 4K18A 4TZRA 3WF6A 5IF1A 3ZS5A 2CLXA 4KIKA 1K3AA 4DTAA 2RGPA 3R00A 1XBAA 3DB8A 2OXXA 2C69A 2HZ0A 1H1SA 3UMXA 2WQMA 1ZMUA 3FY0A 4O0WA 5AM7A 4CFNA 4ZAUA 2X4ZA 5C8MA 2OW3A 4EOQA 4F9YA 2QOCA 2YLFA 3GU6A 3Q9XA 2X7FA 2C1BA 1LEZA 3L8PA 3EZRA 3QHRA 5FEEA 5IA1A 1ZOHA 2BRGA 2PK9A 2XK6A 4I92A 4IWQA 5F4NA 3ZZWA 4EUUA 4ZLOA 5L3AA 3ORKA 4E7WA 5CEOA 4KRCA 5EQYA 4XRJA 3COHA 3QD2B 5I3OA 5AAFA 2C5YA 1UKIA 1Y8YA 4IH8A 5EQPA 2ZOQA 3E3BX 3GU5A 4CQGA 5IUHA 4AU8A 4BI2A 3IQ7A 3QRUA 4IC7A 5E8YA 3H3CA 4L53A 4WNKA 5LVPA 5B2KA 1JOWB 2XVDA 4TYIA 3VJOA 2FYSA 3W55A 3SV0A 3MY1A 4QPSA 4BBFA 3HA8A 5CASA 3Q4TA 4OUCA 4AS0A 3DPKA 3SXFA 3KEXA 3QX4A 1NVQA 4O7VA 3ERKA 2W1GA 2JDRA 3U54A 2WIHA 2C5VA 3NYVA 4GIHA 3MN3A 5I9XA 1UWHA 1YDRE 1OIRA 2YISA 4FG9A 2JLDA 4OTGA 5HNGA 5J1WA 3FEGA 2PVRA 2OG8A 5CTPA 5FEDA 3VS3A 4IX3A 4CCUA 4EH6A 3C4FA 4DCAA 2B9IA 5HZNA 1JKSA 4FIIA 1J3HA 3VRZA 2C68A 4BF2A 4QNYA 2BALA 2BRBA 4Z9LA 2B54A 2VN9A 2XNOA 2YWVA 3ZLYA 5FP5A 1RW8A 2VTJA 3SC1A 5HORA 5CAUA 2BHEA 4XLIA 4JJRA 1KSWA 4AW5A 4R5SA 4TWCA 2J90A 5CVGA 3TZ9A 4HVGA 5I5ZA 5IQDA 2FSLX 2WTWA 3BBWA 2X1NA 3LJ0A 4IFGA 1KE7A 5CF8A 2C0OA 5L6WL 1TKIA 3KKVA 1KE9A 2UZNA 2V55A 2YIQA 4XLVA 4O2PA 5A14A 4QTAA 1H25A 4DF3A 3NLBA 5L6PA 2R3QA 4DLJA 3KRRA 4H58A 4U3ZA 3COKA 5K5NA 4GW8A 4TTHB 5DWRA 1KWPA 4Q9SA 3ZEWA 2PUUA 2HZ4A 3Q2MA 3NAYA 4D4SA 2WMTA 3PJ8A 4MX9A 4X3FB 2WQBA 3FE3A 3VN9A 3W8QA 4PMTA 2PWLA 2W0JA 1WVYA 2YCSA 3UOHA 5D9HA 2QCSA 2VTSA 3A60A 2BDJA 4MXCA 3HECA 4FZ6A 5AV0A 4H05A 3HMIA 3DZOA 5HOAA 1H1RA 3BEGA 4FKRA 4FVRA 4DC2A 4F7SA 4KA3A 3A62A 5L8JA 4BCJA 2ITXA 2W99B 3KFAA 4R6VA 4DEEA 4CMOA 4TYHB 3LXKA 4QQJA 2FH9A 4BTJA 4UWCA 4PPAA 5L4QA 4FOBA 4O0TA 2GHGA 3FYJX 4A9YA 3H30A 3VJNA 3FXWA 3WBLA 5BUIA 4DN5A 4M0ZA 3RWQA 2X81A 3LFSA 3EHAA 3HL7A 3TG1A 3KN6A 3LXNA 2JDVA 3JVRA 3PA4A 4EK3A 3UGCA 5IU2A 4GT3A 1UA2A 2OZAA 4GK2A 4U81A 5EHOA 2WOTA 2ITYA 3EZVA 4G1WA 4Z7GA 4FTOA 4FTMA 4I23A 5A6NA 1NVRA 5LWMA 2C6TA 2PZYA 4LRKA 3MY5A 2W96B 1OB3A 4V04A 3LQ5A 2HIWA 3PVBA 3VULA 3H9FA 1MQ4A 3MH3A 3PRFA 4K33A 3ZFMA 2PULA 2DQ7X 4R8QA 4PQNA 4APCA 3N4VA 2XIZA 5CAVA 2C5NA 4O7SA 1M7NA 2VTIA 3DK6A 4CRLA 3TN8A 4JQEA 5CU3A 5ETFA 4C62A 4F6SA 3ZM9A 2OJGA 1NW1A 4NIFA 3I5NA 2BVAA 4CFMA 1M7QA 4YNEA 2H6DA 3FMMA 2Z60A 3OWJA 4FNWA 3F6XA 3DQXA 4ID7A 3EFWA 1OL6A 2BZIB 2H9VA 2OF2A 4EYMA 4LQMA 4AG8A 4F63A 2CGXA 1VJYA 4X6RA 3V3VA 3LCDA 3I7CA 2P0CA 1FGIA 2XIXA 4CFUA 3FJQE 3F9NA 3EQGA 3FMKA 3OD6X 4LRJA 4QP6A 4DEHA 3QQFA 4IX4A 3L9NA 3QGYA 4U6RA 2PE0A 5FXQA 3PVUA 5BVEA 2GNLA 4EONA 5HG7A 3PLSA 1LR4A 4IDTA 2YAKA 4BCKA 1XH5A 4EC8A 3A4PA 3R83A 4IDVA 4C4EA 2QI8A 3LXPA 1FGKA 2F7EE 4QTDA 3HRFA 3UIBA 3UG2A 4FYOA 1JNKA 1LUFA 2C47A 2BCJA 4G3GA 4BGQA 3EN9A 4IZ5A 5IMEA 1FBNA 3UBDA 2C0IA 1G3NA 3AD5A 2EUFB 4PMSA 1H4LA 4IZAA 4YTIA 3V6SA 2R3MA 4CXAA 4FKUA 5B7VA 4X3JA 2QOHA 5FRIA 4D0WA 4WO5A 2BKKA 4BBEA 1H27A 3VRYA 3E62A 1WFCA 1MRVA 1STCE 2HAKA 2W1DA 2W1IA 4FL3A 2J50A 3ODYX 4FNYA 4PDSA 3WZUA 3I5ZA 4O2ZA 4ZZMA 1CM8A 3EQDA 3GQIA 4W4XA 4AZEA 2C6OA 4JX7A 1PXJA 3O7LD 3R8MA 3PE1A 2I1MA 3IW4A 5AFVA 2X0GA 3NEWA 1U54A 3W33A 3ZO4A 4EOSA 2YWPA 4LM5A 4B0GA 3PLAE 3OS3A 3VW8A 2WTJA 4FKIA 5TR6A 2OJ9A 3C0GA 2OIDA 3BIZA 3MGYA 3O7LB 3V5QA 3KMMA 3LJ2A 1MUOA 1Y6AA 3SGCA 3SHEA 2IZUA 3DKCA 3BHHA 2GU8A 3PA5A 4QMVA 3R01A 4I6FA 1I44A 1PMNA 2JAVA 4JDHA 3EN5A 2QD9A 4PTGA 5K5XA 3TIZA 4DFBA 3LFDA 3OXZA 2XNMA 4QPMA 1WAKA 4ACMA 2J5EA 1BI8A 4O82A 4QP2A 2GHMA 3GBZA 2EXEA 4FKOA 5DE2A 3NYOA 2R9SA 4L42A 4NTTA 2XK3A 4RIXB 1JSVA 1P2AA 4UMQA 2R3KA 2O65A 3QA8A 4G5JA 3C5IA 3O51A 5IKWA 4AWIA 4BDEA 3MB7A 2YIWA 3UMWA 1OBGA 2XB7A 4U80A 5CY3A 5I9VA 3G6GA 1MRUA 1WBOA 2VTLA 3F5PA 4NK9A 4O0XA 3BLRA 3QXPA 4FIJA 3TUBA 2GS7A 3I4BA 4OTIA 4DG0E 4UYNA 3KXGA 5LCKA 3T3UA 3ZBFA 2OGVA 1G8AA 4AZTA 1OUKA 3PUPA 4AOIA 4EJNA 1ZAOA 3EKKA 5CALA 2G2FA 5GJGA 4FT5A 1JBPE 3BHVA 1PXMA 3QQLA 2UW7A 1PKGA 3LHJA 3QQKA 5EI8A 3R8PA 4DFUA 3CS9A 1ZARA 3F3ZA 5TE0A 2GNHA 3TV6A 2O2UA 4L67A 2GSFA 2ZVAA 4A9TA 2F49A 3FAAA 4KBKA 4Q5HA 3IW5A 4JBVA 4RWLA 4YHJA 4BWKA 5E8TA 4FIHA 3D7ZA 3MTFA 3EYHA 5IQCA 2XKEA 4W8EA 2R3GA 3MB6A 4G3EA 4FIEA 4JDKA 4YJTA 5C26A 3BYSA 3IECA 4BGHA 2OF4A 4GSBA 3PIXA 3B2WA 3BGQA 4ASZA 3NYNA 5E8VA 4CFWA 2CDZA 4EKKA 2Y4IB 3IONA 3N51A 1WVXA 3ORZA 2E9UA 1G5SA 3FLNC 3NW5A 3O96A 3HNGA 2C6LA 4WOVA 4NM0A 2V7AA 4XEYA 3SOAA 3QXOA 2IZSA 3SD0A 2BHHA 4ANSA 2IW8A 4AE6A 2YABA 4KSQA 5M06A 3Q9WA 3DU8A 4IM2A 4MWIA 5LXMA 3CPCA 3TIYA 4JT3A 4QMLA 4AA4A 4D2PA 5M57A 2C6IA 2PMLX 3TJCA 4B9DA 3UZRA 3FQHA 3I1AA 4IAYA 3HDNA 4I5CA 2UV2A 3UIXA 2HXQA 5KUPA 2UZTA 3KF4A 2J51A 3QL8A 5DI1A 4DEGA 4AP7A 3UNZA 5HU9A 5HE1A 3VUMA 2WFYA 5DRBA 4D4RA 5ANJA 5FP6A 5J9LA 3ZONA 4IC8A 3VVHA 4A07A 3FV8A 3QD3A 3KMWA 3FWQA 5IA2A 4GRBA 3BWFA 5JEBA 5LMKC 4YTFA 3LCOA 3RMFA 3Q4CA 3IGGA 3CQUA 3K5UA 3U6JA 3BQCA 4AA5A 4DH1A 2PUNA 1IAHA 3FUPA 2VX3A 3C1XA 4LMUA 1ZZ2A 2F57A 3PIYA 4MK0A 5HE0A 3S2PA 5EKNA 4OW8A 5ACKA 2W7XA 2YAAA 3FKLA 3OCTA 3R1NA 4BKYA 5AR5A 2CNQA 3F66A 1YHWA 2P2IA 1PMEA 2BRHA 4E1ZA 2V7OA 3NGAA 4O7YA 2RKUA 1FOTA 3H0YA 3UTOA 5ETIA 4O0SA 4DEIA 3IW6A 4TYEA 4EUTA 2QODA 5IEVA 2C3JA 4FK3A 4DBXA 4ZSAA 4W9WA 4HCTA 2OXYA 2G1TA 4FICA 2UZEA 3HMNA 4FV4A 3QD4A 1HCLA 4L3PA 4YP8A 1Q24A 2RFEA 4KAOA 2ERZE 4LG4A 5TO8A 3V5PA 4EKLA 4M69A 4U42A 4AQCA 4FODA 3WF7A 3VS6A 5AP4A 3CY3A 3CTQA 1OVEA 2VU3A 1F5QA 2B53A 2XF0A 3RNYA 3HX4A 4DG2E 4ZJIA 4RA5A 3NMUF 2CMWA 3HRBA 3A4OX 2QO7A 4C4JA 5F94A 3KA0A 4AX8A 3SRVA 5EHLA 5HG5A 2JD5A 3GUBA 5DIAA 5HO6A 4D9TA 2QQ7A 3R2BA 4NFMA 2AC3A 4G3CA 4LYNA 4RMZA 3EQHA 3VUHA 5LMKA 2BILB 4FBXA 1R39A 3IOKA 2ITOA 3PXYA 4I4FA 4BYIA 4CYJA 1BL6A 4YZNA 1RQQA 4ZLYA 2BRNA 1PW2A 3W32A 4QMNA 4ENXA 5JQ5A 3QKLA 2CPKE 4XCUA 3DLSA 2JIUA 3AMAA 3AOXA 4G9CA 4QRCA 5HICA 4F7LA 2WMWA 3OW4A 5EYKA 4UZDA 3TKIA 5EI6A 2PY3A 3PWYA 1CDKA 5LMBA 2BAJA 2PVMA 3DBEA 4MF0A 4NCTC 4CVAA 1U46A 5GNKA 1ERKA 2PVKA 5DEYA 5HKMA 1XQZA 2NO3A 3RHXA 4BIEA 5BMMA 3ACKA 3PG3A 4S31A 2OI4X 4OTQA 3I0QA 5AA8A 1JVPP 4FTNA 5M4FA 3MFTA 4WNPA 4UY9A 4FX3A 2WNTA 4BN1A 2WMVA 5HLWA 1BKXA 1PYXA 5GHVA 1W82A 3KK9A 3L9MA 5J7BA 3W2PA 4XG2A 3TM0A 3GQLA 4RGJA 5BUEA 3F61A 3GU7A 4BGGA 2EVAA 2YERA 2QU6A 1R78A 2XEZA 3LLTA 4QMUA 5CI6A 4RJ8A 5BNJA 3NS9A 4B6LA 4F7JA 2E9NA 5JT2A 4R7IA 5JK3A 3R02A 3BKBA 4CKRA 2UVYA 4M8TA 4QYEA 3T3VA 4JNWA 2WTDA 4LGHA 1QMZA 3NUAA 1GOLA 2RFNA 5K4JA 4F4PA 1E9HA 4YJSA 2PE2A 4O0UA 4CT2A 3BHTA 4FC0A 4WIHA 3ZHPC 4V0GB 3Q32A 3R63A 1KV1A 2E9PA 4NCTA 3ORMA 1GZ8A 4RVLA 5CZIA 5EM6A 3KXZA 1P4FA 4PTEA 3FZPA 3Q3BA 2HW6A 3GEQA 4M0YA 4YGAA 4EOOA 3T9TA 4R77A 1W84A 4EZ7A 1YDTE 5F95A 4F65A 5G1XA 5LVMA 5DGZA 2WQNA 3MI9A 3UQCA 4HPTE 1I09A 4FKSA 3OT8A 4B4LA 5FTOA 2V5QA 1XBCA 3M42A 5JZNA 4ENYA 1RDQE 4HYIA 3CJFA 5IDNA 3RJCA 4TKSA 5AP3A 3W1FA 1NY3A 3H10A 2Z7RA 4RLKA 4YC8A 2VGPA 3EIDA 3EMGA 3TACA 3WZKA 5HVKA 2BAKA 4E8AA 5CVHA 3E64A 3UYTA 1YWNA 4E73A 3CBLA 4W9XA 2OWBA 3UYSA 4AOJA 4M67A 4GFGA 3R7VA 4X3FC 4IW0A 3TNQB 1U5QA 3C51A 4XOYA 3RALA 3ZLWA 3UC4A 4J53A 3UO6A 2NPQA 5FDXA 2ZMDA 3FMHA 2OIBA 3FKNA 3QC9A 4IVAA 3WE8A 4ZY6A 4CMUA 3S00A 3R8VA 3UIMA 2ZM4A 3JS2A 3AC2A 4A4XA 4BB4A 4G34A 4UN0C 4YBJA 5EFQA 4Q9ZA 2B9HA 3OEFX 3SG8A 5AR8A 3BE2A 4O7ZA 1YKRA 3L8XA 4FIGA 5DT3A 3FKOA 3MFRA 4NSTA 3LW0A 4D2WA 5ICPA 2ITTA 3F88A 5AIKA 2HCKA 4DINA 4KUJA 5JQ8A 2OICA 3SKCA 2IWIA 4R3PA 4IVCA 3R1YA 1PMVA 2J5FA 5FGKA 4XMOA 5EH0A 3RGFA 4ERKA 2YM8A 2R4BA 3OTUA 3FHRA 3KC3A 4W4YA 3GT8A 2OU7A 4WNOA 5GZAA 3HAVA 4O7RA 2I6LA 5M55A 3GCQA 5A4EA 3BELA 3C7QA 5JFXA 5IQIA 3LCKA 1JKLA 5F20A 3P08A 3Q9YA 1H28A 2XEYA 2WTKB 2YITA 2JKKA 4X3FA 5M53A 2HYYA 4ZTNA 4M84A 4NM7A 2GNFA 3WZJA 3EH9A 3Q6UA 4K8AA 5J5TA 1GAGA 3FMJA 2VRXA 5L8LA 3ID6C 2VWBA 5LWNA 3UOLA 1H07A 3ALNA 2ONLA 4CT1A 1M2RA 4HCVA 3FZRA 4GL9A 3PXFA 4OBOA 4DGMA 4YZCA 4DEAA 4F9AA 3Q2JA 1OL7A 1Q97A 2PMIA 3H9RA 5FQDC 2YM3A 5TKDA 4DITA 3ZRKA 2C6DA 5CZHA 3NSZA 3F69A 4D9UA 5A6OA 5HX6A 4FV8A 3V04A 5HD7A 4IMYA 4D4VA 5CEPA 1ZWSA 3RPVA 4M97A 2WO6A 4YZMA 3ZC6A 3QU0A 2X7OA 5CWZA 1XR1A 4FTIA 4FT7A 2UW0A 3QKKA 4J96A 3DBQA 4EORA 2O3PA 3QZGA 4ZSEA 3QTZA 4GH2A 4TN6A 3MWUA 3HDMA 4OAVB 2X39A 4EH8A 2R64A 3PXRA 5CI7A 5J95A 3QCQA 4XG4A 3AC4A 4HCUA 4YJQA 5HEZA 3QTXA 3W2QA 3CLYA 3OT3A 3I6WA 3AD4A 4PP7A 4JBQA 3W18A 5A4QA 4NM5A 4JOAA 2REIA 3MIAA 2PVNA 4WA9A 3ZOSA 4RVMA 4BCGA 5KMNA 4DGLC 4OR5A 4W8DA 4LOPA 4CSVA 2Y9QA 2WTIA 3CGFA 4GK4A 4U8ZA 5KNJA 3V6RA 2WTVA 4K77A 3U4WA 2YA9A 3W10A 4ZLZA 4YR8A 3C0HA 3AXWA 5BVOA 1URWA 2IW6A 4LOOA 3KGAA 3DDQA 2QOFA 3RAKA 5LCJA 3N4TA 4DFYA 3BCEA 5CAQA 3QZFA 4XG7A 1BYGA 2ITVA 3ZTXA 3OUKA 4GEOA 4FNXA 2XIKA 1YXSA 2FO0A 3NW6A 3QQGA 3EFLA 4YPSA 5CU0A 5I3RA 3P7AA 5EW8A 2HZIA 4TW9A 1OUYA 3Q60A 4HNIA 4B8MA 5KBRA 2PVLA 3MY0A 4FVPA 3VBVA 3LCTA 4E5WA 3AD6A 3IDCA 3NCZA 3IS5A 4BTFA 4L01A 3I60A 4FT9A 1GNGA 3ORLA 3PSBA 4MXZA 1VYZA 2QO2A 3OROA 4RG0A 3MTLA 2J0JA 4MD8E 4FR4A 2HZNA 2J0MB 2XKDA 3NYXA 4O27B 3VS7A 1OL5A 3O71A 3PJ1A 1YXUA 1ZYLA 2BAQA 2GDOA 2R3OA 3MVHA 4FKWA 2OK1A 3BLQA 3FI8A 2YDJA 4IB1A 4N0SA 3ANRA 3ROYA 5HU3A 5J5SA 4ZJVA 4DCEA 2VO0A 3HP2A 4JRVA 4FV2A 3WZEA 1URCA 3TDVA 5CLPA 2OO8X 3TV7A 2J6MA 3KXNA 5HCYA 3O0GA 3ZSGA 3FC1X 5L2WA 1A48A 5EW3A 1DM2A 1FVRA 3C4CA 5A3XA 5E8UA 2FA2A 5AJQA 2LAVA 3HV6A 4XG8A 4DFNA 2R3FA 3H0ZA 4ACDA 4EK4A 3RP9A 4MKCA 4YBKA 4AGWA 1KUTA 2J9MA 3RPRA 4UZHA 3R8LA 4ALVA 4FZFB 2W1HA 3KN5A 3Q04A 4NT4A 1OPKA 2F2UA 4RJ6A 5E90A 1PHKA 4CZYB 2A27A 4QQCA 3P78A 1J1CA 2YN8A 4FSWA 1H01A 4OTDA 3BI6A 2CKOA 2QU5A 5GZ8A 5AIRA 2J7TA 1YWRA 1NXKA 1ZY5A 2R7IA 5DMZA 3MH2A 4QQTA 2P3GX 3AT2A 3TTIA 3JY0A 4DGNA 4CFXA 4GK3A 4EI4A 4CLIA 5I9ZA 3KQ7A 3QC4A 5LOHA 5IISA 5K3YA 2BUJA 5EYMA 4BBMA 4GUEA 4LMNA 4ZTLA 4EZ5A 4FEUA 4C3FA 3OCBA 4ALUA 4WSQA 4RIXA 4BIBA 4L3LA 5AUXA 2Y4IC 4G5PA 4RC4A 4EHGA 4I5MA 5CF6A 2WMAA 5IDPA 4NZWB 3AC8A 3F3VA 1Q8TA 4TT7A 5IA0A 5IQAA 2QG5A 1OIUA 5A4TA 3NX8A 5E7RA 4EHVA 3CCNA 4FKQA 5JN2A 2WU7A 4BIDA 2B4SB 3R9RA 3KF7A 2BFXA 4HJOA 3QWKA 3NVMB 4Z7HA 4QP8A 2X2MA 4FV3A 3AC5A 5FTGA 4E3CA 4AZWA 4KIPA 3VUTA 5AR2A 4IAFA 4W4VA 2R3NA 3ATTA 4J8NA 4O0YA 4AGDA 4APPA 3FQSA 4JR3A 3LPBA 4C38A 3QALE 2WPAA 3ELJA 3EN6A 4HGTA 4XHKB 4BTMA 4J7BA 1Q99A 3BHYA 3F5UA 4CV8A 3HMPA 4AE9A 2YLEA 5IQEA 3NCGA 4PP9A 4G3DA 4R3RA 2UZWE 5CAOA 3JYAA 3BLHA 3O2MA 4RJ7A 3QTQA 1Q8UA 2WKMA 5DT4A 5AV4A 5IH6A 2XKFA 5M51A 3PY3A 2UW4A 4XS2A 3U51A 5JGBA 4BWPA 3RI1A 1SMHA 3WI6A 2OIQA 3PA3A 4I93A 4A9RA 4AW2A 4AGCA 4AZFA 4I6BA 2EB2A 4W4WA 4JBOA 4JR7A 4O0RA 4M68A 4IJPA 2BKZA 4G6NA 5DNRA 5HBEA 3W2CA 4LL0A 4OTPA 3OG7A 2WHBA 4J8MA 3TV4A 1R0PA 4FZAB 1P4OA 3NNUA 4WG5A 3E88A 5E8XA 1HCKA 4NJDA 2CGWA 2PVYA 4BC6A 5C1QB 1LEWA 3CQWA 3PXZA 2QOBA 4IE9A 4TWOA 3EJ1A 2QG7A 3F2AA 5KZIA 4ZY5A 1Z57A 3HLLA 5L8KA 3VF8A 4O7LA 5E91A 3B8QA 3QQHA 5EI2A 3RAHA 4AN9A 2CN5A 5J8IA 2WELA 4DLIA 4EH4A 3UO4A 5DFPA 5M4UA 4IAIA 4MTAA 3QTIA 1QCFA 1OKWA 3DTWA 4NW5A 5DG5A 4P2KA 4XG9A 4OAUC 4DFLA 4DTKA 4WBBB 5IEXA 3RINA 4Z16A 5AP1A 5AV1A 2ETMA 3ZRMA 4D4YA 2PZIA 2OFVA 3AMYA 2GS6A 5ANDA 5AWMA 3GFEA 4LGDA 1WBVA 1YI6A 2XM9A 2PVJA 2G15A 3FMLA 2NP8A 3UVPA 3IOPA 4PUZA 1OIYA 2XK8A 4I0RA 4BZNA 3TUDA 2ZYBA 4M66A 2EU9A 4DT8A 4LI5A 4X2JA 4D2VA 3UODA 4QYYA 5CX9A 4F9WA 3KY2A 3ZUVA 3HV3A 4I20A 5JGAA 2YM6A 3I6UA 4GFOA 5CEIA 1UNHA 3VWAA 3VQUA 1H1PA 3V5JA 1IEPA 2H8HA 3QWJA 4UWBA 2W1FA 4YZ9A 5CNOA 1HOWA 3R7IA 3A99A 2ZV9A 2YIXA 3NIZA 4GV1A 4XJ0A 4C58A 1YI3A 5J9YA 4E6DA 3PXKA 2VTTA 4RJ5A 1APME 2XCKA 3C4WA 3K3IA 3EQFA 2E9OA 2WMSA 3VBQA 4E5AX 3NUYA 2VTRA 4H39A 4CFFA 3NUUA 1YXVA 3VBTA 4EEVA 2W06A 3GVUA 1UU9A 4WUNA 4WG3A 1M17A 3TZMA 4C3PA 5KMJA 3A7GA 5KO1A 4O96A 4O81A 2R3HA 1F3MC 4FA2A 5IA3A 3MV5A 2W4KA 2O8YA 1YWVA 4RVTA 5DH3A 2JKOA 4FTUA 4G6LA 1XH7A 3GCPA 4IIRA 4XUFA 5DA3A 3QYZA 2WIPA 3SA0A 4E4XA 1IRKA 2BDFA 3LFFA 4L43A 4GU6A 2PUPA 3MA3A 4P7EA 4OBPA 5ANOA 4YJNA 3S3IA 4O84A 4L9IA 1GZOA 4ANQA 5EM7A 2Z02A 2W17A 4RFZA 2XNEA 1Q62A 5HQ0A 1QPEA 4TNDA 1ZRZA 4HZRA 5CXHA 3ZC5A 1IA9A 3SOCA 2O0UA 3R30A 5J9ZA 4I94A 2HY81 1UV5A 4OGRA 4XBUA 2C6MA 4JI9A 3VQHA 2JITA 4E4MA 5JKGA 5CF4A 4I4EA 3ZO2A 5JGDA 5L2TA 4CG9A 2A0CX 2F7XE 4H36A 4HGLA 1Z5MA 2YHVA 4DHFA 3NW7A 5AP0A 3TNPC 4PX6A 4C57A 4RIYB 2OFUA 3DXNA 3BPRA 3U6HA 5HO8A 3EQRA 5ANEA 3PY0A 1E1XA 2XA4A 3F82A 5CS6A 1U5RA 3MIYA 4EL9A 3NPCA 1SM2A 4MF1A 3TKUA 3TNWA 1BX6A 4L46A 2IW9A 3FDNA 4TWNA 2J0IA 1VZOA 4HYUA 3DFCB 3S4QA 3NNWA 1KE5A 3VBWA 4M13A 5AAGA 1VYWA 2R0UA 4IAKA 4F0GA 2XJ0A 5JFSA 4YSJA 3VW6A 4PL3A 3WF5A 4XBRA 5LJJA 3KCKA 4V0GA 1SNXA 4QOXA 4YTCA 4IM3A 2QONA 3ANQA 1JAMA 4YLKA 4BDFA 3D5VA 2XM8A 5AV2A 1AQ1A 2C5XA 3QUEA 5C8NA 3TJDA 3W2SA 4J52A 1A9UA 3IW8A 2XRUA 4WD5A 4ORKA 3ZRLA 5D12A 3IDPA 3O50A 1OL2A 3GC8A 3DAKA 4GFMA 3NR9A 4YJPA 3CTHA 4RA4A 4U7ZA 4ZMEA 4NM3A 3ET7A 3LZBA 3G2FA 2GQSA 3L9LA 5DRDA 3R8ZA 4WUAA 3PVWA 1J7LA 4L44A 1E1VA 4X2KA 2VWVA 1XH9A 3ZM4A 2YM4A 3BBTB 4C35A 3MFUA 5A9UA 1Y8GA 5BMSA 3UZTA 4YPDA 5CU6A 5EM8A 3D5UA 1GZNA 1OKZA 3GFWA 2VO3A 2WTKC 3II5A 2BZKB 4FEQA 4QMSA 2XK7A 5D1JA 4R5YA 3T8OA 5T6KA 5E1EA 4B7TA 2V62A 3P1AA 5AAEA 4Y5QA 2R2PA 4RBLA 5J1VA 3G15A 1ZXEA 2YCRA 3SAYA 5BVKA 3I79A 4K0YA 3R7GA 5H9BA 4D5HA 3ZSHA 1IASA 3E8NA 4EH3A 3GI3A 3I81A 2RSVA 3N9XA 4GVJA 2GS2A 3ZU7A 3A2CA 3EQPA 1G8SA 3BGPA 2Z8CA 4F9BA 3HMOA 4MXYA 3E8DA 3RM6A 2OH4A 4FL1A 1W8CA 2I0EA 1PJKA 2ZDTA 4DFXE 4F0FA 4HVDA 3V8WA 4FTQA 4ANLA 3LKMA 4C0TA 2X2KA 3FMDA 1JKKA 4UEUA 3SXRA 4CD0A 2HXLA 4NYEA 3FSKA 3TEIA 2X8IA 1YW2A 1P14A 3QTSA 3REPA 3U87A 3VS4A 2FSMX 2JGZA 1REJA 4X0MA 2X6EA 1ZMWA 4BRXA 2XYUA 4FKVA 5EYCA 2JDOA 2Y4PA 2XNBA 2QURA 3D15A 4EWHA 2GQRA 3U8WA 3P9JA 4B8LA 1YDSE 4U97A 4F09A 2R3PA 2PPQA 1B38A 3NUNA 3SQQA 4ACHA 3RVGA 4EOLA 1OM1A 1YI4A 2ITZA 5E9EA 3OEZA 3ORIA 5FLFA 3BEAA 5CSXA 3V5TA 4RPVA 3MVLA 4IM0A 3NWWA 3LMIA 2GQGA 2X9FA 4ONAA 4AA0A 1OMWA 4YNOA 3VNTA 4MCVA 4K2RA 3GCSA 5KCVA 4YURA 3H9OA 4RJ4A 4I1ZA 3EN7A 4ZY4A 2B52A 4FOCA 4MXOA 2W5HA 4QQ5A 1JQHA 4BL1A 4DBNA 4O0VA 1J91A 2KTYA 2JKQA 3GC0A 3IGOA 3WIKA 3TKHA 4DG3E 5AA9A 2VAGA 3WZDA 2CKEA 4BYJA 3E5AA 3GOPA 4GCJA 4IADA 2VTAA 2VTOA 1UU7A 1FVTA 2WOUA 3ETAA 2PSQA 4MVFA 4D0XA 5IMXA 4BDJA 2Q0NA 5DN3A 5EOBA 1YOMA 3R9OA 5JSMA 4DTBA 2JIVA 2XZSA 2RL5A 1LP4A 5HGIA 4UMRA 4ZZNA 1V0OA 1XH4A 3LFQA 4WHZA 3SW4A 3ORXA 5CT7A 5HTIA 4FF8A 3QYWA 4QP7A 3TNIA 2ITQA 5B0XA 4DGOA 5I0BA 3WILA 2R3JA 5IQGA 2ACXA 3RPYA 4FNZA 5AX9A 5CEKA 5KHWA 4G2FA 2SRCA 2ZV8A 4G31A 4U79A 4ACGA 4DH5A 4DE4A 2UW6A 3MESA 5H3QA 1CKPA 2XBJA 4FV1A 1Q5KA 2VZ6A 3CEKA 1TQIA 3HMMA 1Q61A 3V5LA 4GS6A 4CTBA 3OWLA 2JBPA 3WOWA 3IKAA 3F2NA 1XH8A 2WMRA 2A19B 4FMQA 4FSMA 4JQ7A 4PPBA 3ORTA 3V8TA 4EH2A 3KXMA 4J98A 2VWXA 3JPVA 3PP1A 3NIEA 3PPZA 2WEVA 4JG6A 3FLZA 3GXLA 4JAIA 4BCFA 3BYUA 5M4IA 4E5BA 1O6KA 3D94A 1ZOGA 5KKRB 2CCHA 2WB8A 4UV0A 1NA7A 3O8PA 3BU3A 3E7OA 2OKRA 4QD6A 4XOZA 4RQKA 3T9IA 3QF9A 5HE3A 1W0XC 5M44A 2C4GA 3LXLA 3LMHA 3GU4A 3TXOA 4BDCA 4K9YA 4HGEA 4C61A 2E9VA 4CRSA 2DUVA 2ERKA 5C9CA 3JR1A 3UPXA 3ZZEA 4BI0A 3QCSA 5JMSA 4BTKA 2J4ZA 5AR7A 3R28A 2HK5A 1H24A 4RQVA 1K9AA 5E92A 3DJ5A 4O1OA 4O38A 5HG8A 4QYGA 5FXRA 2Y7JA 4N70A 4TNBA 5DPVA 2Y8OA 5ANGA 2AYPA 1DI9A 4H3PA 1J7UA 3F5GA 2OH0E 2C6KA 1ATPE 3DAEA 3QFVA 4FUYA 5GJDA 5A4LA 2VTNA 3MJ2A 4BZDA 4V05A 3LQ3A 3EQCA 4A9SA 3RCJA 3CQEA 1OITA 4P5QA 2X7GA 2O64A 1QL6A 2RFDA 3A61A 4K1BA 3R04A 4FG8A 1YRPA 3UQFA 4FSQA 2XK4A 3RAIA 2F7ZE 4EJ7A 3OWPA 1UVRA 2PVHA 2H34A 1GY3A 5EDPA 4ZTMA 4ITIA 1KOAA 4QT1A 2EXCX 3AGMA 3COIA 4I5PA 1PXPA 4PDOA 5HVJA 5LVNA 3OXTA 4BY9E 1WBPA 4HZSA 4IB0A 2XBAA 3G51A 4XV2A 1M2QA 4EOJA 3RWPA 2OLCA 3EL7A 5AUWA 4A4LA 3VS5A 2ETRA 4CZTA 2ONLC 3OVVA 2HELA 4KNBA 1V0PA 3QZHA 5EK7A 4ITJA 3VUKA 4D2SA 3ZFXA 2ZB0A 2GNGA 5DOSA 3KRWA 3GOKA 1GJOA 4EYJA 3LE6A 1SNUA 3KB7A 4GMYA 2XNPA 3C4XA 3C50A 2I7QA 1J1BA 2X2LA 3CR0A 4UX9A 4KIQA 5BX0A 1K2PA 4O7WA 5LVOA 4MEDA 3RK7A 3ZSIA 3NNVA 3CXWA 3KULB 5EG3A 2O5KA 2Y6MA 3DFAA 3DY7A 1R1WA 2HWOA 3DBFA 5GJFA 5KE0A 5KMKA 4RSSA 4MD7E 5L6OA 2W05A 3AT3A 1ZMVA 2W5AA 3BV3A 3CE3A 4U45A 3UIUA 4XX9A 3ZYAA 4BVUA 3DQWA 3QQJA 5C8KA 4ACCA 4QMTA 3Q4ZA 5IEYA 5TOZA 4Q5EA 4RIWB 5HO7A 3LAUA 4P4CA 4QMPA 3MDYA 1CKJA 1BLXA 4E6CA 4MWHA 5HCXA 5GIPE 2PVFA 3D7TB 3NUXA 1XBBA 3K2LA 4DA5A 3MJ1A 4G17A 5DHJA 3SDJA 2BPMA 2JEDA 4GIIA 3F3TA 2Y0AA 1M14A 3UVQA 2R3RA 3HA6A 3ORPA 4QP1A 2RFSA 4U43A 4ARKA 3THBA 1XKKA 3GC7A 4WBOA 4E93A 2P4IA 3FXXA 4C7TA 4LUEA 4AZVA 5D11A 3QBNA 2VUWA 3ZUUA 2AUHA 3PP0A 4ANMA 3FZ1A 2R3LA 4C36A 5HX8A 4QPAA 2EB3A 2HOGA 3G90X 3IPHA 1FVVA 4FVQA 5FXSA 4QMYA 5AX3A 2W1EA 4D5KA 4I22A 1Q8ZA 2OXDA 1PXLA 3P79A 4MBIA 1IA8A 1PMUA 2BR1A 2IJMA 4JLCA 5J7HA 4G3FA 4JBPA 3R9NA 2XH5A 4FV0A 5AP5A 4OTWA 2YEXA 4GU9A 4X21A 4FSUA 2BIKB 4FTAA 3G0FA 2CLQA 3VIDA 4Y85A 2JBOA 1BI7A 4ZJJA 3K3JA 2G2HA 3PPKA 5H8BA 3R8UA 3POZA 5B2MA 4FIFA 5IUIA 4E20A 4L52A 3OUNB 3EN4A 3Q9ZA 3E3PA 4O7TA 2YCQA 4L68A 4WKQA 4GKHA 3N4UA 3E93A 5AEPA 4FKJA 4IX6A 2JFMA 3RPOA 3PZHA 5IA5A 1ZY4A 2DYLA 3JVSA 2HWPA 3QA0A 3RKBA 5TF9A 4YTHA 4Q2AA 3OCGA 3OOMA 4ITHA 3TUCA 4R7HA 4HVHA 4G16A 2X8DA 2V0DA 5DLSA 4ZTHA 2XIYA 3V8SA 4BWXA 2P33A 3QTRA 3R9HA 1JPAA 5M07A 3BGZA 3EFJA 3E8EA 3O8TA 3V5WA 3RCDA 5B2LA 4AF3A 4QMMA 3UNKA 5DVRA 2QNJA 4C34A 4FZ7A 3DKFA 2QHMA 3POOA 1GZKA 2J0KA 4JL9A 1ZYDA 3FLWA 1M2PA 1B6CB 1SVHA 1FINA 5EM5A 5EW9A 4FEXA 3P4KA 2UZBA 3VAPA 1IG1A 2C30A 5K4IA 4IANA 3RNIA 3PFQA 3PTGA 3PY1A 2XCHA 5KZ0A 3S95A 1Q3DA 4AZSA 4Y83A 3JUHA 4O1PA 4AT5A 4OTHA 4UYAA 4OT6A 4I0SA 3ZDUA 4FSNA 1H8FA 2OZOA 2PHKA 3QCXA 4IJ9A 1PKDA 4YC3A 3KRJA 2XIRA 3MYGA 2BZJA 2XJ1A 1XO2B 4NJ3A 4FTKA 1TVOA 4DGGA 2VV9A 3UPZA 4MAOA 3OZ6A 2NRYA 1VR2A 4QO9A 2C1AA 3U6IA 2G2IA 3FLSA 2ZDUA 3MPAA 2A2AA 4CLJA 2ZV2A 5JRSA 3BV2A 2WZJA 4MYGA 3RK9A 5KMOA 2VGOA 1FQ1B 4QMZA 4RC3A 2I0YA 4Y72A 5F9EA 2VO6A 4EH7A 3LVPA 4IQ6A 4HNFA 4A06A 3PVGA 4KSPA 4JG7A 3D0EA 4CGAA 2WEIA 2VD5A 4BI1A 4WRSA 3A7HA 4LV5A 4UMTA 1XH6A 4Y95A 3QCYA 4J1RA 2BMCA 5BPYA 2FUMA 3MPMA 5BVDA 3AT4A 4I41A 4O21A 4BKJA 2C5OA 3C9WA 4L7SA 3TT0A 4X7QA 4BCQA 2B9JA 2GTMA 2WMQA 4L3JA 4LOQA 5A54A 3R1SA 3BYMA 4J97A 4Z3VA 1SVGA 2WXVA 4MBJA 4EWQA 4FUXA 4RT7A 4CZUA 4EZ3A 5FBOA 2VTHA 4JDIA 4YZDA 2B0QA 3FPQA 5EQEA 5FWKK 3QQUA 1JWHA 2UZVA 3NDMA 4CMTA 1BL7A 3R7UA 4A4OA 2PMOX 2YDIA 5IH5A 3DDPA 1OL1A 2GFSA 3A7JA 3G0EA 4BCOA 3UC3A 4QTEA 4NEUA 3ZDIA 3RBWA 3BQRA 4S2ZA 3TWJA 2ZV7A 3CKXA 4HYHA 4QMWA 4ZMFA 3PYYA 5CXZA 1ZYSA 4FZDB 2XKCA 4KINA 3IK3A 4P90A 4RIYA 2UW9A 3OCSA 3ALOA 3KVWA 5HBJA 3FLYA 3FYKX 4LUDA 4Y5HA 5GZ9A 3DKOA 5IZFA 3CC6A 4J99A 5HNBA 4S33A 4PNKA 4CFVA 2BTSA 4TPTA 2YZAA 5LMAA 3LJ1A 4TXCA 2X4FA 3VUDA 2QC6A 4HVIA 3FBVA 3R2YA 4HW7A 2P55A 3GU8A 3NAXA 4CNHA 1J7IA 2RF9A 2G01A 4X6QC 4QMOA 2HY0A 4C37A 4I21A 1DAWA 3ROCA 1O9UA 3CD3A 3MBLA 4AW0A 2Z2WA 2VX0A 3QGWA 4O83A 4XV1A 3P7CA 4BKZA 4O6LA 4XP2A 1WBWA 4FYNA 5D10A 4PL4A 5I9YA 2DWBA 4EBWA 5HIEA 2ZM1A 3F2RA 4S32A 4ZOGA 3ZH8A 1TQMA 4F7NA 4C33A 2QOOA 2CCIA 4EOMA 3D2IA 2QR7A 4AXAA 3AMBA 1CTPE 3UVRA 2IN6A 1GIHA 5CVFA 5CSWA 3VS2A 3R0TA 2RIOA 5JFVA 4KIOA 2WMBA 4QP9A 4FSZA 4QTCA 4XV3A 5HESA 3MVMA 4GJ3A 3ULZA 4DYMA 4O7NA 4FTRA 2Q83A 3TZ7A 4F08A 3CGOA 3L1SA 3PRIA 4BICA 5C03A 4NL0A 5M09A 5AR3A 1QPJA 3DNEA 4KWPA 4XG3A 3MSSA 3BRBA 4FK6A 4QMQA 2PZ5A 4NH1A 3M11A 3HV4A 3QRJA 1KE8A 4BCMA 3DXQA 3G6HA 1OIQA 2QR8A 4F70A 3ENHA 4FGBA 4H1MA 4FT0A 1P5EA 3FI3A 1Q3WA 3GNIB 4FL2A 2IVUA 3QHWA 4NW6A 3HUBA 1WBTA 1WVWA 4IFCA 4Y46A 2UZDA 4UWYA 1M52A 2PZRA 3CY2A 3Q5IA 4XH6A 4KRDA 2ITWA 4E6QA 4BHNA 3ZXTA 3DV3A 4ZTSA 4NUSA 2JDTA 4EQMA 4YJVA 3O17A 1O6YA 3A7IA 2PL0A 3OP5A 4GT4A 1R0EA 4RWIA 5BVWA 3P5KA 2JAMA 1O6LA 3SXSA 3PIZA 5H8GA 3R21A 5E1SA 4L6QA 3VS1A 4BDKA 4C59A 1CKIA 3JY9A 2GPHA 2RG6A 4C2VA 3OC1A 2IVSA 3F3WA 3PSCA 4IB5A 2QOIA 3DS6A 1OBDA 1B39A 2GTNA 4KB8A 4F9CA 3E63A 4X2NA 4RC2A 4HVSA 5BYLA 2W4OA 3OW3A 1JSUA 2X6DA 4CQEA 4D1XA 2BDWA 1KE6A 4PMMA 3LFEA 5CYIA 5L2IA 5DT0A 4WT6A 1JSTA 3NRMA 4JQ8A 2W1CA 5DR9A 3ZFYA 4D2TA 2FGIA 4EHEA 4OTRA 5FBNC 3U55A 3RTPA 1S9IA 1YOJA 1UU3A 3EL8A 3EQBA 4Y8DA 4XP0A 3NUSA 3AGLA 4DEDA 3BWJA 3V51A 5C4LA 5BYZA 4F64A 1YHSA 3VF9A 4JDJA 4YO4A 3HAMA 2ZM3A 2FVDA 4AW1A 1IAJA 3L9PA 4MNEB 4ANOA 4TL0A 3TNHA 5GINE 4N4SA 5CNNA 2UW3A 4L00A 4IAZA 3IDBA 4RFYA 3HYHA 4IB3A 3ULIA 1OKYA 3HGKA 4I6HA 3OY3A 4D1SA 4U44A 3MFSA 3GB2A 3GCVA 4YHTA 5IQFA 3Q4UA 3I0OA 3EFKA 4IWDA 2WU6A 3VUGA 1KV2A 4X2GA 5FDPA 2CNVA 4JG8A 2VWUA 3HP5A 2PYWA 1FMOE 2CSNA 3VHEA 4J95A 4WNMA 3LFBA 5JFWA 3D83A 5H2UA 1PRYA 4IWPA 1NT2A 3F7ZA 4D28A 5EHYA 5KKRC 3D14A 4YLJA 1OPLA 5E8SA 2G9XA 4C02A 3GC9A 4KIKB 3FC2A 5ANIA 3DKGA 3UNJA 3KRXA 4BDBA 4USFA 4FTTA 1VEBA 3H4JA 3VC4A 4JIKA 2J0LA 5CENA 5CEQA 5EKOA 1YOLA 4FSTA 4BCPA 3S0OA 4EBVA 1PXKA 2ITPA 3C5UA 5L2QA 5A46A 4QMXA 3VO3A 4TYJA 4KKHA 4LL5A 4FV9A 2ZMCA 4L8MA 3QUDA 3W2RA 3KREA 4PWNA 2I0VA 3ITZA 4KS8A 4XRLA 5CF5A 2QLUA 4R3CA 2VX1A 4IBMA 4AN2A 5EDQA 4YLLA 3A7FA 1Q8WA 3OBGA 4MXXA 4O22A 4PRJA 5CQWA 4BDAA 2YCFA 3D4QA 2QLQA 4L45A 3R22A 4D1ZA 1REKA 1PXOA 2UUEA 4RZWA 3RK5A 3W16A 4F1MA 1F0QA 2YACA 5AP2A 3DNDA 2Z7QA 4F99A 5KMIA 2C3LA 3IW7A 4G6OA 1KOBA 3ZO3A 2VTPA 2CNUA 5AM6A 2Z7SA 3C4EA 3FSFA 4RRVA 4FT3A 4V01A 5HBHA 2IVVA 2NNWB 4NWMA 2ZB1A 1OKVA 2QKWB 2VTMA 2VWZA 4NKSA 3DBDA 3FPMA 4EC9A 2CKPA 4GKIA 1PXIA 5C4KA 4LGGA 4RJ3A 1YVJA 3TL8A 2W9FB 4AAAA 3OF0A 2YZLA 3EQIA 2YM5A 4QTBA 4KS7A 1W7HA 2XNNA 4LRMA 3VS0A 5IUGA 3RZFA 5CSPA 3CSVA 5E8WA 3R71A 3HVCA 4IVBA 3DK7A 3DBCA 5ITAA 2EXMA 5HCZA 3LLAA 3PJ2A 4PL5A 5I9UA 2UZLA 3FL4A 5M4CA 1Q4LA 1W98A 3BYOA 3E87A 4I24A 4ASDA 3D5WA 3AG9A 4E26A 3QTUA 3KXHA 3DTCA 4MHAA
chains in the Genus database with same CATH superfamily
3R7EA 1V1KA 3OY1A 4FG7A 4FTJA 2UW5A 3BL7A 1DAYA 1ST4A 3LIJA 3UP7A 4U40A 2PE1A 4ERWA 3QAME 2A1AB 5HLNA 4EOIA 3DLZA 3COMA 3Q53A 5HTCA 4KKEA 3CTJA 4BDDA 5HIBA 4H3QA 3UG1A 2Q0BA 4RX9A 3CPBA 3OBJA 3ZEPA 3OFMA 4M14A 4U41A 2C3KA 2ZAZA 3AC3A 3D9VA 3PJCA 4ZS4A 3JXWA 3A8WA 3DGKA 3UOJA 3R9DA 3ODZX 5BQ0A 3SLSA 1SVEA 1ZYJA 5ETAA 4EQCA 4F1TA 1MQBA 3EOCA 4YZBA 3RHKA 5CAPA 3FMNA 2H96A 3ZMMA 5IQBA 4ANNA 3PJ3A 3B2TA 3HKOA 3RPSA 4R78A 4I5HA 3B8RA 4ANBA 4MQ1A 4X2FA 4IWOA 4ZEGA 3RZBA 4RIOA 1DS5A 5I4NA 2QOLA 5EYDA 3QLFA 5HVYA 5AUTA 4JIAA 3LFNA 4OBQA 4R1VA 4BCHA 3BU5A 4A7CA 5C01A 3ZLSA 3FXZA 1RE8A 4AGUA 1UNGA 1U4DA 5JH6A 3CKWA 4LFIA 2KULA 4IZ7A 2JDSA 5D7AA 3EYGA 3MVJA 2VNYA 3CP9A 1Y6BA 4XP3A 2IG7A 1EH4A 3PZEA 4Y73A 3SX9A 4KKGA 2WGJA 3PE2A 5KBQA 1UU8A 4HYSA 4ZXTA 4GUBA 4ZSGA 4D55A 3EWHA 4ZTQA 5BUJA 1QPDA 2JFLA 1H1QA 4LV8A 2C6EA 3P86A 4YSMA 2OZAB 2QVSE 4IX5A 3DK3A 4U3YA 4QNAA 2FB8A 2DS1A 5FM2A 3ZBXA 4EOPA 4XG6A 2GNJA 4BDIA 3KULA 1H08A 3U9CA 4EOKA 4JAJA 4EH9A 3KL8A 4RWKA 3TI1A 3WE4A 4AUAA 2Y6OA 4FSRA 3G33A 4QYFA 3SG9A 4PY1A 5G6VA 4F1OA 4RFMA 4USDA 2XK9A 3MPTA 2IO6A 1V0BA 4XNEA 3DT1A 3QUPA 4F6UA 4MBLA 4AT3A 2V22A 3EB0A 4QP4A 4RIWA 4USEA 4O91A 2WQOA 4NIFB 1XJDA 3D7TA 1UNLA 3E7VA 3UOKA 2R0IA 2XUUA 3TDWA 1XWSA 5BVFA 4UMPA 2R3IA 1JLUE 1PF8A 2A4LA 3FLQA 5FG8A 2R5TA 3MA6A 3TCPA 3Q6WA 4RVKA 3F5XA 2QOQA 5H8EA 1PXNA 3F7WA 3UQGA 3GCUA 5IH4A 3E8CA 3OOGA 5DR6A 5KX8A 3FQEA 3QRIA 1CSNA 2XP2A 5T3QA 1Q41A 4YUQA 3R1QA 3SVVA 5HHWA 2VO7A 4DH7A 1L8TA 4UALA 4IHPA 4OLIA 4MH7A 4D58A 4ZZOA 4YU2A 3M1SA 4YJUA 3O8UA 3UDBA 1MP8A 3RAWA 3R7OA 4FEVA 1MRYA 3FZTA 5K0KA 4CCBA 5HNIX 1S9JA 4UXQA 5HD4A 4GG5A 2XNGA 3SW7A 4OTFA 5E8ZA 2C0TA 2IZRA 3QZIA 4XV9A 4UB7A 2WMUA 5AR4A 3D2KA 4PMPA 5HIDA 4P5ZA 1OECA 3KU2A 1Q8YA 4S34A 2WTCA 4UXLA 4ZSLA 3QLGA 4KABA 2F9GA 1YQJA 5JZJA 2J2IB 4DEBA 1W83A 5CSVA 2VNWA 4U9AA 5C27A 2UZOA 1SZMA 3W8LA 1H1WA 2VTQA 3HUCA 3LMGA 4F0IA 1OI9A 3U9NA 4WSYA 3R73A 1UKHA 5JRQA 3OTVA 4A9UA 2VWWA 2YDKA 3WF8A 3OHTA 4DAWA 4QYHA 5TT7A 3DJ6A 3HV5A 4JVGA 4TY1A 3P23A 5CU2A 5FEQA 2Z7LA 4HOKA 1BMKA 4DFZE 4EK6A 4C4HA 5KHXA 4KD1A 3NNXA 1L3RE 3P0MA 5F1ZA 3VBYA 4M7IA 4O6EA 4PTCA 1TQPA 1R3CA 2OJFE 2VWIA 4F6WA 1U54B 4BCIA 5BVNA 5J79A 2CGVA 2W5BA 3CD8A 1AD5A 3PDTA 4ALWA 2GCDA 2RG5A 3QTWA 3A8XA 3QD0A 3DJ7A 2XS0A 1XHAA 5FTQA 1WBNA 3V01A 3AQVA 1QPCA 3OWKA 3LOKA 2ESMA 2BTRA 2EWAA 1OPJA 3M2WA 4FV7A 2IZTA 4GJ2A 3MW1A 4TWPA 4YHFA 2LGCA 4IXPA 4M15A 2NRUA 3C0IA 3MH0A 3C13A 4M12A 3K54A 5CSHA 4DH8A 2X9EA 3G9LX 3ZXZA 2E2BA 2HW7A 3EKNA 4QP3A 4N6ZA 2XYNA 3DB6A 4UBAA 2W1ZA 4YC6A 4B99A 5L2SA 1PY5A 2WMXA 3UP2A 3FHIA 2UZUE 3Q5ZA 4EK8A 3GENA 4YJRA 4MNFA 4EK5A 4RWJA 3KK8A 4AN3A 2O63A 3C4ZA 3ACJA 1ND4A 4KBAA 3W2OA 2IVTA 5CANA 3CJGA 3FL5A 3DXPA 3BYVA 4IVDA 1YXTA 4JX3A 5AUVA 3P5JC 4CV9A 4BJJB 2BROA 3K5VA 3BZ3A 2ITUA 3HEGA 4NTSA 4C4GA 4RLLA 4J71A 4YMJA 3GGFA 5AUZA 3UO5A 2B55A 1YHVA 4YJOA 1CMKE 1WCCA 4AACA 4ZP5A 5BYYA 5BV3A 1ZZLA 3IG7A 3UDTA 2I0HA 5DEWA 3KVXA 4K6ZA 1A06A 2WD1A 4PF4A 2ETKA 5KMMA 3DCVA 4IEBA 5DR2A 2QOKA 4LDTA 5E4HA 4RZVA 4ASXA 4GT5A 4R1YA 5IA4A 1T46A 4BDHA 4MXAA 2BIYA 3L8SA 2B7AA 4C3RA 4I0TA 4C8BA 5AADA 2XJ2A 4KBCA 2PTKA 2YIRA 3OMVA 1LPUA 1T45A 3OXIA 2B1PA 2UVZA 5HG9A 4FKLA 3PPJA 4EQUA 5AP7A 1SYKA 2GHLA 3QRKA 4CG8A 4U0IA 3DAJA 3KCFA 4O86A 3FY2A 4N6YA 2R7BA 2CJMA 2UVXA 4IACA 5HLPA 4JXFA 4I6QA 1H26A 1BUHA 5IPJA 5AV3A 3WIGA 2PUIA 5I9WA 1FPUA 5CEMA 1AGWA 4EHZA 4DH3A 3PSDA 4CYIA 2QHNA 2CGUA 3NUPA 1H0VA 1JKTA 4M3QA 5LARA 1NVSA 3LQ8A 1ZLTA 3MS9A 4BDGA 4II5A 3FMEA 4FTCA 2PU8A 4OT5A 3BE9A 4U5JA 5KMLA 1WZYA 3PWDA 4XYFA 2F4JA 2PZPA 1YXXA 3BU6A 3QX2A 4TYGA 3FI2A 2X8EA 5HE2A 2YJSA 4CKJA 3VBXA 3WF9A 2B9FA 1OGUA 5CQUA 5D7VA 3FZSA 2WAJA 3E92A 3TTJA 3HZTA 3CIKA 3NZ0A 3ZCLA 4C4IA 2OJIA 2YFXA 3Q52A 1X8BA 4UMUA 1FMKA 2GFCA 1OZ1A 2ZJWA 3HV7A 4HPUE 4PV0A 4Z55A 4AFJA 4PDYA 2BFYA 2CN8A 3BX5A 4I3ZA 5DYJA 1RJBA 4E4LA 4RX5A 3F3UA 3U4UA 3S1HA 1H0WA 4NKAA 4DT9A 3BHUA 2QKRA 3G5DA 2HENA 2I40A 5T68A 3ZO1A 3UJGA 4AOTA 3I7BA 4E6AA 4FGRA 5EOLA 5FD2A 3IO7A 3KRLA 2C3IB 4L7FA 2BZHB 4CTCA 4K11A 2CKQA 2YIYA 2XRWA 3AC1A 4FV6A 2ITNA 4H1JA 4FEWA 4RX8A 3UE4A 3DA6A 2OBJA 3L8VA 3MH1A 2F2CB 2W4JA 3PG1A 4WRGA 4JS8A 5K9IA 4AT4A 2IPXA 4D2RA 2JKMA 3ENMA 4NU1A 3ZLXA 3LFCA 5AMNA 2FSTX 4PDPA 3Q96A 3ORNA 4S30A 4TYHA 5ETCA 3P7BA 1Y57A 4M69B 3FI4A 5A4CA 2CHLA 4GYGA 3ZUTA 3VUIA 4N57A 4FKTA 4FV5A 3O23A 1GIJA 4G9RA 4JRNA 2OJJA 5IQHA 4R7BA 5AUYA 5GIOE 5AUUA 2JIIA 2W9ZB 5FM3A 4BZOA 4MQ2A 4RX7A 3ATSA 2QO9A 1PYEA 3LM0A 3SRVB 3WARA 4MD9E 4ZK5A 5M56A 5ANKA 3TZ8A 2OSCA 3G9NA 4IZYA 3VHKA 4C4FA 1U59A 5CU4A 2GNIA 1WBSA 4ZIMA 2PMNX 5K0XA 4ASEA 4GVAA 1GIIA 2FSOX 3LM5A 5HI2A 3DOGA 2AC5A 2XMYA 4FKGA 4H3BA 4NFNA 4HGSA 4E4NA 4ZTRA 4ZSJA 3RM7A 5D41A 4GG7A 4CEGA 4FKPA 3R7YA 3FZOA 2BRMA 4CKIA 4YO6A 4FE2A 1ZYCA 1Z9XA 4FSYA 4GYIA 4BR3A 2P2HA 2GMXA 5IG1A 4ZS0A 3LCSA 1WMKA 2UW8A 3QKMA 4C2WA 4BFMA 4FI1A 4MNEA 5EDRA 2WQEA 5FUTA 4WG4A 1Y91A 3WYXA 1H00A 5CT0A 3QRTA 3HRCA 5ACBC 4AFEA 2VWYA 5HTBA 1UWJA 5AP6A 5LQFA 3KMUA 1IR3A 1ZOEA 3DZQA 3LFAA 4BHZA 5J87A 5LVLA 2JC6A 3D5XA 3GP0A 4AXEA 1DI8A 4TRLA 3NVKI 3KXXA 3WYYA 3R6XA 2YJRA 4PPCA 5DBXA 1OGYA 4FTLA 4BCNA 3PXQA 2YM7A 4IAAA 3UZPA 4PNIA 4EH5A 4K18A 4TZRA 3WF6A 5IF1A 3ZS5A 2CLXA 4KIKA 1K3AA 4DTAA 2RGPA 3R00A 1XBAA 3DB8A 2OXXA 2C69A 2HZ0A 1H1SA 3UMXA 2WQMA 1ZMUA 3FY0A 4O0WA 5AM7A 4CFNA 4ZAUA 2X4ZA 5C8MA 2OW3A 4EOQA 3UDZA 4F9YA 2QOCA 2YLFA 3GU6A 3Q9XA 2X7FA 2C1BA 1LEZA 3L8PA 3PUFC 4DHJA 3EZRA 3QHRA 5FEEA 5IA1A 1ZOHA 2BRGA 2PK9A 2XK6A 4I92A 4IWQA 5F4NA 3ZZWA 4EUUA 4ZLOA 5L3AA 3ORKA 4E7WA 5CEOA 4KRCA 1XMLA 4XRJA 3COHA 3QD2B 5I3OA 5AAFA 5EQYA 2C5YA 1UKIA 1Y8YA 4IH8A 5EQPA 2ZOQA 3E3BX 3GU5A 4CQGA 5IUHA 4AU8A 4BI2A 3IQ7A 3QRUA 4IC7A 5E8YA 3H3CA 4L53A 4WNKA 5LVPA 5B2KA 1JOWB 2XVDA 4TYIA 3VJOA 2FYSA 3W55A 3SV0A 3MY1A 4QPSA 4BBFA 3HA8A 5CASA 3Q4TA 4OUCA 4AS0A 3DPKA 3SXFA 3KEXA 3QX4A 1NVQA 4O7VA 3ERKA 2W1GA 1XMMA 2JDRA 3U54A 2WIHA 2C5VA 3NYVA 4GIHA 1G8KA 3MN3A 5I9XA 1UWHA 1YDRE 1OIRA 2YISA 4FG9A 2JLDA 4OTGA 5HNGA 5J1WA 3FEGA 2PVRA 2OG8A 5CTPA 5FEDA 3VS3A 4IX3A 4CCUA 4EH6A 3C4FA 4DCAA 2B9IA 5HZNA 1JKSA 4FIIA 1J3HA 3VRZA 2C68A 4BF2A 4QNYA 2BALA 2BRBA 4Z9LA 2B54A 2VN9A 2XNOA 2YWVA 2XAMA 3ZLYA 5FP5A 1RW8A 2VTJA 3SC1A 5HORA 5CAUA 2BHEA 2X0PA 4XLIA 4JJRA 1KSWA 4AW5A 4R5SA 4TWCA 2J90A 5CVGA 3TZ9A 4HVGA 5I5ZA 5IQDA 2FSLX 2WTWA 3BBWA 2X1NA 3LJ0A 4IFGA 1KE7A 5CF8A 2C0OA 5L6WL 1TKIA 3KKVA 1KE9A 2UZNA 2V55A 2YIQA 4XLVA 4O2PA 5A14A 4QTAA 1H25A 4DF3A 3NLBA 5L6PA 2R3QA 4DLJA 3KRRA 4H58A 4U3ZA 3COKA 5K5NA 4GW8A 4TTHB 5DWRA 1KWPA 4Q9SA 3ZEWA 2PUUA 2HZ4A 3Q2MA 3NAYA 4D4SA 2WMTA 3PJ8A 4MX9A 4X3FB 2WQBA 3FE3A 3VN9A 3W8QA 4PMTA 2PWLA 2W0JA 1WVYA 2YCSA 3UOHA 5D9HA 2QCSA 2VTSA 3A60A 2BDJA 4MXCA 3HECA 4FZ6A 5AV0A 4H05A 3HMIA 3DZOA 5HOAA 1H1RA 3BEGA 4FKRA 4FVRA 4DC2A 4F7SA 4KA3A 3A62A 5L8JA 4BCJA 2ITXA 2W99B 3KFAA 4R6VA 4DEEA 4CMOA 4TYHB 3LXKA 4QQJA 2FH9A 4BTJA 4UWCA 4PPAA 5L4QA 4FOBA 4O0TA 2GHGA 3FYJX 4A9YA 3H30A 3VJNA 3FXWA 3WBLA 5BUIA 4DN5A 4M0ZA 3RWQA 2X81A 3LFSA 3EHAA 3HL7A 3TG1A 3KN6A 3LXNA 2JDVA 3JVRA 3PA4A 4EK3A 3UGCA 5IU2A 4GT3A 1UA2A 2OZAA 4GK2A 4U81A 5EHOA 2WOTA 2ITYA 3EZVA 4G1WA 4Z7GA 4FTOA 4FTMA 4I23A 5A6NA 1NVRA 5LWMA 2C6TA 2PZYA 4LRKA 3MY5A 2W96B 1OB3A 4V04A 3LQ5A 2HIWA 3PVBA 3VULA 3H9FA 1MQ4A 3MH3A 3PRFA 4K33A 4FRFA 3ZFMA 2PULA 2DQ7X 4R8QA 4PQNA 4APCA 3N4VA 2XIZA 5CAVA 2C5NA 4O7SA 1M7NA 2VTIA 3DK6A 4CRLA 3TN8A 4JQEA 5CU3A 5ETFA 4C62A 4F6SA 3ZM9A 2OJGA 1NW1A 4NIFA 3I5NA 1TZDA 2BVAA 4CFMA 1M7QA 4YNEA 2H6DA 3FMMA 2Z60A 3OWJA 4FNWA 3F6XA 4FJVA 3DQXA 4ID7A 3EFWA 1OL6A 2BZIB 2H9VA 2OF2A 4EYMA 4LQMA 4AG8A 4F63A 2CGXA 1VJYA 4X6RA 3V3VA 4QDVA 3LCDA 3I7CA 2P0CA 1FGIA 2XIXA 4CFUA 3FJQE 3F9NA 3EQGA 3FMKA 3OD6X 4LRJA 4QP6A 4DEHA 3QQFA 4IX4A 3L9NA 3QGYA 4O4BB 2PE0A 4U6RA 3PVUA 5FXQA 2GNLA 5BVEA 4EONA 5HG7A 3PLSA 1LR4A 4IDTA 2YAKA 4BCKA 1XH5A 4EC8A 3A4PA 3R83A 4IDVA 4C4EA 2QI8A 3LXPA 1FGKA 2F7EE 4QTDA 3HRFA 3UIBA 3UG2A 4FYOA 1JNKA 1LUFA 2C47A 2BCJA 4G3GA 4BGQA 3VONA 3EN9A 4IZ5A 5IMEA 1FBNA 3UBDA 2C0IA 1G3NA 3AD5A 2EUFB 4PMSA 1H4LA 4IZAA 4YTIA 3V6SA 2R3MA 4CXAA 4FKUA 4O4FA 5B7VA 4X3JA 2QOHA 5FRIA 4D0WA 4WO5A 2BKKA 4BBEA 1H27A 3VRYA 3E62A 1WFCA 1MRVA 1STCE 2HAKA 2W1DA 2W1IA 4FL3A 2J50A 3ODYX 4FNYA 4PDSA 3WZUA 3I5ZA 4O2ZA 4ZZMA 1CM8A 3EQDA 3GQIA 4W4XA 4AZEA 2C6OA 4JX7A 1PXJA 3O7LD 3R8MA 3PE1A 2I1MA 3IW4A 5AFVA 2X0GA 3NEWA 1U54A 3W33A 3ZO4A 4EOSA 2YWPA 4LM5A 4B0GA 3PLAE 3OS3A 3VW8A 2WTJA 4FKIA 5TR6A 3W0RA 2OJ9A 3C0GA 2OIDA 3BIZA 3MGYA 3O7LB 3V5QA 3KMMA 3LJ2A 1MUOA 1Y6AA 3SGCA 5M08A 3SHEA 2IZUA 3DKCA 3BHHA 2GU8A 3PA5A 4QMVA 3R01A 4I6FA 1I44A 1PMNA 2JAVA 4JDHA 3EN5A 2QD9A 4PTGA 5K5XA 3TIZA 4DFBA 3LFDA 3OXZA 2XNMA 4QPMA 1WAKA 4ACMA 2J5EA 1BI8A 4O82A 4QP2A 2GHMA 3GBZA 2EXEA 4FKOA 5DE2A 3NYOA 2R9SA 4L42A 4NTTA 2XK3A 4RIXB 1JSVA 1P2AA 4UMQA 2R3KA 2O65A 3QA8A 4G5JA 3C5IA 3O51A 5IKWA 4AWIA 4BDEA 3MB7A 2YIWA 3UMWA 1OBGA 2XB7A 3W0QA 4U80A 5CY3A 5I9VA 3G6GA 1MRUA 1WBOA 2VTLA 3F5PA 4NK9A 4O0XA 3BLRA 3QXPA 4FIJA 3TUBA 2GS7A 3I4BA 4OTIA 4DG0E 4BJJA 4UYNA 3KXGA 5LCKA 3T3UA 3ZBFA 2OGVA 1G8AA 4AZTA 1OUKA 3PUPA 4AOIA 3KIOC 4EJNA 1ZAOA 3EKKA 5CALA 2G2FA 5GJGA 4FT5A 1JBPE 3BHVA 1PXMA 3QQLA 2UW7A 1PKGA 3LHJA 3QQKA 3W0SA 5EI8A 3R8PA 4DFUA 3CS9A 1ZARA 3F3ZA 5TE0A 2GNHA 3TV6A 2O2UA 4L67A 2GSFA 2ZVAA 4A9TA 2F49A 3FAAA 4KBKA 4Q5HA 3IW5A 4JBVA 4RWLA 4YHJA 4BWKA 5E8TA 4FIHA 1G8JA 3D7ZA 3MTFA 3EYHA 5IQCA 2XKEA 4W8EA 2R3GA 3MB6A 4G3EA 4FIEA 4JDKA 4YJTA 5C26A 3BYSA 3IECA 4BGHA 2OF4A 4GSBA 3PIXA 3B2WA 3BGQA 4ASZA 3NYNA 5E8VA 4CFWA 2CDZA 4EKKA 2Y4IB 3IONA 3N51A 1WVXA 3ORZA 2E9UA 1G5SA 3FLNC 3NW5A 3O96A 3HNGA 2C6LA 4WOVA 4NM0A 2V7AA 4XEYA 3SOAA 3QXOA 2IZSA 3SD0A 2BHHA 4ANSA 2IW8A 4AE6A 2YABA 3W0PA 4KSQA 4JMQA 5M06A 3Q9WA 3DU8A 4IM2A 4MWIA 5LXMA 3CPCA 3TIYA 4JT3A 4QMLA 4AA4A 4D2PA 5M57A 2C6IA 2PMLX 3TJCA 4B9DA 3UZRA 3FQHA 3I1AA 4IAYA 3HDNA 4I5CA 2UV2A 3UIXA 2HXQA 5KUPA 2UZTA 3KF4A 2J51A 3QL8A 5DI1A 4DEGA 4AP7A 3UNZA 5HU9A 5HE1A 3VUMA 2WFYA 5DRBA 4D4RA 5ANJA 5FP6A 5J9LA 3ZONA 4IC8A 3VVHA 4A07A 3FV8A 3QD3A 3KMWA 3FWQA 5IA2A 4GRBA 3BWFA 5JEBA 5LMKC 4YTFA 3LCOA 3RMFA 3Q4CA 3IGGA 3CQUA 3K5UA 3U6JA 3BQCA 4AA5A 4DH1A 2PUNA 1IAHA 3FUPA 2VX3A 3C1XA 4LMUA 1ZZ2A 2F57A 3PIYA 4MK0A 5HE0A 3S2PA 5EKNA 4OW8A 5ACKA 2W7XA 2YAAA 3FKLA 3OCTA 3R1NA 4BKYA 5AR5A 2CNQA 3F66A 1YHWA 2P2IA 1PMEA 2BRHA 4E1ZA 2V7OA 3NGAA 4O7YA 2RKUA 1FOTA 3H0YA 3UTOA 5ETIA 4O0SA 4DEIA 3IW6A 4TYEA 4EUTA 2QODA 5IEVA 2C3JA 4FK3A 4DBXA 4ZSAA 4W9WA 4HCTA 2OXYA 2G1TA 4FICA 2UZEA 3HMNA 4FV4A 3QD4A 1HCLA 4L3PA 4YP8A 1Q24A 2RFEA 4KAOA 2ERZE 4LG4A 5TO8A 3V5PA 4EKLA 4M69A 4U42A 4AQCA 4FODA 3WF7A 3VS6A 5AP4A 3CY3A 3CTQA 1OVEA 2VU3A 1F5QA 2B53A 2XF0A 3RNYA 3HX4A 4DG2E 4ZJIA 4RA5A 3NMUF 2CMWA 3HRBA 3A4OX 2QO7A 4C4JA 4I6LA 5F94A 3KA0A 4AX8A 3SRVA 5EHLA 5HG5A 2JD5A 3GUBA 5DIAA 5HO6A 4D9TA 2QQ7A 3R2BA 4NFMA 2AC3A 4G3CA 4LYNA 4RMZA 3EQHA 3VUHA 5LMKA 2BILB 4FBXA 1R39A 3IOKA 2ITOA 3PXYA 4I4FA 4BYIA 4CYJA 1BL6A 4YZNA 1RQQA 4ZLYA 2BRNA 1PW2A 3W32A 4QMNA 4ENXA 5JQ5A 3QKLA 2CPKE 4XCUA 3DLSA 2JIUA 3AMAA 3AOXA 4G9CA 4QRCA 5HICA 4F7LA 2WMWA 3OW4A 5EYKA 4UZDA 3TKIA 5EI6A 2PY3A 3PWYA 1CDKA 5LMBA 2BAJA 2PVMA 3DBEA 4MF0A 4NCTC 4CVAA 1U46A 5GNKA 1ERKA 2PVKA 5DEYA 5HKMA 1XQZA 2NO3A 3RHXA 4BIEA 5BMMA 3ACKA 3PG3A 4S31A 2OI4X 4OTQA 3I0QA 5AA8A 3NFGB 1JVPP 4FTNA 5M4FA 3MFTA 4WNPA 4UY9A 4FX3A 2WNTA 4BN1A 2WMVA 5HLWA 1BKXA 1PYXA 5GHVA 1W82A 3KK9A 3L9MA 5J7BA 3W2PA 4XG2A 3TM0A 3GQLA 4RGJA 5BUEA 3F61A 3GU7A 4BGGA 2EVAA 2YERA 2QU6A 1R78A 2XEZA 3LLTA 4QMUA 5CI6A 4RJ8A 5BNJA 3NS9A 4B6LA 4F7JA 2E9NA 5JT2A 4R7IA 5JK3A 3R02A 3BKBA 4CKRA 2UVYA 4M8TA 4QYEA 3T3VA 4JNWA 2WTDA 4LGHA 1QMZA 3NUAA 4DHIB 1GOLA 2RFNA 5K4JA 4F4PA 1E9HA 4YJSA 2PE2A 4O0UA 4CT2A 3BHTA 4FC0A 4WIHA 3ZHPC 4V0GB 3Q32A 3R63A 1KV1A 2E9PA 4NCTA 4AXDA 3ORMA 1GZ8A 4RVLA 5CZIA 5EM6A 3KXZA 3W0MA 1P4FA 4PTEA 3FZPA 3Q3BA 2HW6A 3GEQA 4M0YA 4YGAA 4EOOA 3T9TA 4R77A 1W84A 4EZ7A 1YDTE 5F95A 4F65A 5G1XA 5LVMA 5DGZA 2WQNA 3MI9A 3UQCA 4HPTE 1I09A 4FKSA 3OT8A 4B4LA 5FTOA 2V5QA 1XBCA 3M42A 5JZNA 4ENYA 1RDQE 4HYIA 3CJFA 5IDNA 3RJCA 4TKSA 5AP3A 3W1FA 1NY3A 3H10A 2Z7RA 4RLKA 4YC8A 2VGPA 3EIDA 3EMGA 3TACA 3WZKA 5HVKA 2BAKA 4E8AA 5CVHA 3E64A 3UYTA 1YWNA 4E73A 3CBLA 4W9XA 2OWBA 3UYSA 4AOJA 4M67A 4GFGA 3R7VA 4X3FC 4IW0A 3TNQB 1U5QA 3C51A 4XOYA 3RALA 3ZLWA 3UC4A 4J53A 3UO6A 2NPQA 5FDXA 2ZMDA 3FMHA 2OIBA 3FKNA 3QC9A 4IVAA 3WE8A 4ZY6A 4CMUA 3S00A 3R8VA 3UIMA 2XAOA 2ZM4A 3JS2A 3AC2A 4A4XA 4BB4A 4G34A 4UN0C 4YBJA 5EFQA 4Q9ZA 2B9HA 3OEFX 3SG8A 5AR8A 3BE2A 4O7ZA 4AQKA 1YKRA 3L8XA 4FIGA 5DT3A 3FKOA 3MFRA 4NSTA 3LW0A 4D2WA 5ICPA 2ITTA 3F88A 5AIKA 2HCKA 4DINA 4KUJA 5JQ8A 2OICA 3SKCA 2IWIA 4R3PA 4IVCA 3R1YA 1PMVA 2J5FA 5FGKA 4XMOA 5EH0A 3RGFA 4ERKA 2YM8A 2R4BA 3OTUA 3FHRA 3KC3A 4W4YA 3GT8A 2OU7A 4WNOA 5GZAA 3HAVA 4O7RA 2XARA 2I6LA 5M55A 3GCQA 5A4EA 3BELA 3C7QA 5JFXA 5IQIA 3LCKA 1JKLA 5F20A 3P08A 3Q9YA 1H28A 2XEYA 2WTKB 2YITA 2JKKA 4X3FA 5M53A 2HYYA 3UDSA 4ZTNA 4M84A 4NM7A 2GNFA 3WZJA 3EH9A 3Q6UA 4K8AA 5J5TA 1GAGA 3FMJA 2VRXA 5L8LA 3ID6C 2VWBA 5LWNA 3UOLA 1H07A 3ALNA 2ONLA 4CT1A 1M2RA 4HCVA 2AEGA 3FZRA 4GL9A 3PXFA 4OBOA 4DGMA 4YZCA 4DEAA 4F9AA 3Q2JA 1OL7A 1Q97A 2PMIA 3H9RA 5FQDC 2YM3A 5TKDA 4DITA 3ZRKA 2C6DA 5CZHA 3NSZA 3F69A 4D9UA 5A6OA 5HX6A 4FV8A 3V04A 5HD7A 4IMYA 4D4VA 5CEPA 1ZWSA 3RPVA 4M97A 2WO6A 4YZMA 3ZC6A 3QU0A 2X7OA 4LV7A 5CWZA 1XR1A 4FTIA 4FT7A 2UW0A 3QKKA 4J96A 3DBQA 4EORA 2O3PA 3QZGA 4ZSEA 3QTZA 4GH2A 4TN6A 3MWUA 3HDMA 4OAVB 2NYAA 2X39A 4EH8A 2R64A 3PXRA 5CI7A 5J95A 3QCQA 4XG4A 3AC4A 4HCUA 4YJQA 5HEZA 3QTXA 3W2QA 3CLYA 3OT3A 3I6WA 3AD4A 4PP7A 4JBQA 3W18A 5A4QA 4NM5A 4JOAA 2REIA 3MIAA 2PVNA 4WA9A 3ZOSA 4RVMA 4BCGA 5KMNA 4DGLC 4OR5A 4W8DA 4LOPA 4CSVA 2Y9QA 2WTIA 3CGFA 4GK4A 4U8ZA 5KNJA 3V6RA 2WTVA 4K77A 3U4WA 2YA9A 3W10A 4ZLZA