4FC0A

Crystal structure of human kinase domain of b-raf with a dfg-out inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
254
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGGSILWMAPEVIRMNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Design and synthesis of novel DFG-out RAF/vascular endothelial growth factor receptor 2 (VEGFR2) inhibitors: 3. Evaluation of 5-amino-linked thiazolo[5,4-d]pyrimidine and thiazolo[5,4-b]pyridine derivatives.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 254
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fc0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fc0A01
2B1PA 3LLTA 5IEVA 4YZNA 4ZZOA 5B0XA 4LG4A 4E6QA 5K4JA 2Y0AA 3C4CA 2WMAA 3EJ1A 2C0TA 3NUPA 5GJGA 4ZZMA 4R78A 3DZOA 3AOXA 2YERA 3A4OX 4CT2A 2UZBA 3SW7A 3OCBA 5IQGA 5L3AA 4L00A 3R8ZA 1PKGA 4FT9A 4IACA 4U42A 4XG4A 2C6TA 4U41A 4JNWA 4ACHA 1ND4A 1WAKA 3DAKA 4KKGA 2HY81 3RK7A 5H2UA 3OT3A 3OTVA 4EZ5A 2RG5A 4C4FA 2Z02A 3HRCA 4O22A 4BDJA 2BRMA 1KWPA 2QOHA 3BEAA 3LE6A 3PA4A 3BQCA 3LM0A 5DIAA 4C35A 4IAIA 4LL5A 2XIXA 3VUMA 2PY3A 4FKQA 3KCKA 4FG8A 4Y73A 4BZOA 4EOSA 2JDRA 3W33A 3MSSA 5DHJA 3F3UA 4EOQA 3D7TB 4BN1A 3QGYA 5AR8A 4AGCA 4U40A 3Q52A 5FEEA 4FKOA 3T9IA 3UE4A 2ITWA 4BZDA 4TL0A 4ACGA 5BUIA 3WILA 4EK5A 5DEYA 2WEIA 4JRVA 3UPXA 4FT3A 5IPJA 3JPVA 4EH8A 5CU3A 4ALVA 4EH4A 2PUUA 2VX1A 2WQOA 4IX3A 4JDKA 4O0YA 4QQCA 4BCOA 4H05A 1U46A 1PHKA 3HECA 4D2PA 5JT2A 3NYOA 4QP9A 3LM5A 3H9FA 3QQLA 4U44A 4O96A 2UW6A 3HDMA 3Q4UA 4A7CA 3KXNA 5CAQA 3ORNA 3FBVA 1W82A 1G8SA 2R3HA 3LCOA 2OXDA 2J4ZA 4QO9A 4TY1A 2VRXA 4I24A 4JDHA 4XG7A 4ZY5A 5DMZA 3UDBA 3MYGA 3TKIA 3NAXA 2QI8A 1PRYA 3LJ2A 2XNNA 5HO8A 1YW2A 3ZUTA 4FSRA 5E1SA 4C34A 3U6IA 3RPVA 1WZYA 4BDDA 3FQSA 4K1BA 2QOLA 3ZRLA 2JIIA 4M84A 2BRHA 3NUXA 3FZRA 1U59A 3SVVA 4JI9A 3VQHA 4FT5A 4L52A 3W18A 3PSCA 4LRKA 3TUCA 4RG0A 4WO5A 4ANMA 5B2KA 2B0QA 3VF9A 5J79A 3THBA 4TW9A 1Q41A 4DFXE 2C5XA 1H8FA 2LGCA 3Q2JA 4HW7A 3HRFA 4QYGA 3GC9A 2C30A 2QR8A 3D5WA 3KRJA 4UWBA 3VUHA 5HU3A 5J8IA 2BKZA 3MA6A 5FD2A 1XQZA 3V6SA 2J0IA 2VTRA 4Y8DA 4O7WA 5DT0A 3NNXA 3P78A 3VUTA 3FWQA 5AR3A 2PWLA 3I0OA 3POOA 1J91A 2JLDA 2WQNA 4BR3A 2RG6A 5AFVA 1R78A 3HV6A 1ZMWA 2WTWA 2JKMA 2X2LA 3CXWA 5A6OA 5DFPA 2ZM4A 4O84A 4FG9A 1XH9A 2YCSA 2BPMA 4L3PA 2GQRA 1W84A 2WMQA 4J96A 4AA4A 3ZLWA 2Q83A 2ZV8A 4F1OA 5J5TA 4USFA 3U6HA 3BYOA 3OMVA 4KWPA 2BZKB 3ID6C 3PIZA 4V01A 3FI4A 3N51A 5BPYA 4USEA 5HIEA 1TQPA 4O83A 3DKOA 2QOBA 4FZAB 1XH4A 4LI5A 4LOPA 4KIKB 5I4NA 3U6JA 3PPKA 5DE2A 2WZJA 3GI3A 4IAFA 4DEGA 3ZM9A 1UKIA 5A9UA 4XOZA 2WGJA 3JVRA 3OWJA 4RIOA 3RAHA 4UWYA 4W8EA 1MQ4A 5DRBA 3BU5A 5CANA 4UB7A 1YRPA 1OITA 3FMKA 2YLFA 4A4XA 3G6HA 2BMCA 1J7UA 1E1VA 2WIHA 2FSOX 1ZY4A 3V8TA 1LEZA 3F3WA 2C68A 3Q4TA 4QQ5A 3SDJA 1QPEA 2QODA 4NKSA 3V8WA 5IUGA 5AV3A 3F69A 4JT3A 5CI7A 5J9YA 3MA3A 5EYMA 5I9UA 3UIUA 4XG9A 5CF4A 3W8QA 4DFLA 3RP9A 3V3VA 1Q8WA 2R3FA 4DEIA 1OIYA 4X3FB 4R1YA 2BR1A 3C4WA 3UOHA 2W1FA 4S30A 2HY0A 3E8DA 3AD4A 3QA8A 4FZDB 3NYXA 2GS7A 2J50A 2OI4X 2ZV9A 1ERKA 1V0OA 2OWBA 3IQ7A 4GCJA 2GNJA 4J71A 2ITZA 3QTSA 5CVFA 3MDYA 5BVEA 4XG8A 4U3ZA 1Y8YA 4DCAA 2HXLA 4BHNA 3KY2A 1CKIA 2V55A 5LMKC 2XS0A 1BL6A 2A27A 3HMNA 4RJ7A 4RZWA 2FUMA 4MTAA 3BLQA 1SVGA 1URWA 1WMKA 3OG7A 4LRJA 4C2WA 4YLKA 1CMKE 2JKQA 4KNBA 3WARA 1RQQA 1H4LA 3F5GA 4UEUA 1FVRA 5L8JA 2A0CX 5L2SA 2IW6A 2VO6A 3CQEA 4KIQA 5EI8A 3GBZA 1PXKA 2WO6A 2PZ5A 4L9IA 2J0LA 5JFVA 3PIYA 3VUKA 4Z55A 1QPCA 4K9YA 1WBTA 5FXSA 3D7TA 3MPTA 5IQEA 3CTJA 2PVHA 2UUEA 3WF9A 3DBEA 2R3OA 2ZMCA 4JRNA 4O6EA 4Q9ZA 3ATTA 4C7TA 3MTLA 1JVPP 4PDSA 4E26A 4YJPA 4V0GB 4FF8A 3OCGA 4UN0C 3FXXA 4FTIA 4FTNA 3BEGA 3ZCLA 4Y72A 4EHGA 4FEVA 2DYLA 1VYWA 3HMOA 4FTUA 1WBNA 5DR6A 4ITJA 2X6EA 4ACCA 2ETRA 3SD0A 3O50A 4L67A 3R0TA 3QWJA 4HZRA 4W4XA 4XV2A 2QG5A 1IA8A 4TNDA 3KU2A 1FPUA 3QD3A 3RKBA 4YZCA 5LVOA 2VTIA 1Q8ZA 3FMLA 4AU8A 2G1TA 4ZY4A 1OL5A 3RK9A 5ICPA 3UYTA 4APPA 4IAZA 4GJ2A 4YSJA 4HGTA 3MIYA 3ZHPC 2GNHA 2VTMA 4M12A 1HCLA 3DU8A 4E73A 5D9HA 3PLSA 3VIDA 3PLAE 4H3QA 5JGAA 1LP4A 5K5NA 3Q5IA 4PV0A 3ZMMA 3PWDA 3Q9WA 4NTTA 5FLFA 5IA0A 4IVCA 1ZYSA 3DXNA 4GEOA 4YHJA 3ZFMA 2GNIA 4M97A 1UWHA 4WIHA 4L44A 3C4FA 1XH8A 4FSTA 1OBDA 3MI9A 5D41A 5DR2A 3ZLYA 2QO9A 2VGPA 4RSSA 5EI6A 2HZ4A 4ZLOA 4CLIA 3IPHA 4V05A 4MBIA 2C1BA 4CTCA 3TI1A 4CZYB 2R0IA 4XJ0A 3LLAA 5AEPA 3TM0A 3ALNA 2VX0A 4JDJA 1ZRZA 3SG9A 3KXMA 4RLKA 3R7EA 4GW8A 5J7HA 2C4GA 4DTKA 2XNEA 2Q0NA 4DITA 3NAYA 5M4CA 2O5KA 4M0ZA 3A62A 1KE6A 2ITOA 4BWKA 5CAOA 2BFXA 4ARKA 1B6CB 2BROA 4KIKA 4LL0A 2FVDA 4D4VA 2QKRA 3MTFA 4O21A 4E4NA 3MFTA 4PPAA 3GUBA 3BU6A 4F65A 5GZ9A 2X2MA 2BALA 3MBLA 5IH6A 3V5TA 4CV9A 3DBQA 2PMNX 3AT3A 3L8SA 4X6QC 3VUDA 3QRJA 3TZ8A 3FJQE 3ENHA 1PMUA 2P3GX 1JSTA 4H3BA 4UXQA 3VN9A 3FZSA 4DE4A 3KN5A 3VS4A 2W1IA 4FVRA 5FG8A 2V5QA 4ZK5A 5A4QA 4FNZA 1M2RA 2XKEA 4AE6A 1H1SA 1GZNA 4GFOA 4NTSA 5IQBA 3ACJA 4G3DA 4G9RA 3P1AA 5HO6A 2RF9A 4F0GA 5IMXA 2B9FA 4X3FA 2W99B 4IC8A 5L2WA 3LKMA 2R4BA 2HENA 2VX3A 4IVBA 1Q24A 2C3KA 2JAMA 2W1HA 2W4KA 2Y7JA 3PE1A 3DJ7A 5CXHA 5AV0A 5BVFA 4F64A 5C8KA 3D5UA 4FTRA 4YZDA 3UZPA 5E8WA 4QP1A 5HG7A 5LXMA 2NRUA 2YWPA 2PUNA 4DT8A 3D5VA 3HUCA 3R1SA 3LMIA 3GB2A 5ACKA 5J5SA 4D55A 2XIRA 3POZA 3WF8A 2YZAA 4BCGA 1FOTA 2VO7A 2PZYA 3QHRA 4QQJA 2VWBA 5AJQA 4CKIA 3BELA 4XG6A 3TNWA 2BILB 5KZIA 3P5KA 3IO7A 4ZP5A 5E92A 2WMTA 3NNUA 4EHZA 4I0RA 3WIGA 3F61A 3OW3A 3FMJA 4HNIA 4FE2A 4BBMA 1KE9A 1VR2A 4X0MA 3FI2A 3DJ5A 3G2FA 3C4ZA 3LPBA 4QMZA 4WUNA 4WHZA 4MF1A 2XJ0A 4YC6A 2WMUA 3AXWA 4IXPA 1WBOA 2VWUA 4V0GA 3P08A 4F9AA 3OBJA 1BLXA 2VNWA 3QQFA 1U5QA 1UWJA 4IWPA 3EL8A 3I7CA 4Z9LA 3PXFA 3E3BX 4O1PA 5EYCA 2C6EA 3ROCA 3MH3A 4X21A 3GU6A 2UV2A 3VQUA 3PA3A 5IQCA 2W9ZB 3KCFA 4YZMA 3L8PA 5E8SA 4X6RA 2CGVA 3AT2A 4O82A 4XLIA 4ZY6A 4YLLA 1DAYA 1OI9A 4U6RA 3V5JA 3VS6A 4AS0A 4HZSA 4E8AA 1RDQE 2X8IA 4F9WA 3GCVA 1IAJA 4ASXA 4IB0A 2ZM3A 4F9BA 3E8CA 4IBMA 2J0MB 3EMGA 3W8LA 4RJ4A 4NW6A 3MPMA 4R3CA 5D1JA 4QMNA 3QTXA 3B8QA 3D94A 2C47A 4N6YA 4U8ZA 5ITAA 5CNNA 2HK5A 3RM7A 1DI9A 2UZUE 5I3OA 2YABA 3TV4A 3RNIA 2HW6A 3T8OA 4C4JA 4ZMEA 4M13A 1VYZA 5CAVA 2JIVA 2XZSA 4FEXA 4EEVA 4FKGA 3JR1A 1YHWA 4ITIA 3RWPA 4A9TA 3AC3A 3KRXA 4AP7A 3ZUVA 4BKYA 4O91A 2J9MA 4R1VA 4DHFA 2UW7A 2PMIA 2XEZA 2JGZA 5F9EA 2F2CB 1CM8A 4X3JA 5CT7A 4LV8A 3RTPA 3R00A 4OUCA 3ZEPA 4O7ZA 4FC0A 4UMUA 5E90A 3ALOA 5L6OA 2ACXA 1M2QA 2PU8A 5LMBA 4M68A 4XH6A 4I1ZA 3UVRA 3ZO1A 1DI8A 4GJ3A 4KA3A 4DLIA 4EWQA 2CDZA 3LMGA 3QD4A 4IEBA 3UNZA 5A46A 4PWNA 5K9IA 3DK3A 3A7GA 4F7NA 4ORKA 2RGPA 3FYJX 4WKQA 3KK9A 4MXYA 2IVTA 5TF9A 4C33A 2B4SB 2EWAA 4PPCA 4QRCA 4RFMA 3UGCA 3RHKA 1JKLA 3U54A 2X7FA 3GFEA 3IOPA 4F70A 3HMPA 2CCIA 3R9DA 5BX0A 4JG7A 1H0WA 4JDIA 2HYYA 4MH7A 1H25A 4YPDA 3VULA 2ITXA 5J1VA 4ANSA 2A19B 3LMHA 5IH5A 4YHFA 5EM8A 2XNPA 2WMBA 2OZOA 3NRMA 1M14A 2OFVA 3ORPA 3FMDA 3TIYA 1F3MC 4QNAA 4FR4A 4G6OA 4RA4A 5CQUA 4C02A 5J95A 4BC6A 5M57A 4BKJA 3CPCA 4QMLA 4IAKA 2I0YA 4O27B 1TQMA 2XF0A 3GEQA 5HE2A 4NK9A 4MK0A 1LEWA 3SX9A 4EOKA 5IKWA 3W16A 2IVSA 2RFSA 5E91A 4AW1A 2CGXA 2DWBA 2RFNA 1O6KA 3GU4A 4O2PA 4S31A 4E5AX 3BYUA 3VBQA 1URCA 3EQGA 4CKRA 4J1RA 5AA8A 4NWMA 3L1SA 2CKPA 2ESMA 2G9XA 3BV2A 3Q4CA 4QMPA 3I1AA 4NIFB 3FYKX 1Q4LA 3TXOA 5HVJA 4JS8A 4KRCA 3OT8A 2IJMA 4MNEB 5AUXA 4FL2A 4EKLA 1CSNA 4S34A 3C5UA 3ZLSA 3GU7A 2SRCA 4FTCA 4PX6A 5KMJA 3PYYA 3RNYA 2BTSA 4K18A 4RZVA 2VZ6A 5CY3A 2YM4A 1JKTA 2FSMX 2QKWB 2X39A 2W17A 2XK8A 3TKUA 4UX9A 3FQHA 3NNWA 4A9YA 2EVAA 3QRKA 3R1NA 1ZLTA 4IVDA 5FDPA 2W06A 4I6QA 4GFGA 5IQHA 3V51A 4GU6A 3EQIA 4U3YA 5IEYA 3R83A 3PXRA 3VNTA 4XRLA 4KUJA 2R3MA 5EM6A 3QXOA 5LVLA 5FUTA 2V62A 2VWIA 4A07A 2WMVA 5GHVA 5IUIA 3TG1A 5B2LA 1FBNA 2Z2WA 4TZRA 3G90X 5AP7A 3ZSHA 5KNJA 4MD7E 3QC9A 3NUNA 2BAQA 4IZ5A 4IZAA 3EYGA 4BDFA 5IA4A 3R8PA 3AGLA 2CGWA 4DEEA 3F2NA 3E63A 2O3PA 5IA1A 2C6KA 5JEBA 5ANIA 5E7RA 2WB8A 3B2TA 4WUAA 4I4FA 3LXKA 1M7QA 1Q8UA 5BYLA 5EFQA 5M09A 2HAKA 3KFAA 4NFMA 5EKNA 1REKA 3CIKA 4FKRA 4FKVA 2XK9A 3MB6A 3UOKA 4DAWA 1WBSA 4XS2A 2IWIA 2J6MA 4ZSJA 5E8VA 2PVMA 4UMTA 2J90A 4MWIA 5HLPA 3NUAA 4UBAA 3NNVA 1V1KA 4I4EA 3P4KA 2WQEA 4FV4A 4B8LA 3C9WA 3HGKA 5BMSA 2XMYA 3ORKA 3UG2A 4CMUA 2V7AA 3HP5A 4G3FA 5HCYA 5JGDA 4QP3A 2YISA 4MX9A 4EUTA 2W4OA 4E20A 3QZGA 5DOSA 3PVGA 3HX4A 3WYXA 3NS9A 3RWQA 3TWJA 4UMRA 3E8EA 1W0XC 4YJSA 2B55A 2R3QA 1VZOA 3QYWA 5D7VA 4LM5A 4RQVA 1YQJA 4FSMA 4AOTA 2FH9A 4D1XA 4FKSA 3RCJA 3RPRA 4EJ7A 4MWHA 3U4WA 1QMZA 4Y5HA 3O7LD 4FSUA 3KB7A 2VGOA 3QRIA 5HICA 4X2JA 1YXVA 3LFDA 3KA0A 3R01A 1TKIA 4NZWB 3FPQA 3T3UA 4GIIA 4QMSA 2XRUA 3U4UA 2HIWA 2CNVA 4IWDA 1OKYA 5ANKA 3W2CA 5EW9A 4DF3A 4H3PA 3QRUA 5CSWA 1GY3A 3UOLA 3SG8A 4Z7HA 3D0EA 4FICA 2UVXA 2OW3A 3UTOA 5KMNA 1UV5A 2YIRA 1T45A 3LQ5A 4WOVA 4M67A 4CYJA 4O1OA 3R28A 1YKRA 2FSLX 2Y4PA 5AV1A 4XP0A 1KUTA 3R71A 3FLQA 3H9OA 4O81A 1U4DA 4PPBA 3TJDA 5HVKA 3TNQB 3V5WA 3SXFA 4YTCA 3FQEA 3WF7A 3FHIA 4BHZA 4FTKA 4CFFA 4FL3A 5JGBA 3W2OA 4O0SA 2WNTA 4OTHA 3TUDA 2BRGA 4FTOA 2JITA 1J3HA 4IAYA 1OZ1A 4F08A 5I9XA 2WMWA 3DDQA 4PF4A 4Q5HA 2ZB1A 2XNMA 4EHVA 2BKKA 3Q6WA 2YN8A 2BIYA 3PSBA 3QQHA 3CD8A 4NUSA 3T3VA 4E4LA 3OXIA 4LOQA 4DH1A 2OIDA 4DFUA 1XBBA 4XUFA 3DOGA 2OF4A 5FP6A 2QOQA 3D14A 3AMAA 4LOOA 1NW1A 4RBLA 5CU2A 1WBVA 5DYJA 3ZDUA 5E8YA 2I1MA 3OVVA 4APCA 4LGDA 1NA7A 4FVPA 4NIFA 2GCDA 4ZJIA 1YXTA 2GSFA 5AIRA 4EBWA 4BRXA 5KHWA 3AGMA 2GNGA 5AUWA 4D58A 4M7IA 5B7VA 3AC5A 3KGAA 3DK6A 3JS2A 2YDIA 3OOMA 2HOGA 3FLSA 1SZMA 3P7AA 3R7GA 3COHA 4I6FA 4F6SA 3NUSA 4PL4A 1M17A 4W4WA 3KMWA 3WF5A 4Y83A 4FV5A 2EB3A 2EXEA 2F7XE 4GSBA 3U51A 1VEBA 3OUKA 4YMJA 3GXLA 4YO6A 4MHAA 5DH3A 2B52A 3ODZX 4O2ZA 2J5FA 3NMUF 2Z7RA 2PZPA 3PVUA 4RC4A 3NGAA 5C9CA 3NCGA 3ZH8A 4B7TA 3MVHA 2PE2A 3JVSA 3R63A 4DINA 3FEGA 4JJRA 1R0PA 2XBAA 4EUUA 3V8SA 4EH9A 3HAMA 2PVRA 3B2WA 4O0TA 5CU6A 5C1QB 4EQMA 5AMNA 4EBVA 5F4NA 2C6IA 5FTQA 4F6WA 1LR4A 4JOAA 3QUPA 3MGYA 5CEOA 1RJBA 2YITA 1XJDA 4WNMA 1OPJA 4RJ6A 2P2IA 3HNGA 4QYEA 4IW0A 4KRDA 5J9LA 4IVAA 4X2NA 1IAHA 5DT3A 3UVPA 4CD0A 1P2AA 3ZO4A 5KMMA 3UIXA 3R9RA 1Q62A 1YWRA 2OK1A 2O2UA 1KE5A 3V04A 4CMOA 3Q5ZA 5CQWA 4DFNA 2JC6A 4J53A 4RIWA 2W5AA 5EDPA 4TNBA 3NW6A 4GVAA 3BU3A 4I5MA 3E7VA 5AUVA 2I7QA 1QPDA 2CKOA 2IZSA 3CSVA 1NY3A 4KAOA 5BVKA 5CEPA 3DFAA 3IK3A 3JY0A 3KKVA 4S32A 5JZJA 1EH4A 4YC8A 4O7LA 4ZXTA 4EH7A 3TNPC 2ZMDA 4JG6A 2BFYA 3MV5A 2BCJA 5AP4A 2XNGA 4XV1A 4BTJA 5LARA 4NCTC 3MFSA 1MUOA 5HHWA 4BY9E 2ZV2A 3W55A 2GS2A 2W1CA 1JSUA 1YOLA 3ZO2A 3GC8A 3SQQA 1JWHA 5LCKA 4UV0A 5JRSA 4JX7A 4BYIA 5HBEA 4QPMA 4CT1A 3HA6A 2CHLA 2Q0BA 3VUGA 3GENA 3G51A 3MY5A 5I9ZA 2PUIA 3R9OA 3CCNA 4FK6A 4IB3A 3GCPA 2BRBA 2VN9A 1E1XA 2VTJA 1J1BA 3TV6A 1PF8A 4TWOA 5HBJA 1GJOA 2OIQA 3EKNA 4J52A 4EL9A 4RFZA 4OAVB 4FV1A 3IDPA 2YIXA 3RI1A 4PTGA 1JNKA 3RGFA 2WTKB 5G6VA 5FTOA 3UP7A 4FEQA 3SHEA 3FLWA 3SV0A 3EHAA 4IJPA 4DYMA 4K6ZA 3DLZA 5LCJA 3N4TA 3R6XA 4N0SA 4I0TA 3UMXA 2YCQA 3ULZA 4DH8A 5C4LA 3GT8A 4I94A 3VAPA 4BDKA 4DFYA 2PL0A 3DKFA 4I23A 4ENXA 4FSZA 3I0QA 1W7HA 4DFZE 4ANBA 3E8NA 3EH9A 4JIKA 4NM7A 5D10A 3O51A 3R8LA 5LMKA 2YIQA 1J7IA 3LFCA 2XK6A 2Y4IC 4GRBA 4JQ7A 3TL8A 2IPXA 3SOAA 2XP2A 3RPSA 1PMEA 1CKJA 4YO4A 4V04A 3BGPA 4ZTRA 3MVJA 4G3EA 3ATSA 1ZOHA 4M15A 3DAJA 3UJGA 4UMPA 3UQFA 3S1HA 2ERKA 2RSVA 3OC1A 3FI8A 3PRFA 5HIBA 2W5BA 4O0VA 4F6UA 3COMA 4YJQA 5GJFA 3SLSA 3ACKA 4CYIA 1RW8A 4E7WA 5L2IA 2I40A 1XH5A 2R5TA 2XIKA 4YSMA 2CKQA 1H01A 4K8AA 3CE3A 2W7XA 4UXLA 3F82A 3V6RA 1FMOE 3EL7A 1Q99A 5I0BA 3ET7A 3FMMA 3GOKA 2NO3A 2O64A 4KIOA 5HNGA 2C3JA 2XUUA 4BKZA 3C7QA 5CSXA 4CVAA 4LV5A 1YVJA 3QQGA 5IZFA 4HPUE 2UZVA 2B7AA 2ITUA 2YEXA 1IG1A 4FV9A 4DTBA 1Q61A 4QMOA 3R9NA 1XH6A 3SW4A 2CMWA 2IN6A 2UVZA 5KCVA 3UYSA 4AW0A 4FSNA 3I79A 4J8NA 5I9WA 3CY3A 1GZKA 2JAVA 4RC3A 2X8EA 4JQEA 3P7BA 3K5UA 5HTIA 2BUJA 2J2IB 4FIFA 3CBLA 4WNKA 5EHYA 4B9DA 3HA8A 3SA0A 5EK7A 2ITPA 4CRSA 3FLNC 1YDRE 5HNBA 5IQAA 3SRVB 2ITQA 2W0JA 4L46A 4EJNA 4JAIA 3EFLA 5CNOA 4F09A 3BE2A 5TO8A 3SXSA 3DKGA 3ZZEA 5J9ZA 5TKDA 1IA9A 4C3FA 3QTZA 2E9UA 3KMUA 1A06A 2C5VA 4TTHB 4XHKB 4RIYB 2C0IA 2QD9A 3V01A 4NW5A 3NDMA 2XKFA 3HRBA 1SVEA 2XK3A 2ZAZA 4QP6A 5FBOA 3PFQA 4G9CA 5JSMA 1R3CA 3FSFA 5BNJA 3SGCA 4EORA 4RJ3A 5HG8A 4PP7A 4KSPA 3E88A 2UZEA 2JFLA 3PXKA 4JG8A 4PQNA 2R3GA 4U79A 4OTGA 3TTJA 2UW5A 3R7VA 1OKVA 3A7IA 4O7NA 2Y6OA 4FTLA 4I5PA 3KXHA 3R7YA 5EQEA 3A60A 4NU1A 4AX8A 4ANQA 2UZWE 5BUEA 4ALUA 5EYKA 2WELA 3OWKA 3S3IA 4AW2A 4YJRA 1PXPA 4B8MA 2XYNA 4EH5A 2PE0A 4GL9A 2WU7A 4DH7A 3K2LA 4C59A 5EM5A 4BBEA 4E4MA 1O9UA 1U5RA 3RHXA 4CCUA 2XNOA 3UO6A 5BVDA 4HVGA 5KMLA 2WTJA 4DC2A 3OY3A 3V5PA 5CALA 3O8UA 3ORZA 2X4ZA 2WQMA 4N70A 3G9LX 3DNEA 4O0RA 3W32A 4CCBA 1G8AA 2F49A 3EZVA 2CJMA 4GU9A 5JRQA 2OO8X 1SVHA 4FZFB 4CFXA 4WSYA 4FV3A 3I7BA 3ZEWA 1Y8GA 2CSNA 1KOBA 5HLWA 4GYGA 5HEZA 3ZLXA 1H07A 5ANEA 2GNFA 2P0CA 5IQIA 2IZRA 3FL5A 3Q60A 3MESA 3OP5A 5EYDA 2F9GA 4O0UA 4XG2A 1XBAA 2IVUA 3KK8A 4O7RA 4HGSA 1UA2A 4OTPA 2H6DA 4Y5QA 4PMSA 2H9VA 2XCKA 4PMMA 4ZIMA 3FSKA 2I0EA 3CP9A 4BCHA 3PXQA 2OIBA 3A99A 5DVRA 5IG1A 4DGNA 3UNJA 4P2KA 3EFKA 5AAFA 5CSPA 3C0GA 4CFWA 4AZTA 3OFMA 3GQIA 3M42A 3PG3A 5M08A 2JKOA 4OTWA 5AUUA 3RAKA 3BIZA 4UYAA 4XEYA 2JDVA 2OF2A 3LQ3A 2CN8A 4HJOA 4QOXA 3TIZA 3GCQA 3BWJA 4FEWA 4H39A 4YUQA 3QZIA 4FTJA 4MD9E 3PIXA 3GNIB 4S33A 3HMIA 2VU3A 4RVMA 3FUPA 3CTQA 4FV7A 3SAYA 4ASDA 3AC1A 4U9AA 2W05A 5HO7A 2R9SA 2DS1A 3LHJA 2X0GA 1TQIA 1YI3A 4XV9A 3OROA 2PZRA 2VO0A 4D2WA 4TRLA 4PY1A 3PE2A 1SM2A 3TZ7A 3RMFA 3A8XA 4HCTA 5A14A 1H27A 2H34A 3KULB 4MXOA 3F7ZA 4I5CA 5CYIA 3F2RA 4EOJA 3CEKA 4D1ZA 2OJGA 5H8EA 4BI1A 2CN5A 4FBXA 2CPKE 2VAGA 2O8YA 3IECA 2JKKA 3LFQA 4ZOGA 3QRTA 3PUPA 4FKJA 3CKXA 4HVSA 4MXXA 4D1SA 2YDKA 3ITZA 1XH7A 3K3IA 3A7FA 4W4VA 4LQMA 4BTMA 2AC5A 5CTPA 1Y57A 2HZIA 2JEDA 2W9FB 4BFMA 3PP0A 4F1TA 2BAKA 4FTMA 4DGGA 5CS6A 2PHKA 3LCSA 4DGMA 3QX2A 3ELJA 2BHEA 3T9TA 5HTCA 2CNQA 2C6MA 4WBBB 2YM7A 4PMPA 4ZSGA 4FTQA 4FMQA 3Q2MA 2A2AA 3MFRA 3AG9A 2X9EA 3PPJA 2E9VA 5IA2A 3O8TA 1AD5A 3QKMA 4GVJA 4MF0A 4I92A 4H1MA 4PNKA 3IDCA 2EUFB 3LFBA 4H58A 5AR2A 4ZTSA 4MAOA 3KN6A 4FODA 2QQ7A 4EZ7A 1YI4A 2FGIA 5FXRA 2CCHA 3QALE 4YPSA 5AX3A 2CNUA 1WCCA 4ZS4A 3SRVA 3L9PA 5LVPA 5CEKA 1K9AA 3UIBA 4RVTA 5IA3A 4AFEA 2ZV7A 1ZZ2A 4IIRA 5CU0A 1PMNA 1O6LA 2X6DA 4QP4A 4FNYA 4YGAA 5ETAA 4MBJA 5HNIX 1OBGA 1MRUA 4RIYA 5FXQA 3RALA 1AGWA 5GNKA 3UQCA 4EK8A 4GV1A 2BZHB 3EFJA 3BZ3A 4BF2A 3EYHA 5AADA 1P4OA 2J0JA 3FDNA 3KVWA 3QD2B 5E1EA 3VF8A 3C4EA 4BCQA 4QMYA 4BB4A 5ETIA 3BHYA 4HGEA 2R3LA 4A9RA 1Q3DA 4KS7A 2UW3A 2QLQA 2BDWA 3BPRA 4FGRA 4FT0A 3WZJA 4OW8A 5CVGA 3UZTA 4R7BA 4GT3A 4AT3A 4M14A 3D9VA 2HXQA 2YM3A 3IGOA 2XJ2A 3BYMA 4IFCA 2VWWA 4KD1A 4MXCA 5J87A 3VBXA 5KO1A 4HOKA 1Q8TA 5H3QA 3ZDIA 2PPQA 2X1NA 3GU5A 4GS6A 4D4YA 3WYYA 4F1MA 1YWVA 3ZSIA 3VS3A 4F4PA 4GG5A 4FKTA 3VS5A 3HMMA 2RIOA 2F4JA 3DKCA 2BIKB 4BGQA 5IH4A 5AIKA 3VRZA 4F7SA 1CDKA 1CKPA 3DDPA 4XX9A 3DLSA 4UZHA 4AACA 1QPJA 3R7IA 4BDAA 2H96A 2OKRA 4JBQA 4E1ZA 4XRJA 3ZC6A 4WG4A 3QTRA 3DBCA 2I6LA 2V0DA 5IEXA 5JN2A 3FE3A 2Z7QA 3Q9YA 2VTSA 1OL1A 3GU8A 3VJOA 5J1WA 4XP2A 3AT4A 4F0FA 5C4KA 4U0IA 3QTIA 3AD5A 2UW8A 5TT7A 3Q9ZA 2X8DA 4DFBA 4JQ8A 1YHVA 2UZNA 4BCJA 4BI0A 3G5DA 4EKKA 5CEIA 2RFEA 5K5XA 2VTNA 5L2QA 3W2RA 2ITTA 3U9NA 4C8BA 4FL1A 3HV3A 2QURA 3OY1A 5AUZA 4XMOA 4FK3A 5EQPA 5CASA 4WRGA 5CF6A 1H26A 3LXNA 3SOCA 4D28A 5AAGA 1PXMA 1WFCA 1HOWA 3GCSA 4LMNA 4C0TA 1YXUA 2PK9A 4H36A 3ZBXA 1PYXA 4K0YA 3ULIA 5FBNC 4RX8A 5AWMA 4E6DA 4ERKA 5L8LA 3S95A 3O23A 4RJ8A 4EOIA 3ROYA 2OJFE 4FTAA 4BL1A 3EQCA 1PKDA 3ORLA 3S2PA 2R2PA 2VWXA 2QU5A 5TR6A 2OH0E 2WTDA 1Q5KA 5DN3A 3BCEA 3LZBA 3QHWA 3A61A 2C5YA 2YAAA 3IG7A 5DWRA 2C6OA 3F3TA 3PJ8A 4PDYA 3C13A 3I4BA 3EQRA 5IUHA 2O65A 3R02A 4BDGA 2XIYA 1GZ8A 1ZYLA 4AZVA 4B99A 3AC2A 5KBRA 5AP1A 1OKZA 2YACA 2BHHA 4HYUA 4M69B 5EKOA 4ZMFA 3CKWA 3E93A 5ETFA 5F94A 4H1JA 4J8MA 3TKHA 4EQCA 3P86A 2G2HA 4CTBA 5E8TA 2R64A 3I6WA 3KULA 4LMUA 3R7UA 3R8UA 3DQWA 5JH6A 2OXXA 3FMNA 3OF0A 4JR3A 3CLYA 5HCZA 4B0GA 1HCKA 1BMKA 2ONLC 2Y9QA 5A3XA 2WU6A 1OKWA 4EONA 2WOTA 5JZNA 3C0IA 4GG7A 5L8KA 1H1RA 4M3QA 4K2RA 2ZDTA 4L68A 2PVFA 3TN8A 2QO7A 3F2AA 4Y85A 1ZMUA 5M4UA 2GHGA 3KXGA 4QMUA 1PXNA 4CZTA 2BZJA 3BHUA 3RCDA 2GMXA 3IOKA 3DB8A 4JR7A 4NJ3A 2AUHA 4FV8A 3V5QA 3W10A 3ZRKA 4ANNA 4PL5A 5BMMA 4D2RA 4BVUA 4FV0A 4BCKA 4ZJVA 1R0EA 4C4EA 3VWAA 4TXCA 5HD7A 3K3JA 3EQPA 5LJJA 5HX6A 1U54B 2XA4A 4BDCA 2XCHA 5IA5A 3A2CA 4ZS0A 3IW5A 3DV3A 4RVLA 4DGLC 4YBKA 4GT4A 4YTIA 2XYUA 2FB8A 2C5NA 4UWCA 5IU2A 5GIOE 3E5AA 2VD5A 5I5ZA 2YM8A 4G6NA 4DG3E 4MD8E 3W2SA 2VTPA 1FQ1B 2WEVA 3LFEA 4JBOA 4R7IA 4KB8A 4IADA 4BIDA 2ETKA 3LFNA 4ANLA 5H9BA 5C8NA 4ACDA 4W9XA 5C26A 4Z7GA 1W83A 1Z9XA 4U97A 1OECA 3QA0A 5IMEA 5JFWA 3WF6A 4C4IA 3NUUA 4AGUA 4AT5A 1OM1A 3UC3A 5A6NA 4L53A 4LUDA 3ZSGA 3CTHA 4TT7A 4FX3A 4R5YA 4KABA 3TT0A 3ORIA 4MKCA 1PW2A 3OCTA 1GOLA 3UBDA 1TVOA 1WBWA 3C50A 4ZTHA 2XBJA 1YOJA 5ANOA 3RM6A 4GT5A 5KKRC 5EQYA 1R39A 2XJ1A 2GFCA 5DT4A 4IDVA 3DXPA 4HYSA 3PPZA 3OCSA 4MVFA 3QKLA 3CC6A 3R8MA 5BVNA 4FIIA 2R3JA 3OWPA 1X8BA 3F6XA 5T68A 2A4LA 3FY2A 2UZLA 2YIWA 4RQKA 2FA2A 2XKCA 4IFGA 2Y4IB 3F5UA 4EC9A 4GUEA 4RGJA 4DCEA 2C6DA 4OTDA 5IQDA 2FSTX 4C61A 3FPMA 4NKAA 4BCFA 3DXQA 1O6YA 3QD0A 2I0VA 4FUYA 5DRDA 3DFCB 4BDEA 2IG7A 5CVHA 3ENMA 3I60A 4I93A 3MJ2A 4GUBA 4TKSA 5E8UA 4C3RA 2NNWB 3H3CA 3IDBA 1JKKA 3KVXA 4CG9A 4QPSA 3RZFA 1FVTA 4F7JA 2HWOA 3PY3A 1KSWA 2W96B 5AUYA 1GIJA 3MVMA 1K2PA 5M55A 5JK3A 3ORTA 3VBWA 4D2SA 5FGKA 4AW5A 5K0XA 5EH0A 1J1CA 5LVNA 3ZM4A 4EOOA 3PJ1A 4U80A 3LXLA 3PY0A 4I3ZA 4G5JA 3QZHA 3VS2A 1A48A 4RRVA 3QCSA 4A4OA 3VC4A 2WTVA 4IM3A 4QP2A 2VTHA 5BQ0A 5CLPA 3EIDA 4CFVA 2NRYA 3C51A 5A4TA 1XHAA 3DAEA 4FNXA 4G34A 1BL7A 1W8CA 3L8XA 3ZOSA 4XLVA 3ZTXA 2UW4A 3BV3A 3D5XA 4YJNA 3WOWA 4KINA 3VVHA 1IRKA 2UW0A 3KF4A 4FTTA 3OS3A 3PA5A 4FSQA 4F9YA 2IW9A 3U9CA 1OL6A 4GK4A 3ZXZA 1RE8A 4AFJA 5KBQA 4XYFA 2CKEA 5HCXA 3O7LB 3QAME 4FI1A 4BWPA 3R30A 4OT6A 3ZXTA 3QUDA 4BWXA 2R7BA 2OFUA 3HV7A 1ZOEA 4UYNA 3VS0A 3II5A 3QLGA 4G31A 3IW4A 3EKKA 5A54A 1OIQA 5E9EA 5GINE 3GOPA 3OD6X 2A1AB 3VJNA 3F5XA 5M4FA 4L3JA 3DTWA 3EN5A 3FZTA 4LUEA 3I6UA 5BYZA 2OU7A 1AQ1A 5HE0A 3QTWA 3TTIA 2BZIB 4AQCA 4TWCA 5KUPA 1OIUA 3MIAA 4OLIA 3EQFA 2ZJWA 4OTQA 2W5HA 3QCQA 4I6HA 4IDTA 3RBWA 4CQGA 4MNEA 4AOJA 4R3PA 4BZNA 5M53A 4IZ7A 4A9SA 1Z57A 1STCE 1F0QA 4HGLA 4X2GA 1OUKA 5KE0A 4AWIA 3M1SA 4RMZA 2ETMA 5ANDA 1ZOGA 5AP0A 4EOPA 2FYSA 3BX5A 1XBCA 3JY9A 3E64A 4YHTA 5M06A 4PDOA 4AGDA 3OXTA 3ZO3A 5AR7A 3ODYX 3VS1A 2Z7SA 3GQLA 4MQ1A 3WE8A 1NVSA 2B9JA 2XIZA 1U54A 3MPAA 5AA9A 3SC1A 4D2TA 4M0YA 2YAKA 3GC7A 3KL8A 3BHVA 3U55A 5IF1A 3HV5A 2XEYA 1YDSE 1IASA 1BYGA 3L9NA 4O6LA 3MH1A 4PL3A 5HIDA 3UG1A 2WTCA 4NCTA 3DBFA 4AN2A 5KX8A 4QP8A 4CV8A 3IW7A 1BKXA 3OHTA 5GZAA 3PJ3A 1B39A 2QOKA 3HP2A 1PYEA 3G15A 5AAEA 4AN9A 1I09A 4LGGA 1MP8A 4C57A 4YNOA 4BDHA 5B2MA 4BCPA 2GQSA 3M11A 4L7SA 4QMQA 1T46A 4WG3A 2EXCX 1JPAA 2GTNA 3AQVA 4TYHB 3TDVA 5AV2A 4JXFA 1ZYJA 1FGIA 4M8TA 3WIKA 1ZARA 4TN6A 4DN5A 1WVWA 2DUVA 4YBJA 2OGVA 2VTAA 2NPQA 3KXZA 4FYOA 1PXOA 5K0KA 4C36A 3VBTA 3R21A 5FEDA 5K4IA 3KQ7A 3EB0A 4WBOA 2O63A 4QYYA 3LCTA 4IQ6A 4Z16A 4DG2E 3BHTA 1UNHA 4Q9SA 4PMTA 2PVNA 1WVXA 2QCSA 1XWSA 2QU6A 1XR1A 4OTRA 5AM7A 4AUAA 4BYJA 4N57A 1BUHA 3CPBA 4L43A 3QC4A 4W8DA 4YJUA 4C38A 3NSZA 1S9IA 4HVIA 2H8HA 4CMTA 5D12A 4ANOA 1MRVA 4IZYA 5KZ0A 2LAVA 3S4QA 3IW6A 2WFYA 2G15A 3CQUA 4IWOA 4IM0A 3V5LA 2GNLA 4QTAA 4N4SA 4ASEA 1J7LA 2R3PA 3NVKI 3ANRA 5HESA 4CFNA 4FZ7A 4G1WA 3PWYA 3DCVA 4D4RA 4IH8A 4Q2AA 1VJYA 4GKIA 4DGOA 1GZOA 4ZTNA 5DNRA 3IW8A 2W1EA 1KV1A 2XM9A 3KRLA 3P79A 1G3NA 3D2KA 4XP3A 1KV2A 4X2KA 1BI7A 4FGBA 1FMKA 4I5HA 2PZIA 3QKKA 3FXZA 4RC2A 4CNHA 1BX6A 2R3KA 4DEBA 3SXRA 3H0ZA 4KBKA 2XVDA 4ZSEA 3FV8A 4L8MA 3ZFXA 4MCVA 2R0UA 4GFMA 4HVDA 4ZTLA 3FAAA 5GZ8A 4AXAA 3IGGA 4CKJA 3PTGA 5HZNA 3QCXA 4RWIA 2C3IB 3TNHA 1OL7A 3OOGA 3R1QA 3EWHA 4E6CA 5CZHA 4EH3A 3G6GA 4D5HA 4IC7A 3W2QA 2C69A 3FHRA 4BI2A 4AAAA 4R8QA 3NEWA 4IJ9A 1NVQA 4WA9A 3F3ZA 3UC4A 5AV4A 3H30A 3NCZA 2GPHA 1Y91A 4TWPA 4FA2A 3PXZA 1SMHA 2OBJA 4PTCA 3D83A 2V7OA 2GS6A 2C3LA 1WVYA 3K54A 1JAMA 2GU8A 2GTMA 3OXZA 4HPTE 4RIXB 5AP3A 4RWJA 3O8PA 5BUJA 3AMBA 3BGZA 1K3AA 4QT1A 2CLXA 3ZFYA 2FO0A 3E62A 2BRNA 2REIA 4EHEA 4PP9A 4WD5A 4FYNA 4I41A 2P4IA 4MNFA 5C8MA 3IKAA 2Y6MA 1QL6A 2WHBA 2RL5A 1JOWB 2ZYBA 1DM2A 2VUWA 2G2FA 2WMSA 4C3PA 2PYWA 4CLJA 4OAUC 3JYAA 2C0OA 3SKCA 3BBWA 3A7JA 5JQ8A 4FKIA 4O7YA 1H08A 3CS9A 3PZEA 1ZZLA 1DAWA 1PXJA 1ZWSA 5LQFA 4EOLA 4DG0E 4ZEGA 3HUBA 4MEDA 4J98A 2R3NA 3DT1A 4A9UA 3GC0A 3Q4ZA 4QNYA 5E4HA 2B9IA 2BAJA 3R9HA 4BGGA 4CZUA 4IX6A 3H0YA 4UZDA 3COKA 2QC6A 3RK5A 1KE7A 1NXKA 3HYHA 2VTTA 4CXAA 5I9YA 5CENA 5TE0A 4NFNA 1YXXA 3PG1A 5AP5A 4D2VA 3R2BA 3NPCA 1GAGA 4P5QA 4PRJA 4IMYA 5HTBA 5KHXA 4RFYA 2OG8A 3QUEA 1E9HA 1JKSA 4L3LA 4E4XA 4EYJA 4W4YA 4QQTA 4IWQA 4P90A 4G3CA 4FNWA 3FC1X 3FMHA 3E87A 3VHKA 5DBXA 4LRMA 5DEWA 2J7TA 4OBQA 2QHMA 2YHVA 3HEGA 4BCIA 5IISA 2OZAB 4O0XA 2YM6A 3MY1A 4PTEA 2GHMA 1JSVA 4ONAA 3FLYA 1F5QA 4WT6A 4IHPA 3QL8A 4RPVA 4TYHA 3PY1A 4YNEA 3S0OA 3FI3A 4P5ZA 4EH2A 1OB3A 5FEQA 4FVQA 3FZ1A 3OEFX 2VTLA 3F7WA 2RKUA 4N6ZA 4TWNA 3FMEA 3HVCA 3ORXA 4NH1A 4QD6A 5CXZA 3HL7A 4KIPA 5FRIA 3B8RA 4YP8A 2OSCA 4OTIA 4Y95A 3VBVA 3DGKA 1M52A 2PMLX 3WBLA 3FXWA 3GP0A 4S2ZA 5EOBA 2PVYA 2QOIA 3TJCA 2J5EA 3UNKA 1YWNA 4DBNA 4YLJA 5HKMA 3PXYA 5HG9A 3H10A 3N4UA 4EOMA 3E3PA 1H24A 2VTOA 4AN3A 3U8WA 4OBOA 3R73A 1I44A 2OLCA 5EW8A 3EN4A 3LCKA 5DA3A 4TYIA 4C4HA 2JDSA 2JIUA 4CQEA 3C4XA 4AA5A 4CG8A 3G0EA 1ZMVA 3L9LA 5T3QA 4XBUA 4NL0A 1R1WA 3DJ6A 5I3RA 2B53A 5KMKA 4NEUA 3BYVA 4KBAA 2BTRA 4BGHA 5EW3A 3TEIA 4E5BA 4GH2A 1ZAOA 2KTYA 5J7BA 4NM5A 5ANJA 3MW1A 4CFUA 4EK6A 4JBVA 1OMWA 3D15A 3BE9A 5KMOA 2PVLA 4G17A 4MXAA 3ERKA 3IONA 5BVOA 4K77A 5HD4A 2JDTA 5HE3A 4RA5A 4B6LA 3IS5A 2P2HA 4R6VA 2UVYA 3K5VA 3A7HA 4TYEA 5HE1A 4DH5A 3VO3A 3REPA 4GIHA 3RZBA 2XK4A 4B4LA 1ATPE 4C2VA 2JDOA 2XRWA 3NR9A 4ITHA 4C4GA 1UNLA 1G5SA 3UO5A 1SYKA 3H9RA 3MFUA 4I21A 2WD1A 5IDPA 3CR0A 1H1WA 4WG5A 5A4LA 3VW6A 3QTQA 2QHNA 2AYPA 4UY9A 3EZRA 3NLBA 1WBPA 2AC3A 2WPAA 2WTIA 3QZFA 5H8GA 2B54A 2HWPA 3TACA 1V0PA 4O86A 4O7VA 1APME 4DTAA 3DB6A 5LMAA 3MJ1A 3ETAA 4DLJA 5FQDC 3NYVA 4RIXA 2XM8A 3LIJA 4ZAUA 5M4IA 1P5EA 1L8TA 2J51A 5AR5A 3ZC5A 4JAJA 2W4JA 4WSQA 2EXMA 3FZPA 2W1ZA 4AT4A 5DLSA 4ZTQA 5HORA 4FIGA 2XNBA 5L6WL 4FSYA 2ZB0A 3TZMA 3BBTB 1SNXA 4NT4A 5CWZA 3Q3BA 2E9NA 5DI1A 4M66A 3LVPA 3F66A 3P23A 2Z60A 5BYYA 2UZOA 1REJA 2JBOA 3LOKA 4OGRA 2Z7LA 4JX3A 4YR8A 3BWFA 2EB2A 4GK3A 3G0FA 1QCFA 4KBCA 4O7TA 2YM5A 4IX4A 1H1PA 4CRLA 3WZKA 3BKBA 3PSDA 3QFVA 2Z8CA 3EQDA 5DPVA 1KOAA 4FOBA 3I81A 4DEDA 3O71A 2IVVA 4Z3VA 5HI2A 4L01A 4FOCA 3AC4A 3DK7A 4D4SA 2YJRA 5HU9A 5KKRB 4I22A 2VO3A 4QYHA 5CI6A 2WTKC 2ITYA 2ITNA 3FLZA 4QMWA 4RWLA 2QOCA 2KULA 4HVHA 1IEPA 5AX9A 4RVKA 2HCKA 2X4FA 4XG3A 3EQBA 4JBPA 3UQGA 4MQ2A 5C03A 5M56A 4FEUA 2WOUA 3QX4A 4EK3A 3ZONA 4FV6A 5FP5A 3VBYA 5CF8A 3E7OA 3DBDA 2X7GA 4O0WA 1PXLA 4U7ZA 5D11A 1M7NA 4ASZA 5EI2A 4F9CA 5JKGA 1NVRA 3UMWA 5G1XA 4I20A 5AUTA 3KEXA 2G2IA 2X81A 2QONA 1SNUA 2OZAA 4ACMA 2ERZE 3MB7A 2R7IA 3Q9XA 5LVMA 4ZSAA 2PTKA 1CTPE 3FKNA 2HZ0A 4DT9A 2WQBA 5HLNA 3EN6A 2QOOA 4ZSLA 4YJTA 3R7OA 5FM3A 3VW8A 3R22A 3ZYAA 3LFSA 4D5KA 1IR3A 3UPZA 2XH5A 3EN7A 3FY0A 4NJDA 3UOJA 2GQGA 3F5PA 4OTFA 4QPAA 3C1XA 3HDNA 2ZVAA 4FZ6A 3N4VA 3Q96A 4BBFA 3A4PA 4X3FC 4F63A 3PVBA 3Q53A 1JQHA 1GIIA 3N9XA 3QQKA 4NM3A 3BRBA 2YDJA 1XO2B 1YDTE 2I0HA 3KC3A 4QTBA 4F7LA 3UODA 2HZNA 3HKOA 3I5ZA 3P0MA 3WI6A 4ENYA 3BLHA 1JLUE 3P9JA 3RVGA 2YCFA 2ITVA 3JUHA 4KKHA 4YZ9A 5CEQA 4AZFA 4AE9A 2ZM1A 4HYHA 4U45A 2YA9A 3CGOA 3R04A 4BDBA 4EZ3A 3M2WA 1UU3A 3D7ZA 1YI6A 3FC2A 2IO6A 4R7HA 3DQXA 2ZOQA 5EM7A 3QCYA 1UVRA 4G16A 2QNJA 3CD3A 4A06A 2P33A 1MQBA 5IDNA 2X7OA 4Q5EA 3PZHA 5CU4A 3QF9A 4NSTA 4Y46A 3NIEA 4F99A 5M07A 5FWKK 2EU9A 4JLCA 4ZZNA 3NW5A 1OL2A 4DBXA 1NT2A 2F7ZE 2PSQA 2JD5A 5A4EA 5L6PA 3ZBFA 1B38A 4CFMA 4YU2A 3MH0A 4K11A 2UZDA 4C58A 4RT7A 2VV9A 4O38A 3W1FA 4WNPA 1P4FA 4G5PA 4IB1A 2C1AA 2ONLA 2ZDUA 3FL4A 3NWWA 1ZXEA 3CQWA 3DS6A 2QOFA 3MN3A 3LW0A 5HGIA 3BGQA 4FKLA 5JFSA 1GIHA 2OJIA 4GYIA 4BTFA 5CZIA 1PY5A 4ZLYA 3EN9A 3I5NA 2IZUA 1JBPE 4XOYA 3TZ9A 4D9TA 1PXIA 2E9OA 3NVMB 2OJJA 3O96A 3QQJA 2V22A 3WE4A 3DZQA 5JMSA 3G9NA 4U81A 4LYNA 1YHSA 5F1ZA 4I0SA 4AF3A 4OBPA 3MY0A 3ZU7A 4HCUA 2OICA 3LFFA 4AZEA 5LWNA 3P7CA 3C5IA 4KS8A 2GHLA 4TYJA 4O7SA 5HVYA 5HBHA 5M51A 4XCUA 3OEZA 2X9FA 5AM6A 3GGFA 1Q97A 3QYZA 5E8XA 2YJSA 3O0GA 4EH6A 3EFWA 3BHHA 1H28A 5JFXA 4L6QA 2OXYA 4KSQA 3WZDA 4EYMA 5K3YA 4R77A 3WZUA 1ZY5A 3ANQA 2R3RA 2CLQA 2HW7A 2YLEA 3KMMA 3LQ8A 2VWYA 3QGWA 3EQHA 1OGUA 4QTCA 3OTUA 3DTCA 3NYNA 1M2PA 3TCPA 3ZS5A 5FDXA 2WAJA 3LAUA 5C01A 4PNIA 4UALA 4YJVA 3HV4A 2E2BA 2F57A 5EOLA 1UKHA 3VS7A 2Y8OA 3Q6UA 4QTDA 1YXSA 4G2FA 4QMMA 4TYGA 1OPKA 5T6KA 4QTEA 4CSVA 4YZBA 1OUYA 3NUYA 2R3IA 4PDPA 2PE1A 2PULA 1A9UA 2B9HA 2F2UA 2YCRA 3PJ2A 2JFMA 4YURA 4BIBA 5E8ZA 3KXXA 3R2YA 4EC8A 1FGKA 1Q3WA 3DNDA 4U5JA 4EK4A 4A4LA 3LCDA 4R3RA 3PJCA 4FIEA 4XBRA 4C37A 4DEHA 5DR9A 3TUBA 4QMXA 4NYEA 3Q32A 4P7EA 1YOMA 4WNOA 3QBNA 4C62A 2QG7A 4FIHA 3VUIA 4IANA 1UNGA 5HG5A 4E6AA 4LGHA 2BDJA 3CJFA 4FSWA 5CSVA 4DA5A 4KKEA 2VWVA 3CY2A 2CGUA 3AC8A 3PVWA 2WIPA 3GCUA 2WKMA 3L9MA 1ZYCA 5AP2A 3UIMA 3PP1A 1FINA 4EWHA 3KRWA 3OZ6A 1GNGA 2DQ7X 3FKLA 5GJDA 5TOZA 2QO2A 3NW7A 3PDTA 4GKHA 2VTQA 5BVWA 1LPUA 3WZEA 4L45A 5EDQA 2WMRA 5KMIA 2UZTA 3OWLA 2BDFA 4JVGA 2OH4A 2QVSE 2QR7A 3DA6A 2OJ9A 3R1YA 4BTKA 5FM2A 4D0WA 1ZYDA 1Q8YA 5ACBC 4E3CA 3RINA 1Y6BA 5HOAA 1P14A 4RX7A 4BIEA 2PVJA 4QP7A 4MXZA 2XKDA 4I6BA 1UU9A 3MH2A 4IX5A 3VHEA 1DS5A 5IQFA 4GK2A 2WMXA 4YTFA 5CAPA 3DPKA 3G33A 5CAUA 4J99A 3QU0A 4FKPA 3UO4A 3QWKA 4L42A 2RFDA 2IZTA 4QMTA 5CT0A 3KF7A 5F95A 4J7BA 5LWMA 2W1DA 4WRSA 5CX9A 4XNEA 3QLFA 4DH3A 1Z5MA 3MVLA 4GMYA 3OUNB 5I9VA 2IW8A 3LFAA 5FTGA 1OVEA 4EQUA 1OIRA 1S9JA 5AR4A 5ETCA 3RAWA 2E9PA 1BI8A 4BDIA 5L2TA 3LXPA 1MRYA 2GDOA 4FV2A 5DGZA 3ZRMA 4FKWA 4YC3A 4JL9A 5F20A 4XV3A 4RIWB 5ANGA 2WXVA 3A8WA 4JIAA 2PVKA 4X7QA 4ID7A 4K33A 2HELA 5GIPE 4IB5A 1FVVA 4ZJJA 5CF5A 4FKUA 4RJ5A 2UW9A 5JQ5A 3UP2A 3CGFA 4NM0A 5DG5A 4FIJA 3TNIA 4QYFA 3AMYA 3W2PA 2YWVA 4D0XA 4AOIA 3BLRA 4MYGA 3FKOA 4YJOA 3ZUUA 3ZZWA 4AG8A 3HZTA 4HNFA 2YFXA 2YIYA 3AD6A 4J95A 3TV7A 4CEGA 3QXPA 1H00A 2C6LA 3D2IA 3BYSA 3DY7A 2GFSA 3NX8A 4AA0A 5EHOA 2QLUA 5CEMA 2VWZA 3COIA 5H8BA 3UVQA 4II5A 5M44A 3RAIA 4OT5A 4UMQA 4BCNA 1W98A 4LFIA 2BVAA 3Q04A 3FZOA 4USDA 4AGWA 1PMVA 5D7AA 4P4CA 1H1QA 4IE9A 3F88A 4FG7A 4AZWA 4D9UA 5HQ0A 3JXWA 3R8VA 3S00A 4L7FA 1H0VA 2G01A 1OPLA 3C0HA 1PJKA 3GFWA 3RPYA 4IAAA 1XKKA 3QTUA 3BI6A 2NP8A 3H4JA 4G3GA 3TDWA 2JBPA 1KE8A 1Y6AA 5HX8A 5LOHA 5L4QA 2YZLA 3F9NA 4DEAA 5A4CA 4FUXA 4FT7A 4E5WA 2P55A 4CGAA 2X2KA 4BICA 2XB7A 4PUZA 5EG3A 4ZTMA 3ORMA 4RWKA 5CSHA 4J97A 4QMVA 4ALWA 2O0UA 3KRRA 2C5OA 4U43A 4X2FA 3VRYA 3F3VA 1L3RE 4BCMA 4RX5A 4M69A 3RJCA 3O17A 4W9WA 3D4QA 4R5SA 3LJ1A 5AP6A 4ERWA 2VNYA 2W1GA 3NIZA 3HLLA 3MS9A 3U87A 2PMOX 2F7EE 4HYIA 1V0BA 3L8VA 4YTHA 2J0KA 3EOCA 3GVUA 4TPTA 5EDRA 4HCVA 3E92A 3BQRA 3NZ0A 4MBLA 3HAVA 2XK7A 3LJ0A 3O2MA 4RX9A 1UU7A 3OW4A 4AZSA 3QQUA 4EI4A 2PUPA 3CJGA 4ZLZA 1UU8A 3MWUA 3UZRA 4RLLA 3KREA 4E93A 5C27A 3PRIA 4G6LA 3RPOA 4OR5A 5EHLA 1LUFA 4F0IA 4IM2A 3OBGA
chains in the Genus database with same CATH superfamily
2B1PA 3LLTA 5IEVA 2X0QA 4YZNA 4ZZOA 3PUFC 5B0XA 4LG4A 4E6QA 5K4JA 2Y0AA 3C4CA 2WMAA 3EJ1A 2C0TA 3NUPA 5GJGA 4ZZMA 4R78A 3DZOA 3AOXA 2YERA 3A4OX 4CT2A 2UZBA 3SW7A 3OCBA 5IQGA 5L3AA 4L00A 3R8ZA 1PKGA 4FT9A 4IACA 4U42A 4XG4A 2C6TA 4U41A 4JNWA 4ACHA 1ND4A 1WAKA 3DAKA 4KKGA 2HY81 3RK7A 5H2UA 3OT3A 3OTVA 2X0PA 4EZ5A 2RG5A 4C4FA 2Z02A 3HRCA 4O22A 4BDJA 2BRMA 1KWPA 2QOHA 3BEAA 3LE6A 3PA4A 3BQCA 3LM0A 5DIAA 4C35A 4IAIA 4LL5A 2XIXA 3VUMA 2PY3A 4FKQA 3KCKA 4FG8A 4Y73A 4BZOA 4EOSA 2JDRA 3W33A 3MSSA 5DHJA 3F3UA 4EOQA 3D7TB 4BN1A 3QGYA 5AR8A 4AGCA 4U40A 3Q52A 5FEEA 4FKOA 3T9IA 3UE4A 2ITWA 4BZDA 4TL0A 4ACGA 5BUIA 3WILA 4EK5A 5DEYA 2WEIA 4JRVA 3UPXA 4FT3A 5IPJA 3JPVA 4EH8A 5CU3A 4ALVA 4EH4A 2PUUA 2VX1A 2WQOA 4IX3A 4JDKA 4O0YA 4QQCA 4BCOA 4H05A 1U46A 1XMLA 1PHKA 3HECA 4D2PA 5JT2A 3NYOA 4QP9A 3LM5A 3H9FA 3QQLA 4U44A 4O96A 2UW6A 3HDMA 3Q4UA 4A7CA 3KXNA 5CAQA 3ORNA 3FBVA 1W82A 1G8SA 2R3HA 3LCOA 2OXDA 2J4ZA 4QO9A 4TY1A 2VRXA 4I24A 4JDHA 4XG7A 4ZY5A 5DMZA 3UDBA 3MYGA 3TKIA 3NAXA 2QI8A 1PRYA 3LJ2A 2XNNA 5HO8A 1YW2A 3ZUTA 4FSRA 5E1SA 4C34A 3U6IA 3RPVA 1WZYA 4BDDA 3FQSA 4K1BA 2QOLA 3ZRLA 2JIIA 4M84A 2BRHA 3NUXA 3FZRA 1U59A 3SVVA 4JI9A 3VQHA 4FT5A 4L52A 3W18A 3PSCA 4LRKA 3TUCA 4RG0A 4WO5A 4ANMA 5B2KA 2B0QA 3VF9A 5J79A 3THBA 4TW9A 1Q41A 4DFXE 2C5XA 1H8FA 2LGCA 3Q2JA 4HW7A 3HRFA 4QYGA 3GC9A 2C30A 2QR8A 3D5WA 3KRJA 4UWBA 3VUHA 5HU3A 4I6LA 5J8IA 2BKZA 3MA6A 5FD2A 1XQZA 3V6SA 2J0IA 2VTRA 4Y8DA 4O7WA 5DT0A 3NNXA 3P78A 3VUTA 3FWQA 5AR3A 2PWLA 3NFGB 3I0OA 3POOA 1J91A 2JLDA 2WQNA 4BR3A 2RG6A 5AFVA 1R78A 3HV6A 1ZMWA 2WTWA 2JKMA 2X2LA 3CXWA 5A6OA 5DFPA 2ZM4A 4O84A 4FG9A 1XH9A 2YCSA 2BPMA 4L3PA 2GQRA 1W84A 2WMQA 4J96A 4AA4A 3ZLWA 2Q83A 2ZV8A 4F1OA 5J5TA 4USFA 3U6HA 3BYOA 3OMVA 4KWPA 2BZKB 3ID6C 3PIZA 4V01A 3FI4A 3N51A 5BPYA 4USEA 5HIEA 1TQPA 4O83A 3DKOA 2QOBA 4FZAB 1XH4A 4LI5A 4LOPA 4KIKB 5I4NA 3U6JA 3PPKA 5DE2A 2WZJA 3GI3A 4IAFA 4DEGA 3ZM9A 1UKIA 5A9UA 4XOZA 2WGJA 3JVRA 3OWJA 4RIOA 3RAHA 4UWYA 4W8EA 1MQ4A 5DRBA 3BU5A 5CANA 4UB7A 1YRPA 1OITA 3FMKA 2YLFA 4A4XA 3G6HA 2BMCA 1J7UA 1E1VA 2WIHA 2FSOX 1ZY4A 3V8TA 1LEZA 3F3WA 2C68A 3Q4TA 4QQ5A 3SDJA 1QPEA 2QODA 4NKSA 3V8WA 5IUGA 5AV3A 3F69A 4JT3A 5CI7A 5J9YA 3MA3A 5EYMA 5I9UA 3UIUA 4XG9A 5CF4A 3W0QA 3W8QA 4DFLA 3RP9A 3V3VA 1Q8WA 2R3FA 4DEIA 1OIYA 4X3FB 4R1YA 2BR1A 3C4WA 3UOHA 2W1FA 4S30A 2HY0A 3E8DA 3AD4A 3QA8A 4FZDB 3NYXA 2GS7A 2J50A 2OI4X 2ZV9A 1ERKA 1V0OA 2OWBA 3IQ7A 4GCJA 2GNJA 4J71A 2ITZA 3QTSA 5CVFA 3MDYA 5BVEA 4XG8A 4U3ZA 1Y8YA 4DCAA 2HXLA 4BHNA 3KY2A 1CKIA 2V55A 5LMKC 2XS0A 1BL6A 2A27A 3HMNA 4RJ7A 4RZWA 2FUMA 4MTAA 3BLQA 1SVGA 1URWA 1WMKA 3OG7A 4LRJA 4C2WA 4YLKA 1CMKE 2JKQA 4KNBA 3WARA 1RQQA 1H4LA 3F5GA 4UEUA 1FVRA 5L8JA 2A0CX 5L2SA 2IW6A 2VO6A 3CQEA 4KIQA 5EI8A 3GBZA 1PXKA 2WO6A 2PZ5A 4L9IA 2J0LA 5JFVA 3PIYA 3VUKA 4Z55A 1QPCA 4K9YA 1WBTA 5FXSA 3D7TA 3MPTA 5IQEA 3CTJA 2PVHA 2UUEA 3WF9A 3DBEA 2R3OA 2ZMCA 4JRNA 4O6EA 4Q9ZA 3ATTA 4C7TA 3MTLA 1JVPP 4PDSA 4E26A 4YJPA 4V0GB 4FF8A 3OCGA 4UN0C 3FXXA 4FTIA 4FTNA 3BEGA 3ZCLA 4Y72A 4EHGA 4FEVA 2DYLA 1VYWA 3HMOA 4FTUA 1WBNA 5DR6A 4ITJA 2X6EA 4ACCA 2ETRA 3SD0A 3O50A 4L67A 3R0TA 3QWJA 4HZRA 4W4XA 4XV2A 2QG5A 1IA8A 4TNDA 3KU2A 1FPUA 3QD3A 3RKBA 4YZCA 5LVOA 2VTIA 1Q8ZA 3FMLA 4AU8A 2G1TA 4ZY4A 1OL5A 3RK9A 5ICPA 3UYTA 4APPA 4IAZA 4GJ2A 4YSJA 4HGTA 3MIYA 3ZHPC 2GNHA 2VTMA 4M12A 1HCLA 3DU8A 4E73A 5D9HA 3PLSA 3VIDA 3PLAE 4H3QA 5JGAA 1LP4A 5K5NA 3Q5IA 4PV0A 3ZMMA 3PWDA 3Q9WA 4NTTA 5FLFA 5IA0A 4IVCA 1ZYSA 3DXNA 4GEOA 4YHJA 3ZFMA 2GNIA 4M97A 1UWHA 4WIHA 4L44A 3C4FA 1XH8A 4FSTA 1OBDA 3MI9A 5D41A 5DR2A 3ZLYA 2QO9A 2VGPA 4RSSA 5EI6A 2HZ4A 4ZLOA 4CLIA 3IPHA 4V05A 4MBIA 2C1BA 4CTCA 3TI1A 4CZYB 2R0IA 4XJ0A 3LLAA 5AEPA 3TM0A 3ALNA 2VX0A 4JDJA 1ZRZA 3SG9A 3KXMA 4RLKA 3R7EA 3NFFB 4GW8A 5J7HA 2C4GA 4DTKA 2XNEA 2Q0NA 4DITA 3NAYA 5M4CA 2O5KA 4M0ZA 3A62A 1KE6A 2ITOA 4BWKA 5CAOA 2BFXA 4ARKA 1B6CB 2BROA 4KIKA 4LL0A 2FVDA 4D4VA 2QKRA 3MTFA 4O21A 4E4NA 3MFTA 4PPAA 3GUBA 3BU6A 4F65A 5GZ9A 2X2MA 2BALA 3MBLA 5IH6A 3V5TA 4CV9A 3DBQA 2PMNX 3AT3A 3L8SA 4X6QC 3VUDA 3QRJA 3TZ8A 3FJQE 3ENHA 1PMUA 2P3GX 1JSTA 4H3BA 3VONA 4UXQA 3VN9A 3FZSA 4DE4A 3KN5A 3VS4A 2W1IA 4FVRA 5FG8A 2V5QA 4ZK5A 5A4QA 4FNZA 1M2RA 2XKEA 4AE6A 1H1SA 1GZNA 4GFOA 4NTSA 5IQBA 3ACJA 4G3DA 4G9RA 3P1AA 5HO6A 2RF9A 4F0GA 5IMXA 2B9FA 4X3FA 2W99B 4IC8A 5L2WA 3LKMA 2R4BA 2HENA 2VX3A 4IVBA 1Q24A 2C3KA 2JAMA 2W1HA 2W4KA 2Y7JA 3PE1A 3DJ7A 5CXHA 5AV0A 5BVFA 4F64A 5C8KA 3D5UA 4FTRA 4YZDA 3UZPA 5E8WA 4QP1A 5HG7A 5LXMA 2NRUA 2YWPA 2PUNA 4DT8A 3D5VA 3HUCA 3R1SA 3LMIA 3GB2A 5ACKA 5J5SA 4D55A 2XIRA 3POZA 3WF8A 2YZAA 4BCGA 1FOTA 2VO7A 2PZYA 3QHRA 4QQJA 2VWBA 5AJQA 4CKIA 3BELA 4XG6A 3TNWA 2BILB 5KZIA 3P5KA 3AKLA 3IO7A 4ZP5A 5E92A 2WMTA 3NNUA 4EHZA 4I0RA 3WIGA 3F61A 3OW3A 3FMJA 4HNIA 4FE2A 4BBMA 1KE9A 1VR2A 4X0MA 3FI2A 3DJ5A 3G2FA 3C4ZA 3LPBA 4QMZA 4WUNA 4WHZA 4MF1A 2XJ0A 4YC6A 2WMUA 3AXWA 4IXPA 1ST4A 1WBOA 2VWUA 4V0GA 3P08A 2XANA 4F9AA 3OBJA 1BLXA 2VNWA 3QQFA 1U5QA 1UWJA 4IWPA 3EL8A 3I7CA 4Z9LA 3PXFA 3E3BX 4O1PA 5EYCA 2C6EA 3ROCA 3MH3A 4X21A 3GU6A 2UV2A 3VQUA 3PA3A 5IQCA 2W9ZB 3KCFA 3KIOC 4YZMA 3L8PA 3PFYA 5E8SA 4X6RA 2CGVA 3AT2A 4O82A 4XLIA 4ZY6A 4YLLA 1DAYA 1OI9A 4U6RA 3V5JA 3VS6A 4AS0A 4HZSA 4E8AA 1RDQE 2X8IA 4F9WA 3GCVA 1IAJA 4ASXA 4IB0A 2ZM3A 4F9BA 3E8CA 4IBMA 2J0MB 3EMGA 4BJJB 3W8LA 4RJ4A 4NW6A 3MPMA 4R3CA 5D1JA 4QMNA 3QTXA 3B8QA 3D94A 2C47A 4N6YA 4U8ZA 5ITAA 5CNNA 2HK5A 3RM7A 1DI9A 2UZUE 5I3OA 2YABA 3TV4A 3RNIA 2HW6A 3T8OA 4C4JA 4ZMEA 4M13A 1VYZA 5CAVA 2JIVA 2XZSA 4FEXA 4EEVA 4FKGA 3JR1A 1YHWA 4ITIA 3RWPA 4A9TA 3AC3A 3KRXA 4AP7A 3ZUVA 4BKYA 4O91A 2J9MA 4R1VA 4DHFA 2UW7A 2PMIA 2XEZA 2JGZA 5F9EA 2F2CB 1CM8A 4X3JA 5CT7A 4LV8A 3RTPA 3R00A 4OUCA 3ZEPA 4O7ZA 4FC0A 4UMUA 5E90A 3ALOA 5L6OA 2ACXA 1M2QA 2PU8A 5LMBA 4M68A 4XH6A 4I1ZA 3UVRA 3ZO1A 1DI8A 4GJ3A 4KA3A 4DLIA 4EWQA 2CDZA 3LMGA 3QD4A 4IEBA 3UNZA 5A46A 4PWNA 5K9IA 3DK3A 3A7GA 4F7NA 2XARA 4ORKA 2RGPA 3FYJX 4WKQA 3KK9A 4MXYA 2IVTA 5TF9A 4C33A 2B4SB 2EWAA 4PPCA 4QRCA 4RFMA 3UGCA 3RHKA 1JKLA 3U54A 2X7FA 3GFEA 3IOPA 4F70A 3HMPA 2CCIA 3R9DA 5BX0A 4JG7A 1H0WA 4JDIA 2HYYA 4MH7A 1H25A 4YPDA 3VULA 2ITXA 5J1VA 4ANSA 2A19B 3LMHA 5IH5A 4YHFA 5EM8A 2XNPA 2WMBA 2OZOA 3NRMA 1M14A 2OFVA 3ORPA 3UDSA 3FMDA 3TIYA 1F3MC 4QNAA 4FR4A 4G6OA 4RA4A 5CQUA 4C02A 5J95A 4BC6A 5M57A 4BKJA 3CPCA 4QMLA 4IAKA 2I0YA 4O27B 1TQMA 2XF0A 3GEQA 5HE2A 4NK9A 4MK0A 1LEWA 3SX9A 4EOKA 5IKWA 3W16A 2IVSA 2RFSA 5E91A 4AW1A 2CGXA 2DWBA 2RFNA 1O6KA 3GU4A 4O2PA 4S31A 4E5AX 3BYUA 3VBQA 1URCA 3EQGA 4CKRA 4J1RA 5AA8A 4NWMA 3L1SA 2CKPA 2ESMA 2G9XA 3BV2A 3Q4CA 4QMPA 3I1AA 4NIFB 3FYKX 1Q4LA 3TXOA 5HVJA 4JS8A 4KRCA 3OT8A 2IJMA 4MNEB 5AUXA 4FL2A 4EKLA 1CSNA 4S34A 3C5UA 3ZLSA 3GU7A 2SRCA 4FTCA 4PX6A 5KMJA 3PYYA 3RNYA 2BTSA 4K18A 4RZVA 2VZ6A 5CY3A 2YM4A 1JKTA 2FSMX 2QKWB 2X39A 2W17A 2XK8A 3TKUA 4UX9A 3FQHA 3NNWA 4A9YA 2EVAA 3QRKA 3R1NA 1ZLTA 4IVDA 5FDPA 2W06A 4I6QA 4GFGA 5IQHA 3V51A 4GU6A 3EQIA 4U3YA 5IEYA 3R83A 3PXRA 3VNTA 4XRLA 4KUJA 2R3MA 5EM6A 3QXOA 5LVLA 5FUTA 2V62A 2VWIA 4A07A 2WMVA 5GHVA 5IUIA 3TG1A 5B2LA 1FBNA 2Z2WA 4TZRA 3G90X 5AP7A 3ZSHA 5KNJA 4MD7E 3QC9A 3NUNA 2BAQA 4IZ5A 4IZAA 3EYGA 4BDFA 5IA4A 3R8PA 3AGLA 2CGWA 4DEEA 3F2NA 3E63A 2O3PA 5IA1A 2C6KA 5JEBA 5ANIA 5E7RA 2WB8A 3B2TA 4WUAA 4I4FA 3LXKA 1M7QA 1Q8UA 5BYLA 5EFQA 5M09A 2HAKA 3KFAA 4NFMA 5EKNA 1REKA 3CIKA 4FKRA 4FKVA 2XK9A 3MB6A 3UOKA 3W0OA 4DAWA 1WBSA 4XS2A 2IWIA 2J6MA 4ZSJA 5E8VA 2PVMA 4UMTA 2J90A 4MWIA 5HLPA 3NUAA 4UBAA 3NNVA 1V1KA 4I4EA 3P4KA 2WQEA 4FV4A 4B8LA 3C9WA 3HGKA 5BMSA 2XMYA 3ORKA 3UG2A 4CMUA 2V7AA 3HP5A 4G3FA 5HCYA 5JGDA 4QP3A 2YISA 4MX9A 4EUTA 2W4OA 4E20A 3QZGA 5DOSA 3PVGA 3HX4A 3WYXA 3NS9A 3RWQA 3TWJA 4UMRA 3E8EA 1W0XC 4YJSA 2B55A 2R3QA 1VZOA 3QYWA 5D7VA 4LM5A 4RQVA 1TFFA 3AKKA 1YQJA 4FSMA 4AOTA 2FH9A 4D1XA 4FKSA 3RCJA 3RPRA 3TYKA 4EJ7A 4MWHA 3U4WA 1QMZA 4Y5HA 3O7LD 4FSUA 3KB7A 2VGOA 3QRIA 5HICA 4X2JA 1YXVA 3LFDA 3KA0A 3R01A 1TKIA 4NZWB 3FPQA 3T3UA 4GIIA 4QMSA 2XRUA 3U4UA 2HIWA 2CNVA 4IWDA 1OKYA 5ANKA 3W2CA 5EW9A 4DF3A 4H3PA 3QRUA 5CSWA 1GY3A 3UOLA 3SG8A 4Z7HA 4FJVA 3D0EA 4FICA 2UVXA 2OW3A 3UTOA 5KMNA 1UV5A 2YIRA 1T45A 3LQ5A 4WOVA 4M67A 4CYJA 4O1OA 4O4DA 3R28A 1YKRA 2FSLX 2Y4PA 5AV1A 4XP0A 1KUTA 3R71A 3FLQA 3H9OA 4O81A 1U4DA 4PPBA 3TJDA 5HVKA 3TNQB 3V5WA 3SXFA 4YTCA 3FQEA 3WF7A 3FHIA 4BHZA 4FTKA 4CFFA 4FL3A 5JGBA 1G8JA 3W2OA 4O0SA 2WNTA 4OTHA 3TUDA 2BRGA 3TMOA 4FTOA 3UDTA 2JITA 1J3HA 4IAYA 1OZ1A 4F08A 5I9XA 2WMWA 3DDQA 5BV3A 4PF4A 4Q5HA 2ZB1A 2XNMA 4EHVA 2BKKA 3Q6WA 2YN8A 2BIYA 3PSBA 3QQHA 3CD8A 4NUSA 3T3VA 4E4LA 3OXIA 4LOQA 4DH1A 2OIDA 4DFUA 1XBBA 4XUFA 3DOGA 2OF4A 5FP6A 2QOQA 3D14A 3AMAA 4LOOA 1NW1A 4RBLA 5CU2A 1WBVA 5DYJA 3ZDUA 5E8YA 2I1MA 3OVVA 4APCA 4LGDA 1NA7A 4FVPA 4NIFA 2GCDA 4ZJIA 1YXTA 2GSFA 2X0OA 5AIRA 4EBWA 4BRXA 5KHWA 3AGMA 3BLAA 2GNGA 5AUWA 4D58A 4M7IA 5B7VA 3AC5A 3KGAA 3DK6A 3JS2A 2YDIA 3OOMA 2HOGA 3FLSA 1SZMA 3P7AA 3R7GA 3COHA 4I6FA 4F6SA 3NUSA 4PL4A 1M17A 4W4WA 3KMWA 3WF5A 4Y83A 4FV5A 2EB3A 2EXEA 2F7XE 4GSBA 3U51A 1VEBA 3OUKA 4YMJA 3GXLA 4YO6A 4MHAA 5DH3A 2B52A 3ODZX 4O2ZA 2J5FA 3NMUF 2Z7RA 2PZPA 3PVUA 4RC4A 3NGAA 5C9CA 3NCGA 3ZH8A 4B7TA 3MVHA 2PE2A 3JVSA 3R63A 4DINA 3AKJA 4JJRA 1R0PA 3FEGA 2XBAA 4EUUA 3V8SA 4EH9A 3HAMA 2PVRA 3B2WA 4O0TA 5CU6A 5C1QB 4EQMA 5AMNA 4EBVA 5F4NA 2C6IA 5FTQA 4F6WA 1LR4A 4JOAA 3QUPA 3MGYA 5CEOA 1RJBA 2YITA 1XJDA 4WNMA 1OPJA 4RJ6A 2P2IA 3HNGA 4QYEA 4IW0A 4KRDA 5J9LA 4IVAA 4X2NA 1IAHA 5DT3A 3UVPA 4CD0A 1P2AA 3ZO4A 5KMMA 3UIXA 3R9RA 1Q62A 1YWRA 2OK1A 2XAOA 2O2UA 1KE5A 3V04A 4CMOA 3Q5ZA 5CQWA 4DFNA 2JC6A 4J53A 4RIWA 2W5AA 5EDPA 4TNBA 3NW6A 4GVAA 3BU3A 4I5MA 3E7VA 5AUVA 2I7QA 1QPDA 2CKOA 2IZSA 3CSVA 1NY3A 4KAOA 5BVKA 5CEPA 3DFAA 3IK3A 3JY0A 3KKVA 4S32A 5JZJA 1EH4A 4YC8A 4O7LA 4ZXTA 4EH7A 3TNPC 2ZMDA 4JG6A 2BFYA 3MV5A 2BCJA 5AP4A 2XNGA 4XV1A 4BTJA 5LARA 4NCTC 3MFSA 1MUOA 5HHWA 4BY9E 2ZV2A 3W55A 2GS2A 2W1CA 1JSUA 1YOLA 3ZO2A 3GC8A 3SQQA 1JWHA 5LCKA 4UV0A 5JRSA 4JX7A 4BYIA 5HBEA 4QPMA 4CT1A 3HA6A 2CHLA 2Q0BA 3VUGA 3GENA 3G51A 3MY5A 5I9ZA 2PUIA 3R9OA 3CCNA 4FK6A 4IB3A 3GCPA 2BRBA 2VN9A 1E1XA 2VTJA 1J1BA 3TV6A 1PF8A 4TWOA 5HBJA 1GJOA 2OIQA 3EKNA 4J52A 4EL9A 4RFZA 4OAVB 4FV1A 3IDPA 2YIXA 3RI1A 4PTGA 1JNKA 3RGFA 2WTKB 5G6VA 5FTOA 3UP7A 4FEQA 3SHEA 3FLWA 3SV0A 3EHAA 4IJPA 3W0NA 4DYMA 4K6ZA 3DLZA 5LCJA 3N4TA 3R6XA 4N0SA 4I0TA 3UMXA 2YCQA 3ULZA 4DH8A 5C4LA 3GT8A 4I94A 3VAPA 4BDKA 4DFYA 2PL0A 3DKFA 4I23A 4ENXA 4FSZA 3I0QA 1W7HA 4DHJA 4DFZE 4ANBA 3E8NA 3EH9A 4JIKA 4NM7A 5D10A 3O51A 3R8LA 5LMKA 2YIQA 1J7IA 3LFCA 2XK6A 2Y4IC 4GRBA 4JQ7A 3TL8A 2IPXA 3SOAA 2XP2A 3RPSA 1PMEA 1CKJA 4YO4A 4V04A 3BGPA 4ZTRA 3MVJA 4G3EA 3ATSA 1ZOHA 4M15A 4O4BB 3DAJA 3UJGA 4UMPA 3UQFA 3S1HA 2ERKA 2RSVA 3OC1A 3FI8A 3PRFA 5HIBA 2W5BA 4O0VA 4F6UA 3COMA 4YJQA 5GJFA 3SLSA 3ACKA 4CYIA 1RW8A 4E7WA 5L2IA 2I40A 1XH5A 2R5TA 2XIKA 4YSMA 2CKQA 1H01A 4K8AA 3CE3A 2W7XA 4UXLA 3F82A 3V6RA 1FMOE 3EL7A 1Q99A 5I0BA 3ET7A 3FMMA 3GOKA 2NO3A 2O64A 4KIOA 5HNGA 2C3JA 2XUUA 4BKZA 3C7QA 5CSXA 4CVAA 4LV5A 1YVJA 3QQGA 5IZFA 2IF8A 4HPUE 2UZVA 2B7AA 2ITUA 2YEXA 1IG1A 4FV9A 4DTBA 1Q61A 4QMOA 3R9NA 1XH6A 4O4EA 3SW4A 2CMWA 2IN6A 2UVZA 5KCVA 3UYSA 4AW0A 4FSNA 3I79A 4J8NA 5I9WA 3CY3A 1GZKA 2JAVA 4RC3A 2X8EA 4JQEA 3P7BA 3K5UA 5HTIA 2BUJA 2J2IB 4FIFA 3CBLA 4WNKA 5EHYA 4B9DA 3HA8A 3SA0A 5EK7A 2ITPA 4CRSA 3FLNC 1YDRE 5HNBA 5IQAA 3SRVB 2ITQA 2W0JA 4L46A 4EJNA 4JAIA 3EFLA 5CNOA 4F09A 3BE2A 5TO8A 3SXSA 3DKGA 3ZZEA 5J9ZA 5TKDA 1IA9A 4C3FA 3QTZA 2E9UA 3KMUA 1A06A 2C5VA 4TTHB 4XHKB 4RIYB 2C0IA 2QD9A 3V01A 4NW5A 3NDMA 2XKFA 3HRBA 1SVEA 2XK3A 2ZAZA 4QP6A 5FBOA 3PFQA 4G9CA 5JSMA 1R3CA 3FSFA 5BNJA 3SGCA 4EORA 4RJ3A 5HG8A 4PP7A 4KSPA 3E88A 2UZEA 2JFLA 3PXKA 4JG8A 4PQNA 2R3GA 4U79A 4OTGA 3TTJA 2UW5A 3R7VA 1OKVA 3A7IA 4O7NA 2Y6OA 4FTLA 4I5PA 3KXHA 3R7YA 5EQEA 3A60A 4NU1A 4AX8A 4ANQA 2UZWE 5BUEA 4ALUA 5EYKA 2WELA 3OWKA 3S3IA 4AW2A 4YJRA 1PXPA 4B8MA 2XYNA 4EH5A 2PE0A 4GL9A 2WU7A 4DH7A 3K2LA 4C59A 5EM5A 4BBEA 4E4MA 2XALA 1O9UA 1U5RA 3RHXA 4CCUA 2XNOA 3UO6A 5BVDA 4HVGA 5KMLA 2WTJA 4DC2A 3OY3A 3V5PA 5CALA 3O8UA 3ORZA 2X4ZA 2WQMA 4N70A 3G9LX 3DNEA 4O0RA 3W32A 4CCBA 1G8AA 2F49A 3EZVA 2CJMA 4GU9A 5JRQA 2OO8X 1SVHA 4FZFB 4CFXA 4WSYA 4FV3A 3I7BA 3ZEWA 1Y8GA 2CSNA 1KOBA 5HLWA 2AQXA 4GYGA 5HEZA 3ZLXA 1H07A 5ANEA 2GNFA 2P0CA 5IQIA 2IZRA 3FL5A 3Q60A 3MESA 3OP5A 5EYDA 2F9GA 4O0UA 4XG2A 1XBAA 2IVUA 3KK8A 2AEGA 4O7RA 4HGSA 1UA2A 4OTPA 2H6DA 4Y5QA 4PMSA 2H9VA 2XCKA 4PMMA 4ZIMA 3FSKA 2I0EA 3CP9A 4BCHA 3PXQA 2OIBA 3A99A 5DVRA 5IG1A 4DGNA 3UNJA 4P2KA 3EFKA 5AAFA 5CSPA 3C0GA 4CFWA 4AZTA 3OFMA 3GQIA 3M42A 3PG3A 5M08A 2JKOA 4OTWA 5AUUA 3RAKA 3BIZA 4UYAA 4XEYA 2JDVA 2OF2A 3LQ3A 2CN8A 4HJOA 4QOXA 3TIZA 3GCQA 3BWJA 4FEWA 4H39A 4YUQA 3QZIA 4FTJA 4MD9E 3PIXA 3GNIB 4S33A 3HMIA 2VU3A 4RVMA 3FUPA 3CTQA 4FV7A 3SAYA 4ASDA 3AC1A 4U9AA 2W05A 5HO7A 2R9SA 2DS1A 3LHJA 2X0GA 1TQIA 4DHZA 1YI3A 4XV9A 3OROA 2PZRA 2VO0A 4D2WA 4TRLA 4PY1A 3PE2A 1SM2A 3TZ7A 3RMFA 3A8XA 4HCTA 5A14A 1H27A 2H34A 3KULB 4MXOA 3F7ZA 4I5CA 5CYIA 3F2RA 4EOJA 3CEKA 4D1ZA 2OJGA 5H8EA 4BI1A 2CN5A 4FBXA 2CPKE 2VAGA 2O8YA 3IECA 2JKKA 3LFQA 4ZOGA 3QRTA 3PUPA 4FKJA 3CKXA 4HVSA 4F78A 4MXXA 4D1SA 2YDKA 3ITZA 1XH7A 3K3IA 3A7FA 4W4VA 4LQMA 4BTMA 2AC5A 5CTPA 1Y57A 2HZIA 2JEDA 2W9FB 4BFMA 3PP0A 4F1TA 2BAKA 4FTMA 4DGGA 5CS6A 2PHKA 3LCSA 4DGMA 3QX2A 3ELJA 2BHEA 3T9TA 5HTCA 2CNQA 2C6MA 4WBBB 2YM7A 4PMPA 4ZSGA 4FTQA 4FMQA 3Q2MA 2A2AA 3MFRA 3AG9A 2X9EA 3PPJA 2E9VA 5IA2A 3O8TA 1AD5A 3QKMA 4GVJA 4MF0A 4I92A 4H1MA 4PNKA 3IDCA 2EUFB 3LFBA 4H58A 5AR2A 4ZTSA 4MAOA 3KN6A 4FODA 2QQ7A 4EZ7A 1YI4A 2FGIA 5FXRA 2CCHA 3QALE 4YPSA 5AX3A 2CNUA 1WCCA 4ZS4A 3SRVA 3L9PA 5LVPA 5CEKA 1K9AA 3UIBA 4RVTA 5IA3A 4AFEA 2ZV7A 1ZZ2A 4IIRA 5CU0A 1PMNA 1O6LA 2X6DA 4QP4A 4FNYA 4YGAA 5ETAA 4MBJA