4FC0A

Crystal structure of human kinase domain of b-raf with a dfg-out inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
254
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGGSILWMAPEVIRMNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
publication title Design and synthesis of novel DFG-out RAF/vascular endothelial growth factor receptor 2 (VEGFR2) inhibitors: 3. Evaluation of 5-amino-linked thiazolo[5,4-d]pyrimidine and thiazolo[5,4-b]pyridine derivatives.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 254
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fc0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fc0A01
5KHWA 5AP5A 3DJ5A 4L3PA 4RX7A 2WQBA 5KMMA 3LJ2A 1J7LA 4NJDA 1CSNA 2PVNA 2R7BA 5AMNA 4ACMA 3FMJA 4XUFA 4B99A 3FC2A 3W1FA 5A4QA 2I7QA 4JT3A 3VS7A 4C4FA 2IZSA 3KXZA 2V22A 4LMNA 3M2WA 4IADA 4RA5A 5AP0A 3R7YA 3GQIA 4EBWA 5CTPA 5DI1A 3R71A 2CPKE 2QCSA 2VNWA 3FZ1A 5AA9A 4BVUA 4HYSA 4CFUA 3MV5A 5J7BA 3BEAA 1JKSA 3GCPA 4ASEA 1U54A 3DKCA 3O23A 2QG7A 1UNHA 1XQZA 2VWIA 4PRJA 1P5EA 5DOSA 3FUPA 3EYGA 2UZNA 3WYYA 1H1RA 4IDVA 1YXUA 2EU9A 3I5NA 2GFCA 2VWZA 5E90A 3PP1A 4EL9A 1Q97A 4EOOA 3DDQA 3MTFA 3R63A 4AGUA 3U8WA 4CG8A 4GT5A 4EBVA 2CMWA 2XRUA 3NUYA 4GIIA 3VS5A 2PVFA 4E5WA 4YU2A 3TDVA 3ZRKA 3FKOA 2YHVA 4NZWB 1Y6BA 3UOLA 4DTKA 5M57A 1XR1A 2UZLA 3GUBA 4IX5A 3F7ZA 3BHUA 5DT3A 4F1TA 4QYEA 2QODA 4NYEA 3SW7A 5HE3A 3RZBA 1ZYCA 3CLYA 4ZTLA 5EK7A 2ZM4A 5HX8A 2PZPA 4Z9LA 2CNVA 2XNEA 3AD5A 4QMMA 3KF7A 2BHHA 3IKAA 3LFQA 4EHVA 4IZ7A 1IR3A 2W7XA 2RSVA 3D0EA 4EQUA 5BMMA 4TYEA 5EQPA 4II5A 2YFXA 3WE4A 3RHKA 4E6QA 4O1PA 4G31A 2VTHA 4HJOA 5ETIA 1V0OA 1ZYJA 3AC2A 4AF3A 5K5XA 2O65A 4B9DA 4M3QA 3EN6A 4J8MA 2QU5A 3MFTA 5KMNA 3TV4A 4GG7A 5F20A 4V01A 4ZTQA 4AZEA 5M07A 3PPKA 2RIOA 3EOCA 3UO5A 4K77A 3HRBA 4FZ7A 4FTQA 4FT3A 2R3RA 4K6ZA 4BC6A 4JDIA 4QP9A 2YACA 3AC3A 4Y5QA 5DWRA 3DBFA 4OBOA 4FK6A 4L53A 4V0GB 2P2IA 2ITYA 3OTUA 4JR7A 1GOLA 3LMHA 1XHAA 5FEEA 2HWPA 4RIXA 2JKMA 4MXYA 3A7HA 2W1CA 3U9NA 3FZSA 3ZU7A 5TO8A 3D5WA 1J91A 4FKWA 3LHJA 4FL3A 4PP7A 3CGOA 4PPBA 5CAPA 4AW0A 5EOLA 3UVPA 5AIRA 2ZB0A 3PSBA 5D7AA 4QT1A 4CT2A 2GNJA 3MPAA 4BFMA 4CCBA 2OF4A 3MVJA 3Q60A 3POOA 2XUUA 3BU5A 3FWQA 2X0GA 3BLQA 4DFLA 3EWHA 3GXLA 5E8WA 2GQGA 5FXSA 1RQQA 5IQBA 4ACGA 2YZLA 1R39A 5I0BA 4R8QA 3AMYA 3QTSA 3ZEWA 4A4XA 4BCJA 4DT8A 3A7IA 4ANOA 5GINE 3CP9A 5G6VA 3DAEA 4MXAA 5J1VA 3RNYA 3CE3A 4Z55A 5I5ZA 4I0TA 2JDOA 2A1AB 4JAIA 2GS2A 3OP5A 2GFSA 3IW5A 2H9VA 3ZUUA 2UZEA 3C0HA 2C69A 5HEZA 3NGAA 3BHVA 3IPHA 3RBWA 5CSHA 3Q5ZA 5FD2A 2WGJA 4C3RA 5A54A 3U54A 3E64A 5I9UA 4PMSA 2YISA 3BGPA 2BROA 5HKMA 5CVHA 1H00A 1JAMA 3FXZA 3RJCA 2OLCA 2BR1A 4PMPA 4HVHA 4APPA 3UG1A 5CT0A 3C7QA 2C5VA 3FXWA 3VO3A 3VBXA 4DGMA 3BQRA 3IQ7A 3BWJA 1M17A 4KKHA 3NUNA 4AG8A 2OI4X 4G3FA 5EQYA 3FYKX 5CXZA 1M7NA 4RIYB 3ZZEA 3HV4A 3LAUA 3LLTA 4FKGA 5JFSA 2XIRA 1IRKA 2QVSE 5IA3A 3HKOA 5LARA 4PTCA 1YI4A 4GS6A 3VUHA 1H28A 3VBYA 2KTYA 5M51A 3R9NA 3UJGA 5KKRC 5HZNA 1ZMWA 1OPJA 2QKWB 3VUKA 3DBCA 2JFMA 2ZB1A 4FSZA 3AGMA 4IACA 4O0VA 4N57A 2R3NA 1OZ1A 4PF4A 4D0WA 3MFSA 4BI1A 3RWQA 3AT2A 5EHLA 2H34A 1KUTA 5TR6A 4UV0A 3FAAA 3DZOA 4JDHA 4RVKA 3OD6X 5HI2A 4E6DA 3TDWA 3UZPA 4CSVA 4TNBA 1YWRA 1B6CB 1SM2A 5CQWA 4AACA 2E9NA 3RAKA 3W16A 2JIUA 4I93A 4ZS0A 2W9FB 4BGQA 5E1SA 2ESMA 5AAGA 3NYOA 4ZOGA 4QTDA 4DEAA 1R0PA 3FMNA 2JD5A 5E4HA 1BKXA 4FKJA 4L3JA 2J0LA 3K54A 3POZA 3VRYA 5L8JA 3LIJA 4YURA 3DLZA 2PU8A 2UZOA 1JSTA 5HX6A 3VJOA 4L9IA 4FICA 3VWAA 1H4LA 4HYIA 4CMOA 3RPRA 2I0YA 4U8ZA 4UMPA 2HZNA 2E9UA 4ZTRA 2YDJA 5CEKA 4MNEB 3O51A 2V0DA 5AUYA 4LGHA 4C34A 5CEQA 4OUCA 3P7CA 4DEBA 4ZJJA 3CKWA 2JKKA 5DIAA 3R0TA 4G9CA 2J6MA 4I22A 1AD5A 2I40A 3UIBA 4GMYA 4AQCA 5HU9A 3QL8A 3LE6A 4UY9A 4YJSA 4FC0A 3UQGA 3Q32A 4KS7A 1YOJA 2ZMDA 4FTKA 3OZ6A 2WMTA 3VS4A 4ALVA 3BYOA 3MWUA 4TKSA 4ZAUA 3RK9A 1SVGA 2C30A 2RFEA 4IC8A 3EQFA 5AIKA 4CV8A 4CVAA 5H8BA 3MY5A 4F7SA 4X21A 5I4NA 3EZRA 1PYXA 4OTPA 2VZ6A 3HUBA 4KIOA 3FV8A 3RHXA 1JBPE 3UPXA 1CTPE 3FMHA 1GIJA 2X4ZA 2W99B 4NM7A 3R83A 3I60A 2F7XE 4KUJA 2ZYBA 4U45A 4ERWA 2OGVA 3A7JA 4S2ZA 1UU8A 2DS1A 4AW1A 4JBPA 4GK2A 5HG9A 1ZAOA 5AV3A 3WBLA 5CANA 3DLSA 5JZNA 1Y57A 3Q4ZA 3R1NA 4FNWA 4GT3A 4X6RA 5C01A 1PRYA 3AMAA 4DLJA 4LQMA 2ITXA 4IANA 3NSZA 4C2VA 5LMKC 4I24A 4C59A 2FO0A 4I20A 4CLIA 3COIA 5IISA 4F9WA 3GC0A 4GK4A 2XH5A 5K0XA 3DXPA 4NFNA 3UZTA 1REKA 4G3CA 4DEIA 3FLWA 3B8RA 1WVWA 4D4VA 5JEBA 3FMEA 5A14A 1VEBA 3P7BA 5H3QA 4BCNA 3HX4A 4C37A 4PPCA 2YWVA 3R7UA 2OH0E 4QNYA 5CVGA 3ORIA 1H0VA 4GL9A 4A9YA 4JIAA 2EB2A 3DFAA 4FSWA 2IVVA 3QZIA 5D11A 5AP7A 1DI9A 2R3QA 5FEQA 4CZYB 4LOPA 5GZAA 4XS2A 3NNXA 2XK9A 4QTBA 2JEDA 4K18A 3EKNA 3JS2A 3OVVA 4LYNA 1L3RE 3PLSA 5IUGA 4CFFA 1UV5A 2ZV2A 3OBJA 5JFXA 4PDYA 3RWPA 2J50A 3Q4CA 5F95A 4EUTA 4FMQA 4IE9A 5BVOA 4HNFA 5CU2A 3TUCA 4UMTA 3KK8A 3H4JA 3VUDA 4Q5HA 3QU0A 3AG9A 4M69A 3MA3A 4UEUA 5FG8A 4KIQA 4JBQA 3MJ2A 4FT9A 4I6FA 5T3QA 3A60A 2YM8A 5M09A 2HELA 3NUUA 4YO6A 3FZTA 2GU8A 3JPVA 4ZMFA 4CG9A 4BKYA 2XNOA 3OXZA 1ERKA 2BKZA 3TUBA 4O7ZA 2C3LA 4ACCA 3I6UA 4H05A 3Q52A 2XKCA 3N4VA 3E88A 1Q8WA 1JKTA 1X8BA 2WTCA 5J95A 3OMVA 5J9LA 3E7OA 3LJ1A 4W9XA 5HVJA 3UVQA 1A06A 3LZBA 4M8TA 3AT3A 2WEVA 4DFUA 3R7VA 1YQJA 3PXQA 4BB4A 3TKUA 5CVFA 3BYVA 3TKIA 5HBHA 3BKBA 3U6IA 2J2IB 2XRWA 2XCKA 2X7OA 2R5TA 5AX3A 3PSCA 3LFBA 3AC4A 1Q3WA 2ZVAA 4FT5A 4NIFB 2ITZA 3NZ0A 3DFCB 1OL1A 2VX0A 4O0YA 4TRLA 2QQ7A 4RGJA 2C6IA 4DFZE 5KKRB 3OCBA 2GQSA 3JVRA 5AADA 5IF1A 2OZAB 2QC6A 4YHFA 4AP7A 4LRMA 4WRGA 4FSYA 5C4LA 4DH5A 4L8MA 3H9RA 2ZV8A 1W82A 4XHKB 2ACXA 1BYGA 3SKCA 4BCKA 2X2LA 5E9EA 3C4XA 5BUEA 3DTCA 4UMQA 5CSXA 3KXXA 4OGRA 2VWUA 5HNGA 2PPQA 2JITA 3RM6A 3UIXA 4E8AA 1PKGA 5EI8A 3HZTA 3MFUA 3MDYA 4CFMA 3F5XA 4YMJA 4F7JA 2ZAZA 2HENA 3MH3A 4S34A 4GYGA 4EQCA 4EZ5A 4YHTA 2PVKA 3UMXA 4AZVA 1YRPA 3VBQA 3AQVA 3QD4A 3QYWA 3P79A 2VTTA 5CU0A 3O71A 3QKLA 4GU6A 4QYFA 1WBTA 3RINA 4F7NA 5AR7A 4GT4A 4BKZA 2P0CA 3L9PA 2F2UA 3MB7A 4R3PA 2YLEA 2G9XA 5FM3A 5HO7A 4IX6A 3ZO4A 4YLLA 3ORZA 4APCA 4O84A 3N4TA 2JDRA 4X6QC 4BGGA 4BDKA 3GNIB 3HMPA 2C6TA 4J71A 4N6YA 4TYHB 5HOAA 5IUIA 4AGCA 5LCJA 1FOTA 4DT9A 5B0XA 2OH4A 4YC6A 3F66A 1V0BA 4M67A 1XH6A 4WT6A 5LVLA 5DE2A 3TT0A 3G9LX 3PYYA 3BV2A 1G3NA 5CENA 3UC4A 4E5AX 4PMMA 2B9IA 4KKEA 5IA0A 3Q9XA 5TE0A 5K4IA 4K0YA 2QOCA 1Q5KA 2Y7JA 3A62A 5EKNA 3I6WA 5EW3A 2Z8CA 2CCHA 5KE0A 5BPYA 3FE3A 1K9AA 4WD5A 3KC3A 4LOQA 2VRXA 3RP9A 5DR2A 3VVHA 1E1XA 2YIRA 1YHWA 3GU4A 3IONA 1GZ8A 2QO9A 3H0YA 4KINA 4RIWA 1IA9A 5EM5A 5L8LA 4Y95A 2R0UA 3IW7A 3HV3A 4U42A 1J1BA 1BUHA 1KSWA 3NCZA 3EJ1A 5ACKA 4EHEA 5GZ9A 5BVFA 3WZEA 3R28A 3FPQA 2R2PA 2YJSA 3TIYA 4O96A 5KBQA 4BDCA 4FEXA 4KSQA 3C4CA 4XV2A 3CTQA 2PVLA 3MH1A 2F49A 2GHMA 2ZJWA 4LL5A 4YJTA 3ZONA 3FKNA 4IQ6A 3JR1A 5EM6A 3ODZX 3NNWA 3QTRA 3VUGA 3OCSA 4XLVA 3NWWA 4JL9A 3VS3A 4BBEA 4GFGA 3ELJA 3DB6A 2UW3A 3Q9YA 3QQUA 3NS9A 3TNWA 4IFCA 3RVGA 3TV6A 5ETCA 4ANLA 4D58A 4QMUA 5E92A 3UIUA 1VYWA 2HW6A 2W5HA 4QQCA 2ZM3A 3PJ8A 1UKIA 3WF8A 5L2WA 4IVDA 3LQ3A 4W4YA 3MN3A 5DRDA 4BDBA 4EKLA 4DGOA 2W1EA 3BE9A 3PP0A 2F57A 1BL7A 2YITA 4ANSA 4RWKA 4DHFA 2RG6A 3L8VA 3KMUA 2FB8A 3QUPA 4BR3A 2QOLA 4GSBA 3W8QA 4A9UA 4DH1A 3FI4A 1YDSE 5LOHA 1BX6A 4P5ZA 3IW6A 4YJVA 5HBJA 2QURA 4EC8A 4YPDA 4TZRA 3MH2A 3MI9A 3O8UA 5F94A 2HXQA 5M4IA 3OY1A 3CC6A 4TTHB 3RAIA 4C02A 3EZVA 2FUMA 3CTJA 1VR2A 4D4YA 4TXCA 3SXFA 2HYYA 2C0TA 1Q8ZA 3EH9A 3OY3A 2BIKB 4FV7A 4LV5A 4R1YA 2CGVA 3BU6A 3R1QA 1XKKA 5B2KA 3F5GA 3WI6A 3I7CA 2EXCX 1V0PA 4N4SA 4FEVA 5DMZA 2W5BA 3AD4A 5IA4A 3ZTXA 4HCUA 5IH5A 2V7OA 3WOWA 4AWIA 1PMEA 4DH3A 2BZKB 2YM5A 1QMZA 4FKSA 2YCRA 4EH3A 5AR4A 4GRBA 3ETAA 2QU6A 5AV2A 1PMVA 5ANIA 4G6OA 4L7FA 3FY0A 2RL5A 2B7AA 5GHVA 3AC8A 5M44A 5M4FA 3IDPA 2JKQA 2W06A 3Q6UA 4U6RA 4CYJA 1OI9A 2W1ZA 3QZFA 4IAYA 2VWBA 2XIKA 5CZHA 3QFVA 4JAJA 5BYYA 1G8SA 1XH4A 3D5VA 3LLAA 3DY7A 4D2WA 2X8EA 3EKKA 4X2JA 4L00A 2VUWA 2YM3A 4LGDA 4CMUA 2BALA 3HAMA 3V5JA 3SXRA 2QI8A 1KOBA 4KB8A 1YDTE 3JY9A 3LFAA 2WELA 4ZZNA 5GIPE 3OOMA 2QO7A 1OB3A 3TL8A 4EOJA 2IVTA 4YJRA 3ZHPC 2XEYA 3KRJA 4WBOA 4ZP5A 4RX5A 1JOWB 2A19B 4CQEA 3C9WA 4WRSA 4WSQA 2QHNA 3COHA 1FGIA 5IZFA 4NM0A 4UXQA 3DK6A 3A8WA 5M08A 4CKJA 4QP4A 1YWVA 4FK3A 4YHJA 4ZY4A 3PVWA 1H0WA 1IEPA 3ZM4A 2Y6OA 5AP6A 3QD3A 4QMZA 2NP8A 5IA5A 2XVDA 4HVIA 5I9XA 5L8KA 1FVRA 2O8YA 3V51A 3D7TB 3WF6A 2AUHA 2QONA 4ITIA 2ITWA 5B2LA 4XV9A 3CCNA 3FI3A 1F0QA 5M56A 2BPMA 3QAME 1LUFA 4IAIA 4H3BA 3E8NA 4FNYA 4NFMA 4U0IA 4FV1A 5DH3A 5FM2A 1QL6A 3EQRA 1O6KA 3R9RA 1UVRA 4G34A 1WBWA 4XG7A 2CHLA 3G6HA 2B54A 4QQJA 4XG2A 5J9YA 5L2TA 4ORKA 5JGBA 5E8TA 3FHIA 3ZO1A 5FTOA 2IWIA 2Z2WA 4NCTA 4F9CA 4KA3A 4F9YA 1XJDA 5FBNC 2ITTA 2PVYA 3E8CA 5HO6A 5FTGA 4PX6A 4FIIA 3SAYA 4O1OA 4KIKA 3ZFMA 3UOKA 2WOUA 2WOTA 5HIBA 3IDBA 2CN8A 3JVSA 4O7NA 3A4PA 2ITNA 2XKDA 4QMTA 4X2GA 3S3IA 3E3PA 2W0JA 3GT8A 2HK5A 4PQNA 2OJIA 5CZIA 4Z16A 3II5A 4R7BA 1LEWA 5GZ8A 4DG2E 3TNPC 4KNBA 5A4EA 3F9NA 3LXLA 5M4CA 4WNOA 4FODA 1RDQE 3MTLA 5H2UA 3AD6A 3ZUVA 5JRSA 3C13A 3E63A 4ASDA 1U5RA 2VX1A 3UQCA 5ANOA 1FMKA 4XP0A 2PZIA 3R8ZA 2X2MA 3KCFA 4EONA 1W8CA 3WIKA 4HCVA 3FZOA 4YLJA 4AA0A 4EOKA 2OXYA 5IPJA 4BWXA 1UNGA 3QF9A 4RZVA 4DEHA 4JOAA 4OAVB 5HLWA 3DPKA 3G9NA 3BHTA 2YIWA 2PVRA 5HQ0A 2C68A 3C50A 5CSVA 1JPAA 1ZARA 4JQ8A 1YWNA 4E6AA 4FV6A 4GG5A 2EWAA 4G5PA 5T68A 2XS0A 3NYNA 4GKHA 3KULA 4D5KA 2R3FA 4M84A 3FEGA 3W18A 2WMBA 5AR5A 2W1FA 3U6HA 1EH4A 2IO6A 3UOJA 3GGFA 3UO6A 3SLSA 4XOZA 1REJA 4FIGA 4DN5A 5HLNA 4FSMA 3ORMA 3RZFA 4QMWA 1DS5A 2C6OA 2V55A 4RJ4A 4U41A 2YAAA 2OF2A 2UZDA 3TG1A 4OR5A 3PJCA 4PDOA 3HLLA 3ZBXA 1YOLA 2W17A 4GFOA 4R7IA 1U54B 3R00A 5JGAA 4O7YA 2VTPA 2O3PA 2OICA 3A99A 4E5BA 5LMBA 2NPQA 4UXLA 3C0GA 4E1ZA 4IZ5A 1YVJA 2Z7LA 2VX3A 3DS6A 3O7LB 3SRVB 3DKFA 3ZCLA 4IAKA 1IAHA 3LFSA 1UU3A 4MK0A 2BTSA 4MXZA 4ANMA 1WFCA 4QNAA 4WG4A 1GY3A 3EQBA 2WTIA 4MD9E 2F2CB 3FLSA 2X7GA 3PTGA 3CS9A 4LM5A 5CF5A 4QQ5A 2CKQA 3BU3A 2BKKA 4LFIA 4CMTA 3I79A 5EDQA 4NJ3A 5CEIA 4D28A 4GH2A 1BL6A 4RIOA 4DFNA 2IVUA 4ACHA 4PL4A 2XKFA 2YIQA 4XOYA 5BYLA 2PYWA 2EB3A 5AM7A 5KMLA 3LQ5A 4TNDA 4R1VA 4AE6A 4J8NA 3TTJA 3V5WA 3TTIA 3C1XA 3T3UA 4EK8A 3EFKA 4C38A 4HGEA 4IDTA 5A4LA 3PXFA 2BAKA 3EQDA 3W2CA 5AP3A 3RAWA 3DB8A 5CF4A 3OCTA 5FTQA 5LQFA 4AZFA 4JDKA 3KN5A 2WPAA 4YZCA 2C0IA 2C3KA 1ZY4A 4EC9A 3PVGA 1Q41A 5ANKA 5JH6A 3QTQA 5IA1A 4B6LA 3UNKA 4HYHA 2R3MA 1Y91A 4U44A 3UP2A 2ETRA 5ANEA 1KE7A 3I1AA 4NKSA 3EB0A 4CYIA 4ZJIA 4L67A 5H8EA 3NMUF 3BV3A 3DJ6A 3R1YA 5D9HA 1M2RA 2PE2A 1DAYA 2JIIA 3FZRA 5AV0A 2X1NA 3ERKA 4LL0A 3NUXA 3PVBA 2R7IA 4FZDB 4CFXA 3LCKA 2OFVA 4FG8A 4UZHA 2ONLA 2VTRA 2W96B 5IA2A 2PE1A 3WARA 4NTSA 2PZYA 3ORLA 3TZ8A 4X3JA 1PMUA 3OW4A 4XRJA 5AUXA 5J9ZA 4RJ6A 4Y8DA 4TYGA 3A4OX 4OTDA 4O91A 3FMDA 3A7FA 1SMHA 4ITJA 4L68A 5EDPA 3SA0A 2PSQA 4DTBA 4FZFB 2A0CX 1NXKA 2X8DA 3EFLA 4D2TA 4D1XA 5K5NA 4RWLA 2PL0A 4ANNA 3TNHA 4U40A 1KE8A 4LMUA 2E9PA 4J95A 5J8IA 5CF8A 3R30A 1I44A 5D7VA 4MKCA 4QO9A 1ZYSA 2XM9A 2XJ1A 4RX8A 3HMOA 4ZK5A 4IAZA 3SHEA 4BCMA 5HNIX 3BGZA 2YJRA 2J5EA 4C33A 2UVZA 4DAWA 3A61A 2WEIA 2Z7QA 3ORNA 3KGAA 3O50A 4FTAA 3WILA 2WFYA 3R1SA 4QMPA 3L8XA 2BILB 3Q2MA 4Y72A 2HY81 5AX9A 3ROYA 4FA2A 3N4UA 3D5UA 4FV3A 3FMLA 5EYDA 3KU2A 3TEIA 4E73A 4JS8A 2F7EE 4F1OA 5HG7A 4I41A 3N51A 3UVRA 3UODA 3QRKA 4TY1A 5FXRA 4FKUA 3S1HA 3C5IA 3I81A 3NNVA 3G15A 4Q9ZA 3I7BA 2Y9QA 4DC2A 4YTCA 4NW6A 4GYIA 3OW3A 3KF4A 2PWLA 4ZZMA 5IQEA 4XRLA 3AMBA 2QLUA 2QOOA 3HVCA 1PXPA 3MGYA 1QPEA 3R02A 4EH4A 5HD4A 4DA5A 5DHJA 4EYJA 1KE5A 4FUYA 4WNPA 1Z5MA 3UQFA 4O82A 4IVAA 5BX0A 4FTUA 5I9YA 3CD3A 4ZSAA 2CDZA 5AM6A 4MXOA 5AUWA 4QPAA 1L8TA 2PUUA 5HHWA 2OXDA 5A3XA 3SQQA 5HTBA 5DLSA 5E8XA 2YCSA 2Y0AA 1NA7A 4IAAA 4ZSGA 3G2FA 3JYAA 2FA2A 5CSWA 4U79A 2QNJA 5HESA 3ZFXA 1OIQA 3R04A 4F6SA 5HO8A 4BIEA 2CJMA 4UYAA 1LEZA 4G3EA 3QA8A 1JWHA 4QP1A 5TT7A 4QMYA 3IOPA 4IAFA 3W32A 3VIDA 4BRXA 3ZXTA 2GTMA 3GBZA 3FHRA 3QYZA 4O21A 3GC9A 5HCXA 3GCUA 4F4PA 4L45A 4MQ2A 4A7CA 4FV4A 2JDTA 3SOCA 4ZY5A 5EYCA 3E92A 3KRLA 4UZDA 1BMKA 3ZO3A 1OECA 3W8LA 1PXOA 4AA4A 1KE9A 2IVSA 3EN5A 3ZRMA 4YPSA 5LWMA 5AUZA 3QUDA 1XH9A 2WU7A 3PFQA 1RW8A 2QKRA 2YM7A 3A8XA 4YJNA 4FX3A 5J87A 3RNIA 2R3GA 2YWPA 5L3AA 3PSDA 4FL2A 4DE4A 4FV8A 4X7QA 2W9ZB 1ZLTA 4WNKA 5FGKA 5GJFA 1R3CA 5HTIA 4S33A 5C27A 3VJNA 1WBOA 4MNEA 4RPVA 3FMKA 4EORA 1HCKA 2WTDA 3R8PA 4F9AA 2I6LA 3SGCA 3FDNA 5CALA 4JG6A 3OC1A 2WTJA 3R2BA 4FKTA 3ZDUA 4RZWA 1PMNA 5EDRA 1UA2A 3IOKA 2F4JA 4WHZA 4C61A 3PXZA 4CFNA 5ITAA 2P55A 3H9OA 3LPBA 3BI6A 5FUTA 3DTWA 2BDJA 2R3KA 4MBIA 3P9JA 3QX2A 5EW9A 4S31A 1Q8TA 3G90X 3Q5IA 4AFJA 1NW1A 2C6LA 3CPBA 2I0VA 5A4CA 3IECA 2YLFA 3FJQE 4FF8A 3VQUA 2CLXA 3RPYA 4O2PA 3LXNA 4MF1A 4EUUA 3BRBA 3HL7A 2DQ7X 3KEXA 3KCKA 2R3PA 2XBJA 4IWDA 3COMA 4V04A 3F61A 3OT3A 4ZTSA 4TYIA 5BVEA 3L1SA 5FEDA 5AR8A 3C0IA 4IH8A 3SV0A 4JNWA 4X2FA 3MBLA 4GVJA 3QXOA 2OU7A 2G15A 4AN2A 5JRQA 3P1AA 2B1PA 4AZSA 4C58A 4TL0A 5CAUA 2DYLA 5EHOA 4GW8A 4S30A 5FLFA 5AFVA 2XB7A 1CMKE 4CZTA 5HBEA 3QC4A 4FNZA 1CKIA 4EWQA 4Y5HA 1YHVA 5E8UA 2QR7A 2GSFA 4DFXE 1GJOA 2G2HA 3PPJA 3UDBA 4IBMA 3R7GA 5AUTA 1W83A 2UW0A 2GPHA 3FBVA 1SVEA 2RG5A 4L3LA 4JQ7A 4RJ7A 5HU3A 1U5QA 5CI6A 4YSMA 5CNOA 4YTHA 5HG5A 2BRMA 3F69A 3G51A 3NW7A 4WG5A 5DYJA 2VD5A 3LCTA 3C4WA 3F5UA 2XEZA 4HYUA 4J99A 5DVRA 4DG3E 5T6KA 2OSCA 1K2PA 3PXRA 2BCJA 4FOBA 4Y73A 4RMZA 3VNTA 3W2PA 4YBKA 2OJFE 2B55A 2IW6A 3K3IA 4JVGA 4A9SA 3F2AA 1H8FA 4F6UA 1MUOA 3C4ZA 4I94A 4AUAA 2O0UA 3GU7A 1SVHA 3Q4UA 2GNIA 5BUIA 5KHXA 3TKHA 4H58A 5TF9A 3KFAA 3WF5A 2E2BA 4IFGA 2YCFA 4XH6A 2XMYA 4NUSA 4OT6A 4X2NA 5DBXA 3S4QA 2XK6A 3PXYA 4MXCA 3BIZA 4L6QA 3EQIA 3TWJA 4DH7A 4A07A 4ANBA 5AEPA 5HG8A 5CF6A 4BY9E 3WZUA 2PE0A 1YI6A 4Z7HA 4XYFA 1AGWA 4R6VA 1E9HA 2UW4A 3ATSA 3NYXA 3VRZA 3FQHA 3R8MA 4FV2A 1QPDA 5KUPA 2HOGA 4JBOA 3NAYA 5AP2A 1PHKA 3F88A 3IO7A 5I9WA 1YW2A 3GC7A 5IQAA 2EXMA 3FI2A 3H9FA 1CDKA 3QQLA 3V6RA 4H3PA 1BI7A 2WIHA 3PVUA 1FINA 3OOGA 2XJ0A 4U81A 5DGZA 5IMXA 2Y6MA 1VZOA 5ANGA 3D9VA 2C5NA 3ZDIA 3A7GA 4RA4A 2B4SB 2ZDUA 2HCKA 3U4WA 3O2MA 4IVBA 4JJRA 4JX7A 4R7HA 3EYHA 1OMWA 2QOHA 3KVXA 5JQ8A 3EL8A 3EN9A 3Q04A 4FKVA 4EH9A 3LCDA 5G1XA 5L2SA 4IX4A 3S0OA 4O7VA 4LG4A 3MJ1A 4HZSA 4NIFA 5CAOA 4JR3A 3UPZA 1GIIA 4IWOA 4RWIA 1Q8UA 4C57A 4IWQA 5DT4A 4D2VA 2WMSA 4K9YA 1ZMVA 2WMQA 2XP2A 1ZXEA 2OZAA 3C4EA 4A06A 4BYJA 3QWKA 3CTHA 3EN7A 1NVRA 2YM4A 4IB3A 4AN9A 3WZJA 2XKEA 3PY0A 5K4JA 2BRNA 3E62A 5IQFA 3D94A 3LFEA 3GOPA 4P4CA 2XJ2A 4HCTA 3FLQA 4LUDA 2X8IA 3F6XA 4XG4A 5E8SA 2UZTA 1FPUA 4PMTA 4WKQA 4AW5A 5F9EA 1PXLA 4ASZA 1AQ1A 4KD1A 3VBVA 3T3VA 2C5OA 4EZ7A 2B9HA 3QX4A 5IKWA 5EW8A 2VTOA 4FZ6A 4IJPA 1R1WA 3CD8A 2I1MA 1H1QA 3NLBA 4HGLA 4I4EA 4OTIA 1Q62A 5ICPA 4NCTC 4USFA 1J7IA 5IUHA 3TJDA 2GNLA 4U3ZA 4F0IA 1MP8A 2Y8OA 1H01A 2HIWA 2IW8A 2GQRA 5JFVA 5CWZA 2VWWA 1OIUA 3ORPA 5TKDA 3CR0A 4NTTA 4AX8A 5FWKK 4E4NA 3LVPA 4O7SA 3QRUA 2XK3A 2X6EA 5DA3A 2JGZA 2X9FA 1ZZLA 4HGTA 3TN8A 3BHYA 3LJ0A 3DXQA 1LP4A 4CCUA 3Q6WA 2VAGA 1OUKA 4F7LA 3LOKA 2J90A 3MFRA 2FSMX 1TQPA 2C3IB 4FT0A 4EH8A 2NO3A 2QD9A 5HCYA 2HWOA 4ZSLA 3EFWA 3O17A 4RC4A 2IZUA 5DG5A 3P23A 4AU8A 5D41A 5AUVA 2VTJA 2I0EA 2IPXA 3FSKA 1CKPA 1UWJA 2BZIB 5HE0A 3Q96A 4AAAA 5JGDA 3SX9A 4OLIA 4G1WA 5BUJA 2QOBA 4IC7A 3MYGA 5IMEA 4EK6A 4PUZA 3Q4TA 3JXWA 1Q4LA 4FYOA 1ZMUA 3BQCA 4TWNA 4ZTNA 2ITQA 3BLRA 4GEOA 5I3OA 3TNIA 3ZLWA 5C8KA 1P4OA 3C5UA 1STCE 3UNJA 5J79A 3KXMA 5HE2A 4FSTA 3SG9A 1OBGA 3R8VA 4I3ZA 5HICA 3CQUA 5C8NA 2W4KA 4LV8A 3D4QA 2VGOA 2PUNA 4XLIA 2WQMA 1GZKA 4I21A 1H1SA 1YXXA 4FV5A 5ETAA 5HVYA 4G16A 4EOPA 4QQTA 3MH0A 3R6XA 4MBLA 5C4KA 4BCOA 4LGGA 3R7OA 3DKOA 3JY0A 3KK9A 3DJ7A 5B2MA 3VQHA 3MB6A 2PY3A 3N9XA 2WAJA 5HD7A 3FY2A 3LFCA 2BMCA 5KNJA 5B7VA 3QQGA 5EI6A 3PG3A 3LCSA 3OWPA 4BI0A 2XIYA 3ZSGA 1OUYA 3FL5A 2YABA 3MY0A 2BFXA 4AE9A 1ZYLA 4ENXA 5AR2A 4C4IA 1F3MC 4IXPA 2GTNA 2NNWB 2C5XA 5JFWA 3IDCA 1FMOE 5EM7A 4AT3A 3W2RA 3BZ3A 3ZC6A 3KKVA 4CNHA 3OCGA 1MQ4A 3ZFYA 4IB1A 4RVLA 4FKLA 4BDEA 2FSOX 5KX8A 1GAGA 3UGCA 2DWBA 2W05A 2OJJA 4BKJA 3CSVA 1S9JA 3VBWA 4ZEGA 4E26A 4F65A 2PK9A 3PZEA 5IH6A 2W1HA 3FI8A 4MWIA 5HLPA 4E7WA 1SZMA 4L43A 2FGIA 3FC1X 1GZNA 1H27A 2BFYA 2F7ZE 3CJGA 4B7TA 3VHKA 3O7LD 3U4UA 4DFYA 2WO6A 4IEBA 1Q3DA 3H0ZA 4QRCA 4QPMA 4M0ZA 4WO5A 1OIRA 5AP1A 4RQKA 3W55A 5JQ5A 3QD2B 4Y46A 5FXQA 4XBRA 1MRVA 3VS2A 4U80A 4ZJVA 3OWJA 4YO4A 2F9GA 3RMFA 2J5FA 2VGPA 4H3QA 4CFVA 2REIA 4RX9A 3TI1A 4D2SA 2CGUA 1XBBA 3BWFA 2BAJA 5L6OA 4JG8A 3GU8A 2I0HA 3GOKA 4H1MA 3TXOA 4TW9A 1P14A 3QRIA 2FSLX 4BICA 1WBPA 1JKKA 4WBBB 5DFPA 3ORTA 5F4NA 4AW2A 1UU7A 2WQEA 4C4GA 1TQMA 4QP3A 4U3YA 1XWSA 4BZNA 2YERA 1RJBA 3UZRA 4QD6A 3PE2A 3V8TA 5C8MA 3Q53A 3REPA 4I5HA 2YN8A 3QZHA 3T8OA 2FYSA 3ZYAA 2YDIA 4AOIA 4E6CA 4O83A 4DBXA 3O96A 1YOMA 2O64A 4RQVA 3HDNA 4M68A 5E7RA 2OG8A 2WTWA 4NWMA 2BUJA 4O6LA 4BF2A 2PZ5A 5FQDC 2O5KA 4U97A 2W1IA 3QGYA 3RCJA 4ASXA 4YC3A 3DCVA 3R21A 2ITPA 5CXHA 4BDAA 4JG7A 4M13A 2UZVA 4I6BA 3KB7A 4YBJA 3ODYX 3NAXA 4M14A 4PWNA 4MBJA 4IM0A 1PF8A 2IZRA 4L7SA 5LVPA 4U43A 1J1CA 3PA4A 2CKOA 4KS8A 2J51A 5JK3A 2ONLC 3F7WA 4DG0E 3GU6A 4RWJA 5LJJA 2QR8A 3MVHA 4O0UA 3PJ2A 3KRRA 3S2PA 3RK5A 4QMLA 2X2KA 2Y4IC 3M1SA 1OKYA 2RF9A 4FIFA 4EOMA 3QKMA 4RJ3A 3RPVA 4ZLZA 3D2IA 3HMNA 2P2HA 4MAOA 1ZWSA 3QCYA 5KZIA 1M52A 3MIAA 4AOJA 4CLJA 4KAOA 3UYSA 2OW3A 4QTCA 3DT1A 3OT8A 1F5QA 3KXNA 5I9VA 4IWPA 4AT5A 3KMWA 2R3IA 1H1WA 2GNFA 3DK7A 2G2IA 5AV1A 1OGUA 4YJOA 2WMWA 4BWPA 3QLFA 4CRLA 2XCHA 3RPOA 3V5LA 4W4VA 4USDA 3NW6A 1U59A 2WHBA 4RFYA 4X3FA 4XJ0A 3QUEA 4FIJA 1MQBA 4MD8E 4IW0A 2JC6A 2WMAA 3NEWA 4UMUA 3LM5A 3HAVA 3NNUA 3OROA 4YJQA 3ALOA 3QTUA 1BI8A 1JVPP 2ITVA 1UWHA 3KXGA 2C4GA 4L52A 3EQGA 5DEYA 4PNKA 1NVSA 4CKIA 5J5TA 4AT4A 4KIKB 4D1ZA 4O0XA 3R8UA 2NRYA 5KMKA 2BDWA 1JQHA 1GIHA 2HZIA 4J98A 4TWPA 4C36A 4EK4A 4JQEA 4ALWA 2QOQA 4K33A 4G17A 3UOHA 3PJ3A 4FKIA 3PZHA 4EOLA 4AS0A 5CAQA 3GI3A 2VWVA 4RBLA 4BBMA 1BLXA 4P5QA 4NL0A 2OFUA 5C1QB 2BZJA 4KKGA 2Q0BA 3ZXZA 1OBDA 3MPMA 4BCGA 2CN5A 2ETKA 4RSSA 2V7AA 3UC3A 1GNGA 4CFWA 1OL7A 3QD0A 4TPTA 4BCPA 4MYGA 4FG7A 4RJ8A 3GENA 2V62A 3QLGA 3D2KA 5IEYA 3ZOSA 4CXAA 4QMNA 3TJCA 3HA6A 5L2QA 4Z7GA 3TM0A 4DGGA 5JKGA 1PJKA 3HA8A 3ZM9A 4E3CA 2ERZE 2SRCA 4ZMEA 4YR8A 5M53A 5EM8A 3V04A 1JNKA 2R9SA 5AJQA 4UBAA 4BCHA 3BHHA 1Q8YA 2PUIA 3TV7A 3KN6A 4GK3A 4FGBA 4OTHA 3KULB 4NH1A 4NU1A 1IASA 4W9WA 3SC1A 1G8AA 5LMAA 3IW8A 3V6SA 5LCKA 1FVTA 2Y4PA 5IDPA 3W2SA 3DAKA 3HRCA 3F3WA 4N6ZA 4R5SA 1PW2A 1U46A 4QP2A 3RGFA 3KA0A 2QLQA 3VF9A 3QTIA 4IX3A 4S32A 3DA6A 4M0YA 4BBFA 3D83A 5GJDA 3GP0A 4ONAA 3NYVA 3EQPA 3P78A 2C1BA 3H3CA 2PZRA 5LVMA 4QP6A 5IG1A 2WQNA 4B4LA 3H10A 2BIYA 4A9RA 4XCUA 2PTKA 2YIXA 4LI5A 4O6EA 3V5TA 4USEA 1KE6A 4D9TA 3KQ7A 3VN9A 3PA5A 5AA8A 3QRTA 2OZOA 4BZOA 3PDTA 2XZSA 5K3YA 2XA4A 5H9BA 2W5AA 3PRFA 3DNDA 2J4ZA 4HPUE 4FIEA 3FKLA 2XNPA 3QCXA 4F6WA 3NX8A 4I1ZA 3SRVA 1B39A 2C5YA 3VHEA 3ANRA 4KBAA 3EMGA 4RG0A 4ID7A 4FTOA 2UW5A 3IGGA 1R0EA 2UZUE 3GQLA 4BIDA 3RALA 3DKGA 2GS7A 1IAJA 2CCIA 4HVSA 2C6DA 3WIGA 4WSYA 3NUSA 5KMIA 2H96A 3QA0A 3EIDA 4MCVA 4YTIA 3HV6A 2A4LA 4ACDA 4B8MA 3LFDA 5LVOA 3QQJA 3GVUA 3IK3A 2XIXA 1W84A 1DM2A 2OJ9A 1Q61A 4FSQA 4F9BA 3RPSA 4C4JA 3OTVA 4PY1A 2HZ0A 4XV3A 3PUPA 3G33A 2X7FA 5HCZA 1G5SA 2JDSA 3F82A 3HEGA 3D15A 4KBKA 5DR9A 2CKPA 5CNNA 4YGAA 4HVGA 3P08A 3QCQA 2E9OA 3BPRA 5K9IA 4F99A 4XNEA 1H07A 4YNEA 3LW0A 1WMKA 2X4FA 2O63A 4FKQA 1OKWA 4MH7A 1O6LA 3AXWA 3W10A 1OKZA 5M4UA 2JBOA 3QTZA 3D7ZA 3QBNA 3FLZA 2J0IA 3OG7A 3HNGA 3MS9A 3D14A 3S00A 2OXXA 5I9ZA 4RIXB 3MSSA 2IZTA 3BGQA 4FTCA 2E9VA 3FZPA 5IQGA 3ACJA 2C0OA 3O0GA 3RAHA 3V5PA 4F64A 4DBNA 1Z9XA 3SXSA 2PMLX 4BWKA 5J5SA 4O81A 2XNMA 4V0GA 3QRJA 4EZ3A 4R3RA 1YI3A 2WXVA 2CGXA 4M15A 3ULIA 1J3HA 5CEPA 4YJUA 2Y4IB 4I4FA 4DLIA 3LMIA 4YZBA 4C3PA 5DN3A 1PXNA 5FP6A 2G2FA 4JX3A 4YZ9A 2J0KA 3V01A 1URWA 2G1TA 4D9UA 3KVWA 3DBEA 3V5QA 4EH5A 3DK3A 4PL3A 2ZMCA 3QQKA 3GU5A 4NM5A 3OHTA 4OTWA 2XNGA 5H8GA 3V8SA 4J1RA 2ZOQA 3GCSA 4BIBA 2J0MB 3Q9ZA 3QKKA 4TT7A 3EHAA 4UWYA 3VF8A 4ZTMA 2GNGA 2JAMA 4EJNA 4TWOA 4QPSA 4W4XA 3GEQA 1OL5A 2JBPA 3CY2A 3QHRA 3KY2A 5HE1A 3MESA 2B9FA 5I3RA 4H36A 3S95A 5TOZA 4GVAA 3ZEPA 1JKLA 1A9UA 1KV1A 4H1JA 5JMSA 3F2RA 4IB5A 2XK7A 4EH6A 2HW7A 3RKBA 4I6HA 3VW6A 1A48A 4FEUA 1YDRE 1P4FA 4J97A 4K8AA 4YC8A 4FYNA 4NM3A 3SVVA 1XH7A 4RC3A 3QALE 5CT7A 4AZWA 4R78A 3GB2A 3VULA 3ATTA 4BTKA 4EYMA 3BEGA 2VN9A 3OEZA 4ANQA 4O7WA 4MHAA 3DXNA 5JSMA 2WMRA 3TNQB 4Q9SA 2VTIA 3U6JA 4JBVA 3VS6A 4AFEA 3BX5A 3HRFA 2V5QA 3DQXA 4MEDA 4F0FA 4F1MA 3CJFA 4J7BA 4C35A 3IG7A 4QMXA 3GFEA 5HIDA 4RLKA 4O0TA 3K5VA 4WOVA 2C3JA 4D0XA 1YXTA 5KMOA 4XG9A 3CEKA 3HV5A 4RIYA 3UMWA 1SNUA 5E8VA 4K2RA 2ZV9A 2WU6A 5BYZA 1Z57A 4F70A 4O7RA 1Y8GA 3LCOA 5IDNA 3E7VA 2LAVA 4M97A 4D5HA 4IJ9A 1WBVA 1W98A 5CU4A 4O0SA 2B9JA 3L9MA 5BVWA 1LPUA 3DQWA 1YHSA 2WTKC 4O2ZA 3WZDA 2QHMA 2VO0A 3VS1A 3WF7A 4BGHA 5FDPA 3WYXA 3WF9A 4PV0A 5LVNA 1H1PA 4IB0A 3DDPA 4MNFA 3AC1A 3AGLA 5C26A 2R3HA 4Y83A 4ZSEA 4JIKA 2X81A 4JLCA 3G0FA 1NVQA 5FBOA 1ZYDA 3CPCA 4ZIMA 1OITA 4QMQA 4L46A 4IZYA 3R9OA 3ZMMA 3B2WA 4OTQA 4G3GA 3VAPA 3QTWA 3OUNB 4ALUA 2YA9A 5CAVA 4O22A 4O0WA 1SNXA 2WMUA 1DAWA 4KRDA 4OTGA 5HNBA 5KZ0A 3LKMA 2VTSA 3DOGA 3HP2A 3G6GA 4PTGA 3FSFA 3OXIA 3L9LA 4FEQA 4RRVA 4CV9A 4QYHA 2WQOA 3L9NA 3UTOA 3ZO2A 4C0TA 3NUAA 2WMVA 2UW7A 3L8PA 4YZDA 1WZYA 4O38A 2G01A 4MTAA 3HDMA 4FKOA 3ENMA 4UYNA 4Q2AA 4DEEA 4C2WA 2HY0A 3BYSA 1OM1A 1PXIA 4ZY6A 3ULZA 4G2FA 4PNIA 5IQDA 1PYEA 4E20A 2Z7RA 2X39A 4D55A 4PP9A 3K5UA 5A9UA 4C7TA 3CQEA 4XG6A 3FQEA 3HECA 4G9RA 4MWHA 4O27B 5EOBA 3U87A 4EH7A 3FPMA 2CNQA 3VUIA 3DV3A 3CBLA 2VTQA 4RLLA 4UB7A 1CKJA 1VJYA 3SDJA 3DZQA 4CD0A 4FL1A 2QOFA 4GUEA 2PUPA 3UG2A 2Q0NA 4RC2A 4EWHA 1FQ1B 1Y8YA 1M7QA 3F2NA 3WE8A 1TVOA 3CQWA 3PWYA 4ITHA 3MY1A 4DEGA 2BDFA 3LMGA 1URCA 3VUTA 1W7HA 2CGWA 4PDSA 3NVMB 4QP7A 1DI8A 4A9TA 5AV4A 1OPKA 1ZZ2A 4FG9A 3FXXA 3TZ7A 1WBSA 1IA8A 3DU8A 4DEDA 5IEXA 1OL6A 1PY5A 1T46A 3QZGA 4KWPA 3PJ1A 3R8LA 4FEWA 3G0EA 4IZAA 2XK8A 3PY3A 3QC9A 1I09A 5CU6A 3U51A 3SOAA 4BDDA 4F08A 3F5PA 5KCVA 3KREA 3ZH8A 3E93A 4OT5A 1MRYA 5L2IA 4LUEA 3R7IA 4C62A 4RVTA 4GKIA 2Z60A 3R9DA 1OVEA 2A27A 2R64A 4CGAA 2BRGA 2W1DA 3GC8A 3NW5A 2FH9A 4D2RA 4ZLOA 4NW5A 3P5KA 4GU9A 2B0QA 3T9IA 5BVDA 3PPZA 3I5ZA 5CYIA 2AYPA 5E8YA 1XBCA 2EXEA 4WA9A 4UX9A 4TN6A 4FVPA 2BAQA 3LXPA 2AC3A 3ZC5A 3R73A 4XX9A 3ROCA 3OWLA 1M14A 5KO1A 1PKDA 3ZSIA 4FT7A 4DCAA 3Q2JA 4BI2A 4GJ2A 5JT2A 1H25A 2P4IA 3ORXA 3JUHA 1NT2A 2WTVA 2PHKA 3CXWA 3VC4A 4AGWA 4M69B 4YTFA 3BYUA 1ZRZA 4ZZOA 4F0GA 2FSTX 4YZNA 3R22A 5FRIA 4BCFA 1JLUE 3ITZA 4C4EA 4ENYA 4GUBA 2EUFB 1ZOEA 4O7LA 3ZRLA 2OIQA 3ANQA 5KBRA 4BYIA 1Q24A 4FSRA 4X0MA 4FBXA 5CEOA 3QQFA 1B38A 4OW8A 2UUEA 2PMOX 3ACKA 2OO8X 4R5YA 2CLQA 4LRKA 4NSTA 5EG3A 4ZTHA 2YDKA 2QOIA 2OKRA 5IQHA 4P2KA 4Y85A 2C47A 3GCVA 3HGKA 5CI7A 5DEWA 3V8WA 5ANDA 3T9TA 4ARKA 4W8DA 4FE2A 4AN3A 4AOTA 4HW7A 2UZBA 5M06A 4BDFA 3F3UA 4RFZA 1YKRA 4WUNA 4DCEA 4BDHA 3FYJX 3Q3BA 3EFJA 1OKVA 4C8BA 2JIVA 2GCDA 2WIPA 4RVMA 4FKPA 4CZUA 2J7TA 4YZMA 1PXKA 3OWKA 3KL8A 3R7EA 2B53A 4NEUA 1KOAA 3ALNA 4IMYA 3HV7A 5IEVA 4EH2A 3KRXA 3BE2A 4FSNA 4PDPA 2W4JA 4R3CA 4JXFA 1H26A 1O9UA 3DNEA 4IM3A 4KBCA 2IW9A 5A6OA 1YXSA 2GDOA 2WZJA 2GNHA 2RFNA 4A4OA 2JAVA 3NIEA 1WCCA 4FTNA 3MPTA 2NRUA 3P4KA 4QOXA 2W1GA 2OWBA 5CU3A 5CY3A 3QTXA 5GNKA 1PXJA 1WBNA 5C9CA 2PMIA 4FVQA 5IH4A 5D10A 3CIKA 3PLAE 1OPLA 4EK3A 5EKOA 4D4SA 2WD1A 4I92A 4C4HA 4EK5A 5HTCA 5M55A 1ND4A 1WVXA 3LM0A 5E1EA 4KRCA 5L6WL 1QPJA 2JKOA 4XMOA 1IG1A 1E1VA 2RFDA 3B8QA 1ZOHA 3LQ8A 4QTAA 3P86A 4F09A 4DFBA 2DUVA 4O0RA 3TUDA 2WTKB 3PIYA 5KMJA 1SYKA 1T45A 3TACA 1ATPE 4QYGA 4M7IA 3HMMA 2W4OA 4P90A 3FL4A 1RE8A 4DTAA 1LR4A 4AGDA 4WIHA 2WB8A 3ZBFA 2OJGA 4BDJA 2IJMA 5AUUA 4D1SA 4AZTA 5LWNA 2UVYA 4FV0A 4HZRA 4Q5EA 4E4LA 4KABA 4YJPA 2VU3A 3AT4A 3EL7A 5J7HA 4GJ3A 3RI1A 3F3TA 3ORKA 5JN2A 3I4BA 4MQ1A 3BLHA 4G6NA 3LFNA 4X3FC 3NR9A 5BNJA 4FV9A 4CKRA 5ACBC 3OFMA 2C6MA 3UBDA 3CY3A 4L42A 5LXMA 4LRJA 2R3JA 3GFWA 2P3GX 4EI4A 3O8PA 1S9IA 2HAKA 3PIZA 4XBUA 4FKRA 4FI1A 4UALA 4TYHA 4FVRA 3W2QA 2PMNX 1ZOGA 3NDMA 3H30A 5GIOE 1GZOA 4DITA 3TZMA 5L4QA 4F63A 3PE1A 2RGPA 3GCQA 2VTNA 4X2KA 5E91A 5EI2A 2LGCA 4RIWB 2C6EA 4YLKA 4GFMA 3HYHA 4HVDA 3I0OA 2UZWE 4BCIA 2BTRA 5BMSA 4FTIA 1Q99A 1WVYA 1XH5A 3I0QA 4MXXA 4BCQA 3PRIA 1H24A 5AP4A 4HOKA 3G5DA 5HORA 3UIMA 4AA5A 1CM8A 2JDVA 5IQIA 4DF3A 4A4LA 5AAFA 5HGIA 2H6DA 4DGNA 5CQUA 4FUXA 2HZ4A 3E5AA 1FGKA 3TIZA 4DH8A 2VTLA 3TCPA 5A46A 2GHLA 4W4WA 3SW4A 4IHPA 2B52A 2BHEA 3THBA 2R3LA 3KMMA 4EKKA 3RCDA 3UNZA 2UW8A 4RT7A 5HVKA 2VO7A 4ZXTA 3OS3A 4MD7E 4WNMA 4FSUA 2VNYA 4E93A 2GMXA 2PVMA 1UKHA 4J52A 3U9CA 1YXVA 3VW8A 4UN0C 4MF0A 4TYJA 4BDIA 4OAUC 1UNLA 4I6QA 3BELA 4FOCA 3ZZWA 3QCSA 5LMKA 5L6PA 1MRUA 2AC5A 1APME 2CKEA 4IM2A 5AWMA 5K0KA 4HGSA 3FLYA 1WAKA 3OUKA 4OTRA 5A4TA 5CLPA 3O8TA 1FVVA 1QPCA 2YEXA 4GV1A 4E4XA 3NCGA 2XNBA 4U7ZA 3QGWA 2P33A 2XF0A 3UYTA 2KULA 1J7UA 5EFQA 2XYNA 4I5CA 4G6LA 2WKMA 4BHNA 3IGOA 4FZAB 1JSVA 3HP5A 3SG8A 2QO2A 4M66A 2XK4A 4DGLC 4QMOA 2ITUA 3OEFX 4BN1A 3NVKI 5BQ0A 1NY3A 3HUCA 3F3ZA 5CX9A 4D4RA 4I5MA 4PL5A 2RFSA 4CEGA 4G3DA 2OK1A 3P7AA 2VO3A 5IU2A 5ETFA 4WG3A 3IW4A 4FTRA 4FTJA 5CEMA 3BBTB 5IQCA 3PXKA 1OIYA 4B8LA 3ZSHA 4E4MA 5AAEA 3ZLXA 3D5XA 2YZAA 2C1AA 4NT4A 3MVLA 3NUPA 4XEYA 2WNTA 2YCQA 1JSUA 5EYMA 5FP5A 5JZJA 2ITOA 1O6YA 3QXPA 4XG3A 3U55A 4PTEA 3R9HA 2ETMA 2UW6A 4BTJA 1FBNA 5HIEA 2BRHA 4KIPA 4IVCA 2VTAA 2J9MA 4I23A 3MW1A 4G5JA 4UWCA 4FTMA 3E87A 3RK7A 2H8HA 2OIBA 4FTTA 4D2PA 5BVNA 3NIZA 3KRWA 3E8DA 4L01A 2VWYA 2J0JA 4FNXA 4DYMA 1HOWA 3FQSA 5DNRA 5CS6A 4M12A 2RKUA 5E8ZA 4C3FA 3PG1A 4O7TA 4FGRA 3TZ9A 3DGKA 4UWBA 3QQHA 1KV2A 3R01A 4AXAA 3DBDA 2VWXA 4KSPA 4OTFA 2CSNA 2HXLA 4N70A 3M11A 3BYMA 5ANJA 3PA3A 4QMVA 4B0GA 4H39A 4W8EA 4JI9A 4FR4A 3BBWA 3ZLYA 4EOSA 2YAKA 5A6NA 4EJ7A 4O86A 3OBGA 2ZM1A 4UMRA 2XBAA 4JRNA 2UVXA 1XH8A 4OBPA 5DR6A 3AC5A 4CRSA 4ERKA 4FIHA 3EQCA 4P7EA 3P0MA 5EQEA 4JDJA 4QTEA 2BZHB 3AOXA 3UP7A 1KWPA 4EOIA 4CTBA 5CASA 2OIDA 1M2QA 1P2AA 1Y6AA 4GCJA 3HMIA 2IN6A 2YM6A 2CNUA 3RTPA 4EHGA 2X6DA 2R4BA 4WUAA 1M2PA 3C51A 3CKXA 4OBQA 4R77A 4NK9A 4CT1A 2GS6A 4XV1A 2Q83A 2C6KA 2WMXA 3L8SA 3Q9WA 4XP3A 2Z7SA 1H08A 3VUMA 4BHZA 3V3VA 2Z02A 4J96A 4YSJA 3ZS5A 5EHYA 3NRMA 3OXTA 4IIRA 5J1WA 3LXKA 1K3AA 3D7TA 3LFFA 3DAJA 4NKAA 4YNOA 1XBAA 2VTMA 5D12A 4BTFA 2PVJA 2XM8A 3B2TA 2FVDA 3PY1A 4U5JA 4YUQA 4MX9A 1QCFA 5D1JA 4X3FB 2R0IA 4EHZA 5BVKA 1V1KA 3CGFA 3ID6C 5F1ZA 3VS0A 3WZKA 2EVAA 4I0SA 4QP8A 3FMMA 3ZLSA 3E3BX 3IS5A 3F3VA 2OBJA 3A2CA 3K3JA 3NPCA 2ZDTA 3K2LA 4QYYA 5DT0A 5AR3A 4HNIA 4BTMA 3DBQA 1VYZA 4GIHA 4L44A 2X9EA 4XP2A 5EH0A 3PIXA 2O2UA 2ZV7A 4EQMA 4YP8A 4DINA 4I5PA 4RJ5A 5FDXA 3EN4A 4PPAA 2VV9A 4BZDA 3PWDA 2JLDA 1HCLA 3FLNC 4XG8A 4Z3VA 1ZY5A 2XYUA 3R2YA 4TWCA 5DRBA 2A2AA 2JFLA 1R78A 2QG5A 3VBTA 2UW9A 2XIZA 4N0SA 5DPVA 4FTLA 3EQHA 4CTCA 3W2OA 2R3OA 4HPTE 3COKA 3RM7A 4U9AA 5EYKA 3QHWA 1UU9A 4ZS4A 2ERKA 1TKIA 3W33A 1W0XC 4I0RA 2PVHA 3BCEA 2BRBA 4MVFA 4QMSA 4RFMA 2GHGA 2VO6A 4K1BA 4CQGA 5GJGA 3UO4A 3OF0A 2YIYA 3E8EA 2UV2A 1XO2B 3ENHA 4LOOA 5C03A 4ZLYA 4J53A 3QWJA 3MIYA 3ET7A 4BDGA 1TQIA 4JRVA 3KXHA 3UE4A 4EOQA 1OL2A 2BVAA 4ZSJA 1U4DA 1PXMA 4EEVA 3C4FA 5CSPA 2QOKA 3MVMA 3MA6A 4BL1A 2IG7A 4K11A 3SD0A 4V05A 2PULA 3M42A 3ZUTA 2XNNA
chains in the Genus database with same CATH superfamily
5KHWA 5AP5A 3DJ5A 4L3PA 4RX7A 2WQBA 5KMMA 3LJ2A 1J7LA 4NJDA 1CSNA 2PVNA 2R7BA 5AMNA 4ACMA 3FMJA 4XUFA 4B99A 3FC2A 3W1FA 5A4QA 2I7QA 4JT3A 3VS7A 4C4FA 2IZSA 3KXZA 2V22A 4LMNA 3M2WA 4IADA 4RA5A 5AP0A 3R7YA 3GQIA 4EBWA 5CTPA 5DI1A 3R71A 2CPKE 2QCSA 2VNWA 3FZ1A 5AA9A 4BVUA 4HYSA 4CFUA 3MV5A 5J7BA 3BEAA 1JKSA 3GCPA 4ASEA 1U54A 3DKCA 3O23A 2QG7A 1UNHA 1XQZA 2VWIA 4PRJA 1P5EA 5DOSA 3FUPA 3EYGA 2UZNA 3WYYA 1H1RA 4IDVA 1YXUA 2EU9A 3I5NA 2GFCA 2VWZA 5E90A 3PP1A 4EL9A 1Q97A 4EOOA 3DDQA 3MTFA 3R63A 4AGUA 3U8WA 4CG8A 4GT5A 4EBVA 2CMWA 2XRUA 3NUYA 4GIIA 3VS5A 2PVFA 4E5WA 4YU2A 3TDVA 3ZRKA 3FKOA 2YHVA 4NZWB 1Y6BA 3UOLA 4DTKA 5M57A 1XR1A 2UZLA 3GUBA 4IX5A 3F7ZA 3BHUA 5DT3A 4F1TA 4QYEA 2QODA 4NYEA 3SW7A 5HE3A 3VONA 3RZBA 1ZYCA 3CLYA 4ZTLA 5EK7A 2ZM4A 5HX8A 2PZPA 4Z9LA 2CNVA 2XNEA 3AD5A 2IF8A 4QMMA 3KF7A 2BHHA 3IKAA 3LFQA 4EHVA 4IZ7A 1IR3A 2W7XA 2RSVA 3D0EA 4EQUA 5BMMA 4TYEA 5EQPA 4II5A 2YFXA 3WE4A 3RHKA 4E6QA 4O1PA 4G31A 2VTHA 4HJOA 5ETIA 1V0OA 1ZYJA 3AC2A 4AF3A 5K5XA 2O65A 4B9DA 4M3QA 3EN6A 4J8MA 2QU5A 3MFTA 5KMNA 3TV4A 4GG7A 5F20A 4V01A 4ZTQA 4AZEA 5M07A 3PPKA 2RIOA 3EOCA 3UO5A 4K77A 3HRBA 4FZ7A 4FTQA 4FT3A 2R3RA 4K6ZA 4BC6A 4JDIA 4QP9A 2YACA 3AC3A 4Y5QA 5DWRA 3DBFA 4OBOA 4FK6A 4L53A 4V0GB 2P2IA 2ITYA 3OTUA 4JR7A 1GOLA 3LMHA 1XHAA 5FEEA 2HWPA 4RIXA 2JKMA 4MXYA 3A7HA 2W1CA 3U9NA 3FZSA 3ZU7A 5TO8A 3D5WA 1J91A 4FKWA 3LHJA 4FL3A 4PP7A 3CGOA 4PPBA 5CAPA 4AW0A 5EOLA 3UVPA 5AIRA 2ZB0A 3PSBA 5D7AA 4QT1A 4CT2A 2GNJA 3MPAA 4BFMA 4CCBA 2OF4A 3MVJA 3Q60A 3AKJA 3POOA 2XUUA 3BU5A 3FWQA 2X0GA 3BLQA 4DFLA 3EWHA 3GXLA 5E8WA 2GQGA 5FXSA 1RQQA 5IQBA 4ACGA 2YZLA 1R39A 5I0BA 4R8QA 3AMYA 3QTSA 3ZEWA 4A4XA 4BCJA 4DT8A 3A7IA 4ANOA 5GINE 3CP9A 5G6VA 3DAEA 4MXAA 5J1VA 3RNYA 3CE3A 4Z55A 5I5ZA 4I0TA 2JDOA 2A1AB 4JAIA 2GS2A 3OP5A 2GFSA 3IW5A 2H9VA 3ZUUA 2UZEA 3C0HA 2C69A 5HEZA 3TMOA 3NGAA 3BHVA 3IPHA 3RBWA 5CSHA 3Q5ZA 5FD2A 2WGJA 4C3RA 5A54A 3U54A 3E64A 5I9UA 4PMSA 2YISA 3BGPA 2BROA 5HKMA 5CVHA 1H00A 1JAMA 3FXZA 3RJCA 2OLCA 2BR1A 4PMPA 4HVHA 4APPA 3UG1A 5CT0A 3C7QA 2C5VA 3FXWA 3VO3A 3VBXA 4DGMA 3BQRA 3IQ7A 3BWJA 1M17A 4KKHA 3NUNA 4AG8A 2OI4X 4G3FA 5EQYA 3FYKX 5CXZA 3PUFC 1M7NA 4RIYB 3ZZEA 3HV4A 3LAUA 3LLTA 4FKGA 5JFSA 2XIRA 1IRKA 2QVSE 5IA3A 3HKOA 5LARA 4PTCA 1YI4A 4GS6A 3VUHA 1H28A 3VBYA 2KTYA 5M51A 3R9NA 3UJGA 5KKRC 5HZNA 1ZMWA 1OPJA 2QKWB 3VUKA 3DBCA 2JFMA 2ZB1A 4FSZA 3AGMA 4IACA 4O0VA 4N57A 2R3NA 1OZ1A 4PF4A 4D0WA 3MFSA 4BI1A 3RWQA 3AT2A 5EHLA 2H34A 1KUTA 5TR6A 4UV0A 3FAAA 3DZOA 4JDHA 4O4FA 4RVKA 3OD6X 5HI2A 4E6DA 3TDWA 3UZPA 4CSVA 4TNBA 1YWRA 1B6CB 1SM2A 2ZFYA 5CQWA 4AACA 2E9NA 3RAKA 3W16A 2JIUA 4I93A 4ZS0A 2W9FB 4BGQA 5E1SA 2ESMA 5AAGA 3NYOA 4ZOGA 4QTDA 4DEAA 1R0PA 3FMNA 2JD5A 5E4HA 1BKXA 4FKJA 4L3JA 2J0LA 3K54A 3POZA 3VRYA 5L8JA 3LIJA 4YURA 3DLZA 2PU8A 2UZOA 1JSTA 5HX6A 3VJOA 4L9IA 4FICA 3VWAA 1H4LA 4HYIA 4CMOA 3RPRA 2I0YA 4U8ZA 4UMPA 2HZNA 2E9UA 4ZTRA 2YDJA 5CEKA 4MNEB 3O51A 2V0DA 5AUYA 2XAMA 4LGHA 4C34A 5CEQA 4OUCA 3P7CA 4DEBA 4ZJJA 3CKWA 2JKKA 5DIAA 3R0TA 4G9CA 2J6MA 4I22A 1AD5A 2I40A 3UIBA 4GMYA 4AQCA 5HU9A 3QL8A 3LE6A 4UY9A 4YJSA 4FC0A 3UQGA 3Q32A 4KS7A 1YOJA 4AAYA 2ZMDA 4FTKA 3KIOC 3OZ6A 2WMTA 3VS4A 4ALVA 3BYOA 3MWUA 4TKSA 4ZAUA 3RK9A 1SVGA 2C30A 2RFEA 4IC8A 3EQFA 5AIKA 4CV8A 4CVAA 5H8BA 3MY5A 4F7SA 4X21A 5I4NA 3EZRA 1PYXA 4OTPA 2VZ6A 3HUBA 4KIOA 3FV8A 3RHXA 1JBPE 3UPXA 1CTPE 3FMHA 1GIJA 2X4ZA 2W99B 4NM7A 3R83A 3I60A 2F7XE 4KUJA 2ZYBA 4U45A 4ERWA 2OGVA 3A7JA 4S2ZA 1UU8A 2DS1A 4AW1A 4JBPA 4GK2A 5HG9A 3NFGB 1ZAOA 5AV3A 3WBLA 5CANA 3DLSA 5JZNA 1Y57A 3Q4ZA 3R1NA 4FNWA 4GT3A 4X6RA 5C01A 1PRYA 3AMAA 4DLJA 4LQMA 2ITXA 4IANA 3NSZA 4C2VA 5LMKC 4I24A 4C59A 2FO0A 4I20A 4CLIA 3COIA 5IISA 4F9WA 3GC0A 4GK4A 2XH5A 5K0XA 3DXPA 4NFNA 3UZTA 3W0MA 1REKA 4G3CA 4DEIA 3FLWA 3B8RA 1WVWA 4D4VA 5JEBA 3FMEA 5A14A 1VEBA 3P7BA 5H3QA 4BCNA 3HX4A 4C37A 4PPCA 2YWVA 3R7UA 2OH0E 4QNYA 5CVGA 3ORIA 1H0VA 4GL9A 4A9YA 4JIAA 2EB2A 3DFAA 4FSWA 2IVVA 3QZIA 5D11A 5AP7A 1DI9A 2R3QA 5FEQA 4CZYB 4LOPA 5GZAA 4XS2A 3NNXA 2XK9A 4QTBA 2JEDA 4K18A 3EKNA 3JS2A 3OVVA 4LYNA 1L3RE 3PLSA 5IUGA 4CFFA 1UV5A 2ZV2A 3OBJA 5JFXA 4PDYA 3RWPA 2J50A 3Q4CA 5F95A 4EUTA 4FMQA 4IE9A 5BVOA 4HNFA 5CU2A 4AXEA 3TUCA 4UMTA 3KK8A 3H4JA 3VUDA 4Q5HA 3QU0A 3AG9A 4M69A 3MA3A 4UEUA 5FG8A 4KIQA 4JBQA 4O4CA 3MJ2A 4FT9A 4I6FA 5T3QA 3A60A 2YM8A 5M09A 2HELA 3NUUA 4YO6A 3FZTA 2GU8A 3JPVA 4ZMFA 4CG9A 4BKYA 2XNOA 2X0OA 3OXZA 1ERKA 2BKZA 3TUBA 4O7ZA 2C3LA 4ACCA 3I6UA 4H05A 3Q52A 2XKCA 3N4VA 3E88A 1Q8WA 1JKTA 1X8BA 2WTCA 3BL9A 5J95A 3OMVA 5J9LA 3E7OA 3LJ1A 4W9XA 5HVJA 3UVQA 1A06A 3LZBA 4M8TA 3AT3A 2WEVA 4DFUA 3R7VA 1YQJA 3PXQA 4BB4A 3TKUA 5CVFA 3BYVA 3TKIA 5HBHA 3BKBA 3U6IA 2J2IB 2XRWA 2XCKA 2X7OA 2R5TA 5AX3A 3PSCA 3LFBA 3AC4A 1Q3WA 2ZVAA 4FT5A 4NIFB 2ITZA 3NZ0A 3DFCB 1OL1A 2VX0A 4O0YA 4TRLA 2QQ7A 4RGJA 2C6IA 4DFZE 5KKRB 3OCBA 2GQSA 3JVRA 5AADA 5IF1A 2OZAB 2QC6A 4YHFA 4AP7A 4LRMA 4WRGA 4FSYA 5C4LA 4DH5A 4L8MA 3H9RA 2ZV8A 1W82A 4XHKB 2ACXA 1BYGA 3SKCA 4BCKA 2X2LA 5E9EA 3C4XA 5BUEA 3DTCA 4UMQA 5CSXA 3KXXA 4OGRA 2VWUA 5HNGA 2PPQA 2JITA 3RM6A 3UIXA 4E8AA 1PKGA 5EI8A 3HZTA 3MFUA 3MDYA 4CFMA 3F5XA 4YMJA 4F78A 4F7JA 2ZAZA 2HENA 3MH3A 4S34A 4GYGA 4EQCA 4EZ5A 4YHTA 2PVKA 3UMXA 4AZVA 1YRPA 3VBQA 3AQVA 3QD4A 3QYWA 3P79A 2VTTA 5CU0A 3O71A 3QKLA 4GU6A 4QYFA 1WBTA 3RINA 4F7NA 5AR7A 4GT4A 4BKZA 2P0CA 3L9PA 2F2UA 3MB7A 4R3PA 2YLEA 2G9XA 5FM3A 5HO7A 4IX6A 3ZO4A 4YLLA 3ORZA 4APCA 4O84A 3N4TA 2JDRA 4X6QC 4BGGA 4BDKA 3GNIB 3HMPA 2C6TA 4J71A 4N6YA 4TYHB 5HOAA 5IUIA 4AGCA 5LCJA 3ML1A 1FOTA 4DT9A 5B0XA 2OH4A 4YC6A 3F66A 1V0BA 4M67A 1XH6A 4WT6A 5LVLA 5DE2A 3TT0A 3G9LX 3PYYA 3BV2A 1G3NA 5CENA 3UC4A 4E5AX 4PMMA 2B9IA 4KKEA 5IA0A 3Q9XA 3AKKA 5TE0A 5K4IA 4K0YA 2QOCA 1Q5KA 2Y7JA 3A62A 5EKNA 4AXFA 3I6WA 5EW3A 2Z8CA 2CCHA 5KE0A 5BPYA 3FE3A 1K9AA 4WD5A 3KC3A 4LOQA 2VRXA 3RP9A 5DR2A 3VVHA 1E1XA 2YIRA 1YHWA 3GU4A 3IONA 1GZ8A 2QO9A 3H0YA 4KINA 4RIWA 1IA9A 5EM5A 5L8LA 4Y95A 2R0UA 3IW7A 4MUQA 3HV3A 4U42A 1J1BA 1BUHA 1KSWA 3NCZA 3EJ1A 5ACKA 4EHEA 5GZ9A 5BVFA 3WZEA 3R28A 3FPQA 2R2PA 2YJSA 3TIYA 4O96A 5KBQA 4BDCA 4FEXA 4KSQA 3C4CA 4XV2A 3CTQA 2PVLA 3MH1A 2F49A 2GHMA 2ZJWA 4LL5A 4YJTA 3ZONA 4BJJA 3FKNA 4IQ6A 3JR1A 5EM6A 3ODZX 3NNWA 3QTRA 3VUGA 3OCSA 4XLVA 4AXCA 3NWWA 4JL9A 3VS3A 4BBEA 4GFGA 3ELJA 3DB6A 2UW3A 3Q9YA 3QQUA 3NS9A 3TNWA 4IFCA 3RVGA 3TV6A 5ETCA 4ANLA 4D58A 4QMUA 5E92A 3UIUA 1VYWA 2HW6A 2W5HA 4QQCA 2ZM3A 3PJ8A 1UKIA 3WF8A 5L2WA 4IVDA 3LQ3A 4W4YA 3MN3A 5DRDA 4BDBA 4EKLA 4DGOA 2W1EA 3BE9A 3PP0A 2F57A 1BL7A 2YITA 4ANSA 4RWKA 4DHFA 2RG6A 3L8VA 3KMUA 2FB8A 3QUPA 4BR3A 2QOLA 4GSBA 3W8QA 4A9UA 4DH1A 3FI4A 1YDSE 5LOHA 1BX6A 4P5ZA 3IW6A 4YJVA 5HBJA 2QURA 4EC8A 4YPDA 4TZRA 3MH2A 3MI9A 3O8UA 5F94A 2HXQA 5M4IA 3OY1A 3CC6A 4TTHB 3RAIA 4C02A 3EZVA 2FUMA 3CTJA 1VR2A 4D4YA 4TXCA 3SXFA 2XARA 2HYYA 2C0TA 1Q8ZA 3EH9A 3OY3A 2BIKB 4FV7A 4LV5A 4R1YA 2CGVA 3BU6A 3R1QA 1XKKA 5B2KA 3F5GA 3WI6A 3I7CA 2EXCX 1V0PA 4N4SA 4FEVA 5DMZA 2W5BA 3AD4A 5IA4A 3ZTXA 4HCUA 5IH5A 2V7OA 3WOWA 4AWIA 1PMEA 4DH3A 2BZKB 2YM5A 1QMZA 4FKSA 2YCRA 4EH3A 5AR4A 4GRBA 3ETAA 2QU6A 5AV2A 1PMVA 5ANIA 4G6OA 4L7FA 3FY0A 2RL5A 2B7AA 5GHVA 3AC8A 5M44A 5M4FA 3IDPA 2JKQA 2W06A 3Q6UA 4U6RA 4CYJA 1OI9A 2W1ZA 3QZFA 4IAYA 2VWBA 2XIKA 5CZHA 3QFVA 4JAJA 5BYYA 1G8SA 4LV7A 1XH4A 3D5VA 3LLAA 3DY7A 4D2WA 2X8EA 3EKKA 4X2JA 4L00A 2VUWA 2YM3A 4LGDA 4CMUA 2BALA 2XALA 3V5JA 3HAMA 3SXRA 2QI8A 1KOBA 4KB8A 1YDTE 3JY9A 3LFAA 2WELA 4ZZNA 5GIPE 3OOMA 2QO7A 1OB3A 3TL8A 4EOJA 2IVTA 4YJRA 3ZHPC 2XEYA 3KRJA 4WBOA 4ZP5A 4RX5A 1JOWB 2A19B 4CQEA 3C9WA 4WRSA 4WSQA 2QHNA 3COHA 1FGIA 5IZFA 4NM0A 4UXQA 3DK6A 3A8WA 5M08A 4CKJA 4QP4A 1YWVA 4FK3A 4YHJA 4ZY4A 3PVWA 1H0WA 1IEPA 3PFYA 3ZM4A 2Y6OA 5AP6A 3QD3A 4QMZA 2NP8A 5IA5A 2XVDA 4HVIA 5I9XA 5L8KA 1FVRA 2O8YA 3V51A 3D7TB 3WF6A 2AUHA 2QONA 4ITIA 2ITWA 5B2LA 4XV9A 3CCNA 3FI3A 1F0QA 5M56A 2BPMA 3QAME 1LUFA 4IAIA 4H3BA 3E8NA 4FNYA 4NFMA 4U0IA 4FV1A 5DH3A 5FM2A 1QL6A 3EQRA 1O6KA 3R9RA 1UVRA 4G34A 1WBWA 4XG7A 2CHLA 3G6HA 2B54A 4QQJA 4XG2A 5J9YA 5L2TA 4ORKA 5JGBA 5E8TA 3FHIA 3ZO1A 5FTOA 2IWIA 2Z2WA 4NCTA 4F9CA 4KA3A 4F9YA 1XJDA 5FBNC 2ITTA 2PVYA 3E8CA 5HO6A 5FTGA 4PX6A 4FIIA 3SAYA 4O1OA 4KIKA 3ZFMA 3UOKA 2WOUA 2WOTA 5HIBA 3IDBA 2CN8A 3JVSA 4O7NA 3A4PA 2ITNA 2XKDA 4QMTA 4X2GA 3S3IA 3E3PA 2W0JA 3GT8A 2HK5A 4O4BB 2OJIA 4PQNA 5CZIA 4Z16A 3II5A 4R7BA 1LEWA 5GZ8A 3W0QA 4DG2E 3TNPC 4KNBA 5A4EA 3F9NA 3LXLA 5M4CA 4WNOA 4FODA 1RDQE 3MTLA 5H2UA 3AD6A 3ZUVA 5JRSA 3C13A 3E63A 4ASDA 1U5RA 2VX1A 3UQCA 5ANOA 1FMKA 4XP0A 2PZIA 3R8ZA 2X2MA 3KCFA 4EONA 1W8CA 3WIKA 4HCVA 3FZOA 4YLJA 4AA0A 4EOKA 2OXYA 5IPJA 4BWXA 1UNGA 3QF9A 4RZVA 4DEHA 4JOAA 4OAVB 5HLWA 3DPKA 3G9NA 3BHTA 2YIWA 2PVRA 5HQ0A 2C68A 3C50A 5CSVA 1JPAA 1ZARA 4JQ8A 1YWNA 4E6AA 4QDEA 4FV6A 4GG5A 2EWAA 4G5PA 5T68A 2XS0A 3NYNA 4GKHA 3KULA 4D5KA 2R3FA 4M84A 3FEGA 3W18A 2WMBA 5AR5A 2W1FA 3U6HA 1EH4A 2IO6A 3UOJA 3GGFA 3UO6A 3UDTA 3SLSA 4XOZA 1REJA 4FIGA 4DN5A 5HLNA 4FSMA 3ORMA 3RZFA 4QMWA 1DS5A 2C6OA 2V55A 4RJ4A 4U41A 2YAAA 2OF2A 2UZDA 3TG1A 4OR5A 3PJCA 4PDOA 3HLLA 3ZBXA 3UDSA 1YOLA 2W17A 4GFOA 4R7IA 1U54B 3R00A 5JGAA 4O7YA 2VTPA 2O3PA 2OICA 3A99A 4E5BA 5LMBA 2NPQA 4UXLA 3C0GA 4E1ZA 4IZ5A 1YVJA 2Z7LA 2VX3A 3DS6A 3O7LB 3SRVB 3DKFA 3ZCLA 4IAKA 1IAHA 3LFSA 1UU3A 4MK0A 2BTSA 4MXZA 4ANMA 1WFCA 4QNAA 4WG4A 1GY3A 3EQBA 2WTIA 4MD9E 2F2CB 3FLSA 2X7GA 3PTGA 3CS9A 4LM5A 5CF5A 4QQ5A 2CKQA 3BU3A 2BKKA 4LFIA 4CMTA 3I79A 5EDQA 4NJ3A 5CEIA 4D28A 4GH2A 1BL6A 4RIOA 4DFNA 2IVUA 4ACHA 4PL4A 2XKFA 2YIQA 4XOYA 5BYLA 2PYWA 2EB3A 5AM7A 5KMLA 3LQ5A 4TNDA 4R1VA 4AE6A 4J8NA 3TTJA 3V5WA 3TTIA 3C1XA 3T3UA 4EK8A 3EFKA 4C38A 4JMQA 4HGEA 4IDTA 5A4LA 3PXFA 2BAKA 3EQDA 3W2CA 5AP3A 3RAWA 3DB8A 5CF4A 3OCTA 5FTQA 5LQFA 4AZFA 4JDKA 3KN5A 2WPAA 4YZCA 2AQXA 2C0IA 2C3KA 1ZY4A 4EC9A 3PVGA 1Q41A 5ANKA 5JH6A 3QTQA 5IA1A 4B6LA 3UNKA 4HYHA 2R3MA 1Y91A 4U44A 3UP2A 2ETRA 5ANEA 1KE7A 3I1AA 4NKSA 3EB0A 4CYIA 4ZJIA 4L67A 5H8EA 3NMUF 3BV3A 3DJ6A 3R1YA 5D9HA 1M2RA 2PE2A 1DAYA 2JIIA 3FZRA 5AV0A 2X1NA 3ERKA 4LL0A 3NUXA 3PVBA 2R7IA 4FZDB 4CFXA 3LCKA 2OFVA 4FG8A 4UZHA 2ONLA 2VTRA 2W96B 5IA2A 2PE1A 3WARA 4NTSA 2PZYA 3ORLA 3TZ8A 4X3JA 1PMUA 3OW4A 4XRJA 5AUXA 5J9ZA 4RJ6A 4Y8DA 4TYGA 3A4OX 4OTDA 4O91A 3FMDA 3A7FA 1SMHA 4ITJA 4L68A 5EDPA 3SA0A 2PSQA 4DTBA 4FZFB 2A0CX 1NXKA 2X8DA 3EFLA 4D2TA 4D1XA 5K5NA 4RWLA 2PL0A 4ANNA 3TNHA 4U40A 1KE8A 3W0OA 4LMUA 2E9PA 4J95A 5J8IA 5CF8A 3R30A 1I44A 5D7VA 4MKCA 4QO9A 1ZYSA 2XM9A 2XJ1A 4RX8A 3HMOA 4ZK5A 4IAZA 3SHEA 4BCMA 5HNIX 3BGZA 2YJRA 2J5EA 4C33A 2UVZA 4DAWA 3A61A 2WEIA 2Z7QA 3ORNA 3KGAA 3O50A 4FTAA 3WILA 2WFYA 3R1SA 4QMPA 3L8XA 2BILB 3Q2MA 4Y72A 2HY81 5AX9A 3ROYA 4FA2A 3N4UA 3D5UA 4FV3A 3FMLA 5EYDA 3KU2A 3TEIA 4E73A 4JS8A 2F7EE 4F1OA 5HG7A 4I41A 3N51A 3UVRA 3UODA 3QRKA 1W2CA 4TY1A 5FXRA 4FKUA 3S1HA 3C5IA 3I81A 3NNVA 3G15A 4Q9ZA 3I7BA 2Y9QA 4DC2A 4YTCA 4NW6A 4GYIA 3OW3A 3KF4A 2PWLA 4ZZMA 5IQEA 4XRLA 3AMBA 2QLUA 2QOOA 3HVCA 1PXPA 3MGYA 1QPEA 3R02A 4EH4A 5HD4A 4DA5A 5DHJA 4EYJA 1KE5A 3W0PA 4FUYA 4WNPA 1Z5MA 3UQFA 4O82A 4IVAA 5BX0A 4FTUA 5I9YA 3CD3A 4ZSAA 2CDZA 5AM6A 4MXOA 5AUWA 4QPAA 1L8TA 2PUUA 5HHWA 2OXDA 5A3XA 3SQQA 5HTBA 5DLSA 5E8XA 2YCSA 2Y0AA 1NA7A 4IAAA 4ZSGA 3G2FA 3JYAA 2FA2A 5CSWA 4U79A 2QNJA 5HESA 3ZFXA 1OIQA 3AKLA 3R04A 4F6SA 5HO8A 4BIEA 2CJMA 4I6LA 4UYAA 1LEZA 4G3EA 3QA8A 1JWHA 4QP1A 5TT7A 4QMYA 3IOPA 4IAFA 3W32A 3VIDA 4BRXA 3ZXTA 2GTMA 3GBZA 3FHRA 3QYZA 4O21A 3GC9A 5HCXA 3GCUA 4F4PA 4LDTA 4L45A 4MQ2A 4A7CA 4FV4A 2JDTA 3SOCA 4ZY5A 5EYCA 3E92A 3KRLA 4UZDA 1BMKA 3ZO3A 1OECA 3W8LA 1PXOA 4AA4A 1KE9A 2IVSA 3EN5A 3ZRMA 4YPSA 5LWMA 5AUZA 3QUDA 1XH9A 2WU7A 3PFQA 1RW8A 2QKRA 2YM7A 3A8XA 4YJNA 4FX3A 5J87A 3RNIA 2R3GA 2YWPA 5L3AA 3PSDA 4FL2A 4DE4A 4FV8A 4X7QA 2W9ZB 1ZLTA 4WNKA 5FGKA 5GJFA 1R3CA 5HTIA 4S33A 5C27A 3VJNA 1WBOA 4MNEA 4RPVA 3FMKA 4EORA 1HCKA 2WTDA 3R8PA 4F9AA 2I6LA 3SGCA 3FDNA 5CALA 4JG6A 3OC1A 2WTJA 3R2BA 4DDGA 4FKTA 3ZDUA 4RZWA 1PMNA 5EDRA 3TYKA 1UA2A 3IOKA 2F4JA 4WHZA 4C61A 3PXZA 4CFNA 5ITAA 2P55A 3H9OA 3LPBA 3BI6A 5FUTA 3DTWA 2BDJA 2R3KA 4MBIA 3P9JA 3QX2A 5EW9A 4S31A 1Q8TA 3G90X 3Q5IA 4AFJA 1NW1A 2C6LA 3CPBA 2I0VA 5A4CA 3IECA 2YLFA 3FJQE 4FF8A 3VQUA 2CLXA 3RPYA 4O2PA 3LXNA 4MF1A 4EUUA 3BRBA 3HL7A 2DQ7X 3KEXA 3KCKA 2R3PA 2XBJA 4IWDA 3COMA 4V04A 3F61A 3OT3A 4ZTSA 4TYIA 5BVEA 3L1SA 5FEDA 5AR8A 3C0IA 4IH8A 3SV0A 4JNWA 4X2FA 3MBLA 4GVJA 3QXOA 2OU7A 2G15A 4AN2A 5JRQA 3P1AA 2B1PA 4AZSA 4C58A 4TL0A 5CAUA 2DYLA 5EHOA 4GW8A 4S30A 5FLFA 5AFVA 2XB7A 1CMKE 4CZTA 5HBEA 3QC4A 4FNZA 1CKIA 4EWQA 4Y5HA 1YHVA 5E8UA 2QR7A 2GSFA 4DFXE 1GJOA 2G2HA 3PPJA 3UDBA 4IBMA 3R7GA 5AUTA 1W83A 2UW0A 2GPHA 3FBVA 1SVEA 2RG5A 4L3LA 4JQ7A 4RJ7A 5HU3A 1U5QA 5CI6A 4YSMA 5CNOA 4YTHA 5HG5A 2BRMA 3F69A 3G51A 3NW7A 4WG5A 5DYJA 2VD5A 3LCTA 3C4WA 3F5UA 2XEZA 4HYUA 4J99A 5DVRA 1TZDA 4DG3E 5T6KA 2OSCA 1K2PA 3PXRA 2BCJA 4FOBA 4Y73A 4RMZA 3VNTA 3W2PA 4YBKA 2OJFE 2B55A 2IW6A 3K3IA 4JVGA 4A9SA 3F2AA 1H8FA 4F6UA 1MUOA 3C4ZA 4I94A 4AUAA 2O0UA 3GU7A 1SVHA 3Q4UA 2GNIA 5BUIA 5KHXA 3TKHA 4H58A 5TF9A 3KFAA 3WF5A 2E2BA 4IFGA 2YCFA 4XH6A 2XMYA 4NUSA 4OT6A 4X2NA 5DBXA 3S4QA 2XK6A 3PXYA 4MXCA 3BIZA 4L6QA 3EQIA 3TWJA 4DH7A 4A07A 4ANBA 5AEPA 5HG8A 5CF6A 4BY9E 3WZUA 2PE0A 1YI6A 4Z7HA 4XYFA 1AGWA 4R6VA 1E9HA 2UW4A 3ATSA 3NYXA 3VRZA 3FQHA 3R8MA 1ST4A 4FV2A 1QPDA 5KUPA 2HOGA 4JBOA 3NAYA 5AP2A 1PHKA 3F88A 3IO7A 5I9WA 1YW2A 3GC7A 5IQAA 2EXMA 3FI2A 3H9FA 1CDKA 3QQLA 3V6RA 4H3PA 1BI7A 2WIHA 3PVUA 1FINA 3OOGA 2XJ0A 4U81A 5DGZA 5IMXA 2Y6MA 1VZOA 5ANGA 3D9VA 2C5NA 3ZDIA 3A7GA 4RA4A 2B4SB 2ZDUA 2HCKA 3U4WA 3O2MA 1W2FA 4IVBA 4JJRA 4JX7A 4R7HA 3EYHA 2XANA 1OMWA 2QOHA 3KVXA 5JQ8A 3EL8A 3EN9A 3Q04A 4FKVA 4EH9A 4DHZA 3LCDA 5G1XA 5L2SA 4IX4A 3S0OA 4O7VA 4LG4A 3MJ1A 4HZSA 4NIFA 5CAOA 4JR3A 3UPZA 1GIIA 4IWOA 4RWIA 1Q8UA