2W9ZB

Crystal structure of cdk4 in complex with a d-type cyclin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
291
structure length
287
Chain Sequence
ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALAPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Cdk4 in Complex with a D-Type Cyclin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords G1/S-SPECIFIC CYCLIN-D1
total genus 61
structure length 287
sequence length 291
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2w9zB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2w9zB01
4A9SA 4GKHA 1WAKA 4XYFA 2B55A 4IX3A 3ORIA 5CVGA 2JITA 1JAMA 4YSMA 4W4YA 3A7FA 4FIIA 3HRCA 3P86A 2HZIA 3CTHA 4U45A 3DZQA 3K5VA 5JGBA 5AP0A 3MPTA 4ANNA 3EYHA 4ZTHA 4EH6A 3F3UA 5LVOA 3Q4CA 4DEDA 5HIEA 2RFEA 2QOFA 3KN5A 4GS6A 5J8IA 4RIXB 4EZ3A 2XCHA 5HORA 5JGAA 2OH4A 4BCFA 5AP7A 4EHEA 2I40A 5ETCA 3VBXA 4YBJA 5DR6A 1FVTA 1MQ4A 3ZZWA 4TYJA 2ZAZA 4M0ZA 4M68A 4AN9A 2E9VA 3AC1A 3FPMA 4TT7A 4LFIA 4JI9A 5J9LA 5KKRC 5AV0A 3ZBXA 5M53A 5AEPA 5AV1A 4F7NA 2GTMA 3FKOA 3R21A 2YAAA 4FTQA 5H2UA 3HAMA 3P7AA 2R3KA 3PFQA 2YCQA 2QQ7A 1UNLA 2OW3A 4F9CA 1PYEA 2B7AA 2UZEA 2WTKB 3GCSA 3H30A 3LFSA 5I9WA 4LI5A 2PU8A 3ZM9A 3R00A 3R8PA 1B39A 3FHIA 3HZTA 3SVVA 2B9FA 3WF7A 5HCZA 3TNQB 3O17A 4IB5A 5E8ZA 3RHXA 2PULA 3F5GA 4H1JA 1YWRA 3PJ1A 5AX9A 2C6DA 3FUPA 3UG2A 5I9VA 1CMKE 3SG8A 4L6QA 4IAAA 2C69A 2XKDA 3TZ9A 1SNXA 2IZUA 3LCOA 4BCQA 3R7EA 5GIOE 4D2TA 1DAWA 2RGPA 3AMYA 3BLQA 2YM3A 4YPDA 4X2GA 3LFCA 1H1RA 4K9YA 4M3QA 4E26A 2CN8A 5FTGA 2FO0A 3V5JA 1OKZA 3VUGA 4Z16A 3UODA 2CCIA 3KL8A 3LFQA 3P79A 4M13A 4MXCA 5L2QA 1V0BA 4W8EA 2O5KA 4APPA 2GS2A 2JIIA 4X21A 5EKNA 3VS4A 4DTBA 1TQPA 2VWYA 2XBJA 5CEIA 3KB7A 4XG8A 3K3JA 2C5XA 4BDAA 3H0ZA 2B54A 3QLGA 4GVAA 5JFWA 3QLFA 3U9NA 3JUHA 1U46A 4L8MA 4FICA 4HNFA 4J7BA 5L6OA 2X4FA 3R71A 4O7YA 5CI7A 4E20A 3FQSA 1JOWB 4KBKA 5FXSA 3GI3A 3P78A 4IB3A 4I94A 4K0YA 4AOJA 5HESA 1BYGA 5CU3A 2XEZA 3OTVA 5DI1A 4FVRA 4D2VA 4DLJA 3DNDA 4ANMA 3CGFA 3R6XA 4TWOA 3NNVA 2WNTA 1Q3WA 5KZ0A 2HELA 3O7LB 5AIRA 3U4WA 4S34A 4OTWA 4G1WA 2RFSA 1SM2A 3BHVA 2R3QA 2G2IA 4MYGA 1CTPE 3LM0A 4ACHA 2F4JA 2R9SA 3C51A 1R3CA 2C3IB 1YXVA 3P9JA 5EM6A 3DY7A 2XRUA 5I9UA 5J95A 3QA0A 4BDEA 3EN9A 4EQMA 3C5IA 3R1YA 2HAKA 4YPSA 5J87A 4UWYA 4CLIA 3ZSIA 1M7QA 1WBPA 4MK0A 2UZLA 3PXKA 3R7UA 3B2WA 1JPAA 2VGPA 3OWLA 4PY1A 3U87A 5G1XA 2O8YA 3NUNA 3KMMA 4I3ZA 3BU6A 4MXZA 4V0GA 4RWJA 4DGGA 4E5AX 4E6CA 5A46A 3S3IA 4QTEA 5E8TA 4QMXA 4G3GA 3I6WA 3OCBA 1XBBA 4BCOA 4D4VA 4DEEA 5HX8A 2YIQA 3QGYA 2HOGA 2OZOA 4ZY6A 3T3UA 1O6LA 4Y8DA 4FYNA 3R7OA 4IFGA 2G2HA 2GNJA 3G0FA 5C03A 3QF9A 2XJ1A 5M4UA 4FKWA 3I0QA 4XV9A 2IZSA 5D41A 2H8HA 4IB0A 5TKDA 1K2PA 3PLAE 1BX6A 1V0PA 4P5ZA 4D0WA 3QUPA 5J9ZA 2SRCA 5LOHA 3OBJA 2JBPA 4R7HA 4H3BA 2XA4A 4L53A 4CMUA 3NDMA 3KULB 1ND4A 3HP2A 4RC4A 1H1QA 1OI9A 4O38A 4V0GB 4JQ8A 4PV0A 4AWIA 3TN8A 2Q0BA 1GY3A 4IVDA 5FP5A 3F2NA 4R8QA 3R9DA 3UIMA 5BUEA 2ITQA 2YCFA 5DA3A 4AA4A 5CXHA 4BCIA 3V8WA 1ZOGA 4FMQA 4QQTA 3A8XA 5IEYA 4C35A 3VS2A 3MH0A 3CQEA 3L9PA 3TDVA 1RW8A 2XRWA 3M42A 3DPKA 4BB4A 4QNYA 4HZRA 4JIKA 4F99A 4S30A 5EHOA 4OAUC 2YERA 3LLTA 1YHWA 3UIUA 4R77A 3VJNA 3OEFX 1VR2A 3Q53A 4PMMA 5IUIA 5EOBA 3QKLA 1RQQA 3R02A 1KV2A 4I22A 4XOZA 4EK5A 2VWZA 4U0IA 1REJA 4WA9A 4YZNA 1OZ1A 1UNGA 5M09A 2PZIA 2OJIA 4XG6A 3R8UA 2C0OA 2F2CB 1UV5A 4QP7A 2IO6A 4HNIA 3ZUUA 3FMLA 3GGFA 3CPBA 3GVUA 3ENHA 4FKLA 2ITXA 1DI8A 3ZRMA 3HRFA 3LFEA 4FC0A 3HMOA 5HBJA 4UN0C 2JIVA 4JAIA 4XG3A 2W1FA 4M66A 4RLLA 2FUMA 2C5VA 3KC3A 4GK2A 5H8EA 3TKUA 3R8MA 4NJ3A 4RJ8A 3PVWA 4O2PA 5AP5A 4AU8A 3BYVA 4BYIA 4IMYA 4RWKA 3ZO2A 4IDTA 4J8MA 4ID7A 3O8TA 3CD3A 3T9IA 4D2WA 4CLJA 4XG2A 4QT1A 5M55A 2R64A 4G5JA 4AA5A 3W2SA 4BCMA 4EOIA 4GK4A 3DTWA 2GU8A 4C58A 4JDHA 3V6SA 2P2HA 3MVHA 3Q3BA 4J96A 4FTCA 4DBXA 3TV7A 3WYYA 5DE2A 4E3CA 1PMEA 3C0IA 4HVSA 2J4ZA 4IVAA 1A06A 4FKQA 1AD5A 3RJCA 4HVHA 4X3FC 3C4ZA 3EQHA 1Y8YA 2VO6A 4A4LA 3OWKA 2HZNA 3H0YA 5DHJA 1S9IA 5EYKA 2O3PA 1G8AA 2BUJA 5AX3A 3FMDA 3UVPA 4FTLA 4BIDA 4Y5QA 3KK8A 4K77A 5A4QA 5EQEA 1BMKA 2LGCA 2W4OA 2XB7A 2ITPA 3CKWA 4XHKB 2O65A 4IQ6A 5AUZA 1UU3A 4I5PA 2CGVA 3BCEA 4JLCA 4C7TA 5L3AA 3PPJA 2BZIB 4AGDA 1KOBA 5EDPA 2JKOA 3LFNA 4MAOA 3ZS5A 3IONA 2CDZA 3KF7A 3PZEA 4J98A 3NIEA 4NWMA 3RZBA 4YTCA 4RRVA 4V01A 2QO2A 5LQFA 5ETFA 1IR3A 2Y4PA 3NEWA 2WMVA 3IPHA 4XG4A 2C3LA 5I5ZA 5TF9A 3LLAA 5AR2A 4QMVA 4ENYA 2IVUA 5IDNA 4O7NA 2X7OA 4I0SA 4W8DA 3C1XA 4NH1A 4RIWB 4CKRA 2Z02A 3O8UA 3OXZA 4FBXA 2BR1A 4CRLA 2HY0A 4XRJA 5F1ZA 2X1NA 3E3BX 4WBBB 3VF8A 4EEVA 1Q8TA 5CSXA 1WCCA 2JDRA 1NY3A 3EFJA 3R63A 4N70A 4O22A 5EKOA 3UP2A 3ZXTA 4A4OA 4MVFA 5K3YA 3NYVA 5CNOA 2W1ZA 1H0VA 3COKA 2OZAB 2WTCA 4F08A 2C1AA 4IX4A 4AW1A 1GOLA 2QLQA 4YU2A 2I7QA 4R7BA 5AR5A 3RCDA 2WMQA 4WT6A 5CI6A 4WOVA 4E93A 4YJUA 5CF8A 5IA3A 3TUBA 5DEYA 2UZUE 3BYOA 3TZ8A 3W2QA 1O6YA 4HVGA 2XK9A 3RP9A 2O0UA 4P7EA 2CLQA 5HE2A 4BHNA 4RFYA 3WZUA 4ACMA 2C0TA 3GC0A 3QCSA 4YNEA 3QUEA 5EI8A 3ZLWA 3F5UA 3S95A 2JEDA 5HTIA 3QXPA 4UMQA 3VVHA 4O6EA 5AV2A 4EOMA 2DUVA 1BL7A 3B8QA 3KXGA 2G15A 2YM6A 1OBDA 3NNWA 1KE5A 3FEGA 1X8BA 1QPDA 4E5WA 4QMNA 1SZMA 4O82A 4O0YA 4OTGA 3ATTA 2E9PA 5I0BA 2HXLA 4M67A 5I3RA 4DEIA 2C30A 3UNKA 2UW6A 3F5PA 4TWNA 4BDIA 4C4HA 4S32A 4XMOA 2ITUA 3O50A 4WHZA 3EQGA 1ZYSA 5DG5A 3P4KA 1LEZA 3ORPA 4FEWA 1FGKA 1M7NA 3OUKA 1R0PA 3KXXA 4CV8A 4TY1A 3ETAA 1Y6AA 3CXWA 5CEMA 4FTUA 2UZWE 1YRPA 4UV0A 3D14A 3G9LX 4EUTA 1UKHA 2Y9QA 4ONAA 1LPUA 5E9EA 4QMOA 2PUIA 4XX9A 3FMJA 4UMTA 3HV6A 2WMBA 4U80A 5LWMA 3BV2A 2RG6A 3QTUA 2REIA 4O1PA 4U40A 4D0XA 4DEAA 5ICPA 4DC2A 3SHEA 5B0XA 1OL1A 4FL3A 3SXSA 3GNIB 3NMUF 1HCLA 2XM8A 4KA3A 4MX9A 2PWLA 1W83A 2XVDA 3DAKA 3HP5A 5M51A 3BX5A 2YWVA 2OWBA 2QNJA 3IOKA 3SRVA 3VBTA 3QD2B 3ZFMA 2E9NA 2VTLA 4XCUA 2ITNA 3HECA 4K33A 4X3FB 3THBA 4FV9A 4O7RA 4RX9A 4RX8A 3PYYA 4YUQA 4QP4A 3O71A 4ZMEA 3CC6A 4YLLA 2GQGA 2XM9A 2CKPA 4TKSA 3NVMB 4CG9A 3AXWA 3LMGA 5EDRA 5CASA 3L8SA 3VBQA 4EYMA 1H1WA 2WELA 2W1DA 3ZHPC 3BKBA 4ASZA 2R3GA 2VTSA 3V5PA 4IANA 4NL0A 2X9FA 3E62A 3NW6A 4C2WA 4EWHA 1PRYA 5IA1A 3NX8A 1YHVA 1F5QA 3CKXA 3VJOA 4EOSA 2QR7A 3HDNA 3CGOA 4BKZA 3TZ7A 3BELA 1DS5A 2WD1A 4R6VA 3QL8A 4CKJA 3TM0A 1J7IA 4HZSA 1OKYA 3RCJA 2IW6A 3GQIA 4JT3A 1QL6A 3QD3A 4NCTA 1J91A 2BDWA 5FRIA 3W2PA 1P2AA 4R3PA 3E87A 2CNQA 1YI4A 3EZRA 4MNEB 2BPMA 3ORTA 4K11A 2XH5A 4MBLA 5K0KA 1WBTA 5IH5A 4EJ7A 3GFWA 3FWQA 3C4CA 3MIYA 4R7IA 1OUKA 1WBNA 4F6UA 2J5EA 2OI4X 4QYGA 4R3RA 2E9UA 3SW4A 1XQZA 5CAVA 3B2TA 1SYKA 3OZ6A 3ZU7A 1VJYA 1PXLA 3E64A 2ZM4A 2C5OA 3COIA 2W9ZB 4D9TA 1OIRA 3G90X 4LM5A 4EOPA 3PXRA 4WSYA 3FQEA 4M12A 4Z7GA 3FJQE 5JRSA 3OUNB 3A4OX 3NNUA 4G6NA 3UNZA 3AT3A 2J2IB 3TWJA 4DN5A 3AD5A 5ETAA 2PMLX 4HJOA 4JAJA 5AV3A 2CLXA 5E90A 2PZYA 3QCQA 5ANDA 5BVEA 1W7HA 2WB8A 3QWJA 4LMNA 4U44A 4FEVA 5AUWA 3FC1X 4MF1A 5BVFA 4BGGA 3MYGA 3F2RA 3NYOA 4FIJA 2VWWA 2P33A 3BYUA 4MEDA 4X3JA 4PNKA 5K5XA 3E8CA 4JL9A 5EYMA 4LV5A 3FLSA 4UXQA 4TYHA 1GIIA 4IM2A 2GNGA 5AUYA 4OAVB 2XK8A 1K9AA 2ZB0A 5CU0A 2PZPA 4F70A 2VWXA 1Q24A 5CT0A 3R8LA 1WBOA 4I0TA 3V5LA 2JGZA 4I5HA 4F9AA 3BYSA 2XNEA 4ANQA 4R78A 1IRKA 4U9AA 2AC5A 3NUAA 4EK6A 2YCRA 3B8RA 3C0HA 4G9RA 1IAJA 3ZO3A 2R3PA 2QKRA 2NRUA 3H10A 4JG7A 4JR7A 2YIRA 3RPYA 5M4CA 4L01A 3MVLA 4DG3E 4NIFA 1VEBA 3EHAA 4BTFA 4EBVA 5C8KA 3NLBA 4PMPA 1O9UA 2R3NA 3FC2A 4D9UA 3UYSA 2VGOA 4TWPA 2X81A 3ITZA 4NW5A 5C4KA 1YWVA 2VTJA 2WQBA 3PLSA 2XK6A 4BHZA 4X6QC 5AP6A 4YZDA 4ZEGA 2E9OA 4BI2A 3R9NA 4ZLOA 3E63A 4Y83A 4DGMA 4XJ0A 3KGAA 3HV4A 4FYOA 2X4ZA 2JDTA 2QHNA 2R3MA 2YCSA 2KTYA 4E1ZA 3BE2A 1FPUA 2H34A 1FOTA 4KAOA 4U97A 4O1OA 1JSTA 4DH8A 4IAFA 3EZVA 4FL2A 4QTBA 3A7HA 5CWZA 4DYMA 3W8QA 4CMTA 2GHGA 3AQVA 2WTIA 1OL7A 2ITTA 5JFVA 3MDYA 4U79A 2C6OA 4U5JA 5FTQA 2J50A 3VNTA 4CFNA 4F9BA 3RWQA 4QMWA 4LUEA 3PIXA 4PL4A 5EDQA 3ZEPA 1CM8A 3RZFA 1PY5A 2DS1A 2IVVA 3FBVA 4V05A 4C61A 2GNIA 4PDYA 5GIPE 1PHKA 2WU7A 4G2FA 3IKAA 5CEQA 5DWRA 3DKOA 3P7CA 1NVRA 2JIUA 4QRCA 4CFMA 4RC2A 2VTQA 4RQVA 4O27B 3W10A 4C4GA 1RE8A 2VV9A 5JRQA 5KMIA 3PY3A 5TE0A 5M57A 4M69B 5FDXA 1U54B 4R3CA 3PRIA 4NTTA 4LRKA 1BKXA 4PRJA 4RFZA 1XH5A 4JVGA 4LL0A 1CKPA 1ZYJA 3E5AA 3NUXA 1XWSA 3DTCA 3Q4ZA 3QTIA 3UOHA 3UIXA 5LXMA 1JLUE 4B7TA 1PXPA 4OTHA 4UZHA 5EOLA 2CKOA 5M08A 3DCVA 3MH2A 3PZHA 2BDJA 5EI6A 3DXNA 4N4SA 3G2FA 4C0TA 4DEBA 5AM6A 2JC6A 2WTKC 2UZNA 2J9MA 3Q4TA 4KABA 1H8FA 3M2WA 4BDCA 4QMMA 4OTRA 5IQIA 3N4TA 2BTRA 3UTOA 3OCGA 2Z7LA 4FT3A 3OCSA 3E88A 5HHWA 3D2KA 3A8WA 3N51A 1XJDA 3PA4A 3LFBA 5HCYA 2I0HA 4FNXA 4RWIA 4W9WA 4JRNA 2UVZA 3IDCA 2BILB 3ACJA 4WG4A 3NPCA 4Y5HA 4DHFA 4ERWA 3QHRA 3QGWA 5HE3A 5IU2A 2W5AA 3D5UA 3HGKA 4FTAA 4CTBA 4JR3A 5EK7A 3HYHA 2OGVA 4JQ7A 4LV8A 4QMPA 3A7JA 3MJ1A 4IVBA 3UJGA 1Z9XA 4APCA 4ZTQA 4RC3A 4C8BA 3LMHA 4DGOA 1Q61A 3UIBA 3KRLA 3EKNA 3IGGA 3KEXA 4AP7A 1M17A 2ITYA 1OB3A 2YLFA 1TKIA 4PL5A 2Y4IB 2F7EE 4NM5A 4XV3A 5D12A 2EB3A 5E1EA 3Q9YA 5AP2A 3UG1A 4QMUA 4IBMA 4PWNA 4DFLA 4F0GA 2C5YA 3DLZA 2CKEA 4XV2A 5FWKK 3PP0A 3SD0A 3ZLYA 4G9CA 4F1OA 2P3GX 4ZAUA 3CTQA 4DF3A 3WIKA 3BWFA 5IQAA 3Q52A 4PTCA 4I0RA 1EH4A 3E92A 4KIQA 4K18A 3SX9A 5HO6A 3T9TA 4ZJIA 4K2RA 4GG5A 3RTPA 2EXMA 4P4CA 3FPQA 2FSLX 2RG5A 5J1WA 2BAKA 2EUFB 2OICA 4OTPA 3UDBA 2VX0A 4DFBA 4FI1A 2HYYA 4ZLYA 1URWA 2YM8A 2UW7A 3NR9A 3GC9A 3FY2A 4NEUA 3DFCB 2F57A 4AW5A 1IG1A 4U42A 4ZK5A 2UVXA 1YXXA 3E7OA 4BIBA 5C8MA 2ERKA 4M7IA 4ZS4A 4G3CA 3DZOA 2VWIA 3MI9A 4KS7A 3FE3A 4EUUA 3QRJA 4AT4A 4RGJA 2C47A 2JKMA 3C4WA 3V51A 2E2BA 2JBOA 4L44A 5KUPA 3VW6A 1UA2A 4Y95A 2ZDUA 2H6DA 3RNYA 5GJFA 3G51A 3GCQA 4HVIA 3BQRA 5AMNA 3IECA 5HE1A 3EFWA 5BX0A 5GZAA 5HVKA 5HQ0A 4IE9A 4MTAA 3V01A 4NFNA 4BTMA 3NUYA 3DQWA 2J0JA 4II5A 3MBLA 3U6HA 2PMIA 2GDOA 4Q5EA 3WARA 3FMEA 4B99A 4HOKA 1PXJA 2OZAA 4QPMA 3NUUA 1JSVA 3KU2A 5JN2A 3LHJA 1WVYA 4EK4A 4GW8A 2VTPA 1OKWA 1F3MC 2BMCA 2YDIA 4U3ZA 2BTSA 1GZOA 2ZM1A 4MH7A 3DKFA 3ZLSA 2JDOA 1V0OA 2AUHA 2OJGA 5F4NA 3LMIA 4I93A 2BZHB 2X8IA 4BGQA 1S9JA 3EQDA 3O8PA 1QMZA 1YDRE 5GHVA 4F1MA 3DLSA 3QTSA 3R1SA 4NYEA 5AA8A 1VZOA 3MFTA 4GYIA 4H05A 4GJ2A 3L8VA 2J5FA 3Q6WA 5EW3A 1XH9A 3D0EA 2VUWA 3EQBA 3SC1A 3OWJA 3LFFA 4F1TA 5J7HA 1P4FA 4C36A 2FYSA 4BGHA 5KMKA 2JAMA 1OKVA 4QTCA 4F7JA 2OU7A 5HKMA 4EC9A 3PXYA 5BPYA 3VUMA 5FEEA 1AGWA 3TNHA 5JFSA 4FSZA 2UZOA 1JKSA 3WIGA 3VQUA 2YDKA 3ORLA 4RVLA 1JBPE 2J0MB 5BQ0A 5AJQA 2NO3A 4QP3A 4DH5A 2XCKA 5HD7A 2AYPA 3R30A 4FKIA 3ZDUA 2BROA 4BC6A 3QQGA 4BN1A 3GXLA 2UW3A 5CU6A 4CFXA 5A14A 5G6VA 1SMHA 5C4LA 3DGKA 1F0QA 3RPRA 5E8WA 3U4UA 1R78A 2B0QA 3HA6A 4CZYB 3UZPA 4BCHA 4K8AA 2Z8CA 3FZ1A 2YN8A 3ELJA 5CZHA 1FVVA 4EBWA 5I3OA 1FGIA 3VAPA 4C4IA 2XK4A 2YZLA 5EQPA 2QVSE 3ORMA 2WMUA 2XNMA 4MXOA 4WIHA 4YNOA 4AX8A 3COHA 4FG8A 4MBJA 5DT3A 3SLSA 3Q04A 3MJ2A 4EWQA 5L4QA 5C01A 3DV3A 3GT8A 3DNEA 4O0TA 3KCKA 3BLHA 2YM7A 4LG4A 3CQWA 3EJ1A 5H9BA 1SVGA 4UY9A 2WQOA 2XKFA 4YJPA 3O96A 4FNYA 3NW7A 4KKGA 4RPVA 3QRKA 2UW9A 4FR4A 3RAHA 2HWPA 2ACXA 3F7ZA 5CSVA 4EK3A 4XP3A 4BZOA 4G17A 5HBHA 3LFDA 3LQ3A 1V1KA 4GH2A 1H25A 5HD4A 4XNEA 4N57A 4RZWA 3COMA 3ATSA 4R1VA 3W2CA 4FL1A 3FI3A 3QTRA 3F66A 4FSRA 4LUDA 2G1TA 2QG7A 3WE8A 3DJ5A 1WZYA 4BF2A 4DG0E 2YJRA 4IACA 3DJ7A 4BDKA 5D1JA 2BKKA 2BAJA 4WBOA 3A7GA 2WGJA 2JD5A 4ENXA 5LVMA 3GEQA 1Z57A 4I5MA 3V8SA 4U7ZA 4QO9A 4DH3A 2YHVA 3I60A 5FD2A 1Q97A 3VIDA 4FVQA 4RJ6A 4YO4A 3N4VA 1ZMUA 4I6HA 3UBDA 2QHMA 4O0VA 3K5UA 3R04A 4EOJA 1IAHA 3KF4A 5HEZA 3UZRA 2YIXA 5KMOA 2WU6A 2Q83A 3CTJA 3IW6A 3QAME 5J79A 2QOQA 2W9FB 3FL5A 3MB6A 4EZ5A 3TNWA 2QOCA 3LJ1A 3NCZA 4DFXE 3VS3A 3A2CA 5I4NA 2VTMA 3LPBA 4GIIA 4TL0A 3VRZA 4USFA 2A4LA 3I81A 1ZZLA 3CE3A 2B4SB 3RI1A 3RKBA 4FT9A 5C26A 1RDQE 2A2AA 4X2KA 3TJDA 5AADA 3V5TA 4FTNA 3QC9A 2O63A 1ZMWA 4YGAA 2WQEA 3EL7A 4M69A 3U6JA 5DVRA 3DKCA 3JR1A 1JQHA 5CVFA 4DT9A 1ZRZA 2GFSA 4ZSAA 4BZNA 3ORZA 5HVJA 5LMKC 2ZMCA 3WZDA 2X8EA 3NGAA 4CRSA 2XP2A 3QTWA 4RG0A 4LQMA 3EN7A 3FYJX 2OIDA 1OPLA 2BFXA 4O7LA 2J90A 4B6LA 3GCVA 5AR3A 5IQHA 2V62A 4XOYA 3BHUA 3OCTA 3MY1A 4JOAA 4C3PA 1PMNA 4FEQA 1XH7A 3EN6A 4RJ5A 2IJMA 4CFUA 2QO9A 3F69A 1K3AA 3SXFA 1AQ1A 1UU8A 4G16A 3D5WA 4MD9E 5J1VA 4G31A 4W4XA 5CT7A 2F2UA 1CKIA 2CMWA 4IIRA 3C7QA 3FQHA 3QQHA 5FQDC 3IW7A 4KWPA 2OXDA 3CS9A 2VD5A 3UPZA 4FKRA 3NUSA 3OFMA 4QMZA 5HI2A 4NM0A 4D1XA 4A7CA 5HG7A 3PIYA 4FZFB 3ZBFA 1OPKA 4H3PA 1B6CB 4M8TA 4E4LA 4EYJA 3DKGA 2Z7RA 3QX2A 1MRUA 5JT2A 3ZYAA 2HZ0A 1WVXA 3MS9A 1Q8UA 4H1MA 3LOKA 1NT2A 3BE9A 1GZ8A 3Q2JA 2ZMDA 2IVTA 2F7XE 3GCPA 4D28A 3HUCA 3TXOA 3ORNA 4C4FA 3P08A 4J97A 4I4FA 3BRBA 3L8XA 4FTMA 4I6QA 5HICA 4RMZA 2VTRA 4I1ZA 4C57A 3RPOA 3A61A 5DH3A 2OBJA 1CDKA 3RK7A 3BEGA 3ZSHA 5CANA 4OLIA 1U54A 4BDFA 5HTCA 5K0XA 2WTWA 3SA0A 5L2IA 3SW7A 3PJ8A 2YFXA 4IADA 3QWKA 2R4BA 3CY3A 5HLPA 5A4TA 1U5QA 1FQ1B 4JIAA 4AN2A 2RIOA 4LRMA 4EH9A 1UWHA 3R22A 4RSSA 4KUJA 3IK3A 3IW8A 1KV1A 3D7TA 3ORKA 4IB1A 3VS5A 2Z7QA 4JBOA 2UW5A 1Q4LA 4W9XA 2WIPA 3CQUA 5CF4A 2IZRA 3BHYA 4C34A 2GNLA 5ANJA 3Q96A 4OTFA 3HMIA 3W2RA 2ZDTA 3FSFA 1P4OA 4EHZA 4G5PA 4YZ9A 4UWBA 2PMNX 4H3QA 5AP1A 5GINE 3NVKI 4E8AA 3QQKA 5DT4A 3KXHA 4AZFA 3MSSA 1Q5KA 2JAVA 1DM2A 2PTKA 1PJKA 3CD8A 2VZ6A 5JSMA 4KSPA 4MD7E 5K9IA 5F20A 3ZONA 2BHHA 4FKJA 2VTAA 4D5KA 3PP1A 5GNKA 5JZNA 4GEOA 1MQBA 3P23A 3D7TB 3EQPA 4XLIA 1YOLA 4CYJA 3LFAA 3PXQA 5J9YA 3FZOA 4FNWA 3R7YA 3SQQA 4IH8A 1HOWA 1XBAA 4E6AA 5A4EA 1FMOE 2A0CX 3DB8A 1WBSA 2C6EA 4FV2A 1ZYCA 3R9HA 3OY1A 5AUTA 3MA3A 2YA9A 3DU8A 4C33A 4XV1A 1OMWA 1LR4A 3VUHA 3W55A 4ACDA 3AD4A 2CJMA 4DFZE 3RAWA 2WMWA 3G9NA 3IG7A 5KE0A 2UUEA 2J0IA 4UYAA 4GFMA 4BCPA 4OBPA 4EOOA 4F63A 2I1MA 2BKZA 4YZMA 1PW2A 3S1HA 4HCVA 4FKPA 4GU9A 2R3LA 3FLYA 3PWDA 5A3XA 1ERKA 3RGFA 4QYHA 5HLWA 1QPCA 1JVPP 3SOCA 2GNFA 3SOAA 4ZJJA 4KSQA 5A6NA 1ZYDA 4CZUA 2PVKA 4YTIA 1Q99A 4XG9A 3QCXA 2RFDA 2VRXA 4ITJA 2W17A 5IQEA 3G0EA 5C27A 4RVMA 2W1IA 4CFWA 5FXRA 4RJ4A 1OECA 2HW6A 4EOLA 1O6KA 2VWUA 3UO6A 1YHSA 3KXNA 4XLVA 3MW1A 1XHAA 2P2IA 3MIAA 3NNXA 4FA2A 5M56A 4J53A 3ID6C 3MV5A 3HDMA 3UOJA 3UGCA 2PVJA 2QOBA 5FP6A 5DPVA 3KY2A 1YXUA 1Y6BA 2I0EA 3TIYA 4ZSJA 1OITA 4FT0A 4FV4A 5CAPA 4GK3A 1NA7A 4CXAA 3CIKA 4O96A 2PUNA 4DEHA 2Y6MA 1UKIA 3EN5A 3TIZA 5C8NA 2BZJA 4HGEA 4AGCA 2VTHA 3IDPA 2FSMX 5E8VA 4E73A 1H4LA 4PQNA 2R0UA 3RVGA 4ZP5A 4ANSA 5DR9A 3N4UA 4L45A 4QPAA 5E8YA 4FTKA 4ZIMA 3WF5A 3ODYX 4D5HA 4FTTA 1VYWA 3JYAA 2PL0A 4WRSA 3D83A 5TOZA 4KBAA 2QU6A 3LAUA 4PMSA 5B2KA 2B9JA 4ITIA 1OL6A 2VTIA 4U6RA 2FH9A 2QODA 3ZM4A 2HY81 3MFUA 2JFLA 5JQ8A 4DTAA 1P5EA 4A9TA 4NKSA 2XZSA 3FLWA 4WSQA 2C3JA 3TT0A 4DITA 4ZS0A 3QD4A 2IW9A 5IEVA 4XRLA 1BI8A 2CCHA 3ORXA 4FTJA 3GENA 3ZLXA 4HYIA 2WMXA 3R28A 5EFQA 4J71A 3FL4A 5CTPA 4BBEA 4FIEA 1GIJA 1ZARA 2A27A 5HG8A 3QFVA 4AZEA 2X0GA 4BFMA 3TI1A 4L52A 5JEBA 3AC2A 2A1AB 2ETKA 2VWVA 4PF4A 1NW1A 3O0GA 3VHEA 1R39A 2GS7A 2UZDA 2W7XA 2QURA 4C4EA 2QO7A 4HGTA 4I21A 4TNBA 3UOKA 3BPRA 4IZ7A 4G6LA 3ODZX 2I0VA 3CCNA 3CLYA 3PVBA 3TL8A 3I5ZA 1U59A 4Z3VA 3Q4UA 5CSPA 3BGPA 4ARKA 5IQFA 3HVCA 4ACGA 3Q60A 5E8SA 5A4LA 1LP4A 4FIHA 4YHFA 3OS3A 3Q5ZA 2ERZE 2P0CA 4BBMA 3SKCA 3BHHA 4AGUA 4YTFA 2ZV7A 4GCJA 3UMXA 5LVPA 1OPJA 3R7GA 2HENA 2DQ7X 2QOIA 3HUBA 4IAIA 4C4JA 2PY3A 5L2SA 4MXXA 4FV3A 3R9RA 1H0WA 4CFFA 1GZKA 2B9HA 2BDFA 4W4VA 5BUIA 2WXVA 4CT2A 4FF8A 2OXYA 4D1ZA 3HLLA 3Q6UA 2R3JA 3C0GA 5BUJA 2DYLA 2X2KA 1KSWA 2UW0A 4DFUA 4KKHA 2BIKB 3OXTA 4ANBA 2WZJA 1JKLA 3GOPA 2OXXA 5EHLA 4EONA 3OW3A 4YZBA 5CY3A 5HZNA 1XO2B 3C9WA 3PIZA 5HNGA 4C38A 3NRMA 4CTCA 3FZTA 3F3WA 2Y4IC 3U8WA 2PVYA 3DBCA 2HXQA 2QOLA 5CU4A 5DOSA 2X8DA 1W0XC 2FSOX 4NCTC 4UZDA 4UMPA 3GU6A 4NFMA 5AAFA 3WZEA 4A9UA 3EYGA 2QCSA 3GU4A 3VS0A 2GSFA 2ITWA 4Q2AA 3PA3A 3PY1A 4AFEA 2YM4A 4F6SA 3HX4A 3R0TA 5CF6A 4IX6A 3RM7A 3QRUA 2V7OA 3UZTA 2VO3A 5JGDA 2JDVA 2WPAA 3H9FA 1YDTE 3QRIA 2IG7A 3TACA 3QTZA 1NXKA 4ZTMA 3Q32A 4JBPA 3P7BA 3WI6A 2X2MA 3WZJA 1APME 3FZRA 4F7SA 5I9ZA 5J5SA 4HCTA 2R7BA 4MHAA 1IA8A 3GFEA 4AF3A 3JVSA 5HG9A 3PE1A 3F61A 2QOHA 4FV6A 2OF2A 1OL2A 2R0IA 4QP6A 5IKWA 4D58A 2QLUA 3LJ0A 4LGHA 4PDPA 1ZLTA 3TV4A 4BDHA 4O7ZA 3GU7A 5FGKA 4QYEA 3PA5A 5L2TA 3IS5A 4TZRA 4UEUA 3V3VA 5LWNA 2OIBA 3ET7A 2PHKA 3JPVA 5B2LA 4RJ7A 2JKKA 5AR4A 4OTQA 5FEQA 5KKRB 4O81A 3GQLA 2OFUA 3O51A 3R2BA 4E6QA 3W16A 5KMJA 3C4FA 5IZFA 4G3EA 4Z9LA 4BTKA 3I7CA 3OHTA 4YLJA 3EFKA 3QALE 5CQWA 4R5YA 5H3QA 3LXNA 4X2NA 5CEPA 3BV3A 4WKQA 4YLKA 3QKMA 2A19B 3FZPA 3QBNA 4GJ3A 4JX3A 1J7UA 4YBKA 2PUUA 5KBRA 4GU6A 4BY9E 4NKAA 4I6FA 4X6RA 4RJ3A 4LYNA 1WFCA 2QOKA 4FZAB 5AV4A 2YLEA 2GPHA 5IPJA 3OW4A 4BZDA 5ACBC 1Q3DA 4YURA 1KUTA 3MH1A 3OD6X 1YI3A 4BCNA 4EOQA 4CSVA 4PX6A 4AUAA 3NCGA 5ANIA 4MCVA 5DR2A 4AN3A 3GBZA 4ZTLA 3R9OA 1GJOA 5ANKA 3AC4A 3AGMA 3MPMA 4RA5A 2ZJWA 3POZA 4B0GA 1URCA 4OT5A 5T6KA 2I6LA 4IC8A 3VBVA 4BKJA 4N0SA 4CV9A 3NYNA 2B53A 4L3LA 4MQ2A 3A62A 5AAEA 1MRVA 4YMJA 1H00A 3F2AA 3GC8A 3D2IA 4MQ1A 4D4YA 1XH8A 3BBWA 2PZ5A 3ZO4A 4O84A 5EH0A 3KXZA 3ZZEA 4TRLA 1Y57A 3HV3A 4XH6A 4BKYA 3FSKA 4RIOA 4WNMA 4EKLA 3HA8A 4USDA 4G6OA 5BNJA 3QQLA 2PE2A 2XNPA 3DDQA 2RF9A 3T8OA 4ANOA 3EMGA 5KHWA 4GRBA 1J1CA 4L67A 3D94A 1H26A 4CQEA 3FMMA 3V6RA 5AUXA 3VWAA 4HPUE 4PDOA 5CSHA 4IAKA 4ZLZA 3LVPA 4TW9A 4OUCA 3E3PA 2FGIA 4MXYA 3UNJA 3PSDA 5C9CA 5IUHA 4IVCA 1H07A 4KINA 3V04A 1GAGA 4EH7A 4XS2A 3II5A 5EQYA 2X7FA 4ZZNA 4LGDA 4J99A 4BI1A 3NSZA 4B8MA 2J7TA 2C6TA 3HV5A 4YSJA 4L3JA 5EYDA 2RFNA 2CNUA 1W82A 4O91A 4E5BA 4FKGA 3QKKA 1Y8GA 1QPJA 3SRVB 4CD0A 3JY9A 4FSTA 4UMRA 3MWUA 1YVJA 3OC1A 4BCJA 4PP7A 4IAZA 5KZIA 5KCVA 4BCGA 4G34A 5DNRA 3TTJA 3ZFXA 1I44A 2PVNA 2W4JA 3LCDA 4AW2A 4ZZOA 4YZCA 5A4CA 1YQJA 3PG3A 2PVHA 3OF0A 4XG7A 1G3NA 3QA8A 1G5SA 4QP1A 2WMRA 4MD8E 4XP2A 5CLPA 4IJPA 1OBGA 3R2YA 2VNYA 5FM2A 5HE0A 2C6IA 5JFXA 4FSWA 5J7BA 5L8LA 2GQRA 4FE2A 2B52A 1BL6A 2ZOQA 3LQ5A 5L2WA 2VTNA 4F6WA 4H39A 3DT1A 3KRXA 4RIYA 4JBQA 1Q41A 3KFAA 1Q8ZA 4TTHB 4R1YA 5A9UA 5AAGA 2OO8X 4JX7A 4CFVA 4I23A 5HVYA 4XBUA 2JKQA 4X2JA 4O7TA 5EI2A 5FEDA 1KE6A 4AZTA 2XJ0A 3DOGA 1STCE 3EFLA 5IMEA 2G01A 4J52A 5BYZA 4E4MA 3D5VA 5HU9A 4IZYA 2YEXA 2BRBA 3CPCA 3KMWA 4PP9A 4WO5A 5AP4A 3VQHA 4FV0A 3MH3A 4EKKA 2R3OA 4RVKA 2W1GA 3VRYA 3SDJA 3BU3A 3KK9A 2XF0A 3PY0A 3W32A 2H96A 4DH7A 3CEKA 4GG7A 3F6XA 2R5TA 2Y0AA 4BCKA 3UQGA 4OR5A 2GHMA 2VWBA 2XIYA 2HCKA 5D9HA 4L46A 4X0MA 5TR6A 4QMQA 2IWIA 4I24A 4YJTA 4BBFA 1OVEA 5FBOA 1R0EA 3AMBA 4FV7A 5CZIA 3EOCA 4NU1A 4IM0A 3R7VA 3VBYA 2W1EA 3FAAA 3LE6A 4QPSA 3LXPA 3TNIA 1U5RA 2YACA 2C6LA 3QYWA 3RBWA 3TKIA 3T3VA 2BRMA 3U6IA 3R01A 4D1SA 3VN9A 3OG7A 4F64A 3U54A 2X6EA 2W05A 1A48A 3UOLA 2R3IA 3K3IA 3E8DA 3SAYA 2WQNA 4D2SA 2EB2A 2GFCA 3PPZA 2QKWB 2WFYA 4FUXA 4KB8A 4FKTA 2BRNA 3BQCA 4FEUA 3SV0A 4ANLA 4H58A 3DFAA 3PJ2A 2YABA 5A6OA 4O6LA 3Q9ZA 4KRDA 4QYFA 5HTBA 3DBDA 2B9IA 3L9LA 2RKUA 3V5WA 3WF9A 2WAJA 5LVLA 3V8TA 3VULA 2C6KA 1BUHA 4GVJA 4QP2A 2BZKB 2HIWA 1FINA 1YOMA 4KIKA 5JMSA 4R5SA 4KD1A 4OT6A 1H27A 2YWPA 2B1PA 3H9OA 3VO3A 4OBQA 2XIRA 5D7AA 3OTUA 3DB6A 4PPCA 4FKVA 1M2RA 4MXAA 5CEKA 3MPAA 3O2MA 4XUFA 2OF4A 5CNNA 2BCJA 5CX9A 4EK8A 5IQDA 4LOQA 3D4QA 2CGXA 2ZB1A 2OJFE 5IA0A 3DBQA 2RSVA 2WHBA 1ZMVA 4C3RA 4CMOA 3OVVA 4U3YA 3JY0A 3FMKA 2BAQA 4I4EA 4F0IA 4BVUA 3VW8A 5F9EA 3CSVA 3BIZA 4N6YA 5HG5A 1ZY4A 1PXIA 5D11A 5IA5A 1SNUA 3KRRA 4BICA 1E1XA 3AT4A 4PL3A 3KRWA 2ITOA 3UQCA 2FA2A 1QPEA 2O2UA 4FZ7A 4Q5HA 3PPKA 3R73A 1ZZ2A 4XBRA 4FVPA 3LCSA 3VHKA 2XNOA 4G3FA 3WYXA 5CALA 3ROYA 2WTVA 3BGQA 4FZ6A 2PMOX 5HGIA 3TCPA 2XBAA 4AOTA 2UW4A 3HMPA 3F3VA 1XH6A 2OG8A 4DT8A 1PMUA 2UVYA 4IX5A 4E7WA 3S2PA 2EWAA 1G8SA 4EI4A 3OBGA 4AGWA 4ZSEA 3JXWA 2BRGA 2WO6A 2X7GA 4FGRA 4KNBA 4EQCA 3FY0A 4EH4A 2W06A 3KCFA 4WD5A 5AIKA 3VS6A 1OIUA 3U51A 4PUZA 1DI9A 5DFPA 5ANEA 3R7IA 3UP7A 3TDWA 5KX8A 3LCTA 2XKEA 3UC4A 5GJDA 3MFRA 1ATPE 1M2QA 5CXZA 4ERKA 2CKQA 3AMAA 3L9NA 4JDIA 5CYIA 3KN6A 1YKRA 5ANOA 4IZ5A 3HRBA 1ZY5A 3ALOA 4QQCA 3ZRKA 2GMXA 3FLNC 5AP3A 4OW8A 3BHTA 3HMMA 4EHGA 4EL9A 4GYGA 3PE2A 1OL5A 3D5XA 4ZSGA 3D9VA 1P14A 3KRJA 3HNGA 2QD9A 3NUPA 4FX3A 5LMBA 1MUOA 4HGSA 3ZRLA 3O7LD 4JBVA 3UO5A 1RJBA 3G33A 4H36A 5AFVA 2DWBA 5AUVA 2VX3A 4YJSA 4DCEA 1PMVA 4L00A 4CGAA 5CU2A 3R8ZA 2YISA 3W8LA 4O86A 1TQIA 4A07A 3R83A 4PPBA 3VUTA 4M84A 1E1VA 2ETMA 3ROCA 4DGNA 5C1QB 4ZOGA 4FV5A 4TYIA 5AM7A 4ZJVA 5I9YA 2W0JA 4GT5A 4P5QA 4DE4A 4CQGA 4AZVA 4YJRA 3L9MA 3E8EA 3FV8A 3FLQA 4IHPA 3QUDA 3ZSGA 4CNHA 3QXOA 4FT5A 4LMUA 2BVAA 3HL7A 3ACKA 4OGRA 4S33A 3RK5A 3RWPA 3CBLA 3Q2MA 1REKA 4LOOA 5IF1A 3ZTXA 4GFGA 4HYUA 1PF8A 3FLZA 2W1CA 4OTIA 1SVEA 2H9VA 3F9NA 4A06A 4C62A 1H01A 4M0YA 5HU3A 3KREA 4LL5A 4TYGA 2NNWB 3R1QA 3TKHA 4BDJA 3ZUTA 3NAYA 3PWYA 4QOXA 1E9HA 5E91A 2W99B 3RINA 3ZXZA 4KBCA 3H3CA 4QP8A 2Z2WA 1FBNA 1LEWA 4ZZMA 5DYJA 2GS6A 1W84A 3POOA 2YJSA 5GZ9A 4DINA 5ITAA 3CJFA 4L3PA 3OEZA 5B2MA 3LXLA 5E7RA 3RPSA 5IH6A 2EVAA 5M06A 2ESMA 3VC4A 3K54A 4J1RA 5L8KA 2EXEA 5DRBA 4MNFA 4F9YA 4BWXA 4I92A 3I4BA 3ZEWA 4Q9ZA 3UPXA 1YWNA 4RX5A 1H1PA 1YOJA 2NPQA 5IMXA 5KHXA 2WQMA 4DFNA 5IISA 4MNEA 4AZWA 1PYXA 5L6PA 4NT4A 2C68A 2QR8A 3IGOA 3A99A 2UW8A 3AC5A 3QZHA 3R8VA 4CKIA 5HX6A 3QCYA 3DBEA 5BMMA 4QMYA 2BALA 4ZXTA 1OM1A 2ONLC 4UXLA 1TQMA 3W33A 2OJJA 5M44A 2YIYA 3JVRA 4FODA 1XKKA 2ITVA 4NJDA 4OBOA 4QNAA 3EB0A 5FBNC 4FG9A 2HWOA 2XK7A 2UZBA 3I6UA 3GB2A 1A9UA 4FTRA 4BDBA 2OH0E 4YR8A 3EQCA 3U9CA 2QI8A 3P5KA 4GUBA 4TYEA 4Z7HA 4CYIA 2CHLA 1YDSE 5LARA 3G15A 3OOMA 4OTDA 5E4HA 2RL5A 3NAXA 4I41A 3UVQA 5JQ5A 2XS0A 1WBVA 2P55A 5FM3A 5J5TA 4DA5A 5E8UA 3N9XA 5EM7A 4QMSA 4CZTA 5CQUA 1BI7A 2WIHA 2R7IA 2X9EA 2J51A 1M2PA 4KS8A 4HYHA 4PPAA 4A4XA 4B9DA 3WE4A 3EQIA 4KIPA 4RLKA 3ZO1A 4QQ5A 4EH5A 1FVRA 2WKMA 2XKCA 4YJNA 4EQUA 3IW4A 4QMTA 2OSCA 5EYCA 1Q8YA 3OROA 1L8TA 3BZ3A 5L8JA 3FMNA 4WG5A 3GP0A 4M14A 4QTAA 1UU7A 3QQJA 4ZMFA 3NWWA 4O0XA 2ZV2A 2VAGA 2OLCA 4FIGA 1MP8A 2W1HA 3CR0A 4DAWA 3I7BA 3RMFA 2F49A 4TN6A 4YTHA 3DJ6A 3QZGA 5KBQA 4X7QA 4GFOA 3QX4A 5BYYA 4C59A 5LJJA 3I0OA 2PZRA 5HIDA 3WOWA 4U81A 1J7LA 4Y85A 4ALVA 4AW0A 1KE9A 3PSBA 4Y46A 1T45A 4ZY5A 3LXKA 4DG2E 4KIOA 4GL9A 2PK9A 4GSBA 2W5BA 4RIXA 3F82A 4IW0A 2QONA 4WUAA 5HIBA 2PE0A 1UWJA 1OGUA 3I1AA 4MBIA 4EZ7A 5CVHA 4O0SA 1W98A 3BEAA 4MKCA 1H24A 5K5NA 4DCAA 2XNBA 4QTDA 1YXTA 2F7ZE 4BWPA 4CCBA 2WTJA 3EL8A 2VNWA 3QQFA 1UNHA 3DA6A 5GJGA 2OKRA 2PSQA 4TXCA 5HBEA 4FSNA 3UO4A 4ALUA 4RX7A 1XR1A 3TV6A 2G9XA 4QD6A 3QTQA 4JNWA 3SG9A 4AA0A 4F09A 3DXQA 1R1WA 1T46A 4HCUA 2VN9A 1GIHA 2C5NA 2WTDA 2PYWA 2GTNA 4K6ZA 5FG8A 2OK1A 3IO7A 5FDPA 3PXFA 3LZBA 2PPQA 3OT8A 1B38A 5HO8A 5HO7A 4O7WA 5CENA 2V55A 3PRFA 1ZAOA 2J6MA 3EQRA 3KKVA 2HZ4A 3ULZA 4YJQA 3BBTB 4XEYA 3A4PA 5JZJA 4EH8A 4AZSA 4M15A 4ZTSA 4BRXA 5FXQA 4BYJA 1HCKA 1WVWA 4AE6A 1ZXEA 5M07A 3MGYA 5IH4A 2IPXA 4O0UA 5K4IA 2CNVA 3F5XA 4NZWB 3C4EA 5A54A 4ZSLA 3DDPA 2FB8A 2KULA 3D15A 3G6HA 4TYHB 4HW7A 5TO8A 4CCUA 5LMAA 5M4FA 2WEIA 2OFVA 3KULA 3DK3A 2CN5A 4C37A 2YAKA 3RALA 4CEGA 5HNBA 1XBCA 3DQXA 3MY0A 3OOGA 2C6MA 3PTGA 4WNKA 4ALWA 4U41A 4ZY4A 1JNKA 1OIYA 2P4IA 2Y7JA 1OUYA 3DK6A 3I79A 1PXMA 3QTXA 3LIJA 2XIXA 2ZVAA 3OY3A 2WMTA 4YO6A 4NSTA 4FGBA 3L1SA 4DH1A 3EN4A 5CAOA 4QQJA 1I09A 3G5DA 2QC6A 3ANRA 3WF8A 4DFYA 1DAYA 3MN3A 4FTOA 4BI0A 3S00A 5IQBA 4IM3A 4JS8A 4AG8A 2IW8A 2ETRA 3LKMA 1ZOHA 5DEWA 5EG3A 4C3FA 1JSUA 4L68A 3E7VA 4TNDA 4L9IA 2YZAA 4JDJA 3EWHA 4Y72A 2V7AA 4FIFA 3WBLA 3FXXA 2NP8A 3ANQA 4FZDB 4RQKA 4ASEA 1FMKA 2ZV8A 4C02A 4DGLC 5KMMA 2R2PA 4TPTA 5AUUA 3AC3A 5DMZA 5AWMA 3IOPA 1CKJA 2WOUA 3D7ZA 3MESA 3FI8A 2AC3A 3LW0A 3KMUA 5AR7A 2GHLA 5F94A 5LMKA 4FOBA 4YHJA 5FLFA 4U43A 2XUUA 3CY2A 1W8CA 3FYKX 3OXIA 3PDTA 1QCFA 4I20A 4PTEA 4ASXA 5HCXA 3TJCA 3VF9A 3DAJA 4UMUA 5CAQA 2HW7A 1IA9A 1Q8WA 2VO7A 4QYYA 4IC7A 3KXMA 4RZVA 4FEXA 3NYXA 2GQSA 3V5QA 4XP0A 2UZVA 4UB7A 3UMWA 5IQGA 4FKSA 2R3FA 3MTFA 1PXNA 3MB7A 2V0DA 4DBNA 4YHTA 5D10A 3C13A 3DS6A 4KRCA 4FSMA 3FZSA 3F88A 3WF6A 1JKKA 4FUYA 4B4LA 3L8PA 4BTJA 3G6GA 4ASDA 4JDKA 4G3DA 1H1SA 5LVNA 4O7VA 1Z5MA 2FSTX 4O83A 5H8GA 5T68A 2QOOA 1KWPA 3NW5A 4BIEA 3TUCA 2LAVA 4NW6A 4UBAA 4AE9A 5JH6A 4P2KA 2PVRA 1PKDA 2F9GA 4FK6A 2XNGA 3EIDA 3FI2A 4JJRA 3UQFA 2BFYA 4FKUA 1ZWSA 4FV1A 5CF5A 3IW5A 4AFJA 4YJVA 4NIFB 4ITHA 2QU5A 3GU8A 3NS9A 5D7VA 4RIYB 4EJNA 4GT4A 3DK7A 5DLSA 4FV8A 5BVKA 3RHKA 4CT1A 4FSYA 5JK3A 2ZM3A 1KE8A 4PTGA 3GU5A 1XH4A 1PXKA 4WNPA 2VTOA 2UV2A 2VO0A 1GZNA 4L7SA 4MWHA 3F3TA 4YC6A 3VUDA 3S0OA 3UE4A 3FXWA 4PDSA 3U55A 4WG3A 4E4NA 3MFSA 4NUSA 4BWKA 4L7FA 3HV7A 3HMNA 3ZMMA 4E6DA 2ONLA 2WMAA 5IG1A 3SGCA 5BVNA 3NIZA 3H4JA 3ZC6A 4AACA 2XJ2A 2XYUA 4YC8A 4BDGA 4MWIA 4CVAA 2Z7SA 2Z60A 4F0FA 5FUTA 3AG9A 3AT2A 3C4XA 3QZFA 2PVLA 2UZTA 4K1BA 4Z55A 4O7SA 2YM5A 3RM6A 2CSNA 5AA9A 1ZOEA 4RBLA 5HLNA 5IDPA 3O23A 2W5HA 3KVXA 3HAVA 4GKIA 3ZH8A 5DBXA 3FKNA 2ZV9A 3Q9XA 3KA0A 3KVWA 2OIQA 4IEBA 3NZ0A 5LCKA 5IEXA 4FSUA 4JQEA 3W18A 4O0RA 4X2FA 2VX1A 3QQUA 5AR8A 2IVSA 3P1AA 4RFMA 5CEOA 3ENMA 5EM8A 2C0IA 2R3HA 4PNIA 4UALA 3PJCA 4GIHA 1KE7A 3FMHA 4AOIA 3FHRA 3S4QA 4YJOA 4IDVA 3UC3A 3SXRA 4HYSA 4YC3A 4EH3A 4L42A 3TZMA 1VYZA 2R3RA 2W4KA 4O21A 4D55A 2HK5A 4NK9A 3QU0A 3BU5A 3UYTA 3ZC5A 2JLDA 4AQCA 3RK9A 3TUDA 3MA6A 2XIZA 4RA4A 2YDJA 3QD0A 3ZCLA 4EH2A 4EOKA 4CG8A 3MVJA 3PJ3A 3LCKA 5KO1A 3C5UA 5CAUA 4BR3A 4F4PA 4FK3A 4FT7A 3E93A 3QRTA 2O64A 2XNNA 4LOPA 4RIWA 2Y6OA 3EQFA 5IUGA 3GC7A 2PVFA 2WMSA 4EC8A 2I0YA 5ANGA 5DT0A 3DBFA 5E92A 2OJ9A 3K2LA 3OP5A 3ZOSA 2XYNA 2XIKA 2EXCX 2J0LA 1UU9A 3ALNA 2PVMA 1YW2A 3IDBA 5F95A 3UVRA 4TWCA 2CGWA 5BMSA 1J1BA 2C4GA 5HNIX 3F3ZA 4IAYA 2NRYA 1CSNA 4FNZA 3MTLA 4AAAA 1KOAA 3ERKA 4KIKB 4AS0A 3EKKA 5M4IA 2VTTA 3C50A 3TTIA 3AOXA 4FG7A 5CSWA 3RPVA 4ACCA 5GZ8A 2X6DA 5KMLA 3KQ7A 4IJ9A 4U8ZA 3BYMA 4DEGA 3W1FA 2JDSA 3R1NA 3TG1A 3JS2A 4I6BA 3ULIA 4IWOA 4Y73A 3W2OA 4D2PA 4ORKA 2GCDA 4UWCA 4DTKA 3CP9A 2YIWA 2J0KA 2V22A 1SVHA 3P0MA 4PMTA 3VS1A 4UYNA 4C2VA 5JKGA 4NM7A 4RWLA 5LCJA 1YI6A 3TEIA 4HVDA 2XEYA 5DN3A 5IA2A 2ITZA 2VU3A 3BLRA 2C1BA 4FSQA 4IWDA 1IEPA 3FI4A 3LJ2A 4RVTA 2YITA 4B8LA 2X39A 5DGZA 5KMNA 4RT7A 5EW8A 5BVOA 1H28A 3F7WA 4E4XA 1WBWA 5K4JA 2PE1A 3BGZA 3QC4A 4JXFA 3Q9WA 3ZDIA 4D4SA 5FTOA 1LUFA 4J8NA 3HKOA 3VUKA 3FDNA 2WEVA 2XMYA 4GT3A 2W96B 4J95A 2FVDA 3AC8A 3VBWA 2JFMA 4JRVA 4N6ZA 3GOKA 3M1SA 4AT5A 3PVGA 3LM5A 3LQ8A 1UVRA 2X2LA 4Q9SA 3AD6A 4W4WA 2QG5A 5L6WL 4LGGA 4LRJA 2CPKE 2ZYBA 2WOTA 1PKGA 5DIAA 1JWHA 4ZTRA 1PXOA 3WILA 3MY5A 4GMYA 5ETIA 1J3HA 5CS6A 4S31A 5ACKA 1M52A 4A9YA 1OIQA 4F7LA 3Q5IA 3BWJA 3OMVA 4IWQA 5IA4A 4ZTNA 4IFCA 2EU9A 5BYLA 4UX9A 3DXPA 1BLXA 1MRYA 3PUPA 4IWPA 4JG8A 2C3KA 4IZAA 5HOAA 5E1SA 4D4RA 3VS7A 4HPTE 5B7VA 4O2ZA 1H08A 2Y8OA 3GCUA 2V5QA 2BRHA 3IQ7A 5T3QA 3WZKA 1Q62A 1L3RE 4F65A 1ZYLA 2PUPA 3RAKA 1WMKA 3OWPA 1TVOA 5DRDA 4FKOA 5H8BA 3REPA 4USEA 4GV1A 4WRGA 3AGLA 4HGLA 2BHEA 3M11A 3BI6A 3OT3A 3CJGA 4IXPA 3FXZA 5IQCA 3QHWA 4QMLA 1IASA 1NVSA 4EORA 3I5NA 2GNHA 3DAEA 2IZTA 3FKLA 4A9RA 3RNIA 3HEGA 4X3FA 4M97A 4NTSA 3PSCA 5EHYA 4EHVA 2G2FA 3QZIA 3MVMA 5I9XA 1JKTA 5EW9A 4V04A 5EM5A 3TNPC 4AXAA 1GNGA 3PG1A 4JG6A 4KKEA 4YP8A 2XK3A 4FTIA 1NVQA 4WUNA 4S2ZA 4WNOA 4MF0A 3E8NA 4DLIA 4QP9A 2BIYA 5E8XA 4AT3A 1U4DA 3H9RA 5TT7A 4BL1A 4FOCA 3A60A 5KNJA 4D2RA 4BDDA 1YXSA 4GUEA 4L43A 2Q0NA 4P90A 4O0WA 2IN6A 3ZFYA 3A7IA 3VUIA 4F9WA 3RAIA 5BVDA 3ZUVA 3PXZA 3PVUA 1M14A 2CGUA 3GUBA 3QYZA 5BVWA 4NM3A 3EH9A 4I5CA 1Y91A
chains in the Genus database with same CATH superfamily
4A9SA 4GKHA 1WAKA 4XYFA 2B55A 4IX3A 3ORIA 5CVGA 2JITA 1JAMA 4YSMA 4W4YA 3A7FA 4FIIA 3HRCA 3P86A 2HZIA 3CTHA 4U45A 3DZQA 3K5VA 5JGBA 5AP0A 3MPTA 4ANNA 3EYHA 4ZTHA 4EH6A 3F3UA 5LVOA 3Q4CA 4DEDA 5HIEA 2RFEA 2QOFA 3KN5A 4GS6A 5J8IA 4RIXB 4EZ3A 2XCHA 5HORA 5JGAA 1ST4A 2OH4A 4BCFA 5AP7A 4EHEA 2I40A 5ETCA 3VBXA 4YBJA 5DR6A 1FVTA 1MQ4A 3ZZWA 4TYJA 2ZAZA 4M0ZA 4M68A 4AN9A 2E9VA 3AC1A 3FPMA 4TT7A 4LFIA 4JI9A 5J9LA 5KKRC 5AV0A 3ZBXA 5M53A 5AEPA 5AV1A 4F7NA 2GTMA 3FKOA 3R21A 2YAAA 4FTQA 5H2UA 3HAMA 3P7AA 2R3KA 3PFQA 2YCQA 2QQ7A 1UNLA 2OW3A 4F9CA 1PYEA 2B7AA 2UZEA 2WTKB 3GCSA 3H30A 3LFSA 5I9WA 4LI5A 2PU8A 3ZM9A 3R00A 3R8PA 1B39A 3FHIA 3HZTA 3SVVA 2B9FA 3WF7A 5HCZA 3TNQB 3O17A 4IB5A 5E8ZA 3RHXA 2PULA 3F5GA 4O4CA 4H1JA 1YWRA 3PJ1A 5AX9A 2C6DA 3FUPA 3UG2A 5I9VA 1CMKE 3SG8A 4L6QA 4IAAA 2C69A 2XKDA 3TYKA 3TZ9A 1SNXA 2IZUA 3LCOA 4BCQA 3R7EA 5GIOE 4D2TA 1DAWA 2RGPA 3AMYA 3BLQA 1VLRA 2YM3A 4YPDA 4X2GA 3LFCA 1H1RA 4K9YA 4M3QA 4E26A 2CN8A 5FTGA 2FO0A 3V5JA 1OKZA 3VUGA 4Z16A 3UODA 2CCIA 3KL8A 3LFQA 3P79A 4M13A 4MXCA 5L2QA 1V0BA 4W8EA 2O5KA 4APPA 2GS2A 2JIIA 4X21A 5EKNA 3VS4A 4DTBA 1TQPA 2VWYA 2XBJA 5CEIA 3KB7A 4XG8A 3K3JA 2C5XA 4BDAA 3H0ZA 2B54A 3QLGA 4GVAA 5JFWA 3QLFA 3U9NA 3JUHA 1U46A 4L8MA 4FICA 4HNFA 4J7BA 5L6OA 2X4FA 3R71A 4O7YA 5CI7A 4E20A 3FQSA 1JOWB 4KBKA 5FXSA 3GI3A 3P78A 4IB3A 4I94A 4K0YA 4AOJA 5HESA 1BYGA 5CU3A 2XEZA 3OTVA 5DI1A 4FVRA 4D2VA 4DLJA 3DNDA 4ANMA 3CGFA 3R6XA 4TWOA 3NNVA 2WNTA 1Q3WA 4FRFA 2HELA 3O7LB 5AIRA 5KZ0A 4S34A 3U4WA 4OTWA 4G1WA 2RFSA 1SM2A 3BHVA 2R3QA 2G2IA 4MYGA 1CTPE 3LM0A 4ACHA 2F4JA 2R9SA 3C51A 1R3CA 2C3IB 1YXVA 3P9JA 5EM6A 3DY7A 2XRUA 5I9UA 5J95A 3QA0A 4BDEA 3EN9A 4EQMA 3C5IA 3R1YA 2HAKA 4YPSA 5J87A 4UWYA 4CLIA 3ZSIA 4AXCA 1M7QA 1WBPA 4MK0A 2UZLA 3PXKA 3R7UA 3B2WA 1JPAA 2VGPA 3OWLA 4PY1A 3U87A 5G1XA 2O8YA 3NUNA 3KMMA 4I3ZA 3BU6A 4MXZA 4V0GA 4RWJA 4DGGA 4E5AX 4E6CA 5A46A 3S3IA 4QTEA 5E8TA 4QMXA 4G3GA 3I6WA 2AEGA 3OCBA 1XBBA 4BCOA 4D4VA 4DEEA 5HX8A 2YIQA 3QGYA 2HOGA 2OZOA 4ZY6A 3T3UA 1O6LA 4Y8DA 4FYNA 3PUFC 3R7OA 4IFGA 2G2HA 2GNJA 3G0FA 5C03A 3QF9A 2XJ1A 5M4UA 4FKWA 3I0QA 4XV9A 2IZSA 5D41A 2H8HA 4IB0A 5TKDA 1K2PA 3PLAE 1BX6A 1V0PA 4P5ZA 4D0WA 3QUPA 5J9ZA 2SRCA 5LOHA 3OBJA 2JBPA 4R7HA 4JMQA 4H3BA 2XA4A 4L53A 4CMUA 3NDMA 3KULB 1ND4A 3HP2A 4RC4A 1H1QA 1OI9A 4O38A 4V0GB 4JQ8A 4PV0A 4AWIA 3TN8A 2Q0BA 1GY3A 4IVDA 5FP5A 3F2NA 4R8QA 3R9DA 3UIMA 5BUEA 3VONA 2ITQA 2YCFA 5DA3A 4AA4A 5CXHA 4BCIA 3V8WA 1ZOGA 4FMQA 4QQTA 3A8XA 5IEYA 4C35A 3VS2A 3MH0A 3CQEA 3L9PA 3TDVA 1RW8A 2XRWA 3M42A 3DPKA 4BB4A 4QNYA 4HZRA 4JIKA 4F99A 4S30A 5EHOA 4OAUC 2YERA 3LLTA 1YHWA 3UIUA 4R77A 3VJNA 3OEFX 1VR2A 3Q53A 4PMMA 5IUIA 5EOBA 3QKLA 1RQQA 3R02A 1KV2A 4I22A 4XOZA 4EK5A 2VWZA 4U0IA 1REJA 4WA9A 4YZNA 1OZ1A 1UNGA 5M09A 2PZIA 2OJIA 4XG6A 3R8UA 2C0OA 2F2CB 1UV5A 4QP7A 2IO6A 4HNIA 3ZUUA 3FMLA 3GGFA 3CPBA 3GVUA 3ENHA 4FKLA 2ITXA 1DI8A 3ZRMA 3HRFA 3LFEA 4FC0A 3HMOA 5HBJA 4UN0C 2JIVA 4JAIA 4XG3A 2W1FA 4M66A 4RLLA 2FUMA 2C5VA 3KC3A 4GK2A 5H8EA 3TKUA 3R8MA 4NJ3A 4RJ8A 3PVWA 4O2PA 5AP5A 4AU8A 3BYVA 4BYIA 4IMYA 4RWKA 3ZO2A 4IDTA 4J8MA 4ID7A 3O8TA 3CD3A 3T9IA 4D2WA 4CLJA 4XG2A 4QT1A 5M55A 2R64A 4G5JA 4AA5A 3W2SA 4BCMA 4EOIA 4GK4A 3DTWA 2GU8A 4C58A 4JDHA 3V6SA 2P2HA 3MVHA 3Q3BA 4J96A 4FTCA 4DBXA 3TV7A 3WYYA 5DE2A 4E3CA 1PMEA 3C0IA 4HVSA 2J4ZA 4IVAA 1A06A 4FKQA 1AD5A 3RJCA 4HVHA 4X3FC 3C4ZA 3EQHA 1Y8YA 2VO6A 4A4LA 3OWKA 2HZNA 3H0YA 5DHJA 1S9IA 5EYKA 2O3PA 1G8AA 2BUJA 5AX3A 3FMDA 4O4FA 4FTLA 3UVPA 4Y5QA 3KK8A 4K77A 4BIDA 5A4QA 1BMKA 5EQEA 2LGCA 2W4OA 2XB7A 2ITPA 3CKWA 4XHKB 2O65A 4IQ6A 5AUZA 1UU3A 4I5PA 2CGVA 3BCEA 4JLCA 4C7TA 5L3AA 3PPJA 2BZIB 3BLAA 4AQKA 4AGDA 1KOBA 5EDPA 2JKOA 3LFNA 4MAOA 3ZS5A 3IONA 2CDZA 3KF7A 3PZEA 4J98A 3NIEA 4NWMA 3RZBA 4YTCA 4RRVA 4V01A 2QO2A 5LQFA 5ETFA 1IR3A 2Y4PA 3NEWA 2WMVA 3IPHA 4XG4A 2C3LA 5I5ZA 5TF9A 3LLAA 5AR2A 4QMVA 4ENYA 2IVUA 5IDNA 4O7NA 2X7OA 4I0SA 4W8DA 3C1XA 4NH1A 4RIWB 4CKRA 2Z02A 3O8UA 3OXZA 4FBXA 2BR1A 4CRLA 2HY0A 4XRJA 5F1ZA 2X1NA 3E3BX 4WBBB 3VF8A 4EEVA 1Q8TA 5CSXA 1WCCA 2JDRA 1NY3A 3EFJA 3R63A 4N70A 4O22A 5EKOA 3UP2A 3ZXTA 4A4OA 4MVFA 5K3YA 3NYVA 5CNOA 2W1ZA 1H0VA 3COKA 2OZAB 2WTCA 4F08A 2C1AA 3AKKA 4IX4A 4AW1A 1GOLA 2QLQA 4YU2A 2I7QA 4R7BA 5AR5A 3RCDA 2WMQA 4WT6A 5CI6A 4WOVA 4E93A 4YJUA 5CF8A 5IA3A 3TUBA 5DEYA 2UZUE 3BYOA 3TZ8A 3W2QA 1O6YA 4HVGA 2XK9A 3RP9A 2O0UA 4P7EA 2CLQA 5HE2A 4BHNA 4RFYA 3WZUA 4ACMA 2C0TA 3GC0A 3QCSA 4YNEA 3QUEA 5EI8A 3ZLWA 3F5UA 3S95A 2JEDA 5HTIA 3QXPA 4UMQA 3VVHA 4O6EA 5AV2A 4EOMA 2DUVA 1BL7A 3B8QA 3KXGA 2G15A 2YM6A 1OBDA 3NNWA 1KE5A 3FEGA 1X8BA 1QPDA 4E5WA 4QMNA 1SZMA 4O82A 4O0YA 4OTGA 3ATTA 2E9PA 5I0BA 2HXLA 4M67A 5I3RA 1XMLA 4DEIA 2C30A 3UNKA 2UW6A 3F5PA 4TWNA 4BDIA 4C4HA 4S32A 4XMOA 2ITUA 3O50A 4WHZA 3EQGA 1ZYSA 5DG5A 3P4KA 1LEZA 3ORPA 4FEWA 1FGKA 1M7NA 3OUKA 1R0PA 3KXXA 4CV8A 4TY1A 3ETAA 1Y6AA 3CXWA 5CEMA 4FTUA 2UZWE 1YRPA 4UV0A 3D14A 3G9LX 4EUTA 1UKHA 2Y9QA 4ONAA 1LPUA 5E9EA 4QMOA 2PUIA 4XX9A 3FMJA 4UMTA 3HV6A 2WMBA 4U80A 5LWMA 3BV2A 2RG6A 3QTUA 2REIA 4O1PA 4U40A 4D0XA 4DEAA 5ICPA 4DC2A 3SHEA 5B0XA 1OL1A 4FL3A 3SXSA 3GNIB 3NMUF 1HCLA 2XM8A 4KA3A 4MX9A 2PWLA 1W83A 2XVDA 3DAKA 3HP5A 5M51A 3BX5A 2YWVA 2OWBA 2QNJA 3IOKA 3SRVA 3VBTA 3QD2B 3ZFMA 2E9NA 2VTLA 4XCUA 2ITNA 3HECA 4K33A 4X3FB 3THBA 4FV9A 4O7RA 4RX9A 4RX8A 3PYYA 4YUQA 4QP4A 3O71A 4ZMEA 3CC6A 4YLLA 2GQGA 2XM9A 2CKPA 4TKSA 3NVMB 4CG9A 3AXWA 3LMGA 5EDRA 5CASA 3L8SA 3VBQA 4EYMA 1H1WA 2WELA 2W1DA 3ZHPC 3BKBA 4ASZA 2R3GA 2VTSA 3V5PA 4IANA 4NL0A 2X9FA 3E62A 3NW6A 4C2WA 4EWHA 1PRYA 5IA1A 3NX8A 1YHVA 1F5QA 3CKXA 3VJOA 4EOSA 2QR7A 3HDNA 3CGOA 4BKZA 3TZ7A 3BELA 1DS5A 4LV7A 2WD1A 4R6VA 3QL8A 4CKJA 3AKLA 1J7IA 4HZSA 1OKYA 3TM0A 3RCJA 2IW6A 3GQIA 4JT3A 1QL6A 3QD3A 4NCTA 2AQXA 1J91A 2BDWA 5FRIA 3W2PA 1P2AA 4R3PA 3E87A 2CNQA 1YI4A 3EZRA 4MNEB 2BPMA 3ORTA 4K11A 2XH5A 4MBLA 5K0KA 1WBTA 5IH5A 4EJ7A 3GFWA 3FWQA 3C4CA 3MIYA 4R7IA 1OUKA 1WBNA 4F6UA 2J5EA 2OI4X 4QYGA 4R3RA 2E9UA 3SW4A 1XQZA 5CAVA 3B2TA 1SYKA 3OZ6A 3ZU7A 1VJYA 1PXLA 3E64A 2ZM4A 2C5OA 3COIA 2W9ZB 4D9TA 2XAOA 1OIRA 3G90X 4LM5A 4EOPA 3PXRA 3W0PA 4WSYA 3FQEA 4M12A 4Z7GA 3FJQE 5JRSA 3OUNB 3A4OX 3NNUA 4G6NA 3UNZA 3AT3A 2J2IB 3TWJA 4DN5A 3AD5A 5ETAA 2PMLX 4HJOA 4JAJA 5AV3A 2CLXA 5E90A 2PZYA 3QCQA 5ANDA 5BVEA 1W7HA 2WB8A 3QWJA 4LMNA 4U44A 4FEVA 5AUWA 3FC1X 4MF1A 5BVFA 4BGGA 3MYGA 3F2RA 3NYOA 4FIJA 2VWWA 2P33A 3BYUA 4MEDA 4X3JA 4PNKA 5K5XA 3E8CA 4JL9A 5EYMA 4LV5A 3FLSA 4UXQA 4TYHA 1GIIA 4IM2A 2GNGA 5AUYA 4OAVB 2XK8A 1K9AA 2ZB0A 5CU0A 2PZPA 4F70A 2VWXA 1Q24A 5CT0A 3R8LA 1WBOA 4I0TA 3V5LA 2JGZA 4I5HA 4F9AA 3BYSA 2XNEA 4ANQA 4R78A 1IRKA 4U9AA 2AC5A 3NUAA 4EK6A 2YCRA 3B8RA 3C0HA 4G9RA 1IAJA 3ZO3A 2R3PA 2QKRA 2NRUA 3H10A 4O4BB 4JG7A 4JR7A 2YIRA 3RPYA 5M4CA 4L01A 3MVLA 4DG3E 4NIFA 1VEBA 3EHAA 4BTFA 4EBVA 5C8KA 3NLBA 4PMPA 1O9UA 2R3NA 3FC2A 4D9UA 3UYSA 2VGOA 4TWPA 2X81A 3ITZA 4NW5A 5C4KA 1YWVA 2VTJA 2WQBA 3PLSA 2XK6A 4BHZA 4X6QC 5AP6A 4YZDA 4ZEGA 2E9OA 4BI2A 3KIOC 3R9NA 4ZLOA 3E63A 4Y83A 4DGMA 4XJ0A 3KGAA 3HV4A 4FYOA 2X4ZA 2JDTA 2QHNA 2R3MA 2YCSA 2KTYA 4E1ZA 3BE2A 1FPUA 2H34A 1FOTA 4KAOA 4U97A 4O1OA 1JSTA 4DH8A 4IAFA 3EZVA 4FL2A 4QTBA 3A7HA 5CWZA 4DYMA 3W8QA 4CMTA 2GHGA 3AQVA 2WTIA 1OL7A 2ITTA 5JFVA 3MDYA 4U79A 2C6OA 4U5JA 5FTQA 2J50A 3VNTA 4CFNA 4F9BA 3RWQA 4QMWA 4LUEA 3PIXA 4PL4A 5EDQA 3ZEPA 1CM8A 3RZFA 1PY5A 2DS1A 2IVVA 3FBVA 4V05A 4C61A 2GNIA 4PDYA 5GIPE 1PHKA 2WU7A 4G2FA 3IKAA 5CEQA 5DWRA 3DKOA 3P7CA 1NVRA 2JIUA 4QRCA 4CFMA 4RC2A 2VTQA 4RQVA 4O27B 3W10A 4C4GA 1RE8A 2VV9A 5JRQA 5KMIA 3PY3A 5TE0A 5M57A 4M69B 5FDXA 1U54B 4R3CA 3PRIA 4NTTA 4LRKA 1BKXA 4PRJA 4RFZA 1XH5A 4JVGA 4LL0A 1CKPA 1ZYJA 3E5AA 3NUXA 1XWSA 3DTCA 3Q4ZA 3QTIA 3UOHA 3UIXA 5LXMA 1JLUE 4B7TA 1PXPA 4OTHA 4UZHA 5EOLA 2CKOA 5M08A 3DCVA 3MH2A 3PZHA 2BDJA 5EI6A 3DXNA 4N4SA 3G2FA 4C0TA 4DEBA 5AM6A 2JC6A 2WTKC 2UZNA 2J9MA 3Q4TA 4KABA 1H8FA 3M2WA 4BDCA 4QMMA 4OTRA 5IQIA 3N4TA 2BTRA 3UTOA 3OCGA 2Z7LA 4FT3A 3OCSA 3E88A 5HHWA 3D2KA 3A8WA 3N51A 1XJDA 3PA4A 3LFBA 5HCYA 2I0HA 4FNXA 4RWIA 4W9WA 4JRNA 2UVZA 3IDCA 2BILB 3ACJA 4WG4A 3NPCA 4Y5HA 4DHFA 4ERWA 3QHRA 3QGWA 5HE3A 5IU2A 2W5AA 3D5UA 3HGKA 4FTAA 4CTBA 4JR3A 5EK7A 3HYHA 2OGVA 4JQ7A 4LV8A 4QMPA 3A7JA 3MJ1A 4IVBA 3UJGA 1Z9XA 4APCA 4ZTQA 4RC3A 4DHZA 4C8BA 3LMHA 4DGOA 1Q61A 3UIBA 3KRLA 2IF8A 3EKNA 3IGGA 3KEXA 4AP7A 1M17A 2ITYA 1OB3A 2X0OA 2YLFA 1TKIA 4PL5A 2Y4IB 2F7EE 4NM5A 4XV3A 5D12A 2EB3A 5E1EA 3Q9YA 5AP2A 3UG1A 4QMUA 4IBMA 4PWNA 4DFLA 4F0GA 2C5YA 3DLZA 2CKEA 3UDTA 4XV2A 5FWKK 3PP0A 3SD0A 3ZLYA 4G9CA 4F1OA 2P3GX 4ZAUA 3CTQA 4DF3A 3WIKA 3BWFA 5IQAA 3Q52A 4PTCA 4I0RA 1EH4A 3E92A 4KIQA 4K18A 3SX9A 5HO6A 3T9TA 4ZJIA 4K2RA 4GG5A 3RTPA 2EXMA 4P4CA 3FPQA 4QDEA 2XALA 2FSLX 2RG5A 5J1WA 2BAKA 2EUFB 2OICA 4OTPA 3UDBA 3W0NA 2VX0A 4DFBA 4FI1A 2HYYA 4ZLYA 1URWA 2YM8A 2UW7A 3NR9A 1G8JA 3GC9A 3FY2A 4NEUA 3DFCB 2F57A 4AW5A 1IG1A 4U42A 4ZK5A 2UVXA 1YXXA 3E7OA 4BIBA 5C8MA 2ERKA 4M7IA 4ZS4A 4G3CA 3DZOA 2VWIA 3MI9A 4KS7A 3FE3A 4EUUA 3QRJA 4AT4A 4RGJA 2C47A 2JKMA 3C4WA 3V51A 2E2BA 2JBOA 4L44A 5KUPA 3VW6A 1UA2A 4Y95A 2ZDUA 2H6DA 3RNYA 5GJFA 3G51A 3GCQA 4HVIA 3BQRA 5AMNA 3IECA 5HE1A 3EFWA 5BX0A 5GZAA 5HVKA 5HQ0A 4IE9A 4MTAA 3V01A 4NFNA 4BTMA 3NUYA 3DQWA 2J0JA 4II5A 3MBLA 3U6HA 2PMIA 2GDOA 4Q5EA 3WARA 3FMEA 4B99A 4HOKA 1PXJA 2OZAA 4QPMA 3NUUA 1JSVA 3KU2A 5JN2A 3LHJA 1WVYA 4EK4A 4GW8A 2VTPA 1OKWA 1F3MC 2BMCA 2YDIA 4U3ZA 2BTSA 1GZOA 2ZM1A 4MH7A 3DKFA 3ZLSA 2JDOA 1V0OA 2AUHA 2OJGA 5F4NA 3LMIA 4I93A 2BZHB 2X8IA 4BGQA 1S9JA 3EQDA 3O8PA 1QMZA 1YDRE 5GHVA 4F1MA 3DLSA 3QTSA 3R1SA 4NYEA 5AA8A 1VZOA 3MFTA 4GYIA 4H05A 4GJ2A 3L8VA 2J5FA 3Q6WA 5EW3A 1XH9A 3D0EA 2VUWA 3EQBA 3SC1A 3OWJA 3LFFA 4F1TA 5J7HA 1P4FA 4C36A 2FYSA 4BGHA 5KMKA 2JAMA 4AXFA 1OKVA 4QTCA 4F7JA 2OU7A 5HKMA 4EC9A 3PXYA 5BPYA 3VUMA 5FEEA 1AGWA 3TNHA 5JFSA 4FSZA 2UZOA 1JKSA 3WIGA 3VQUA 2YDKA 3ORLA 4RVLA 1JBPE 2J0MB 5BQ0A 5AJQA 2NO3A 4QP3A 4DH5A 2XCKA 5HD7A 2AYPA 3R30A 4FKIA 3ZDUA 2BROA 4BC6A 3QQGA 4BN1A 3GXLA 2UW3A 5CU6A 4CFXA 5A14A 5G6VA 1SMHA 5C4LA 3DGKA 1F0QA 3RPRA 5E8WA 3U4UA 1R78A 2B0QA 3HA6A 4CZYB 3UZPA 4BCHA 4K8AA 2Z8CA 3FZ1A 2YN8A 3ELJA 5CZHA 1FVVA 4EBWA 5I3OA 1FGIA 3VAPA 4C4IA 2XK4A 2YZLA 5EQPA 2QVSE 3ORMA 2WMUA 2XNMA 4MXOA 4WIHA 4YNOA 4AX8A 3COHA 4FG8A 4MBJA 5DT3A 3SLSA 3Q04A 3MJ2A 4EWQA 5L4QA 5C01A 3DV3A 3GT8A 3DNEA 4O0TA 3KCKA 3BLHA 2YM7A 4LG4A 3CQWA 3EJ1A 5H9BA 1SVGA 4UY9A 2WQOA 2XKFA 4YJPA 3O96A 4FNYA 3NW7A 4KKGA 4RPVA 3QRKA 2UW9A 4FR4A 3RAHA 2HWPA 2ACXA 3F7ZA 5CSVA 4EK3A 4XP3A 4BZOA 4G17A 5HBHA 3LFDA 3LQ3A 1V1KA 4GH2A 1H25A 5HD4A 4XNEA 4N57A 4RZWA 3COMA 3ATSA 4R1VA 3W2CA 4FL1A 3FI3A 3QTRA 3F66A 4FSRA 4LUDA 2G1TA 2QG7A 3WE8A 3DJ5A 1WZYA 1W2FA 4BF2A 4DG0E 2YJRA 4IACA 3DJ7A 4BDKA 5D1JA 2BKKA 2BAJA 4WBOA 3A7GA 2WGJA 2JD5A 4ENXA 5LVMA 3GEQA 1Z57A 4I5MA 3V8SA 4U7ZA 4QO9A 4DH3A 2YHVA 3I60A 5FD2A 1Q97A 3VIDA 4FVQA 4RJ6A 4YO4A 3N4VA 1ZMUA 4I6HA 3UBDA 2QHMA 4O0VA 3K5UA 3R04A 4EOJA 1IAHA 3KF4A 5HEZA 3UZRA 3W0RA 2YIXA 5KMOA 2WU6A 2Q83A 3CTJA 3IW6A 3QAME 5J79A 2QOQA 2W9FB 3FL5A 3MB6A 4EZ5A 3TNWA 2QOCA 3LJ1A 3NCZA 4DFXE 3VS3A 3A2CA 5I4NA 2VTMA 3LPBA 4GIIA 4TL0A 3VRZA 4USFA 2A4LA 3I81A 1ZZLA 3CE3A 2B4SB 3RI1A 3RKBA 4FT9A 5C26A 1RDQE 2A2AA 4X2KA 3TJDA 5AADA 3V5TA 4FTNA 3QC9A 2O63A 1ZMWA 4YGAA 2WQEA 3EL7A 4M69A 3U6JA 5DVRA 3DKCA 3JR1A 1JQHA 5CVFA 4DT9A 1ZRZA 2GFSA 4ZSAA 4BZNA 3ORZA 5HVJA 5LMKC 2ZMCA 3WZDA 2X8EA 3NGAA 4CRSA 2XP2A 1XMMA 3QTWA 4RG0A 4LQMA 3EN7A 3FYJX 2OIDA 1OPLA 2BFXA 4O7LA 2J90A 4B6LA 3GCVA 5AR3A 5IQHA 2V62A 4XOYA 3BHUA 3OCTA 3MY1A 4JOAA 4C3PA 1PMNA 4FEQA 1XH7A 3EN6A 4RJ5A 2IJMA 4CFUA 2QO9A 3F69A 1K3AA 3SXFA 3NFFB 1AQ1A 1UU8A 4G16A 3D5WA 4MD9E 5J1VA 4G31A 4W4XA 5CT7A 2F2UA 1CKIA 2CMWA 4IIRA 3C7QA 3FQHA 3QQHA 5FQDC 3IW7A 4KWPA 2OXDA 3CS9A 2VD5A 3UPZA 4F78A 4FKRA 3NUSA 3OFMA 4QMZA 5HI2A 4NM0A 4D1XA 4A7CA 5HG7A 3PIYA 4FZFB 3ZBFA 1OPKA 4H3PA 1B6CB 4M8TA 4E4LA 4EYJA 3DKGA 2Z7RA 3QX2A 1MRUA 5JT2A 3ZYAA 2HZ0A 1WVXA 3MS9A 1Q8UA 4H1MA 3LOKA 1NT2A 3BE9A 1GZ8A 3Q2JA 3W0MA 2ZMDA 2IVTA 2F7XE 3GCPA 4D28A 3HUCA 3TXOA 3ORNA 4C4FA 3P08A 4J97A 4I4FA 3BRBA 3L8XA 4FTMA 4I6QA 5HICA 4RMZA 2VTRA 4I1ZA 4C57A 3RPOA 3A61A 5DH3A 2OBJA 1CDKA 3RK7A 3BEGA 3ZSHA 3TMOA 5CANA 4OLIA 1U54A 4BDFA 5HTCA 5K0XA 2WTWA 3SA0A 5L2IA 3SW7A 3PJ8A 2YFXA 4IADA 3QWKA 2R4BA 3CY3A 4O4DA 5HLPA 1U5QA 5A4TA 1FQ1B 4JIAA 4AN2A 2RIOA 4LRMA 4EH9A 1UWHA 3R22A 4RSSA 4KUJA 2ZFYA 3IK3A 3IW8A 1KV1A 3D7TA 3ORKA 4IB1A 3VS5A 2Z7QA 4JBOA 2UW5A 1Q4LA 4W9XA 2WIPA 3CQUA 5CF4A 2IZRA 3BHYA 4C34A 2GNLA 5ANJA 3Q96A 4OTFA 3HMIA 3W2RA 2ZDTA 3FSFA 1P4OA 4EHZA 4G5PA 4YZ9A 4UWBA 2PMNX 4O4EA 4H3QA 5AP1A 5GINE 3NVKI 4E8AA 3QQKA 5DT4A 3KXHA 4AZFA 3MSSA 4I6LA 1Q5KA 2JAVA 1DM2A 2PTKA 1PJKA 3CD8A 2VZ6A 5JSMA 4KSPA 4MD7E 5K9IA 5F20A 3ZONA 2BHHA 4FKJA 2VTAA 4D5KA 3PP1A 5GNKA 5JZNA 4GEOA 1MQBA 3P23A 3D7TB 3EQPA 4XLIA 1YOLA 4CYJA 3LFAA 3PXQA 5J9YA 3FZOA 4FNWA 3R7YA 3SQQA 4IH8A 1HOWA 1XBAA 4E6AA 5A4EA 1FMOE 2A0CX 3DB8A 1WBSA 2C6EA 4FV2A 1ZYCA 3R9HA 3OY1A 5AUTA 3MA3A 2YA9A 3DU8A 4C33A 4XV1A 1OMWA 1LR4A 3VUHA 3W55A 4ACDA 3AD4A 2CJMA 4DFZE 3RAWA 2WMWA 3G9NA 1W2CA 3IG7A 5KE0A 1TFFA 2UUEA 2J0IA 4UYAA 4GFMA 4BCPA 4OBPA 4EOOA 4F63A 2I1MA 2BKZA 4YZMA 1PW2A 3S1HA 4HCVA 4FKPA 4GU9A 2R3LA 3FLYA 3PWDA 5A3XA 1ERKA 3RGFA 4QYHA 5HLWA 1QPCA 1JVPP 3SOCA 2GNFA 3SOAA 4ZJJA 4KSQA 5A6NA 1ZYDA 4CZUA 2PVKA 4YTIA 1Q99A 4XG9A 3QCXA 2RFDA 2VRXA 4ITJA 2W17A 5IQEA 3G0EA 5C27A 4RVMA 2W1IA 4CFWA 5FXRA 4RJ4A 1OECA 2HW6A 4EOLA 1O6KA 2VWUA 3UO6A 1YHSA 3KXNA 4XLVA 3MW1A 1XHAA 2P2IA 3MIAA 3NNXA 4FA2A 5M56A 4J53A 3ID6C 3MV5A 3HDMA 3UOJA 3UGCA 2PVJA 2QOBA 5FP6A 5DPVA 3KY2A 1YXUA 1Y6BA 2I0EA 3TIYA 4ZSJA 1OITA 4FT0A 4FV4A 5CAPA 4GK3A 1NA7A 4CXAA 3CIKA 4O96A 2PUNA 4DEHA 2Y6MA