2HZ0A

Abl kinase domain in complex with nvp-aeg082
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
265
structure length
265
Chain Sequence
DKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Structural biology contributions to the discovery of drugs to treat chronic myelogenous leukaemia.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2hz0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2hz0A01
3WZDA 1SNUA 1OUYA 4QNAA 1X8BA 4TWCA 5BYZA 3W18A 2QURA 4YJPA 3AT4A 2QCSA 4RJ4A 3QCXA 4DGOA 4Y5HA 3JY9A 5H9BA 5J9ZA 1FGKA 5EM6A 3LFAA 1AQ1A 4O22A 5E8WA 3ALOA 4OTIA 2FYSA 4NCTA 3NPCA 4ENXA 4ID7A 5T68A 1MQBA 2C69A 1IG1A 1UU9A 3HP5A 4WUNA 4XG8A 4D28A 5EHOA 3Q52A 3TDWA 3R7VA 2E9UA 2WTKB 1JNKA 3SHEA 3H0YA 4X0MA 1M52A 4FV7A 2XZSA 3C0HA 3KK8A 3UO6A 4GEOA 3ZO3A 5B2KA 2B52A 5L2IA 1RW8A 3BPRA 2WB8A 3HV7A 3ALNA 2Y4IB 3HVCA 1URCA 4AU8A 5HD4A 1XO2B 5AR4A 4U6RA 4LV5A 4CNHA 4XBRA 1CSNA 3IQ7A 3QFVA 3ZO2A 3OWKA 1GZ8A 3PXQA 4FNXA 1SYKA 2OXDA 4NJ3A 4HVDA 2VNWA 5D1JA 5IUGA 4R7BA 4XV1A 4FKRA 2NPQA 5LMKA 3HMNA 2PVNA 4I5HA 4CTCA 4QMNA 3HNGA 1PXPA 1YI3A 1NXKA 4NIFA 5BYYA 2YM8A 5HD7A 3TN8A 3ATSA 2H9VA 1GZNA 4GRBA 3UG2A 4QMUA 4E6QA 1SVGA 3EN4A 4BKJA 4L6QA 4CVAA 4PL5A 3ZSHA 3SOCA 4S30A 2HWOA 1YWRA 4FVPA 4M8TA 5JSMA 4JNWA 2F57A 3ORPA 3UQGA 4QMPA 4GFOA 5EDQA 1U59A 3FZ1A 3KFAA 2WTIA 2RSVA 3RNYA 4CFMA 2PULA 1OKYA 4LGHA 1TQIA 3PYYA 3V01A 4TYHB 4Z16A 4CG9A 4GFMA 1VZOA 3MB6A 2XMYA 5CEOA 2C0OA 4V05A 4QMZA 1XH6A 3RKBA 5JQ5A 4M7IA 3GGFA 4I5CA 5CASA 2PU8A 4ZTNA 3LFQA 4YJSA 3A7JA 2W1CA 3NSZA 2YM3A 3WE4A 2XJ2A 4IAIA 3LFCA 3OCGA 2E9OA 4FC0A 2ZB1A 4AFJA 4O0YA 4DITA 3COIA 4YZ9A 1YHVA 3QHRA 5FQDC 4XX9A 5HX8A 5AP3A 2WGJA 5JK3A 1WVYA 1Y91A 3ACKA 3SW4A 3S95A 2WIHA 4FTLA 3VF9A 5CF6A 3QTUA 3CQEA 4B4LA 5FXRA 4MF0A 5I4NA 4MQ2A 4QMYA 3ZS5A 4RLKA 4MXYA 2Z2WA 3UZPA 4QTEA 3TG1A 4C0TA 3CKWA 2WU6A 3NAXA 5HE3A 5LJJA 5IA2A 2AUHA 5DR2A 3ZDIA 1H1WA 3ZBFA 3D0EA 4EKKA 2EXMA 2WTJA 5CAQA 3C5IA 3DXPA 2FH9A 3BI6A 3I4BA 2HW7A 5J87A 4OW8A 3R9HA 3ZZEA 3C7QA 5LCKA 2QO9A 3VQUA 3W8QA 4EH6A 1YQJA 2PMLX 5EDRA 2ZV7A 1QPJA 3KXHA 5JFSA 3U6IA 3AQVA 4GIIA 5K3YA 3THBA 3VUHA 2CNUA 4O7SA 3QZGA 3GB2A 5CEQA 3V5WA 1XJDA 3C4XA 4X2NA 4IAAA 1JBPE 1W98A 4RBLA 4MQ1A 4OTPA 3TV6A 2Q0BA 1U46A 2HZNA 3MY5A 4PTEA 4EOIA 3UOKA 2GHMA 3BLQA 3FSFA 4TRLA 5BMSA 5CENA 4CQGA 3PVWA 5M44A 3KMWA 2IN6A 3RAHA 3BRBA 3F9NA 4BI1A 3M2WA 3T3VA 4W4YA 3EL8A 3UIMA 4B8LA 3FY2A 1Y6BA 3BYOA 1YOLA 3LQ8A 4TYJA 1A9UA 4ZAUA 2BRBA 3HMPA 4F63A 5IA1A 3HYHA 3ACJA 5FTOA 5AAGA 3GU4A 5AV0A 3MB7A 4RVTA 2IW8A 1XH9A 1ZOEA 4KKHA 2WTDA 3DNEA 3KXMA 2QHNA 4H39A 3NZ0A 4C58A 1TQPA 2GNGA 3C13A 5BVKA 3BYSA 5CAOA 4CMUA 2WTCA 5LVNA 2V0DA 5AFVA 4XRJA 4XV3A 2A0CX 2B0QA 3NS9A 3CY2A 3ZLXA 2JC6A 4BICA 4RJ3A 4USEA 3E8DA 4FT9A 4K8AA 3QUPA 4CV8A 4MNFA 2UZVA 5J7HA 3RCDA 1EH4A 2YERA 3PLSA 1YOJA 2Z7SA 3FXXA 4N0SA 5CEIA 2XBJA 4JLCA 3KY2A 4FL1A 1SNXA 4F9AA 4ZMFA 4OBPA 2QI8A 2V5QA 2V7OA 1YHWA 4IQ6A 1OIRA 2J2IB 3MVLA 4FIIA 4QMWA 5DR9A 2CNVA 4PQNA 4QD6A 3C51A 1M7NA 4CMOA 5HZNA 5JKGA 5KKRC 5HOAA 4FV9A 3WF8A 4ACGA 4RIYB 3LJ1A 3AC8A 4GUBA 5CVHA 4JX7A 5HI2A 3QUDA 4RJ7A 3R7IA 4YTFA 4GG7A 5CS6A 3MH1A 1WBSA 4IC7A 4M15A 2HAKA 2V55A 1MQ4A 4IAZA 4V01A 3FEGA 2CGWA 2UW3A 3CGOA 4ANNA 1PMUA 2RFSA 4DEDA 2XYNA 3C5UA 4FTTA 4GJ2A 3HV5A 3GOKA 1ZZLA 5AP0A 4TPTA 4YC8A 3IW7A 5G6VA 2JKOA 1HCKA 4UALA 4JRVA 2C5YA 5HE0A 5L2WA 1YXUA 2B53A 3OTUA 4AT4A 3CP9A 3H4JA 1OKZA 3DA6A 3FZRA 3JVRA 2IZUA 5M51A 2WMXA 3CIKA 2C6TA 3G0EA 4Z7GA 4RQKA 3UVPA 1ZLTA 5F9EA 5DA3A 2X8DA 2PZYA 2QOQA 4P5QA 5H3QA 3C0GA 3JYAA 3WOWA 5HLWA 1PY5A 4IVAA 4IMYA 4PNKA 3DLSA 3FKLA 4DH3A 3PIXA 3M11A 4O0RA 4W4WA 4D9TA 4FTQA 2ESMA 5DR6A 3TWJA 2O0UA 4XJ0A 2E9VA 4O96A 4OTFA 4FSNA 3G0FA 5EFQA 5I3OA 3ZMMA 3EQPA 2W05A 4PRJA 4QMVA 4R77A 5DH3A 5F4NA 3BGPA 4PP7A 2IVUA 4ASXA 5IEYA 4NM7A 2WMVA 2OZAB 1YDTE 2OW3A 3HKOA 4QYFA 4F9BA 4HVGA 3O2MA 4I93A 2ZV2A 4OTGA 1MRUA 2GS6A 4OTDA 3UE4A 2BFYA 4FKJA 4G3FA 4DG0E 3BWFA 4OTRA 4AGDA 3FXWA 3G15A 3WILA 3BX5A 1LEZA 2I0YA 3U54A 3AGMA 4RZVA 4O7VA 2OO8X 5K4JA 5KHWA 4HVSA 4AQCA 2JDTA 5AA8A 2WQMA 4HGSA 2XJ1A 3FYKX 3KKVA 3L1SA 5GHVA 3RPOA 4DFUA 5M09A 4N70A 4BGQA 2FSMX 4OAUC 4I5PA 1UWHA 3BV2A 5BVFA 1OVEA 3BHUA 3D7TA 2J0JA 2QOKA 2KULA 3HGKA 4BBEA 4BTKA 5FP6A 3IW5A 4ASZA 4U9AA 4KABA 3G2FA 3V5LA 4RFMA 1R0EA 4FTKA 4HNFA 4XG6A 2OIBA 4CT1A 4EC8A 2VN9A 3QTRA 4IXPA 2OJFE 2GHGA 3GCQA 3O8UA 1YDSE 4L8MA 3BE2A 3LOKA 3NW6A 4ALWA 3M42A 4FSZA 4PTCA 3MFUA 1XH4A 2PVJA 3GCVA 3QWJA 5ANJA 5HCZA 1PXNA 3UMWA 3ENHA 4O86A 3QQHA 3LLTA 4G9RA 1PKDA 3KULA 4L67A 4TTHB 4B7TA 1L3RE 2X4FA 2GQGA 2W1IA 4EQCA 5L8KA 2BROA 1YXSA 4IJPA 4FVRA 3WZEA 3CTJA 1E9HA 2JFLA 2XNBA 1FMOE 2XIXA 4JBVA 2W4KA 3VS0A 2GSFA 3QZIA 4FUXA 2JKMA 3BHVA 4O21A 2RFEA 3G9NA 4FG9A 3OVVA 5AV2A 4FTOA 3Q9YA 2XIZA 4D55A 5DG5A 5A6OA 2ITTA 3RALA 5HE1A 2R3JA 3CEKA 4I4FA 1WBOA 2P0CA 2PHKA 3OF0A 2BPMA 1K9AA 1YDRE 2C4GA 2AYPA 5BX0A 2PVKA 2ZAZA 4XV2A 1E1XA 1M2PA 2OXXA 4TYGA 2OF2A 3PZHA 5I9YA 4B8MA 5J1WA 2CLQA 2DYLA 1K2PA 1ZYDA 3AG9A 4U43A 5EI6A 4D4YA 3IOKA 5CU6A 3UTOA 5A4QA 1M17A 5B7VA 2YDJA 2P55A 5C03A 4J52A 1B38A 3K3JA 4A07A 2WIPA 4O82A 5EW9A 3VC4A 1DS5A 5T6KA 5H8GA 2WPAA 4O7WA 1G5SA 2GFSA 2WNTA 4RJ8A 4FT3A 4IW0A 4ZY6A 4ASEA 5IH4A 3F3VA 1R0PA 4RZWA 4IWOA 3UNKA 3HMOA 3CD8A 2ETRA 5CVFA 4DG3E 3F7ZA 3LPBA 3F2AA 4MH7A 1ATPE 2RG5A 4EYMA 4K11A 2QOOA 2ZMCA 5AAFA 3KXGA 2PZRA 4YBJA 1JVPP 5FWKK 3HV3A 2OSCA 2X7GA 3G33A 4R3PA 3VWAA 3DKCA 3ZC5A 2O3PA 1UVRA 4MKCA 3GT8A 5BYLA 4O7ZA 4IC8A 5C9CA 3T9TA 3REPA 5EH0A 5HO8A 2X7OA 3SC1A 3TKHA 4CLJA 5IA0A 4WO5A 4JXFA 1PMNA 4IDVA 3VBWA 4WNPA 1W84A 3EQGA 4IB3A 2YIQA 3VBXA 2E9NA 4OBOA 2F2CB 3GC7A 4X2KA 4ZTSA 4QP7A 5ANIA 1W8CA 4IVBA 5B0XA 3RPRA 3TL8A 5I9XA 3VQHA 3UQCA 4WRSA 2Y9QA 4ZSEA 4DGLC 4DT8A 1PRYA 3S2PA 4UBAA 4FT0A 4WSQA 4F08A 2FO0A 4ZOGA 1V0OA 4XEYA 2ZDTA 2C68A 1H25A 5LMBA 3MPMA 3A60A 2R3LA 1H28A 2HY81 1GJOA 1YOMA 4BB4A 5L2QA 4TL0A 3FI8A 1DM2A 4GT5A 5E91A 4JIAA 4FZFB 4H58A 1QPDA 5HO7A 5DYJA 4OTWA 3HUCA 4AT3A 4WHZA 4QMMA 1CTPE 3FMJA 1Q62A 2UW9A 3MV5A 2GNIA 3OD6X 2QVSE 2XNPA 4O7TA 4XUFA 4YZNA 5FEDA 3D5XA 4WG5A 4CCUA 3CC6A 5DNRA 5GZAA 4LGGA 1PJKA 1PXJA 2J5EA 3QGWA 3E7VA 3UNJA 2X81A 3OT8A 3FZTA 2W5AA 5IMXA 4O7NA 2JAMA 2GU8A 3PZEA 5HE2A 2ZB0A 2XNEA 3MH3A 4RX7A 4N6YA 5EI2A 4AZSA 4FSWA 5H8EA 5AR3A 1OECA 5IF1A 5AV4A 3R8VA 1Y8GA 2IVSA 4L3JA 3CSVA 2JKKA 5EYMA 3FMLA 4YTCA 4YO4A 5L6WL 3ORKA 4EEVA 4H1MA 4BDHA 4F7LA 3FE3A 1PW2A 3PWDA 3PXFA 4FICA 5E92A 4YZMA 1TKIA 3FC1X 4O2PA 2OLCA 4D58A 4JOAA 2O8YA 4U0IA 3IG7A 5F20A 2E2BA 4R7IA 4A06A 3TZ7A 3WYYA 4R6VA 4G3DA 2JEDA 2VV9A 3L8PA 3BBTB 3OUKA 4U5JA 4XP2A 3R8UA 3VW6A 4A9TA 1FPUA 1J7LA 4QQJA 5G1XA 3H30A 5J79A 3QKLA 5FXSA 3FPMA 4RWLA 3QBNA 1VYZA 4G2FA 5DGZA 4A7CA 2HY0A 2NO3A 4PV0A 3W2OA 4CFWA 3NRMA 4BI2A 5IQEA 3RPYA 3MYGA 5K5XA 3V8TA 2CDZA 3H0ZA 3OG7A 2BZHB 4DCEA 5EOBA 4I0SA 2IW9A 4FGBA 2XK7A 2B7AA 3Q3BA 4FTJA 3W33A 4HVIA 5HNIX 3VO3A 4GT4A 2NP8A 2QKWB 4YTIA 2VWVA 5CXHA 3RTPA 4DT9A 1Q3DA 5DBXA 3DJ5A 4O0WA 3U55A 4BBMA 4S2ZA 4HCVA 2W1EA 3H9RA 3O96A 4IAKA 4R1VA 4S33A 1S9JA 2J7TA 4J1RA 1DI9A 4AW0A 2WXVA 3BHTA 3L8VA 5H8BA 2B4SB 5C01A 3LQ3A 3UO5A 4O1PA 4LUEA 4S32A 3DQXA 4FF8A 2WO6A 3TIZA 4ZSJA 2WQBA 3O71A 3HRBA 4IWPA 2OKRA 3MSSA 2Y6OA 4D4RA 3V5TA 3FZPA 2VTAA 4IVCA 3NUSA 3D5UA 3R8MA 3JVSA 2OFVA 3OEFX 4GVAA 3F2NA 4C37A 4L46A 3FI4A 4L01A 2V22A 3DB6A 5DLSA 4UX9A 4IX6A 3WYXA 4CEGA 3S0OA 5M53A 2ZV9A 4FZ6A 1Z9XA 3DK3A 3TUCA 5KMJA 1ZRZA 2IJMA 5L6OA 1WFCA 4FYNA 4LMNA 5HNBA 1FVTA 3PJCA 3Q5ZA 3D2IA 4CKJA 4TZRA 3DFAA 4HCUA 3AMBA 4MBLA 4MHAA 3KN6A 1PMEA 2YIXA 4IAFA 4JG6A 5CTPA 2XIKA 3KREA 4LL0A 5FTQA 3PIYA 4C2WA 3HV4A 4FSRA 4AGWA 1UU3A 3RHXA 2YWVA 3WF6A 2X39A 3OXTA 3VUGA 3LVPA 4JQ8A 4J95A 4UMPA 2YM4A 4YJTA 1XH5A 4GKHA 3DQWA 2P2IA 1E1VA 3I5NA 3LFEA 3OWJA 4QMTA 3UO4A 4OLIA 1H27A 1P4OA 2HIWA 2WKMA 1OZ1A 2CGXA 3BEAA 2ZJWA 3BU3A 2VTIA 3EKNA 3O17A 1ZZ2A 3P08A 1UNLA 4FK6A 4EOOA 5TO8A 4GK4A 5CAVA 4E6CA 5AUTA 5CXZA 5I9VA 3RWPA 3QALE 4UY9A 1CDKA 3F7WA 3DOGA 3B2WA 4EOSA 3D7TB 3L9LA 5JGDA 3E8CA 4BYJA 3OY3A 3QQKA 4WG3A 2ZM1A 4FL3A 5DT4A 2WFYA 4PDOA 3EWHA 1B39A 4EKLA 3F5UA 3ZFXA 4PMSA 2B9HA 4YLJA 2X6DA 3UVQA 4FR4A 4FZAB 4ZTQA 2C5NA 4QTAA 2W96B 4KSPA 4O0TA 3EQFA 3S3IA 4BZDA 3JR1A 4OGRA 3LFFA 4DN5A 3ZZWA 1PKGA 4ZZNA 4KIOA 2YACA 4D5HA 4BCPA 3KULB 3QYZA 4MD8E 3LCTA 1UV5A 1XBBA 4F0GA 3O51A 3JUHA 4YTHA 2BZJA 5HU9A 5J95A 1Z57A 3P1AA 2LGCA 4JJRA 2GS2A 4E5AX 3KC3A 4LI5A 4QYYA 4IWQA 4HGLA 4CLIA 3NYOA 4QPSA 1R78A 4R3RA 2CSNA 4EOKA 4ZSGA 2C6DA 3ZHPC 4MCVA 3PFQA 3Q2JA 5IISA 4F6WA 2OZAA 4QP2A 5CT7A 3W2SA 2QOLA 2R64A 1OI9A 3UNZA 3DB8A 3WF7A 3OUNB 3C1XA 2FGIA 4ANBA 3G90X 2JLDA 3NUPA 4ZSLA 2BIKB 3CCNA 4LL5A 4BCHA 3MTLA 4FGRA 3HMMA 2F9GA 2WMRA 4IZ5A 5HBEA 4FKGA 4L9IA 2YITA 4ACMA 3DK7A 3SOAA 3D83A 1JOWB 4I22A 5C26A 5K0XA 2QNJA 5I9ZA 4FEVA 2Y4PA 4I6HA 4JDHA 2R5TA 4U42A 3ANRA 3MVHA 4XP0A 4NW5A 4QOXA 4EOJA 4O1OA 2X0GA 4LGDA 4FTCA 4O0XA 4QNYA 3JY0A 1J1CA 2F4JA 5A6NA 3IECA 4WNOA 3PJ2A 2RFDA 4OBQA 3OEZA 5AR2A 4EK3A 3HAVA 3EMGA 3KF4A 3KGAA 3NNXA 1ZAOA 1DAYA 3MJ1A 4WBBB 4ACHA 2ONLC 3NDMA 3TKIA 2ZV8A 2OF4A 4CFNA 5FDPA 2PUIA 4WT6A 5AP7A 2YN8A 3AC3A 3PE1A 1LPUA 1YXVA 1NW1A 2IPXA 3O50A 4UWYA 3R0TA 3KA0A 5L2SA 2UZUE 3Q4UA 5I9UA 5CF5A 1H0VA 3VHKA 4YR8A 1H07A 2C3IB 2H34A 4KS8A 1KV2A 1TQMA 4NTSA 3GU6A 3MBLA 3Q5IA 2JKQA 2C5VA 4RJ6A 4HYUA 2PVYA 4D1SA 1FQ1B 3R1SA 5L2TA 2QD9A 4LG4A 3SXFA 4IM0A 5TR6A 4XS2A 4NTTA 3U6JA 3V51A 4RQVA 3UGCA 4EOQA 1UNHA 4A4OA 1H01A 4YPDA 2CKPA 3P5KA 3HZTA 4EQUA 3G6HA 5D11A 2ZM4A 2CJMA 2ITVA 2XK3A 5IPJA 3R7YA 4YSMA 4BIEA 2YCSA 4OTHA 3U6HA 4X3JA 4LUDA 5D41A 4CD0A 3R71A 2F2UA 4FNYA 5CAPA 5HG9A 3RAKA 3EFKA 1O9UA 3PWYA 2GDOA 4GG5A 3WIKA 3ZC6A 5M08A 4QRCA 5ANEA 3ZSIA 3FKNA 1JLUE 3W2RA 4RX8A 5EM7A 4PNIA 4QYEA 2GPHA 4MF1A 4NSTA 5CEKA 3PG1A 4M68A 3OP5A 4L53A 4QMXA 2YABA 1QPEA 4FKVA 3LJ2A 2YEXA 3KVWA 4KIPA 3QRJA 4IIRA 3Q6WA 4NCTC 1H1RA 2BTSA 5M4IA 3PP0A 3ITZA 5I0BA 3WE8A 4IHPA 2XYUA 2HWPA 3ORLA 3A7HA 3SXSA 3UPZA 2BRHA 1J7IA 4UZDA 5IQHA 4YHTA 3W16A 4EZ7A 4EK8A 4G6LA 2UZWE 3DCVA 4HOKA 5LVOA 5HCXA 3HLLA 2J50A 1XH7A 4G6NA 4PX6A 4XRLA 3V3VA 4BCQA 3PP1A 3HRCA 4B9DA 4FIFA 4ITJA 2VO6A 1Q97A 5F95A 4RRVA 3TV4A 5B2LA 1JSUA 2QLQA 3PA5A 2YJRA 1J91A 2WEIA 3NUUA 2PE0A 3ET7A 3FLWA 4TYEA 5C8MA 5CALA 4DINA 4ANSA 4AZWA 2RG6A 2C1BA 2HZ4A 5EI8A 2X8IA 3LFSA 3PY3A 3LM5A 1G3NA 4BTFA 1IASA 4O27B 5IG1A 3BEGA 2OBJA 3A62A 2G2HA 5HLPA 3ZEWA 4AN2A 1IAHA 5AUVA 5IQBA 5IDNA 4UV0A 4YNOA 3VUIA 4BCFA 3EFJA 3FV8A 3G5DA 5CVGA 5KZ0A 3RM7A 2BAQA 3FDNA 4BGHA 5J8IA 1R3CA 5L6PA 5LOHA 4FIHA 5FTGA 2DQ7X 2B54A 3CGFA 2QONA 4IX4A 3QTQA 1BLXA 2C6IA 4FEUA 1M7QA 3CBLA 3EIDA 4JBPA 1VEBA 4L45A 2UW8A 5E7RA 3ZTXA 3VRZA 3DBDA 3GC8A 1UKIA 2WTVA 5AX9A 1BI8A 4IZYA 4E26A 2VTTA 5CU4A 4ACCA 3ERKA 3F66A 1WZYA 1FGIA 1YXTA 3LW0A 4KA3A 4NWMA 3UIUA 2H96A 2CKOA 3OS3A 3R21A 4WBOA 4C4FA 5IA4A 5LCJA 5C27A 3IO7A 3HDMA 4DC2A 4PMPA 4Z3VA 3W2QA 3KXZA 4R3CA 3C50A 3C4CA 4ERWA 2WOTA 3OCTA 4CKIA 3COKA 4WUAA 2V7AA 2XIYA 2X4ZA 4E73A 5DI1A 3FL5A 5FXQA 1O6YA 1Q5KA 4JQEA 3B8RA 5HICA 4HGTA 4ASDA 4J96A 4TW9A 4E3CA 2OZOA 2QODA 3KMMA 4FKWA 1O6KA 4RWJA 4EONA 3FHIA 2C5XA 3PJ8A 3TZMA 4C57A 4ZY5A 5JT2A 4E8AA 1FINA 3UVRA 4BC6A 4BCOA 5BNJA 2H8HA 3DAJA 4C33A 5K4IA 3EJ1A 3NCGA 5I9WA 2YLFA 3ATTA 1CKIA 4FTIA 4IFGA 3KMUA 5EHYA 4G5PA 4DGNA 5AA9A 4MNEA 5TOZA 5IEVA 3DY7A 3LXPA 1ZMUA 2V62A 3NNUA 3P79A 4ZTRA 4DH1A 1OIUA 5C4KA 5ETCA 4CZTA 4FEQA 3HRFA 1ZYLA 4TNBA 3ODZX 3EKKA 5CF4A 1RQQA 2GS7A 4EORA 4QPMA 4M69A 4D2TA 4O7YA 4MWHA 2X1NA 4EK4A 3ENMA 3POOA 1A48A 4GKIA 4I23A 4WD5A 3RZFA 4G5JA 3KL8A 2VTMA 3MPAA 3E63A 4KRDA 2I0VA 4C4EA 5KMMA 4C34A 2F7XE 2XUUA 4RC4A 2UZNA 1DI8A 3MFRA 3NR9A 4ERKA 4FA2A 3LXNA 3BHHA 2QG5A 3GVUA 3BWJA 4P90A 3FPQA 3BYMA 3EZVA 4C3RA 2CCHA 3CTQA 1OKVA 4I94A 4NKAA 3ZLSA 4DH5A 1RE8A 2XK4A 4PL3A 5HIEA 1STCE 3PIZA 4KD1A 3I79A 3IONA 5DT0A 1ZMVA 4CZUA 3E3BX 3H3CA 3LLAA 4F6SA 3VUTA 5CU3A 1MUOA 2WD1A 2WMTA 3MPTA 4NM3A 3TT0A 3V5PA 4BTMA 4F1MA 4U7ZA 3PXZA 3UZTA 3QLFA 4RIXA 5E1SA 2CN5A 4CCBA 3IW6A 4DBNA 3ORMA 2VGPA 3KXNA 2WTWA 4YZBA 3RM6A 4WG4A 1U4DA 2JBOA 3TUBA 3AD4A 3PRIA 4XOZA 3V6SA 2CGVA 3R7GA 3P7AA 1V0PA 3BE9A 3F69A 5AIRA 4APPA 5HO6A 2OJJA 3IGGA 2FVDA 3QA8A 3MI9A 5HG5A 3U51A 3VJNA 3NW5A 4AA5A 3PG3A 4V0GA 4DH8A 3U9NA 2PMNX 1YI4A 2I1MA 3RMFA 3EL7A 3DKOA 2WMAA 2G2FA 3FL4A 5HIDA 4ALVA 3CY3A 2R3HA 4F64A 1BUHA 4JR3A 3R9OA 5AEPA 2Z7LA 4FZ7A 1WVWA 4NKSA 3OT3A 2LAVA 1HCLA 3GFWA 3TJDA 1QL6A 5HX6A 2PMOX 2R3MA 2W7XA 2YCRA 3HA8A 3IW4A 1WMKA 3QTZA 4K6ZA 1NA7A 2W1DA 4FV8A 5EK7A 5KCVA 3BYVA 4F65A 5ETFA 2BMCA 4I20A 5KBQA 3QQGA 3PVBA 4X2JA 3WZKA 3MA3A 4LOQA 4BKZA 4QTBA 3NGAA 1UNGA 3GC9A 5E90A 3EN9A 3KK9A 4MXOA 5AV3A 4FODA 5HKMA 3ZRKA 4YU2A 3UOJA 3SXRA 2R9SA 4I4EA 2VWXA 1Q8YA 2G1TA 5F1ZA 1BI7A 3TXOA 2ZYBA 1XQZA 3C4FA 1OL2A 1KOAA 5HNGA 4EL9A 3LZBA 3F61A 4RFZA 4RIWA 3TV7A 2EXEA 3UJGA 4FX3A 4EZ3A 3TNWA 1REJA 5LXMA 3QAME 2CN8A 3F3ZA 4FV5A 4UWCA 1GZOA 5ANGA 4CTBA 3GCSA 4PUZA 4ONAA 4EWQA 1BYGA 3KN5A 5A3XA 2GHLA 3K5VA 4II5A 4ITHA 3AMYA 3NW7A 4F99A 2XNGA 4W4VA 2VTPA 4NYEA 2R3FA 3DJ7A 4UYNA 5KE0A 3NEWA 4AZVA 2YAAA 4N6ZA 3S00A 5BVNA 5J5SA 2ZVAA 3LQ5A 1W82A 3LCSA 4FTRA 3IS5A 4BDKA 3DNDA 2I0HA 5J1VA 3R28A 4FIJA 3Q53A 4MAOA 5KMKA 5IQCA 2J0KA 3OMVA 3II5A 4IDTA 4U81A 4L42A 5DRDA 3A7IA 4AAAA 2Z7QA 2R0UA 3DPKA 5AR8A 3NYXA 5E8YA 2Y8OA 4L00A 4O91A 1SM2A 4Y46A 3EYHA 4YJOA 3ZONA 5BUJA 5DOSA 3BLRA 2ZOQA 5EW3A 3I0QA 5M06A 1F3MC 3L9MA 1PYEA 2OJ9A 5GIOE 4EJ7A 1JPAA 2HCKA 3VULA 3PE2A 2XA4A 4AGCA 4EH4A 5L4QA 3P7CA 3ORXA 3LMIA 3E62A 2VWWA 4MWIA 2WMSA 5CQUA 4MBIA 4KKEA 1PMVA 3ZFMA 4ZY4A 4BHZA 4Z55A 3E8NA 5HTIA 2UV2A 2X2MA 2XKDA 2X9FA 3ZSGA 4XP3A 3MVJA 2O63A 3R04A 2EUFB 4QP8A 1Y8YA 3OCSA 3VUDA 3HDNA 4FTMA 2VTLA 5AUWA 4RIOA 4U3YA 2FB8A 1KE9A 4YJVA 3SD0A 2REIA 4FVQA 4IEBA 4YJUA 4I6BA 5ANOA 4WSYA 3CS9A 4M0YA 3U4WA 3PA4A 3FMKA 3KU2A 1ZWSA 5DN3A 4FKUA 1PXOA 2EB2A 1KV1A 2VO3A 3QA0A 4I0TA 3ZYAA 5AIKA 4APCA 4KUJA 4BR3A 4XG7A 4QP3A 4J53A 3I81A 2PUNA 1ZOHA 5JFWA 3UODA 1H1QA 3PPKA 3ROYA 4DGMA 1KSWA 3BZ3A 4LRMA 5DVRA 1OL6A 4XG2A 4D0XA 5IEXA 3JXWA 4KRCA 2OG8A 3A8WA 4XBUA 3DKGA 1RJBA 3QD3A 2HXQA 4FIGA 3VW8A 1H4LA 4DEGA 3GENA 3IPHA 4PTGA 4IADA 2OK1A 4DEBA 3R9RA 5IQDA 5JFXA 1J7UA 3P78A 2W0JA 4QYHA 3VBYA 1OM1A 2YISA 5BUEA 5IQFA 4X6RA 4ZJJA 4A9UA 4Y83A 2UVXA 3PY1A 1I09A 4AOJA 1KE8A 4C8BA 1ZXEA 1OGUA 2C3JA 5KBRA 4NFMA 4AX8A 2RIOA 2GQRA 3DKFA 2A2AA 3AT2A 3W2CA 4JAJA 4NW6A 1A06A 5FD2A 3RP9A 2ITWA 2VTSA 5LWNA 3NYVA 3PSBA 4IANA 4AOTA 5A4LA 4GU9A 4LOOA 3OBGA 4I24A 5AP2A 4EH5A 2CPKE 1MRVA 2G9XA 2YJSA 3NUYA 4W8DA 1ZARA 3R7EA 4L7SA 2CKEA 5CLPA 3FWQA 5EW8A 4WIHA 4DHFA 2VAGA 5LQFA 2VNYA 5M4FA 4KAOA 2JITA 3C4ZA 3NNWA 1T46A 2Q83A 4GL9A 3SV0A 3RHKA 5KMOA 2BAKA 4D1XA 2FUMA 4AW1A 1W0XC 3P0MA 2WQOA 2WMBA 5FBOA 2W99B 4DCAA 3LHJA 3UIXA 4GJ3A 4JQ7A 5EQYA 2F49A 4L3LA 1FVRA 1H08A 2XRWA 4AXAA 3QZHA 3U87A 2VWBA 2WTKC 2W5HA 4ZTHA 2VWZA 4PY1A 3COHA 4E4NA 4O81A 3V8SA 2WOUA 5GJDA 4XG3A 4NJDA 3LFDA 5E8XA 1I44A 3QXPA 5EOLA 2Y4IC 5AMNA 1KE7A 5D12A 3D7ZA 3R22A 5EYKA 3BGZA 4FV4A 3O23A 3R2BA 4FL2A 2J0IA 3IGOA 5ACKA 2ITPA 3RVGA 2JIVA 5AP5A 3DTCA 2R7BA 2VU3A 3LCDA 1ZY5A 4AS0A 4FEXA 2J0MB 4JIKA 4RVMA 3ORZA 4P7EA 4BCIA 4EK5A 1BL6A 1V1KA 3CLYA 3FBVA 3AC4A 2ITXA 3I7CA 5IU2A 4ZEGA 3QKMA 3D94A 2HZIA 3A4PA 2CGUA 4JG7A 4MNEB 3IOPA 3T3UA 3V5JA 5J9YA 1SZMA 2O64A 4K2RA 3TUDA 2KTYA 5EYDA 4W9XA 5DT3A 2JFMA 1ZYJA 3FZSA 4A9YA 4IAYA 3FHRA 3QCQA 3FY0A 3I60A 4FNWA 4LQMA 1GOLA 3HP2A 5EYCA 4ZZMA 3VBTA 3SRVA 2PE1A 2YM7A 3VIDA 4LRJA 5E1EA 4M69B 4X3FA 4BDJA 2NRUA 1LUFA 5KKRB 2BZIB 4BDDA 4TNDA 3R7OA 3O7LD 3F3TA 4NZWB 3TZ8A 2GNJA 4XLIA 3R83A 4BCMA 5IKWA 4IACA 1G8AA 1Q8TA 2ZM3A 2C6LA 3GC0A 2W1ZA 3MDYA 3QTSA 4FTUA 2WELA 4RC3A 5CYIA 5DMZA 5ITAA 5HESA 4D2VA 3Q9XA 2UZDA 5KUPA 4QQ5A 5AM7A 4U8ZA 3MS9A 2W17A 4J99A 3RK9A 5GZ8A 4USDA 2NNWB 5IA3A 3LKMA 1WAKA 4ENYA 2JDOA 1KOBA 2QG7A 4YNEA 3MJ2A 1JQHA 4GSBA 4K18A 3FI3A 3UBDA 2UZBA 2XCKA 4RMZA 4YC3A 4BDBA 1WBWA 4AW2A 3NX8A 4ALUA 2G2IA 3PDTA 4U79A 4M3QA 4J97A 4DEIA 3F3UA 5AUYA 4RIXB 4DFZE 1URWA 4EBVA 4EH2A 2Z7RA 5AR7A 4CQEA 2BDJA 4IB5A 4O7RA 2IZTA 2VTNA 5DRBA 2P2HA 2C0TA 5CSVA 2X2LA 4YP8A 5JGAA 4ZS4A 3GU7A 4WNKA 5C4LA 3W32A 4FZDB 4U3ZA 4KBCA 5E4HA 3O8PA 4EHEA 2B55A 1NVQA 4V0GB 4G6OA 2ITOA 3NUAA 5DIAA 3DXNA 4E6AA 4DTBA 4JDIA 5DE2A 4JI9A 1WBPA 3BLHA 3CTHA 4ZZOA 1G8SA 1L8TA 2I6LA 2Z02A 1IAJA 1Q3WA 1NVSA 1R39A 3WARA 4E4XA 3TIYA 3L9PA 3JPVA 3L9NA 4ZS0A 5FG8A 2EVAA 3U4UA 4C36A 3PVGA 4E6DA 4EZ5A 2PVRA 1VJYA 4DG2E 3O0GA 2CNQA 4OT6A 4U97A 3RWQA 3UMXA 4AUAA 3QCYA 5D7AA 2UVZA 5JZJA 3NUXA 3D15A 1NY3A 5LARA 4IJ9A 1JKKA 4FOBA 2OFUA 3FLYA 2A4LA 3RINA 3BIZA 4UMTA 4PL4A 2HK5A 2WEVA 3EQRA 2JDSA 4JBQA 4NU1A 4RA4A 2GFCA 3NVKI 3PJ1A 1U5QA 4YGAA 2X6EA 3DAEA 3PA3A 3ROCA 1PF8A 4LFIA 5L8LA 4RIWB 2A27A 3WI6A 4PF4A 3ZUVA 5BVDA 2PZPA 3KB7A 3SG8A 2IVTA 4IM3A 1MP8A 4Q5HA 4TWOA 2P3GX 4AA4A 3MWUA 5K0KA 4FKOA 4NEUA 4DAWA 4AOIA 3VUMA 2R3RA 5HCYA 2OIDA 1QCFA 1ZYCA 3HV6A 2DS1A 2UVYA 4R7HA 3NYNA 5LMAA 4UXLA 1HOWA 4KS7A 3VUKA 4GVJA 2CCIA 1KE5A 2XBAA 3VBQA 4LYNA 1DAWA 3ZO4A 3K5UA 4DFXE 2P4IA 4K0YA 4W9WA 1F0QA 4AW5A 3TNQB 3DBQA 2W1GA 3DGKA 4DLJA 4D2SA 2JDVA 3F3WA 3ELJA 4JG8A 1JSVA 4U44A 5EM8A 5ICPA 2HOGA 5GNKA 3E93A 3FLSA 3R00A 3RGFA 5LWMA 3U8WA 4ZLYA 3KXXA 3ZH8A 4RPVA 2C6MA 3I7BA 2PY3A 4I92A 4M13A 3QUEA 4BN1A 1P4FA 2B1PA 2VTRA 4CSVA 4X21A 1CKJA 2QLUA 4P2KA 2J6MA 1OUKA 2UW4A 2XNNA 4QQTA 4FNZA 2XP2A 1Q99A 1OL7A 2I0EA 1PXKA 4G3EA 3FYJX 3QU0A 3K54A 3RPVA 4GU6A 2YIYA 2BCJA 2QOBA 2YWPA 2ITUA 2VGOA 4UMQA 3UOLA 4RWKA 2XB7A 3B2TA 4IWDA 2ETMA 5ANDA 1KWPA 3A99A 3BU6A 2YIRA 4G9CA 4BDFA 4BWKA 2FA2A 2FSLX 2XCHA 3Q04A 4JVGA 3FLZA 3EQDA 4P5ZA 1LEWA 5HTCA 2UZLA 5IA5A 3P9JA 1NVRA 3R2YA 4MXXA 4QO9A 5GZ9A 4CV9A 5C8KA 2XJ0A 5BMMA 2BKKA 2PZ5A 2WZJA 3DZQA 3QD0A 4FTNA 2J0LA 2C5OA 3R8PA 3T9IA 2YZLA 3R6XA 5BUIA 3E92A 3OROA 4G16A 4QP1A 4HW7A 4LV8A 5CWZA 2XEYA 4EBWA 2C47A 4I6QA 3RBWA 5C8NA 3QX4A 5CZHA 4H36A 4FKTA 2Y0AA 3D14A 3I5ZA 2WQEA 5JMSA 3ORTA 1Q24A 1Z5MA 2VUWA 4R8QA 4K77A 4I0RA 4IM2A 4M97A 5M56A 2EWAA 3R9DA 4F9CA 5ETAA 2C3LA 3DFCB 1XBCA 3RCJA 3RZBA 3CQUA 4RGJA 3EH9A 5EKNA 1FBNA 1UU8A 3NIEA 3LXKA 4KINA 5CU2A 4GYIA 4ITIA 4XNEA 3N51A 4EH9A 3FUPA 4AN3A 5JN2A 2YM6A 4GT3A 4MX9A 3ZUTA 3FMDA 3MY1A 1REKA 3QQLA 5CI6A 4ZK5A 4KNBA 3FXZA 3FMEA 4IZAA 2YM5A 3W55A 3OW3A 5IQAA 2QC6A 3G9LX 4I5MA 4UMUA 3OOGA 3Q4ZA 4EH7A 3POZA 4C38A 4G31A 4V04A 4O6EA 3Q6UA 3GEQA 4L43A 1LR4A 4BRXA 4C02A 3TNHA 2XEZA 1IA8A 2J4ZA 4HJOA 5AUUA 5E8VA 4XHKB 2R3GA 3HEGA 3AC1A 3AD5A 1JKLA 3LFNA 1YHSA 2Y6MA 3DDQA 4RFYA 5F94A 4YHFA 3FI2A 4HZRA 2RFNA 3I6UA 2VD5A 5DEYA 5FM3A 2VWIA 4AG8A 2J51A 3P4KA 2I7QA 2HXLA 3C0IA 4QMSA 4KIKA 1T45A 2GMXA 3VS2A 1APME 3O7LB 5E9EA 4HYIA 3VS1A 5BVOA 3QLGA 3NVMB 2QU6A 3SKCA 5D10A 1GIJA 1P5EA 1J3HA 4H05A 5E8UA 4Y5QA 2X8EA 4G3CA 5HHWA 5L3AA 4HZSA 3G6GA 3PPZA 3QQUA 1FOTA 5AJQA 3R9NA 3Q96A 5E8TA 5HQ0A 3PY0A 5HVYA 4ZSAA 2J90A 3EQCA 3NIZA 4Q9ZA 5I3RA 2PPQA 1OB3A 4UN0C 1XKKA 1XR1A 2PZIA 2BALA 3EN5A 3H10A 4C35A 3S1HA 3PUPA 3ZRLA 1Q41A 2BRGA 3VF8A 4BTJA 5DWRA 3EZRA 4FI1A 4PMMA 5HLNA 4D2PA 2YCFA 5FP5A 4GUEA 3KRRA 4NT4A 4Q5EA 4UB7A 1J1BA 2JDRA 4I3ZA 5HVJA 4JS8A 2OICA 4CFXA 3I6WA 4I21A 4Q2AA 5C1QB 5J5TA 5CY3A 1OL5A 2XK6A 5LMKC 3GXLA 3FSKA 3QKKA 3VS5A 4CMTA 5LVLA 4AGUA 3QD2B 4MD9E 4DE4A 2XKCA 3R30A 4UXQA 4AZFA 4QP6A 4C62A 3ZLYA 1OKWA 4HCTA 4CT2A 2HELA 4D4VA 4Z7HA 4G1WA 2OI4X 2O5KA 3KRLA 1BMKA 1JKSA 1JAMA 1GIIA 5DEWA 3C4EA 3PSCA 3SRVB 4OT5A 3TCPA 4BDIA 2UZTA 4H3PA 5KNJA 4X3FB 5A46A 4O6LA 2B9IA 4RT7A 3PLAE 4FSQA 3VHEA 3QRUA 2OJIA 3QC9A 3GOPA 4GMYA 2X9EA 5HIBA 4EK6A 3FLQA 5AX3A 4JBOA 4IB1A 2WMUA 2C3KA 4GV1A 5AP1A 1H1SA 4AF3A 3R63A 1OIYA 3E87A 4X2GA 4CFUA 4EOMA 4H3BA 4ZP5A 4PDYA 2HENA 2WQNA 3OBJA 4DF3A 3EFLA 5CQWA 4BIDA 3RJCA 1JKTA 4AZTA 3LE6A 2IW6A 2G15A 3AMAA 4FV2A 5HTBA 3OC1A 4TKSA 4BZOA 5DFPA 3TNIA 5CSHA 5FGKA 5I5ZA 4ACDA 4GK3A 4M14A 3V8WA 3P23A 4MXZA 3W10A 3ZLWA 2HZ0A 4OR5A 4DEHA 5JGBA 4YJNA 3DBFA 2XNOA 3S4QA 4TT7A 4IE9A 2VWUA 4FKSA 3MVMA 1S9IA 2JIUA 1B6CB 4NFNA 4F6UA 4EOPA 3HAMA 5M55A 4J8NA 5T3QA 5A4EA 3QD4A 4XOYA 1IA9A 5IQGA 4DGGA 3GP0A 2HW6A 5A14A 2XM8A 4BCJA 5KMLA 4H3QA 2GTNA 2R3IA 1Y6AA 2QOFA 2DWBA 4QPAA 3IW8A 4D4SA 3C4WA 3CJFA 3DTWA 3R1QA 2W1FA 3F6XA 3LCKA 3WF5A 4BIBA 3TTIA 3LIJA 2OXYA 4IX5A 5AM6A 4IVDA 2W9ZB 3R8ZA 4L68A 5CNOA 5EQPA 4F1OA 4FT5A 3Q32A 2PVHA 2C30A 4FSUA 3OWPA 3ULZA 1ERKA 1WCCA 1GZKA 3QTIA 4CYIA 4BGGA 4QYGA 3QZFA 5D7VA 1SVHA 4KIQA 3F5GA 4BWPA 4AFEA 5HG8A 1IRKA 4DTAA 4WA9A 4QQCA 2PUUA 3EYGA 4KKGA 3OOMA 5IH6A 2BTRA 3RPSA 3AGLA 3VS7A 5AADA 2VX1A 2ERKA 3HECA 4O2ZA 1JWHA 4BL1A 1M14A 5AAEA 1KUTA 1ZY4A 4AZEA 3ANQA 1Q8UA 2W4OA 3D5VA 5JZNA 4CG8A 4ZXTA 4U80A 3R01A 3UP2A 4PWNA 2PTKA 1H00A 3QQFA 4EH8A 2XIRA 1V0BA 3KVXA 3PJ3A 2OH0E 3TKUA 4TXCA 1KE6A 2C0IA 3LMGA 3BQRA 4QTCA 4X6QC 5CANA 4FKPA 4NH1A 2R3KA 4PPCA 3BELA 2DUVA 3ORIA 4D2RA 4TWPA 2F7EE 3LFBA 4JT3A 1CM8A 5ANKA 5K5NA 4E1ZA 4I1ZA 4H1JA 1JSTA 3UYTA 2VX0A 4DLIA 2ETKA 4DEEA 1K3AA 2BILB 5TE0A 3Q9WA 3DS6A 3UC4A 4E4MA 2RL5A 4YZDA 3GCPA 2W06A 3GQIA 1H0WA 1IR3A 4FBXA 2XNMA 1PXMA 1P2AA 3UQFA 3QTWA 2UUEA 2Q0NA 4FE2A 3NNVA 2A1AB 2YCQA 2HYYA 3SX9A 3MIAA 3RK7A 4EOLA 3F88A 5KO1A 3DAKA 4RC2A 1GNGA 4QP9A 1WBVA 3QX2A 4IZ7A 3ZFYA 4C61A 4CGAA 3ZOSA 5HU3A 4W4XA 2OWBA 3FMMA 4JR7A 2W4JA 3PPJA 1U54A 4OUCA 2VTJA 3DV3A 4FSMA 4AWIA 4BI0A 3MY0A 4ANLA 4J8MA 2VWYA 2G01A 4X7QA 5TT7A 3ZBXA 3DXQA 2XK9A 3E5AA 2C1AA 4HPUE 4TWNA 4ANQA 4C4GA 1GIHA 2GNHA 2C6KA 4D9UA 3WZUA 3UIBA 3F2RA 1YRPA 3WIGA 2BUJA 3W1FA 3TDVA 2WMQA 3BYUA 1H26A 4IX3A 2XM9A 3KF7A 4YHJA 3UYSA 4ARKA 4BKYA 5BPYA 4GW8A 4M66A 4BDEA 3ETAA 4HYHA 4L7FA 4M67A 4EHGA 2YHVA 4R1YA 3FQSA 4USFA 5CX9A 4J7BA 4XCUA 5A4TA 3ZM9A 3E3PA 1XWSA 4LOPA 3SW7A 4KBKA 4FV1A 4A4LA 5GINE 2PVMA 2IO6A 2VO0A 2YDIA 4WNMA 5JEBA 3KCFA 4Y95A 3CQWA 4D2WA 3DK6A 2CKQA 3GCUA 4W8EA 3IDBA 4RX9A 4CKRA 2VTHA 2YFXA 4G17A 4EHVA 3LJ0A 5HG7A 4YC6A 4G3GA 4O83A 2OH4A 3UOHA 2NRYA 1R1WA 3A61A 5KZIA 4B0GA 4C59A 4YURA 3UG1A 4Y72A 3R1YA 4TYIA 4LM5A 2R3PA 4DFYA 5K9IA 3L8SA 3EFWA 4MXCA 1CKPA 4AN9A 3I0OA 4OAVB 2R3OA 5J7BA 3MA6A 3MH2A 3H9FA 4E93A 5TF9A 2SRCA 5FEEA 4C3FA 4IB0A 4MK0A 4GFGA 3SQQA 5J9LA 2O2UA 3QC4A 5ACBC 2AC3A 2ITZA 3QRIA 2PMIA 3SVVA 1YXXA 3CPBA 4YMJA 1PHKA 4BWXA 3R8LA 5CSPA 3IKAA 3QGYA 4ZTMA 4ZLZA 1O6LA 3O8TA 4EJNA 4XYFA 3MESA 3QXOA 4C7TA 4IFCA 3C9WA 3MFTA 3QHWA 3VS3A 3FAAA 4BF2A 2BDWA 3QWKA 4FKLA 3LAUA 3ZUUA 4CYJA 3COMA 3I1AA 4ZLOA 4GH2A 5BVWA 2GNLA 2ITQA 5LVMA 3OHTA 5HGIA 4F09A 3BU5A 3DBEA 4J98A 3AXWA 5EHLA 4F4PA 3Q9ZA 4JDKA 3E7OA 3ODYX 3EN7A 4D0WA 4G34A 2W1HA 2XF0A 3K3IA 4EC9A 1VR2A 4FTAA 4BDCA 2WU7A 5IH5A 4F7NA 3R1NA 3MN3A 3OY1A 4O0VA 5AP6A 4UEUA 2R4BA 4I41A 4JAIA 4XG9A 4BZNA 5KHXA 2CLXA 3CR0A 4C3PA 1CMKE 4FK3A 4KIKB 4FMQA 4GIHA 4HYSA 4E5WA 4WKQA 2UW5A 1FMKA 2UZOA 2VO7A 3FZOA 4E7WA 4YUQA 5A9UA 2VX3A 4PP9A 2YZAA 4C2VA 4NM5A 4TN6A 4Q9SA 4XMOA 4DH7A 3QRTA 4C4IA 5HVKA 2E9PA 4HNIA 2OIQA 4PDSA 1AGWA 5B2MA 2BRMA 2ZMDA 2XK8A 3A8XA 2GTMA 5FDXA 4RVLA 3D9VA 4O0SA 3E88A 2BIYA 4PPBA 4BHNA 1OBGA 4EUTA 4JX3A 5AWMA 2QQ7A 4NIFB 3TJCA 5GJFA 2FSTX 4LRKA 4EWHA 3OXIA 1PYXA 5JRQA 3DBCA 4FYOA 5CT0A 5HBJA 2ERZE 4RJ5A 1BL7A 3DZOA 3PRFA 1W7HA 3Q4CA 2QO7A 3KEXA 4BDAA 1SVEA 1U5RA 3RAIA 3V6RA 3PXYA 3EQIA 5CSXA 5FEQA 4BYIA 3GQLA 3K2LA 2IVVA 2J5FA 4BFMA 4BDGA 3F82A 3BHYA 2VTOA 4DYMA 2R0IA 1XH8A 3QF9A 3B8QA 5M4CA 3RK5A 4F9WA 2O65A 3DLZA 5CI7A 5AUZA 4HGEA 2YLEA 3ZXZA 5CU0A 4BCGA 1XBAA 3OXZA 1QPCA 4YO6A 4Y85A 5AR5A 3ZDUA 5IUHA 4DFNA 3VS6A 1SMHA 2ITNA 4FUYA 2BHEA 1UWJA 4PDPA 5D9HA 1UA2A 2XRUA 2A19B 4QMLA 3SGCA 5EM5A 3U9CA 4QMQA 2RKUA 5ETIA 3TNPC 4AA0A 5KMNA 4X2FA 2Z60A 4FEWA 3GFEA 1Q8WA 2XKFA 3OZ6A 1BX6A 1QMZA 4CXAA 3IK3A 3PSDA 5CF8A 3V04A 2OU7A 3UDBA 4BCKA 3ZCLA 3VBVA 4A9SA 4FT7A 3E8EA 4YLKA 4AE9A 2XH5A 4KB8A 5GJGA 3MIYA 3TEIA 3WBLA 4O84A 3PXKA 4R5YA 4YJRA 2BVAA 3F5PA 5IDPA 2BZKB 4YBKA 5HEZA 3KRWA 2QR7A 5GIPE 2YIWA 5FM2A 4F7SA 4EYJA 3NLBA 4FSYA 5JQ8A 3MFSA 4B99A 1YKRA 2QOIA 3ULIA 2OJGA 2QHMA 2XKEA 4WOVA 3SAYA 3VNTA 2YAKA 1NT2A 3LMHA 2IZSA 5IQIA 2F7ZE 2BHHA 4ZJIA 1YI6A 5IMEA 3SA0A 4CRSA 3FLNC 5IUIA 2QU5A 4FV0A 4O0UA 4Y73A 4F7JA 2IZRA 3VJOA 4FKQA 4XLVA 2UW6A 2WAJA 4CRLA 2R3QA 3SLSA 2C6EA 3TI1A 5EDPA 3RI1A 3QRKA 3W2PA 3DT1A 3BQCA 4MBJA 2QR8A 2WMWA 3SG9A 4TYHA 3A4OX 4I6FA 4FV6A 3P86A 3LM0A 4RA5A 4U45A 3GNIB 4JDJA 1OL1A 5DHJA 3N4TA 3ZU7A 2EXCX 3HA6A 1WBTA 3KCKA 1H8FA 4K9YA 3VAPA 3V5QA 5E8ZA 3AD6A 4YZCA 4F0IA 4K1BA 5L8JA 3FC2A 3CE3A 4ZTLA 5JFVA 3PTGA 2JIIA 3TM0A 3N9XA 3GU5A 3Q60A 4HVHA 5M57A 2BDFA 2IG7A 4EHZA 3GUBA 2RF9A 4FIEA 5AV1A 3WZJA 2AC5A 1MRYA 2PVFA 5CEPA 2UW7A 3P7BA 4A9RA 5FUTA 4L3PA 2PVLA 4RLLA 5FRIA 4S31A 5FLFA 3RNIA 4ANMA 4RWIA 4R78A 3T8OA 4QP4A 4AE6A 3RAWA 4GK2A 4MXAA 4X3FC 1H24A 3UPXA 5CAUA 2X7FA 1YW2A 4EH3A 1Q4LA 5A4CA 4XH6A 4EQMA 4RG0A 2BKZA 2RGPA 4ZMEA 4AACA 1M2QA 3W8LA 2CMWA 3QYWA 4WRGA 4M84A 4BBFA 4YLLA 3DDPA 3DU8A 4XG4A 1W83A 3WF9A 2JD5A 1YWVA 4B6LA 3Q2MA 4LMUA 3D4QA 3FJQE 3QTXA 4EI4A 3UZRA 1OITA 1UU7A 4KWPA 3LXLA 4K33A 4Z9LA 3EQHA 2PL0A 5EKOA 5IZFA 2QOCA 4YSJA 1TVOA 2GCDA 2UZEA 2J9MA 1Q8ZA 2VZ6A 2BFXA 4ANOA 1OPJA 5KMIA 5HORA 4E20A 4ZIMA 1OPLA 1U54B 3UC3A 4PPAA 3N4VA 3ZXTA 3ZM4A 3GI3A 1GAGA 2YDKA 3OW4A 2ITYA 4MTAA 2XS0A 4P4CA 2VTQA 4A4XA 3VRYA 4JRNA 2JAVA 5EG3A 4DA5A 3A2CA 4FG7A 4EUUA 2QO2A 4BY9E 4MD7E 3A7FA 1H1PA 4UYAA 3Q4TA 3MGYA 3R73A 5HBHA 4D1ZA 3KQ7A 2QKRA 5M07A 1M2RA 5KX8A 3MW1A 4QTDA 1BKXA 3KRJA 2PSQA 5AP4A 2PE2A 1F5QA 2QOHA 3E64A 3EOCA 3TACA 4F70A 4XV9A 4AP7A 4M0ZA 3R7UA 2BR1A 3ZEPA 3BGQA 5CNNA 4RSSA 1ZMWA 2P33A 4NM0A 4RX5A 4L44A 3ID6C 3HX4A 3LCOA 4FG8A 5EQEA 3HMIA 4JL9A 4DEAA 3G51A 1PXIA 5CSWA 4DFBA 3OFMA 5AUXA 3NUNA 4DTKA 1OBDA 3N4UA 4MVFA 1XHAA 3CJGA 4S34A 3VVHA 2B9FA 5JRSA 3TTJA 2WHBA 4N57A 4NUSA 2R3NA 2ZDUA 4RIYA 3ZRMA 4R5SA 3EHAA 4M12A 2I40A 3VN9A 3BV3A 1LP4A 1OPKA 1GY3A 3KRXA 4IH8A 2R2PA 4HPTE 3NAYA 3MH0A 3FKOA 3QL8A 4PMTA 4N4SA 4OTQA 5CZIA 3IDPA 4TY1A 2W5BA 3D5WA 3AC5A 3R02A 2R7IA 4FV3A 4GCJA 1ND4A 3M1SA 2PK9A 5DPVA 1WVXA 4QT1A 3QQJA 1OIQA 1RDQE 3F5XA 2JBPA 4DFLA 2JGZA 3PVUA 4FOCA 5E8SA 3AC2A 1UKHA 3CD3A 3FMHA 3ZO1A 4QMOA 3NWWA 3D2KA 4L52A 5H2UA 4F0FA 5CEMA 1P14A 2W9FB 2VRXA 3BBWA 4CFVA 1FVVA 5A54A 2GQSA 1WBNA 2X2KA 3IDCA 4UMRA 2UW0A 5LVPA 3HL7A 4MEDA 2Y7JA 3BCEA 4AT5A 3EQBA 3FQHA 2YA9A 4ZJVA 4UWBA 1YVJA 2ACXA 4FSTA 5JH6A 1AD5A 3OTVA 2Z8CA 2FSOX 2OGVA 3L8XA 2ONLA 4D5KA 4U41A 1Q61A 2C6OA 4DBXA 3PXRA 3AOXA 1YWNA 3A7GA 3SDJA 4YJQA 4KSQA 4O7LA 4F9YA 2EU9A 1VYWA 2XVDA 4NK9A 1PXLA 2H6DA 3JS2A 4C4JA 1IEPA 4E5BA 3OCBA 4U40A 4O38A 3HUBA 2EB3A 3MTFA 3NMUF 4BVUA 3OWLA 3AT3A 3VS4A 1OMWA 2GNFA 5M4UA 4KBAA 3UP7A 1Y57A 4E4LA 4GS6A 4Y8DA 4FKIA 2PYWA 3NCZA 2PUPA 1ZYSA 4RVKA 5BVEA 5BQ0A 3ORNA 3FQEA 4C4HA 3EN6A 3FMNA 4UZHA 3CKXA 4CFFA 4GYGA 3QCSA 2IWIA 2BRNA 3CXWA 4J71A 4NL0A 3EB0A 3GBZA 5FBNC 3H9OA 4BCNA 4ORKA 2PWLA 3DJ6A 4IBMA 2BAJA 4CZYB 5TKDA 3TZ9A 2B9JA 3BKBA 3CPCA 4YPSA 4MYGA 2CHLA 1ZOGA 4F1TA 3GU8A
chains in the Genus database with same CATH superfamily
3WZDA 1SNUA 1OUYA 4QNAA 1X8BA 4TWCA 5BYZA 3W18A 2QURA 4YJPA 3AT4A 2QCSA 4RJ4A 3QCXA 4DGOA 4Y5HA 3JY9A 5H9BA 5J9ZA 1FGKA 5EM6A 3LFAA 1AQ1A 4O22A 5E8WA 3ALOA 4OTIA 2FYSA 4NCTA 3NPCA 4ENXA 4ID7A 5T68A 1MQBA 2C69A 1IG1A 1UU9A 3HP5A 4WUNA 4XG8A 4D28A 5EHOA 3Q52A 3TDWA 3R7VA 2E9UA 2WTKB 1JNKA 3SHEA 3H0YA 4X0MA 1M52A 4FV7A 2XZSA 3C0HA 3KK8A 3UO6A 4GEOA 3ZO3A 5B2KA 2B52A 5L2IA 1RW8A 3BPRA 2WB8A 3HV7A 3ALNA 2Y4IB 3HVCA 1URCA 4AU8A 5HD4A 1XO2B 5AR4A 4U6RA 4LV5A 4CNHA 4XBRA 1CSNA 3IQ7A 3QFVA 3ZO2A 3OWKA 1GZ8A 3PXQA 4FNXA 1SYKA 2OXDA 4NJ3A 4HVDA 2VNWA 5D1JA 5IUGA 4R7BA 4XV1A 4FKRA 2NPQA 4O4DA 5LMKA 3HMNA 2PVNA 4I5HA 4CTCA 4QMNA 3HNGA 1PXPA 1YI3A 1NXKA 4NIFA 5BYYA 2YM8A 5HD7A 3TN8A 3ATSA 2H9VA 1GZNA 4GRBA 3UG2A 4QMUA 4E6QA 1SVGA 3EN4A 4BKJA 4L6QA 4CVAA 4PL5A 3ZSHA 3SOCA 4S30A 2HWOA 1YWRA 4FVPA 4M8TA 5JSMA 4JNWA 2F57A 3ORPA 3UQGA 4QMPA 4GFOA 5EDQA 1U59A 3FZ1A 3KFAA 2WTIA 2RSVA 3RNYA 4CFMA 2PULA 1OKYA 4LGHA 1TQIA 3PYYA 3V01A 4TYHB 4Z16A 4CG9A 4GFMA 1VZOA 3MB6A 2XMYA 5CEOA 2C0OA 4V05A 4AAYA 4QMZA 1XH6A 3RKBA 5JQ5A 4M7IA 3GGFA 4I5CA 5CASA 2PU8A 4ZTNA 3LFQA 4YJSA 3A7JA 2W1CA 3NSZA 2YM3A 3WE4A 2XJ2A 4IAIA 3LFCA 1ST0A 3OCGA 2E9OA 4FC0A 2ZB1A 4AFJA 4O0YA 4DITA 3COIA 4YZ9A 1YHVA 3QHRA 5FQDC 4XX9A 5HX8A 5AP3A 2WGJA 5JK3A 1WVYA 1Y91A 3ACKA 3SW4A 3S95A 2WIHA 4FTLA 3VF9A 5CF6A 3QTUA 3CQEA 4B4LA 5FXRA 4MF0A 5I4NA 4MQ2A 4QMYA 3ZS5A 4RLKA 4MXYA 2Z2WA 3UZPA 4QTEA 3NFFB 3TG1A 4C0TA 3CKWA 2WU6A 3NAXA 5HE3A 5LJJA 5IA2A 2AUHA 5DR2A 3ZDIA 1H1WA 3ZBFA 3D0EA 4EKKA 2EXMA 2WTJA 5CAQA 3C5IA 3DXPA 2FH9A 3BI6A 3I4BA 2HW7A 5J87A 4OW8A 3R9HA 3ZZEA 3C7QA 5LCKA 2QO9A 3VQUA 3W8QA 4EH6A 1YQJA 2PMLX 5EDRA 2ZV7A 1QPJA 3KXHA 5JFSA 3U6IA 3AQVA 4GIIA 5K3YA 3THBA 3VUHA 2CNUA 4O7SA 3QZGA 3GB2A 5CEQA 3V5WA 1XJDA 3C4XA 4X2NA 4IAAA 1JBPE 1W98A 4RBLA 4MQ1A 4OTPA 3TV6A 2Q0BA 1U46A 2HZNA 3MY5A 4PTEA 4EOIA 3UOKA 2GHMA 3BLQA 3FSFA 4TRLA 5BMSA 5CENA 4CQGA 3PVWA 5M44A 3KMWA 2IN6A 3RAHA 3BRBA 3F9NA 4BI1A 3M2WA 3T3VA 4W4YA 3EL8A 3UIMA 4B8LA 3FY2A 1Y6BA 3BYOA 1YOLA 3LQ8A 4TYJA 1A9UA 4ZAUA 2BRBA 3HMPA 4F63A 5IA1A 3HYHA 3ACJA 5FTOA 5AAGA 3GU4A 5AV0A 3MB7A 4RVTA 2IW8A 1XH9A 1ZOEA 4KKHA 2WTDA 3DNEA 3KXMA 2QHNA 4H39A 3NZ0A 4C58A 1TQPA 2GNGA 3C13A 5BVKA 4LV7A 3BYSA 5CAOA 4CMUA 2WTCA 5LVNA 2V0DA 5AFVA 4XRJA 4XV3A 2A0CX 2B0QA 3NS9A 3CY2A 3ZLXA 2JC6A 4BICA 4RJ3A 4USEA 3E8DA 4FT9A 4K8AA 3QUPA 4CV8A 4MNFA 2UZVA 5J7HA 3RCDA 1EH4A 2YERA 3PLSA 1YOJA 2Z7SA 3FXXA 4N0SA 5CEIA 2XBJA 4JLCA 3KY2A 4FL1A 1SNXA 4F9AA 4ZMFA 4OBPA 2QI8A 2V5QA 2V7OA 1YHWA 4IQ6A 1OIRA 2J2IB 3MVLA 4FIIA 4QMWA 4FJVA 5DR9A 2CNVA 4PQNA 4QD6A 3C51A 1M7NA 4CMOA 5HZNA 5JKGA 5KKRC 5HOAA 4FV9A 3WF8A 4ACGA 4RIYB 3LJ1A 3AC8A 4GUBA 5CVHA 4JX7A 5HI2A 3QUDA 4RJ7A 3R7IA 4YTFA 4GG7A 5CS6A 3MH1A 1WBSA 4IC7A 4M15A 2HAKA 2V55A 1MQ4A 4IAZA 4V01A 3FEGA 2CGWA 2UW3A 3CGOA 4ANNA 1PMUA 2RFSA 4DEDA 2XYNA 3C5UA 4FTTA 4GJ2A 3HV5A 3GOKA 1ZZLA 5AP0A 4TPTA 4YC8A 3IW7A 5G6VA 2JKOA 1HCKA 4UALA 4JRVA 2C5YA 5HE0A 5L2WA 1YXUA 2B53A 3OTUA 4AT4A 3CP9A 3H4JA 1OKZA 3DA6A 3FZRA 3JVRA 2IZUA 5M51A 2WMXA 3CIKA 2C6TA 3G0EA 4Z7GA 4RQKA 3UVPA 1ZLTA 5F9EA 5DA3A 2X8DA 2PZYA 2QOQA 4P5QA 5H3QA 3C0GA 3JYAA 3WOWA 5HLWA 1PY5A 4IVAA 4IMYA 4PNKA 3DLSA 3FKLA 4DH3A 3PIXA 3M11A 4O0RA 4W4WA 4D9TA 4FTQA 2ESMA 5DR6A 3TWJA 2O0UA 4XJ0A 2E9VA 4O96A 2XAMA 4OTFA 4FSNA 3G0FA 5EFQA 5I3OA 3ZMMA 3EQPA 2W05A 4PRJA 4QMVA 4R77A 5DH3A 5F4NA 3BGPA 4PP7A 2IVUA 4ASXA 5IEYA 4NM7A 2WMVA 2OZAB 1YDTE 2OW3A 3HKOA 4QYFA 4F9BA 4HVGA 3O2MA 4I93A 2ZV2A 4OTGA 1MRUA 2GS6A 4OTDA 3UE4A 2BFYA 4FKJA 4G3FA 4DG0E 3BWFA 4OTRA 4AGDA 3FXWA 3G15A 2XANA 3WILA 3BX5A 1LEZA 2I0YA 3U54A 3AGMA 4RZVA 4O7VA 2OO8X 5K4JA 5KHWA 4HVSA 4AQCA 2JDTA 5AA8A 2WQMA 4HGSA 2XJ1A 3FYKX 3KKVA 3L1SA 5GHVA 3RPOA 4DFUA 5M09A 4N70A 4BGQA 2FSMX 4OAUC 4I5PA 1UWHA 3BV2A 5BVFA 1OVEA 3BHUA 3D7TA 3W0OA 2J0JA 2QOKA 2KULA 3HGKA 4BBEA 4BTKA 5FP6A 3IW5A 4ASZA 4U9AA 4KABA 3G2FA 3V5LA 4RFMA 1R0EA 4FTKA 4HNFA 4XG6A 2OIBA 4CT1A 4EC8A 2VN9A 3QTRA 4IXPA 2OJFE 2GHGA 3GCQA 3O8UA 1YDSE 4L8MA 3BE2A 3LOKA 3NW6A 4ALWA 3M42A 4FSZA 4PTCA 3MFUA 1XH4A 2PVJA 3GCVA 3QWJA 5ANJA 5HCZA 1PXNA 3UMWA 3ENHA 4O86A 3QQHA 3LLTA 4G9RA 1PKDA 3KULA 4L67A 4TTHB 4B7TA 1L3RE 2X4FA 2GQGA 2W1IA 4EQCA 5L8KA 2BROA 1YXSA 4IJPA 4FVRA 3WZEA 4I6LA 3CTJA 1E9HA 2JFLA 2XNBA 1FMOE 2XIXA 4JBVA 2W4KA 3VS0A 2GSFA 3QZIA 4FUXA 2JKMA 3BHVA 4O21A 2RFEA 3G9NA 4FG9A 3OVVA 5AV2A 4FTOA 3Q9YA 2XIZA 4D55A 5DG5A 5A6OA 2ITTA 3RALA 5HE1A 2R3JA 3CEKA 4I4FA 1WBOA 2P0CA 2PHKA 3OF0A 2BPMA 1K9AA 1YDRE 2C4GA 2AYPA 5BX0A 2PVKA 2ZAZA 4XV2A 1E1XA 1M2PA 2OXXA 4TYGA 2OF2A 3PZHA 5I9YA 4B8MA 5J1WA 2CLQA 2DYLA 1K2PA 1ZYDA 3AG9A 4U43A 5EI6A 4D4YA 3IOKA 5CU6A 3UTOA 5A4QA 1M17A 5B7VA 2YDJA 2P55A 5C03A 4J52A 1B38A 3K3JA 4A07A 2WIPA 4O82A 5EW9A 3VC4A 1DS5A 5T6KA 5H8GA 2WPAA 4O7WA 1G5SA 2GFSA 2WNTA 4RJ8A 4FT3A 4IW0A 4ZY6A 4ASEA 5IH4A 3F3VA 1R0PA 4RZWA 4IWOA 3UNKA 3HMOA 3CD8A 2XALA 2ETRA 5CVFA 4DG3E 3F7ZA 3LPBA 3F2AA 4MH7A 1ATPE 2RG5A 4EYMA 4K11A 2QOOA 2ZMCA 5AAFA 3KXGA 2PZRA 4YBJA 1JVPP 5FWKK 3HV3A 2OSCA 2X7GA 3G33A 4R3PA 3VWAA 3DKCA 3ZC5A 2O3PA 1UVRA 4MKCA 3GT8A 5BYLA 4O7ZA 4IC8A 5C9CA 3T9TA 3REPA 5EH0A 5HO8A 2X7OA 3SC1A 3TKHA 4CLJA 5IA0A 3VONA 4WO5A 4JXFA 1PMNA 4IDVA 3VBWA 4WNPA 1W84A 3EQGA 4IB3A 2YIQA 3VBXA 2E9NA 4OBOA 2F2CB 3GC7A 4X2KA 4ZTSA 4QP7A 5ANIA 1W8CA 4IVBA 5B0XA 3RPRA 3TL8A 5I9XA 3VQHA 3UQCA 4WRSA 2Y9QA 4ZSEA 4DGLC 4DT8A 1PRYA 3S2PA 4UBAA 4FT0A 4WSQA 4F08A 2FO0A 4ZOGA 1V0OA 4XEYA 2ZDTA 2C68A 1H25A 5LMBA 3MPMA 3A60A 2R3LA 1H28A 2HY81 1GJOA 1YOMA 4BB4A 5L2QA 4TL0A 3FI8A 1DM2A 4GT5A 5E91A 4JIAA 4FZFB 4H58A 1QPDA 5HO7A 5DYJA 4OTWA 3HUCA 4AT3A 4WHZA 4QMMA 1CTPE 3FMJA 1Q62A 2UW9A 3MV5A 2GNIA 3OD6X 2QVSE 2XNPA 4O7TA 4XUFA 4YZNA 5FEDA 3D5XA 4WG5A 4CCUA 3CC6A 5DNRA 5GZAA 4LGGA 1PJKA 1PXJA 2J5EA 3QGWA 3E7VA 3UNJA 2X81A 3OT8A 3FZTA 2W5AA 5IMXA 4O7NA 2JAMA 2GU8A 3PZEA 5HE2A 2ZB0A 2XNEA 3MH3A 4RX7A 4N6YA 5EI2A 4AZSA 4FSWA 5H8EA 5AR3A 1OECA 5IF1A 5AV4A 3R8VA 1Y8GA 2IVSA 4L3JA 3CSVA 2JKKA 5EYMA 3FMLA 4YTCA 4YO4A 5L6WL 3ORKA 4EEVA 4H1MA 4BDHA 4F7LA 3FE3A 1PW2A 3PWDA 3PXFA 4FICA 5E92A 4YZMA 1TKIA 3FC1X 4O2PA 2OLCA 4D58A 4JOAA 2O8YA 4U0IA 3IG7A 5F20A 2E2BA 4R7IA 4A06A 3TZ7A 3WYYA 4R6VA 4G3DA 2JEDA 2VV9A 3L8PA 3BBTB 3OUKA 4U5JA 4XP2A 3R8UA 3VW6A 4A9TA 1FPUA 2XARA 1J7LA 4QQJA 5G1XA 3H30A 5J79A 3QKLA 5FXSA 3FPMA 4RWLA 3QBNA 1VYZA 4G2FA 5DGZA 4A7CA 2HY0A 2NO3A 4PV0A 3W2OA 4CFWA 3NRMA 4BI2A 5IQEA 2IEWA 3MYGA 3RPYA 3V8TA 5K5XA 2CDZA 3H0ZA 3OG7A 2BZHB 4DCEA 5EOBA 4I0SA 2IW9A 4FGBA 2XK7A 2B7AA 3Q3BA 4FTJA 3W33A 4HVIA 5HNIX 3VO3A 4GT4A 2NP8A 2QKWB 4YTIA 2VWVA 5CXHA 3RTPA 4DT9A 1Q3DA 5DBXA 3DJ5A 4O0WA 3U55A 4BBMA 4S2ZA 4HCVA 2W1EA 3H9RA 3O96A 4IAKA 4R1VA 4S33A 1S9JA 2J7TA 4J1RA 1DI9A 4AW0A 2WXVA 3BHTA 3L8VA 5H8BA 2B4SB 5C01A 3LQ3A 3UO5A 4O1PA 4LUEA 4S32A 3DQXA 4FF8A 2WO6A 3TIZA 4ZSJA 2WQBA 3O71A 3HRBA 4IWPA 2OKRA 3MSSA 2Y6OA 4D4RA 3V5TA 3FZPA 2VTAA 4IVCA 3NUSA 3D5UA 3R8MA 3JVSA 2OFVA 3OEFX 4GVAA 3F2NA 4C37A 4L46A 3FI4A 4L01A 2V22A 3DB6A 5DLSA 4UX9A 4IX6A 3WYXA 4CEGA 3S0OA 5M53A 2ZV9A 4FZ6A 1Z9XA 3DK3A 3TUCA 5KMJA 1ZRZA 2IJMA 5L6OA 1WFCA 4FYNA 4LMNA 5HNBA 1FVTA 3PJCA 3Q5ZA 3D2IA 4CKJA 4TZRA 3DFAA 4HCUA 3AMBA 4MBLA 4MHAA 3KN6A 1PMEA 2YIXA 4IAFA 4JG6A 5CTPA 2XIKA 3KREA 4LL0A 5FTQA 3PIYA 4C2WA 3HV4A 4FSRA 4AGWA 1UU3A 3RHXA 2YWVA 3WF6A 2X39A 3OXTA 3VUGA 3LVPA 4JQ8A 4J95A 4UMPA 2YM4A 4YJTA 1XH5A 4GKHA 3DQWA 2P2IA 1E1VA 3I5NA 3LFEA 3OWJA 4QMTA 3UO4A 4OLIA 1H27A 1P4OA 2HIWA 2WKMA 1OZ1A 2CGXA 3BEAA 2ZJWA 3BU3A 2VTIA 3EKNA 3O17A 1ZZ2A 3P08A 1UNLA 4FK6A 4EOOA 5TO8A 4GK4A 5CAVA 4E6CA 5AUTA 5CXZA 5I9VA 3RWPA 3QALE 4UY9A 1CDKA 3F7WA 3DOGA 3B2WA 4EOSA 3D7TB 3L9LA 5JGDA 3E8CA 4BYJA 3OY3A 3QQKA 4WG3A 2ZM1A 4FL3A 5DT4A 2WFYA 4PDOA 3EWHA 1B39A 4EKLA 3F5UA 3ZFXA 4PMSA 2B9HA 4YLJA 2X6DA 3UVQA 4FR4A 4FZAB 4ZTQA 2C5NA 4QTAA 2W96B 4KSPA 4O0TA 3EQFA 3S3IA 4BZDA 3JR1A 4OGRA 3LFFA 4DN5A 3ZZWA 1PKGA 4ZZNA 4KIOA 2YACA 4D5HA 4BCPA 3KULB 3QYZA 4MD8E 3LCTA 1UV5A 1XBBA 4F0GA 3O51A 3JUHA 4YTHA 2BZJA 5HU9A 5J95A 1Z57A 3P1AA 2LGCA 4JJRA 2GS2A 4E5AX 3KC3A 4LI5A 4QYYA 4IWQA 4HGLA 4CLIA 3NYOA 4QPSA 1R78A 4R3RA 2CSNA 4EOKA 4ZSGA 2C6DA 3ZHPC 4MCVA 3PFQA 3Q2JA 5IISA 4F6WA 2OZAA 4QP2A 5CT7A 3W2SA 2QOLA 2R64A 1OI9A 3UNZA 3DB8A 3WF7A 3OUNB 3C1XA 2FGIA 4ANBA 3G90X 2JLDA 3NUPA 4ZSLA 2BIKB 3CCNA 4LL5A 4BCHA 3MTLA 4FGRA 3HMMA 2F9GA 2WMRA 4IZ5A 5HBEA 4FKGA 4L9IA 2YITA 4ACMA 3DK7A 4AQKA 3SOAA 3D83A 1JOWB 4I22A 5C26A 5K0XA 2QNJA 5I9ZA 4FEVA 2Y4PA 4I6HA 4JDHA 2R5TA 4U42A 3ANRA 3MVHA 4XP0A 4NW5A 4QOXA 4EOJA 4O1OA 2X0GA 4LGDA 4FTCA 4O0XA 4QNYA 3JY0A 1J1CA 2F4JA 5A6NA 3IECA 4WNOA 3PJ2A 2RFDA 4OBQA 3OEZA 5AR2A 4EK3A 3HAVA 3EMGA 3KF4A 3KGAA 3NNXA 1ZAOA 1DAYA 3MJ1A 4WBBB 4ACHA 2ONLC 3NDMA 3TKIA 2ZV8A 2OF4A 4CFNA 5FDPA 2PUIA 4WT6A 5AP7A 2YN8A 3AC3A 3PE1A 1LPUA 1YXVA 1NW1A 2IPXA 3O50A 4UWYA 3R0TA 3KA0A 3BL9A 5L2SA 2UZUE 3Q4UA 5I9UA 5CF5A 1H0VA 3VHKA 4YR8A 1H07A 2C3IB 2H34A 4KS8A 1KV2A 1TQMA 4NTSA 3GU6A 3MBLA 3Q5IA 2JKQA 2C5VA 4RJ6A 4HYUA 2PVYA 4O4EA 4D1SA 1FQ1B 3R1SA 5L2TA 2QD9A 4LG4A 3SXFA 4IM0A 5TR6A 4XS2A 4NTTA 3U6JA 3V51A 4RQVA 3UGCA 4EOQA 1UNHA 4A4OA 1H01A 4YPDA 2CKPA 3P5KA 3HZTA 4EQUA 3G6HA 5D11A 2ZM4A 2CJMA 2ITVA 2XK3A 5IPJA 3R7YA 4YSMA 4BIEA 2YCSA 4OTHA 3U6HA 4X3JA 3AKLA 4LUDA 5D41A 4CD0A 3R71A 2F2UA 4FNYA 5CAPA 5HG9A 3RAKA 3EFKA 1O9UA 3PWYA 2GDOA 4GG5A 3WIKA 3ZC6A 5M08A 4QRCA 5ANEA 3ZSIA 3FKNA 1JLUE 3W2RA 4RX8A 5EM7A 4PNIA 4QYEA 2GPHA 4MF1A 4NSTA 5CEKA 3PG1A 4M68A 3OP5A 4L53A 4QMXA 2YABA 1QPEA 4FKVA 3LJ2A 2YEXA 3KVWA 4KIPA 3QRJA 4IIRA 3Q6WA 4NCTC 1H1RA 2BTSA 4QDVA 5M4IA 3PP0A 3ITZA 5I0BA 3WE8A 4IHPA 2XYUA 2HWPA 3ORLA 3A7HA 3SXSA 3UPZA 2BRHA 1J7IA 4UZDA 5IQHA 4YHTA 3W16A 4EZ7A 4EK8A 4G6LA 2UZWE 3DCVA 4HOKA 5LVOA 5HCXA 3HLLA 2J50A 1XH7A 4G6NA 4PX6A 4XRLA 3V3VA 4BCQA 3PP1A 3HRCA 4B9DA 4FIFA 4ITJA 3W0PA 2VO6A 3UDSA 1Q97A 5F95A 4RRVA 3TV4A 5B2LA 1JSUA 3UDTA 2QLQA 3PA5A 2YJRA 1J91A 2WEIA 3NUUA 2PE0A 3ET7A 3FLWA 4TYEA 5C8MA 5CALA 4DINA 4ANSA 4AZWA 2RG6A 2C1BA 2HZ4A 5EI8A 2X8IA 3LFSA 3PY3A 3LM5A 1G3NA 4BTFA 1IASA 4O27B 5IG1A 3BEGA 2OBJA 3A62A 2G2HA 5HLPA 3ZEWA 4AN2A 1IAHA 5AUVA 5IQBA 5IDNA 4UV0A 4YNOA 3VUIA 4BCFA 3EFJA 3FV8A 3G5DA 5CVGA 5KZ0A 3RM7A 2BAQA 3FDNA 4BGHA 5J8IA 1R3CA 5L6PA 5LOHA 4FIHA 5FTGA 2DQ7X 2B54A 3CGFA 2QONA 4IX4A 3QTQA 1BLXA 2C6IA 4FEUA 1M7QA 3CBLA 3EIDA 4JBPA 1VEBA 4L45A 2UW8A 5E7RA 3ZTXA 3VRZA 3DBDA 3GC8A 2AQXA 1UKIA 2WTVA 5AX9A 1BI8A 4IZYA 4E26A 2VTTA 5CU4A 4ACCA 3ERKA 3F66A 1WZYA 1FGIA 1YXTA 3LW0A 4KA3A 4NWMA 3UIUA 2H96A 2CKOA 4LDTA 3OS3A 3R21A 4WBOA 4C4FA 5IA4A 5LCJA 5C27A 3IO7A 3HDMA 4DC2A 4PMPA 4Z3VA 3W2QA 3KXZA 4R3CA 3C50A 3C4CA 4ERWA 2WOTA 3OCTA 4CKIA 3COKA 4WUAA 2V7AA 2XIYA 2X4ZA 4E73A 5DI1A 3FL5A 5FXQA 1O6YA 1Q5KA 4JQEA 3B8RA 5HICA 4HGTA 4ASDA 4J96A 4TW9A 4E3CA 2OZOA 2QODA 3KMMA 4FKWA 1O6KA 4RWJA 4EONA 3FHIA 2C5XA 3PJ8A 3TZMA 4C57A 4ZY5A 5JT2A 4E8AA 1FINA 3UVRA 4BC6A 4BCOA 5BNJA 2H8HA 3DAJA 4C33A 5K4IA 3EJ1A 3NCGA 5I9WA 2YLFA 3ATTA 1CKIA 4FTIA 4IFGA 3KMUA 5EHYA 3W0MA 4G5PA 4DGNA 5AA9A 4MNEA 5TOZA 5IEVA 3DY7A 3LXPA 1ZMUA 2V62A 3NNUA 3P79A 4ZTRA 4DH1A 1OIUA 5C4KA 5ETCA 4CZTA 4FEQA 3HRFA 1ZYLA 4TNBA 3ODZX 3EKKA 5CF4A 1RQQA 2GS7A 4EORA 4QPMA 4M69A 4D2TA 4O7YA 4MWHA 2X1NA 3AKJA 4EK4A 3ENMA 3POOA 1W2FA 1A48A 4GKIA 4I23A 4WD5A 3RZFA 4G5JA 3KL8A 2VTMA 3MPAA 3E63A 4KRDA 2I0VA 4C4EA 5KMMA 4C34A 2F7XE 2XUUA 4RC4A 1G8KA 2UZNA 1DI8A 3MFRA 3NR9A 4ERKA 4FA2A 3LXNA 3BHHA 2QG5A 3GVUA 3BWJA 4P90A 3FPQA 3BYMA 3EZVA 4C3RA 2CCHA 3CTQA 1OKVA 1TFFA 4I94A 4NKAA 3ZLSA 4DH5A 1RE8A 2XK4A 4PL3A 5HIEA 1STCE 3PIZA 4KD1A 3I79A 3IONA 5DT0A 1ZMVA 4CZUA 3E3BX 3H3CA 3LLAA 4F6SA 3VUTA 5CU3A 1MUOA 2WD1A 2WMTA 3MPTA 4NM3A 3TT0A 3V5PA 4BTMA 4F1MA 4U7ZA 3PXZA 3UZTA 3QLFA 4RIXA 5E1SA 2CN5A 4CCBA 3IW6A 4DBNA 3ORMA 2VGPA 3KXNA 2WTWA 4YZBA 3RM6A 4WG4A 1U4DA 2JBOA 3TUBA 3AD4A 3PRIA 4XOZA 3V6SA 2CGVA 3R7GA 3P7AA 1V0PA 3BE9A 3F69A 5AIRA 4APPA 5HO6A 2OJJA 3IGGA 2FVDA 3QA8A 3MI9A 5HG5A 3U51A 3VJNA 3NW5A 4AA5A 3PG3A 4V0GA 4DH8A 3U9NA 2PMNX 1YI4A 2I1MA 3RMFA 3EL7A 3DKOA 2WMAA 2G2FA 3FL4A 5HIDA 4ALVA 3CY3A 2R3HA 4F64A 1BUHA 4JR3A 3R9OA 5AEPA 2Z7LA 4FZ7A 1WVWA 4NKSA 3OT3A 2LAVA 1HCLA 3GFWA 3TJDA 1QL6A 5HX6A 2PMOX 2R3MA 2W7XA 2YCRA 3HA8A 3IW4A 1WMKA 3QTZA 4K6ZA 1NA7A 2W1DA 4FV8A 5EK7A 5KCVA 3BYVA 4F65A 5ETFA 2BMCA 4I20A 5KBQA 3QQGA 3PVBA 4X2JA 3WZKA 3MA3A 4LOQA 4BKZA 4QTBA 3NGAA 1UNGA 4BJJA 3GC9A 5E90A 3EN9A 3KK9A 4MXOA 1W2CA 4FODA 5AV3A 5HKMA 3ZRKA 4YU2A 3UOJA 3SXRA 2R9SA 4I4EA 2VWXA 1Q8YA 2G1TA 5F1ZA 1BI7A 3TXOA 2ZYBA 1XQZA 3C4FA 1OL2A 1KOAA 5HNGA 4EL9A 3LZBA 3F61A 4RFZA 4RIWA 3TV7A 1VLRA 2EXEA 3UJGA 4FX3A 4EZ3A 3TNWA 1REJA 5LXMA 3QAME 2CN8A 3F3ZA 4FV5A 4UWCA 1GZOA 5ANGA 4CTBA 3GCSA 4PUZA 4ONAA 4EWQA 1BYGA 3KN5A 5A3XA 2GHLA 3K5VA 4II5A 4ITHA 3AMYA 3NW7A 4F99A 2XNGA 4W4VA 4AXCA 2VTPA 4NYEA 2R3FA 3DJ7A 4UYNA 5KE0A 3NEWA 4AZVA 2YAAA 4N6ZA 3S00A 5BVNA 5J5SA 2ZVAA 3LQ5A 1W82A 3LCSA 4FTRA 3IS5A 4BDKA 3DNDA 2I0HA 5J1VA 3R28A 4FIJA 3Q53A 4MAOA 5KMKA 5IQCA 2J0KA 3OMVA 3II5A 4IDTA 4U81A 4L42A 5DRDA 3A7IA 4AAAA 2Z7QA 2R0UA 3DPKA 5AR8A 3NYXA 5E8YA 2Y8OA 4L00A 4O91A 1SM2A 4Y46A 3EYHA 4YJOA 3ZONA 5BUJA 5DOSA 3BLRA 2ZOQA 5EW3A 3I0QA 5M06A 1F3MC 3L9MA 1PYEA 2OJ9A 5GIOE 4EJ7A 1JPAA 2HCKA 3VULA 3PE2A 2XA4A 4AGCA 4EH4A 5L4QA 3P7CA 3ORXA 3LMIA 3E62A 2VWWA 4MWIA 2WMSA 5CQUA 4MBIA 4KKEA 1PMVA 3ZFMA 4ZY4A 4BHZA 4Z55A 3E8NA 5HTIA 2UV2A 2X2MA 2XKDA 2X9FA 3ZSGA 4XP3A 3MVJA 2O63A 3R04A 2EUFB 4QP8A 1Y8YA 3OCSA 3VUDA 3HDNA 4FTMA 2VTLA 5AUWA 4RIOA 4U3YA 2FB8A 1KE9A 4YJVA 3SD0A 2REIA 4FVQA 4IEBA 4YJUA 4I6BA 5ANOA 4WSYA 3CS9A 4M0YA 3U4WA 3PA4A 3FMKA 3KU2A 1ZWSA 5DN3A 4FKUA 1PXOA 2EB2A 1KV1A 2VO3A 3QA0A 4I0TA 3ZYAA 5AIKA 4APCA 4KUJA 4BR3A 4XG7A