2W9ZB

Crystal structure of cdk4 in complex with a d-type cyclin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
291
structure length
287
Chain Sequence
b'ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALAPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G1/S-SPECIFIC CYCLIN-D1
publication title Crystal Structure of Human Cdk4 in Complex with a D-Type Cyclin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 61
structure length 287
sequence length 291
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2w9zB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2w9zB01
3IOKA 2UVYA 2QODA 4BKJA 4ZLOA 1M14A 5AM6A 4ZJJA 4YTCA 3FI2A 4U8ZA 3KMWA 4EOIA 4O0WA 3QTIA 4E4NA 5KKRB 4CZTA 3MA6A 4MX9A 3E62A 3PJ3A 4U9AA 1SVGA 2PHKA 3ENHA 1JAMA 4AQCA 4OTRA 4XG8A 4UWCA 4BICA 5HZNA 4L43A 3U9NA 3MESA 1Q24A 1ZZLA 4M12A 2BRBA 5HE3A 3NUNA 3FZPA 3E8NA 4LUDA 4LL5A 4RLLA 4TYEA 2PVLA 3TZ9A 4RG0A 5F94A 2JITA 1RW8A 2W4JA 4LOOA 3NRMA 2WOTA 2UZBA 3L9NA 4FSYA 4AGCA 3Q5IA 4NH1A 4E6CA 3OBGA 3ZOSA 3RGFA 4IAIA 5AR2A 4HCUA 1Q4LA 3VRYA 4EOMA 3QQGA 4QMLA 3Q3BA 3QWJA 1O6LA 4NTTA 3DFCB 4NEUA 3A7IA 4FKJA 2PVKA 2W5HA 2HZNA 3KXXA 4IB0A 5JZNA 3C4EA 5AX3A 3UO6A 5AR7A 4OTQA 1ERKA 4IJ9A 5DE2A 2C3KA 5L3AA 1V0PA 4IACA 5DOSA 5DLSA 1JLUE 4K1BA 3VHKA 1XH6A 2HZ4A 3MIAA 4KD1A 4JNWA 4MTAA 1UU8A 5AA8A 3OXZA 4UBAA 1I44A 4PX6A 4KIQA 4HYHA 3R7YA 3NUSA 3CE3A 3B2TA 3PZHA 4BCMA 1UNGA 5EQPA 2WMWA 4NJDA 3ORXA 4G34A 3SXFA 4E4LA 5EHYA 3L8VA 2J50A 3O96A 4CFMA 3DBFA 3UIUA 4UY9A 4LGDA 4K77A 2WMUA 4D28A 2Q0BA 2QHNA 2OFVA 3NIEA 4J95A 3U8WA 4FKLA 2R3NA 3V8WA 3BHTA 3ALNA 1CKJA 3P7AA 3PIXA 4O2ZA 4QPAA 2CKQA 1UU9A 5AV1A 3P79A 3TNQB 3H9OA 5BYYA 4USFA 3M42A 5IQCA 4FGRA 3NNUA 2YEXA 3L9LA 1WBTA 3PJCA 4FGBA 2WMVA 3WI6A 3I60A 1P14A 2I0VA 2F7ZE 4Z9LA 2B7AA 4E1ZA 3OWJA 1YW2A 5E8SA 5FWKK 2B55A 3VJOA 3R01A 1H07A 3SOCA 3ORIA 3TTJA 4YLLA 3T3VA 1OPJA 2WMQA 4TTHB 4EKKA 5BUJA 2IZRA 1Q8TA 5HO7A 5L2WA 1Y8GA 2QKWB 3VBTA 3IK3A 3U6IA 1J1BA 1Q41A 2C0OA 3E88A 3UOJA 3QCYA 4BCPA 2YIXA 4N57A 4IZ5A 2P2HA 3MJ2A 4U3YA 3CLYA 5IMXA 4FK6A 2OG8A 3PWDA 1A9UA 1RJBA 5HIDA 2R3RA 4OW8A 3P7BA 3GI3A 4PF4A 4BBMA 4D4SA 4R5YA 4FBXA 2GQSA 4GVJA 4XUFA 4WRGA 4EZ5A 2F2CB 5K4IA 3NW6A 4TYHA 3G51A 3QZIA 3PXFA 4BRXA 3PP1A 3C9WA 4FZDB 4A07A 5I0BA 3ERKA 4ENXA 5M4IA 3O0GA 4G17A 3SLSA 3TJDA 5HTCA 2PE2A 3DKOA 2PMOX 4IXPA 4GV1A 4O81A 4I21A 4EQUA 4B8MA 2ZVAA 4I4FA 2B9FA 4OR5A 3DJ5A 3QU0A 3UPXA 5IZFA 3SDJA 3PLSA 2XIYA 3OUNB 4RIWB 4AOJA 4QNYA 5CXZA 2ITZA 3O8UA 1M2QA 4FTOA 3R73A 3ODZX 5AUXA 3IW4A 4RC3A 4M0YA 2C1AA 3QCSA 3RAWA 3WF6A 5EYMA 4A9RA 4C2WA 5HIEA 4BDIA 1QPCA 4BKYA 4F1MA 5GZ8A 2RFDA 2ONLA 2XJ2A 4K2RA 2QI8A 3Q4CA 2OU7A 2WTCA 3R6XA 4RZWA 4W4WA 4N0SA 2OIDA 4C2VA 3FXWA 4GUBA 4NTSA 4DHFA 4GK4A 4RQVA 2E9OA 1GAGA 4JS8A 3A4PA 2B9HA 3ZBXA 3LFNA 5AIRA 3BBWA 5AP7A 5FM3A 2WMBA 2XBJA 3HV3A 4KUJA 3FMLA 4LRJA 3UNZA 4NYEA 4Y46A 4IAZA 2IZTA 2ZOQA 3CD8A 3NAXA 4AT5A 3G9NA 5A3XA 4JQ8A 3QHWA 3VRZA 1M7NA 1WCCA 4RJ6A 2Y4IB 3KRLA 3SRVA 3VN9A 4APPA 3FYKX 3VS6A 4F9BA 3Q4TA 5HG5A 5FEDA 3OTUA 5TO8A 4AZVA 3W8LA 2B0QA 1H8FA 4U43A 2ITNA 5E7RA 1W7HA 1PHKA 3BQRA 4FTNA 3JS2A 2R9SA 3PA5A 4AFJA 2BMCA 4KIPA 3FLSA 1KE7A 4RQKA 5AP1A 5GJGA 3IG7A 4H39A 4GT5A 4EQMA 4QMWA 2OF4A 5FEQA 2QOCA 3MPTA 4HGEA 1PMVA 1MRVA 5IQHA 4UXQA 4QOXA 5CNOA 2W1DA 5HNBA 4ASEA 3PZEA 4QMVA 5HOAA 4USDA 5J5SA 3LM0A 2PTKA 2CNVA 4DEAA 4EOPA 2GHGA 3FQHA 4WSQA 4FG7A 1YI3A 1PW2A 1VZOA 2J90A 2W1EA 2XNPA 3FMEA 4JL9A 4DBXA 3SQQA 2WO6A 4LMUA 2AC3A 3GCVA 4S33A 2BDFA 4ACCA 3UPZA 2X81A 4IM0A 4JJRA 2CSNA 3EQIA 1P4FA 4U81A 4JX7A 3V5WA 2XEYA 3H9FA 3PJ2A 4DGOA 5CWZA 2F49A 2ZMCA 2EU9A 4XS2A 5AUTA 3NCGA 1OL6A 2BCJA 3B8RA 3KXNA 3QC9A 4MNEA 1LP4A 4OTGA 5HCXA 4ACHA 4L3JA 4C4FA 2CKPA 2CN5A 2O65A 3C0GA 3D15A 4KRCA 3ROYA 3C0HA 4FI1A 3HMPA 5AP6A 2A2AA 2BILB 5EYCA 5M51A 4PDSA 4RPVA 5HLWA 1GIHA 5AM7A 1GIJA 5C03A 3ZEWA 3BGZA 4OTHA 3C13A 2VTTA 4TYHB 5BUIA 3EN9A 3IDBA 4CTCA 3RTPA 2Z02A 2XB7A 4PL3A 4EONA 3QQUA 4FSMA 5TE0A 5JFVA 1OBGA 1H1WA 4ZTLA 3EFKA 3R7IA 4E4XA 2ITTA 4EL9A 5B2KA 2BROA 2G2FA 4WKQA 4L3PA 5HGIA 4C4GA 3KULA 1NW1A 1OUYA 4L9IA 3ZO1A 5AWMA 2PUIA 3EFJA 2PY3A 4DFLA 2YITA 3CJGA 2CLXA 2X2LA 2RIOA 2C6DA 3E63A 2YABA 3F3ZA 3P86A 3LW0A 1WAKA 4RFYA 4WBOA 5CU2A 2UZDA 3VAPA 4AX8A 2C5VA 4WT6A 3AGLA 3P0MA 3POZA 4RX5A 3PY0A 1OPKA 3AC1A 4RFZA 3ZRLA 3QRJA 2I7QA 3TNHA 3DT1A 2C3JA 2X7GA 4G5PA 4BYJA 4EHZA 2G1TA 3ZFYA 2QD9A 3QWKA 4I6HA 3TDVA 3I0QA 4FKGA 2WD1A 4UEUA 1YHWA 4AT4A 1YXVA 3GOPA 4YZ9A 4FA2A 4R1YA 5A6OA 5CYIA 4WUAA 3VBVA 4ANLA 2BVAA 3ID6C 1KE9A 2VN9A 3W33A 4TWPA 3RNIA 3E7OA 3V8SA 3SRVB 5FRIA 3CQUA 3CIKA 4RWKA 4CCUA 3OF0A 3PG1A 1NVSA 3BE2A 3LQ5A 4QTAA 4BI1A 3RKBA 3RPRA 3U4WA 3V6SA 4Z55A 5IQAA 4EOOA 3C4ZA 4BCOA 4LYNA 4YGAA 2XJ1A 2C3IB 5EM5A 5LCJA 4X7QA 5E1EA 4EOJA 3JXWA 4PDPA 3G33A 3QZFA 2CKEA 3CQEA 3B2WA 1OBDA 4RJ8A 4C57A 5CEMA 4OTIA 5JQ8A 1H0WA 4G3CA 4AW2A 3W32A 1L8TA 3FSKA 5DEWA 4XX9A 4BIBA 3BRBA 3DV3A 4E7WA 5K4JA 3ZFMA 3TUCA 4IX6A 5HKMA 2W9ZB 4Y8DA 3DXPA 2G01A 3GOKA 3IO7A 2WMXA 3R83A 1SYKA 2BIYA 4KNBA 2X4ZA 4HVDA 4ZK5A 2ZB0A 5I3RA 3QTRA 3VUDA 5I9YA 4D9UA 3K5UA 4CZYB 2OZAB 2W1CA 3QXPA 5CAOA 4G3DA 3HA6A 4WUNA 4A9TA 4USEA 2ITYA 3QZGA 4IB1A 4BKZA 2V62A 2YWPA 3MH0A 3VIDA 4DINA 2PU8A 4FV9A 3UTOA 4XP0A 3C4WA 4NIFA 3HMMA 5FUTA 2VTJA 1DAYA 3KL8A 3PJ8A 4MNEB 2Q0NA 3QHRA 3PTGA 2OXXA 3CQWA 2OJFE 4H36A 3I5NA 4C3FA 1OB3A 2I0YA 3KQ7A 1OL5A 4DGGA 3ZO4A 3BIZA 2J0MB 4EK8A 2PVMA 3RI1A 2Y6MA 2ZM1A 4GIHA 4S32A 3VC4A 1XR1A 2GHLA 5C8MA 3RAKA 3OUKA 3A99A 2QLQA 3MY1A 1JBPE 2VX0A 1J7UA 3SGCA 5D11A 3K2LA 3COHA 4X3FC 1Q62A 4HVSA 2IVUA 4QP1A 5CAQA 3D83A 4IX4A 3QQLA 3SHEA 5I4NA 3BX5A 2ACXA 5IEXA 2VO3A 3MVMA 3A60A 3KULB 4AA5A 4CLJA 4M69A 3RWQA 4C4JA 3VQUA 3H0YA 4YPSA 3P23A 2X4FA 2IW9A 3PA3A 3WZDA 3GEQA 3AD5A 4UYNA 4DTKA 4AFEA 1PYXA 2XH5A 3PVWA 5HI2A 5BNJA 2OJ9A 3TV6A 4E6DA 5GINE 1Q8YA 2F4JA 2QCSA 4Z3VA 1SVHA 3DOGA 3LXLA 4ZJIA 2RFNA 3RBWA 4PNKA 4E5WA 1KSWA 3K5VA 3GNIB 2ITWA 3KXHA 3OY3A 3TCPA 2PE0A 3EL7A 3GP0A 5FD2A 4CSVA 2EB2A 5F1ZA 4UX9A 2ZV8A 2W1ZA 4MCVA 4WG3A 3WOWA 3E8EA 2CPKE 2PVHA 1OL7A 4FNZA 3EKKA 5EFQA 3H10A 4FSTA 3DAKA 3NDMA 4L68A 4PRJA 3ZFXA 3GBZA 2ZJWA 2R3KA 2UZEA 5GZAA 3UG2A 3W2OA 2GCDA 3ENMA 3NMUF 3REPA 2PUPA 3UGCA 5D1JA 3AD6A 4GK3A 1ND4A 3HRCA 5IF1A 2I0HA 1WVYA 2JIUA 4AGUA 4BTJA 3FC1X 3WF9A 3F2RA 2JIIA 3TUBA 2BTSA 2GTMA 2UW0A 3WARA 1UV5A 2C5YA 4ZAUA 4DFUA 5CZIA 4ACGA 3QTUA 4AWIA 3DK6A 4OTPA 4FKVA 2Z7QA 3AT4A 1WBPA 4YJUA 4FV6A 2H8HA 4O1PA 3RM7A 5E8WA 5JFXA 4Q5EA 5KKRC 5AJQA 4Q9SA 5D7VA 4IC8A 5KMIA 3EYHA 4CFUA 3GQLA 3MFRA 4IVCA 1ZYSA 3RHXA 2BKZA 1CM8A 3MTFA 4MBJA 1OKZA 2OSCA 3WIGA 1B38A 1Q8ZA 3BYUA 4UMTA 4X21A 1URWA 2QU5A 4IDTA 3MVJA 3WYXA 4ZZOA 1G5SA 4L44A 2PVNA 4FIJA 1J91A 2OI4X 3R9HA 3BLRA 3MVHA 3ZC5A 4DG0E 4O82A 3C50A 5HBJA 3KXGA 3JPVA 4NIFB 5CY3A 4XG9A 3QGWA 4FE2A 4TRLA 4BDDA 3D9VA 1OIYA 3C5UA 2BZHB 3I7BA 4XRJA 5EW8A 5IA3A 4UXLA 2UVZA 3KB7A 5FG8A 4FK3A 4XLIA 4KBCA 4FYNA 1H27A 4BCKA 3ZUTA 1KOBA 3BEAA 3OVVA 3LXNA 1ZARA 4X3FA 5AP3A 2VO6A 2J5EA 4GFOA 1PF8A 4PNIA 4L6QA 1YWRA 3DY7A 3LAUA 3ULIA 5HVKA 3UIBA 5H9BA 3CEKA 1R3CA 3PXYA 3WF7A 2HCKA 4X2NA 3KK9A 4C35A 3NX8A 4X3JA 4O0RA 3RCDA 5I9UA 5C9CA 1P4OA 5ACBC 4TPTA 2WAJA 4IAKA 5A14A 3AC2A 4M69B 5AMNA 3A8WA 2NNWB 1ZYJA 3D7ZA 4NSTA 3TV7A 4U3ZA 3LFSA 3R8ZA 4WIHA 4HGTA 3EL8A 4FKRA 2XK9A 4K11A 1YOLA 1REJA 1IG1A 2UZTA 1WFCA 3A4OX 3KCKA 3MYGA 5DR2A 3ZC6A 4F0GA 2YWVA 3QBNA 4WRSA 1M2PA 2BTRA 2VTPA 1PKGA 2W4KA 3GENA 3R2BA 1MP8A 1CTPE 2HXLA 5ETIA 5A6NA 3H0ZA 2A1AB 1ZOGA 2BRGA 3Q6UA 1SM2A 3T9TA 2XRWA 1WZYA 4QQTA 5EM6A 3DBCA 5CQUA 4TW9A 3EB0A 5A4LA 4PL5A 5J9ZA 2HW6A 2CHLA 4BTMA 4NL0A 3PFQA 5HO6A 4XNEA 5H2UA 4G5JA 3LJ2A 4LL0A 4DYMA 3BCEA 3ZSIA 3CGOA 4I24A 3P08A 1UKHA 3RZBA 2NRYA 4NM3A 4BVUA 4YZNA 1WBOA 2JFMA 2ZB1A 4ZMFA 2GNJA 4QYYA 3ORKA 2Y9QA 5AR4A 3N4UA 2RG6A 3NGAA 1G8SA 2ZDTA 4I0TA 4YZDA 3OC1A 5KMJA 4IQ6A 5H8GA 1O6YA 4S30A 1Q5KA 2HWOA 1H1SA 1JOWB 2PMNX 3MN3A 3KRRA 4ONAA 2HENA 5ETFA 4YSMA 3F66A 3MPMA 3V5PA 1YVJA 2BR1A 2C47A 3EWHA 2FSTX 5FTGA 3DXNA 2YM5A 3BLHA 1R0EA 3R00A 4OBQA 2A0CX 4FT9A 4GT4A 3E64A 5HHWA 5DH3A 4C4IA 4FT5A 3QD2B 3U55A 3AGMA 3EN4A 4IZYA 2WQOA 3WZJA 4B9DA 4OAUC 1S9IA 3NCZA 2WOUA 1IRKA 4PDOA 2V55A 5DIAA 1XH9A 2JBOA 4O0TA 3L9MA 4R3RA 4AZEA 3W2CA 3OZ6A 3HMOA 4AN3A 1XWSA 5H8BA 3VF8A 4NT4A 1JNKA 2X2MA 2WIHA 5HU9A 2C5OA 2YM3A 5L8JA 2RSVA 1JQHA 4RIXA 4DC2A 4XEYA 2QC6A 5L2QA 3FPMA 4FUYA 4C37A 4HYIA 4JDIA 4R7BA 1DI8A 4C4HA 1Q3WA 4QMOA 4YLKA 2UZOA 5C4KA 2YJRA 1YXUA 2GQGA 2C6IA 3QQHA 4PL4A 4QP6A 4YJRA 2WQNA 3CSVA 3R8MA 5J87A 4AZSA 2Y4IC 3MI9A 4ZIMA 4C62A 4HVGA 3EIDA 5ANDA 3DPKA 4RGJA 4FG8A 4NFNA 1IAJA 4MWIA 1GY3A 1YXSA 4ANNA 3MFUA 2WU6A 3CTJA 3LZBA 4I0SA 3L1SA 3R0TA 3ACJA 3GC8A 4F7LA 3VS4A 3HUCA 4XG7A 3P4KA 5IG1A 4ZLYA 2OXDA 4LRKA 5HO8A 5BMMA 1OECA 3UG1A 4ID7A 2X9EA 5FQDC 3QX2A 5E9EA 2P33A 4JRVA 1TQIA 4QRCA 2Y7JA 3HMNA 2VTRA 3FMKA 5GZ9A 3ZTXA 1PXJA 3AT3A 3G0FA 5L6PA 4YU2A 4I5CA 5IQIA 3TT0A 5KUPA 3EZVA 1UWJA 3ORLA 2W0JA 3HGKA 1Q99A 5DVRA 1IASA 3FMHA 4QYFA 1Z9XA 3LFAA 4EC8A 5CT0A 1PXKA 3PUPA 3E3PA 4U41A 4F99A 4QP8A 5IPJA 4P90A 5AR5A 1U59A 3FMNA 1CSNA 2GPHA 3EQPA 2C1BA 2VU3A 2E9NA 4WG4A 1CDKA 4G6OA 4D1ZA 4HNIA 4O0SA 3U9CA 3UIXA 5BPYA 3KVXA 4J99A 4RX9A 1T45A 2B1PA 4XP2A 3UYSA 3NIZA 4IMYA 4FZ6A 2WFYA 2B54A 3O7LB 4AT3A 4FIEA 4R8QA 5HE0A 5CF6A 2VWUA 3Q5ZA 2J5FA 4JI9A 1OKVA 4DCAA 3ALOA 4M97A 2YM4A 5EG3A 5CEQA 1FINA 2XCHA 4BC6A 5J9YA 4Y73A 2GNHA 3G6HA 3G2FA 3UZTA 2UZLA 2WU7A 3MY5A 3NNXA 3LXPA 4I6QA 5KMKA 3ACKA 4XOZA 2LGCA 4TKSA 4ZEGA 4JBPA 2YZAA 2ZAZA 4NZWB 4RIWA 4BF2A 5EQYA 3ORPA 4BHNA 1YI4A 3OCBA 5AUUA 4BCGA 2QOFA 5HG8A 5L2TA 5KNJA 3UZPA 4ERKA 4CG9A 3BI6A 1ZMVA 2C5XA 4IADA 4E93A 5IEVA 2VWYA 4ZSLA 4IWOA 3L9PA 2PWLA 1XO2B 4FVRA 4KBKA 2Y6OA 3SW4A 5EKNA 5L2SA 1M2RA 3BYOA 4G2FA 4C61A 3ZSGA 2XA4A 2ONLC 2XJ0A 4QTEA 5DN3A 5F4NA 4IM2A 5FXQA 2X0GA 4CQEA 2NRUA 3QA8A 3ZLSA 4RIXB 1J7IA 2GDOA 4ZTQA 3FXXA 3HNGA 1B6CB 1OIUA 3BGPA 1BLXA 5C4LA 2ZDUA 3K3JA 3UZRA 2G2IA 3ODYX 2ZV9A 3R8LA 4JR3A 4DEEA 5IA0A 1OMWA 2O63A 3DB8A 3NPCA 5IUGA 5LMKA 4ALUA 3CBLA 4QYHA 3PXRA 5FLFA 3O8PA 3LIJA 4MEDA 5CSXA 3DKCA 4L7SA 1XH7A 1OZ1A 2HK5A 2OJGA 4MD8E 3EN7A 4CFWA 4GJ2A 1XH8A 4PV0A 2XUUA 1U54A 3PPJA 3KRJA 3ZLYA 2UZVA 4TT7A 2X7OA 5CALA 2XVDA 5I9WA 4FL2A 2BAJA 3BPRA 2IW6A 1ZY4A 3UQCA 5A4QA 3ET7A 4OLIA 3WE4A 4HVIA 2H96A 4O7ZA 4UMUA 5B2LA 4DITA 3FMDA 2VX3A 3QUDA 3SG8A 3AC8A 5BVNA 3PDTA 4M15A 1REKA 4AZFA 4IVBA 2W1GA 3KXZA 4KIKA 2PPQA 2X8IA 3Q53A 3UQFA 5DR9A 2BFYA 3AMAA 4EJNA 2OO8X 3NSZA 2GQRA 4DFBA 5JT2A 1LUFA 4I0RA 4AZTA 5IA4A 3GCQA 2VTAA 3EQCA 2UZNA 3F3UA 4M0ZA 1YDTE 2QO7A 3RPSA 4AGDA 2AUHA 3H30A 3PIZA 4J1RA 5LVPA 5HTBA 1W83A 2ITVA 4ITHA 4EZ7A 4QMNA 4OBOA 4L8MA 3JR1A 4LMNA 4DA5A 2F2UA 4TN6A 2HZ0A 1TKIA 3FL4A 4XCUA 5CT7A 3BEGA 1XHAA 3ROCA 2OICA 2Z7SA 4DCEA 4TYJA 5HE1A 2VTSA 3RK7A 4M66A 3ZDIA 4F0IA 4ZSJA 5LQFA 1ATPE 2E9PA 3IKAA 4G3EA 5IQFA 4E3CA 1OL2A 3C4CA 4C3PA 4B7TA 4DE4A 3DB6A 2FGIA 5EI6A 1EH4A 3F5GA 3RZFA 2UVXA 1OITA 4F08A 2QR8A 1XBAA 5B2MA 1YDRE 2WPAA 4O0XA 4EK3A 3QA0A 5AP0A 2Y0AA 3CCNA 3T9IA 2VRXA 3OOGA 3R2YA 4CKIA 4L52A 4C34A 1XKKA 4O21A 1BI8A 2PSQA 2CJMA 3QGYA 3JVRA 3TNPC 1FGIA 4J52A 3V01A 2OKRA 5FP6A 4BDHA 5IH6A 5KMMA 2WGJA 2F9GA 4FKUA 3S95A 5CVGA 3FHRA 2X9FA 2PZIA 5LVMA 3PYYA 5AR3A 2W17A 2VTOA 2R5TA 3D5WA 3ZO2A 4M7IA 5EK7A 4FTCA 5B7VA 3E87A 5HCYA 3QKKA 4IB5A 2BZJA 2GS6A 3EN6A 4IVAA 4ENYA 5EI2A 5TT7A 4AZWA 3KRXA 3Q9WA 2W5AA 4RLKA 3UQGA 3DK3A 4FYOA 4C8BA 4Z16A 4LV5A 2XKCA 3R7GA 5HX8A 5AUWA 4KKEA 5HNIX 5JEBA 5M07A 2R3PA 4JIAA 4BCFA 3GCSA 3VVHA 2GTNA 4FV4A 3N4VA 2WKMA 2REIA 1VYZA 3LFQA 4RMZA 3TWJA 3W2PA 5JFWA 5DA3A 2CGUA 5DNRA 3II5A 1Q97A 1MQBA 1H08A 3AC5A 3ZXTA 2IG7A 4GFMA 4BGGA 4U7ZA 4F4PA 4FV3A 3NS9A 4UV0A 4D1XA 4JQ7A 2GFSA 1M52A 5GJFA 3IS5A 5KMLA 4LV8A 3EJ1A 4QMZA 5DRDA 3R04A 5FP5A 3C5IA 3CY3A 4YNOA 4CV8A 2QG5A 5E8ZA 4DLJA 1LEZA 4FKSA 4FSQA 1U54B 5I9ZA 1OM1A 3DA6A 4BTKA 4FNXA 3HDMA 3NYVA 4KSPA 4BZDA 4XG2A 2X2KA 4HYUA 4JG7A 2YDIA 3V04A 4NM5A 5A46A 1KV2A 2Y4PA 5DRBA 2NPQA 3RHKA 1GZNA 2WEVA 4Y95A 4G6NA 4L53A 1U5RA 3KRWA 4N70A 4BCHA 5CNNA 2QONA 4HZRA 1GJOA 5EM7A 4HNFA 4KIKB 4CFVA 2OZAA 5GHVA 5CX9A 4WNKA 2XZSA 1H01A 3D14A 3WZUA 4BI2A 4TYGA 3MDYA 5FXSA 4XH6A 4EYJA 1SNXA 3EMGA 4DH3A 5IU2A 4EC9A 2JKMA 3M2WA 4H58A 4CGAA 4J97A 3SW7A 3QCXA 3TNIA 1FVTA 3VO3A 4C02A 3ATSA 5M57A 3TXOA 1OIQA 1QPJA 2X6DA 4KB8A 3G90X 5J8IA 2XEZA 4RC4A 4D0WA 3EFLA 3SXRA 3TIZA 3PE2A 4XRLA 5EW3A 3FC2A 4MD7E 4AN2A 2ITUA 2YDJA 5EI8A 3U6JA 2YISA 4B0GA 1JSVA 1DI9A 2W5BA 3BYVA 5CEIA 4AACA 5DGZA 3W2SA 4CEGA 4PMPA 4GL9A 3IONA 3FZOA 4C58A 4ZY4A 3MH1A 3PSCA 1XH4A 5LVLA 3G6GA 4HPTE 4R7IA 5EQEA 2O3PA 4D4VA 2AYPA 3EQFA 3DKGA 4ZS0A 3MV5A 3UVRA 4TY1A 3PSDA 5E92A 2VWBA 3CD3A 4J8MA 1WVXA 3IOPA 1LPUA 4B4LA 5EDPA 3RAIA 4BL1A 2CNQA 4D58A 3ZHPC 4EORA 4CMTA 3KC3A 5CS6A 4A9YA 4C36A 3QQFA 4GU6A 5HQ0A 1BL7A 3U87A 4A06A 4XV1A 4MXZA 4X6QC 4M13A 4YJOA 5T68A 5CEKA 4GFGA 5DHJA 5LWMA 2W96B 1OUKA 2PVJA 3F69A 3FZRA 2PUUA 4EH9A 4BHZA 1XQZA 4F1TA 3CXWA 2GNIA 4X2KA 4IEBA 1CMKE 1ZMWA 4PWNA 5LVNA 3FLNC 4CKRA 1MRYA 3OS3A 4IW0A 3BLQA 3Q9XA 3KMUA 4WA9A 5DT0A 1DM2A 4RT7A 4TZRA 3DAJA 3IGGA 4FUXA 4L01A 4M67A 4O86A 3JUHA 4M8TA 5K0KA 3TV4A 4CNHA 4EK6A 5ITAA 3DJ7A 3R9RA 3FSFA 3PE1A 1KV1A 2JDRA 3ANQA 3GB2A 3U51A 2WQEA 1CKIA 1ZMUA 2W06A 4F7JA 4FZAB 1FVRA 3G0EA 5CF8A 3H9RA 2PE1A 4PUZA 4Q2AA 2ZMDA 4W8DA 4H1JA 3AXWA 3Q32A 3Q9YA 2XNEA 4GT3A 5DG5A 4EH8A 3ZUUA 5HX6A 3P7CA 4FTIA 4EH7A 4ITJA 4CFXA 3UVQA 5LJJA 2WQBA 5CASA 3RWPA 4G9RA 1UWHA 1GNGA 4Y5QA 4YC3A 3ZMMA 3I6WA 3RCJA 3TZ7A 2WTWA 5G1XA 2A19B 2ETRA 2Q83A 4MD9E 4WSYA 4MXAA 1G8AA 5M09A 5JGAA 1YOJA 4OT6A 3V5JA 3Q4ZA 2XIXA 5IISA 2V7AA 2YCQA 3I81A 3OEZA 2UW8A 3F88A 3CKWA 3HECA 5AV0A 3HMIA 2O5KA 2VNYA 4GYGA 4HGLA 4XBUA 3BYMA 4YJVA 2I1MA 2XIZA 2H34A 1Y91A 5HG7A 3F5PA 4DBNA 3OD6X 2O0UA 5BVOA 2WTKB 4LGGA 4P5ZA 2C6TA 4D2VA 4NFMA 3R9OA 5AFVA 4C7TA 4E73A 5AV4A 1PXIA 1UVRA 2C6LA 3ZU7A 3E5AA 2BHHA 4MH7A 1OPLA 1GOLA 5L8LA 3OFMA 4FC0A 4QMSA 3EQHA 4KKHA 3CC6A 4R3CA 4V04A 3RNYA 2OWBA 3I0OA 5EOBA 3RJCA 4BR3A 4BGHA 3NW7A 4ZTNA 5CANA 4PPAA 3RK9A 1SNUA 1APME 3ZS5A 4EWHA 3QX4A 3GCPA 2BAQA 5M4FA 2IZSA 3GC9A 3QRIA 2YFXA 2XK6A 1ZOEA 3R28A 1YOMA 5JK3A 4YJNA 5EDQA 3UIMA 3IECA 4AOTA 2J0IA 4W8EA 1W8CA 4M84A 3OCTA 2F7EE 4JDJA 2JAVA 3COKA 3NUXA 4IDVA 1H28A 2OK1A 1R39A 2NO3A 4QP7A 4ANSA 5CZHA 3D7TA 3R21A 2QQ7A 5CF5A 3L8PA 3MGYA 3ZDUA 2I6LA 3VWAA 4TXCA 3G5DA 4O6EA 4CLIA 2ZV2A 3DK7A 2XYUA 4HCVA 3FXZA 3UOLA 3FBVA 3V51A 5EKOA 4NWMA 4R3PA 5AADA 3UO5A 4MNFA 4UYAA 5CVFA 5HVJA 3S2PA 4IHPA 4MBIA 3VBQA 2XP2A 1QMZA 4GW8A 2RL5A 2QOHA 1QPEA 4IZAA 3F7ZA 1W84A 2BRHA 3RPOA 5K9IA 4RVKA 2R3IA 1OGUA 3O23A 4AW5A 3KN5A 4KAOA 2PVRA 3FZSA 4I5PA 2IVTA 3UVPA 3O8TA 4ANBA 1NVRA 4BBFA 2VWXA 3KGAA 3FLWA 4FOBA 2VO7A 3FI3A 4EH4A 2GSFA 4I1ZA 5J1WA 3VW8A 2WTJA 3DNEA 2PK9A 2BRMA 4ITIA 4XV3A 5CSWA 4WG5A 4PY1A 3EOCA 2B9JA 2XK3A 4JRNA 5L6OA 3P78A 2C6KA 2EXMA 2FUMA 1V1KA 4CRLA 2OW3A 5HVYA 3HV6A 4W4YA 4Q5HA 1BI7A 5F20A 3RALA 2CGXA 4UWYA 1Q61A 4D2TA 4NW5A 5J5TA 4CFNA 3ATTA 1MQ4A 3LMIA 3ZONA 2YIWA 4GJ3A 2OH0E 3R1QA 3S00A 1BUHA 4UN0C 2UW6A 3QD0A 4JDKA 4NW6A 4D4YA 4AE6A 5IUIA 3EFWA 3CJFA 1NA7A 2QHMA 4BN1A 2C3LA 4I3ZA 4CT1A 1R1WA 4QPMA 4CV9A 3R1YA 2VTNA 2C6MA 3QLGA 4TWOA 4AU8A 3GQIA 3R8VA 2JDTA 2VGPA 4IC7A 4D4RA 2IW8A 5IEYA 2Z8CA 4C0TA 4DEIA 1DAWA 4GYIA 4V05A 3FV8A 4BDCA 3OBJA 4IWDA 3UO4A 3VUTA 2W1FA 3C0IA 5FTOA 3TL8A 5HLPA 3ZBFA 5AAGA 2B4SB 2SRCA 5D9HA 4U6RA 2WXVA 4D2PA 5KZIA 5EDRA 5B0XA 3JYAA 1DS5A 3LFDA 4XG6A 2R3HA 4FEUA 2Z2WA 3BHHA 2YM6A 5ACKA 2JD5A 3MJ1A 4NKSA 5EYKA 4MHAA 4KINA 3I5ZA 4RVTA 3NWWA 4IB3A 3DNDA 3HZTA 4MXXA 3ZRKA 2R7IA 4HW7A 4EHVA 3OW4A 2CNUA 5DBXA 1YHVA 4M68A 4HJOA 3R8PA 3DQWA 4PTEA 2OJIA 4BYIA 3NNWA 1BX6A 4I41A 3AG9A 2QOQA 2YLFA 3NYNA 3UNJA 1F5QA 2FSOX 1PRYA 3LFBA 3FAAA 2FYSA 3VS7A 4CYIA 5CU0A 4B6LA 4IX3A 3E8CA 4OTWA 3W16A 1A48A 3D7TB 4ZLZA 2G15A 4I23A 3QL8A 3DFAA 3VNTA 4FT0A 1I09A 4QMTA 2JLDA 2WZJA 3UC3A 4RVLA 5AV2A 4E26A 1BKXA 4W9XA 2QOKA 5K5NA 4W4VA 2R3JA 3UBDA 4HVHA 4ACMA 4AE9A 5CU4A 2ESMA 4BDBA 3ELJA 4RIOA 1UKIA 3SOAA 5CSPA 5HIBA 1K9AA 4DG2E 5K0XA 1PJKA 3MIYA 4U45A 2ITQA 3UYTA 3V6RA 2JEDA 5A4CA 3LLAA 4O96A 3R8UA 2QLUA 4CQGA 2R3FA 3LJ0A 4MXCA 3ZO3A 3NUAA 1SZMA 2OH4A 3M11A 3T3UA 2GU8A 3WZEA 4I93A 2YCRA 4XBRA 1ZWSA 4GG5A 4CCBA 4DAWA 3P1AA 4FZ7A 5ANOA 3R71A 4BDGA 2R3MA 4H3BA 4AN9A 1P2AA 1ZYCA 5AP5A 5JMSA 2ITPA 3R1NA 4KABA 2ERKA 5CSVA 4MKCA 3O17A 4DT8A 1GZKA 4EHEA 4FTKA 3ZM9A 4S2ZA 4DH1A 3JVSA 4GMYA 3WYYA 4GCJA 4K0YA 4O1OA 4PDYA 3F2NA 4LOPA 4JIKA 4XYFA 2QKRA 4RJ7A 2YAAA 2F57A 3VQHA 1BMKA 3N51A 4FVQA 4LQMA 4GG7A 5CTPA 3O50A 4I5HA 4FKIA 3QUPA 5JKGA 1ZY5A 3G9LX 2IO6A 3KKVA 4HYSA 4F1OA 1M17A 4L3LA 3NVKI 5HD7A 3HV7A 4UWBA 3FKNA 5TKDA 3V3VA 3DLSA 2GFCA 2ITOA 3QKLA 3CTHA 4YURA 4IANA 2BHEA 2VV9A 1FBNA 4TWNA 3ORZA 2J0KA 3EZRA 4FR4A 5CAUA 3W10A 4DEGA 4FL1A 2R4BA 2F7XE 1YWVA 4FNYA 3LCKA 3HL7A 2VGOA 3DDPA 4BWXA 3RINA 1R78A 4G1WA 2R3OA 4C3RA 3HDNA 1FOTA 3VW6A 2QOIA 3DQXA 1HCKA 2YHVA 3IW5A 1JVPP 4FTLA 4PTGA 4CMOA 2H9VA 3FI8A 5TF9A 2DUVA 3GUBA 3HP2A 4XV2A 3OWPA 2QVSE 3GU8A 3QTSA 4E8AA 3QQKA 1YI6A 4QMXA 2J4ZA 5BVDA 1CKPA 3HX4A 1T46A 5LCKA 4DEHA 2BALA 4RRVA 3CY2A 5DT4A 4UMRA 5I9VA 4KSQA 5AX9A 3SKCA 3TN8A 2EB3A 5ETCA 4AG8A 4DGLC 5LMKC 1QPDA 4HCTA 2JC6A 3AOXA 5FM2A 2W05A 4GIIA 4MWHA 3ZLWA 4I6FA 1K3AA 4OTFA 1U5QA 3R7OA 2QOLA 3PXZA 3UDBA 2IVVA 4BIEA 2KULA 2B9IA 3VUHA 4O7TA 1URCA 4A4LA 5LXMA 3OTVA 3TUDA 3FZ1A 4YO6A 2AC5A 4ACDA 5FDPA 4NU1A 3FMMA 2VTIA 4DH8A 2YDKA 1ZLTA 2W4OA 2J0LA 4HOKA 3HRBA 3F5XA 5LARA 4J96A 3FEGA 4S31A 3DS6A 5KO1A 4HZSA 2YAKA 1K2PA 5E90A 5J1VA 4F09A 1JKLA 2OGVA 3PG3A 2QURA 4DG3E 2R3GA 3GGFA 3KXMA 4FV5A 2Z60A 3IQ7A 4ZTMA 2PMIA 3VUKA 4M3QA 5AR8A 4BCIA 3PIYA 4V0GA 2OZOA 2BAKA 3BHUA 4BY9E 5AUVA 3NNVA 4ARKA 4FV7A 2JKKA 4E5BA 5HBEA 1VYWA 3GU6A 3QYZA 5DFPA 5IDNA 4C4EA 2XK7A 3U4UA 5E1SA 4MVFA 2GMXA 3BKBA 4YP8A 2HIWA 4LOQA 3QTXA 3MSSA 3W8QA 3A7GA 2R7BA 4BBEA 4YNEA 2RKUA 3LPBA 4IVDA 3PRFA 4RX8A 3I79A 3KK8A 3AMBA 4H3PA 3VS2A 3RVGA 1UA2A 2RFSA 2IVSA 2VWZA 4WD5A 2YERA 4KS8A 5C26A 2VTHA 2YCFA 4X0MA 2FSMX 3LVPA 2C5NA 3DBQA 3NYXA 1UNLA 3PXKA 4JOAA 5AUZA 5KBRA 3DGKA 1ZYLA 4L42A 2UW3A 3SG9A 4FF8A 3D5VA 4H1MA 4YMJA 5HG9A 4E6QA 3SD0A 4Z7HA 4O7RA 4QQJA 4CMUA 1TQMA 4MF0A 2X39A 3EHAA 1RE8A 1FQ1B 4QP3A 3MB7A 4A4OA 4K6ZA 2J7TA 5JFSA 5F9EA 2OJJA 4XG4A 1FGKA 4FV1A 4NJ3A 4F6UA 5CSHA 3S0OA 4U42A 2LAVA 2BRNA 3FWQA 5KBQA 5ANJA 5JSMA 5LWNA 1JSUA 2CGWA 2EWAA 2VNWA 3QXOA 4R1VA 4F6WA 1YQJA 2HOGA 4I94A 4WBBB 1H4LA 3UP2A 4D2SA 4J98A 4EH3A 5M4UA 4BCQA 3A62A 1OI9A 4YUQA 4YZCA 5JQ5A 1Z57A 3P5KA 3AMYA 2YZLA 1V0BA 2I0EA 4ZZMA 3UMWA 4AS0A 4Y83A 3IW6A 3E8DA 3F9NA 5J9LA 4OAVB 3AD4A 5IA5A 3QTWA 2W9FB 3OW3A 4MBLA 4I6BA 4DGMA 4EH6A 4QT1A 3F5UA 1WBVA 1PXLA 3ZRMA 3ZZWA 3G15A 1WVWA 3KREA 4D2RA 4QMQA 4FNWA 2UV2A 3FUPA 3Q2MA 4PMSA 1Q8UA 1AGWA 4F70A 5ANEA 2HAKA 3TKUA 4QMMA 1YDSE 4YPDA 3K54A 2R3LA 3V5TA 1W0XC 5T3QA 2PULA 1JSTA 2BFXA 2C6EA 4GSBA 4QP9A 2NP8A 4EQCA 1E1XA 4YSJA 2EXCX 2YA9A 2HY81 4K9YA 5D41A 4BCJA 4DGNA 4FTAA 4J7BA 5FBOA 3E3BX 4H3QA 5HE2A 3RPVA 3S4QA 4ASDA 1E9HA 3KVWA 5JGDA 1UU7A 3CGFA 4RZVA 2BPMA 2OLCA 4JDHA 2XM8A 5E8TA 2BDWA 4P4CA 3Q2JA 4JG8A 1P5EA 4RSSA 5CF4A 1G3NA 4G31A 4W9WA 5HCZA 2VWVA 2YIRA 4YJTA 1ZYDA 2IZUA 5BUEA 3EYGA 4X6RA 5T6KA 3GC7A 4O91A 5JGBA 4QP4A 5JRQA 3VUMA 3W2RA 4JBQA 4KKGA 2VWWA 4DEBA 4LM5A 4MQ1A 2IWIA 4CYJA 3UC4A 3Q04A 2GNGA 2XMYA 1V0OA 3FI4A 3QC4A 3VBWA 4EUTA 2EVAA 2P2IA 4Z7GA 4ZY5A 3Q60A 2X1NA 5J95A 3SX9A 3BBTB 3BV3A 4I20A 1H00A 4AA0A 2WTKC 2GS2A 4V0GB 5BYLA 5TOZA 4GS6A 3MH3A 2EUFB 3FKLA 5E8UA 4RBLA 4O0YA 2JDOA 1MUOA 4AAAA 4ZTRA 1F0QA 4NCTC 5FGKA 3TG1A 3DLZA 4CRSA 3LKMA 3SV0A 1UU3A 2R3QA 5FDXA 3W55A 3DBDA 4YC8A 3QF9A 4BGQA 3Q96A 4ANQA 2WELA 4AW0A 4D0XA 2Y8OA 3C1XA 3HYHA 4YZBA 4YHJA 5DPVA 4BI0A 4FIFA 2O8YA 4RIYA 4BZOA 1QCFA 3C4XA 3ORMA 4RWIA 4S34A 2VTLA 5DYJA 4YJSA 1OIRA 4ERWA 1J1CA 4JX3A 4EHGA 4FTMA 4R7HA 4W4XA 3N4TA 5EYDA 3MB6A 5IA2A 2QU6A 2B53A 5HESA 4DF3A 1NXKA 3ZCLA 4TWCA 4IH8A 3A61A 3SA0A 5E8VA 4G6LA 4FKPA 4O2PA 4G9CA 4X2FA 4U40A 3FL5A 1PXNA 3PXQA 2G2HA 4YJPA 3PY3A 2JFLA 2PZYA 5HLNA 4JXFA 2CMWA 3NLBA 4R78A 5L8KA 2CCHA 5CQWA 1H26A 3FKOA 3BHYA 4FTTA 4IX5A 2GNLA 4RJ5A 5CVHA 2C30A 4II5A 4LFIA 4P2KA 3OCGA 4IJPA 1JWHA 3ORTA 2XIRA 2P4IA 2W7XA 1VR2A 1W98A 4ZOGA 5AP2A 5CI7A 4JLCA 3DKFA 4FV2A 2JGZA 4V01A 1FMOE 4AXAA 2R0IA 3R7EA 2OIBA 1U4DA 3AC4A 4AGWA 2W1HA 3PVGA 4O84A 3ETAA 4FSZA 1SVEA 3LFEA 4J8NA 4Y72A 2WIPA 3CR0A 3L8SA 4C38A 5AA9A 3F3VA 1YKRA 1UNHA 2PVYA 1Q8WA 4M14A 4E5AX 2X7FA 3DZQA 1IR3A 4RVMA 2QO9A 2UZWE 4U44A 4YLJA 4QTBA 4R6VA 5ANGA 2O64A 3GC0A 4CTBA 5K5XA 4MXOA 3OOMA 3QLFA 4I22A 3L8XA 4PMMA 2FA2A 4WHZA 5J79A 3PVBA 4DEDA 4QMPA 2OXYA 2XBAA 4QQ5A 2FO0A 5ETAA 4ZJVA 3EKNA 3FLQA 2BKKA 4ANMA 3BWFA 2P0CA 1R0PA 3EQBA 3NUUA 4IZ7A 4EUUA 3OCSA 3OG7A 2JDVA 1YRPA 3R9NA 4ALVA 3THBA 4FEQA 4QD6A 3Q9ZA 1JKKA 1B39A 4IWPA 2CCIA 4AA4A 2ETMA 5F95A 3IDPA 3KY2A 4F9WA 5EW9A 3LOKA 3VS0A 3MFSA 2FSLX 5AAFA 2WB8A 5FBNC 4DTBA 5BX0A 2PYWA 4U80A 5L6WL 4N6YA 1KWPA 4KS7A 4AP7A 5IUHA 4Q9ZA 3CS9A 3KN6A 4UB7A 2QO2A 4BDKA 4O38A 3RK5A 4FV8A 1Y57A 4HGSA 3VF9A 2QOBA 4IE9A 4IIRA 3ZYAA 2YN8A 4F9AA 5BMSA 3HA8A 4NCTA 3CKXA 4BDFA 4O83A 1H1RA 2PZRA 1VEBA 3GXLA 3RMFA 3OXIA 4L45A 5DWRA 3ZEPA 4WNMA 3KFAA 4ALWA 2QOOA 3ZLXA 3DAEA 5DR6A 4EH2A 5A9UA 5KHXA 5ANKA 3TKIA 3QRUA 3VJNA 5L2IA 4PTCA 4QYEA 4QYGA 5IA1A 5IMEA 2VO0A 5EM8A 1RQQA 3PRIA 4IFCA 4RIYB 3W2QA 4EBWA 2YM7A 5E8YA 2RG5A 3COMA 2R0UA 1O6KA 4EWQA 2CN8A 3AQVA 2XCKA 3QCQA 3QQJA 4YR8A 3TEIA 4FKWA 3E93A 3VS3A 4D2WA 4XV9A 4FVPA 2J9MA 3F2AA 2XNNA 3E92A 2ZV7A 5AUYA 2JBPA 3HV5A 2HW7A 3O2MA 2XNMA 4QMYA 3MH2A 5A4EA 3DBEA 2Z7LA 4RC2A 5HNGA 1PY5A 3VS1A 1YHSA 5IQGA 2V0DA 3FE3A 4JAJA 3V5QA 2XK4A 2OBJA 3PWYA 4O7SA 5M56A 1KE5A 5AAEA 3RPYA 3VS5A 3LMHA 5BQ0A 3LHJA 1JPAA 4JR7A 3PPZA 1H1QA 3I7CA 5E91A 3FDNA 3TDWA 1AD5A 3ZZEA 3QYWA 3FYJX 3O71A 3MW1A 2WTVA 4UMPA 1VJYA 4C59A 1S9JA 2UW5A 3QRTA 3BU3A 3R7UA 3IDCA 4I92A 3UODA 3BYSA 5JRSA 4DFYA 3VUGA 2C69A 3TJCA 1YXXA 2BDJA 4FODA 4J71A 4FEVA 4YHTA 3F61A 4O27B 4E20A 4RFMA 4FSNA 4DT9A 4ZTSA 3FQSA 5LMAA 4R77A 1PXPA 3LCTA 5J7HA 2YM8A 4APCA 4BTFA 3LJ1A 5EH0A 2CDZA 5KMNA 2GHMA 5AEPA 4JBVA 3TNWA 1GIIA 2XNOA 4GRBA 1STCE 1TQPA 4EOKA 3POOA 4YJQA 2VUWA 4X2GA 2XS0A 4O6LA 4BWKA 5IH5A 3DU8A 4EEVA 5DT3A 2WMSA 4IWQA 3DDQA 3R1SA 5HD4A 2PL0A 3HVCA 5BVWA 4FZFB 5GIPE 2JAMA 4HPUE 4EOLA 4F9YA 2XRUA 1ZAOA 5EOLA 1IA8A 3FLZA 4EJ7A 2YIYA 4FIHA 3WBLA 2DYLA 4NM7A 4FTQA 4IFGA 3SVVA 4JG6A 3QFVA 4FG9A 3O7LD 5E8XA 2WQMA 5I5ZA 4GEOA 4KRDA 4D55A 1XBBA 2BIKB 4B8LA 3NZ0A 1KOAA 1HOWA 2HYYA 3NYOA 2V22A 3A7HA 2IPXA 4BCNA 2RFEA 3QZHA 5FTQA 4IAFA 3EQGA 4AW1A 3TM0A 4N4SA 5A4TA 3KCFA 5CEPA 3BQCA 4MK0A 4MAOA 3D0EA 2E9UA 4IAAA 5FEEA 2DQ7X 2BZIB 4LRMA 3NEWA 4R5SA 1IAHA 4GH2A 2PZ5A 3E7VA 3Q6WA 3LFFA 5C27A 3F6XA 3KMMA 5C01A 2FB8A 3Q52A 3SAYA 3WILA 2IN6A 3KEXA 3TI1A 1ZOHA 2J6MA 1W82A 3H3CA 1GZ8A 2YLEA 3LCOA 4L00A 1OL1A 5IDPA 4FT7A 4RX7A 1BYGA 2E9VA 4FV0A 2HWPA 2RGPA 3QALE 4J53A 3HKOA 4XJ0A 4BDJA 2UUEA 4QPSA 4A9SA 4YC6A 4FICA 3TZMA 2R64A 4PP7A 2XK8A 3FJQE 2PZPA 3GU4A 4EZ3A 2UZUE 3PSBA 2ETKA 3MFTA 5BYZA 4FSUA 3UMXA 4OT5A 5CU6A 4BIDA 3I6UA 4DFNA 3PJ1A 4DN5A 3EN5A 3Q4UA 3ANRA 4EOQA 2WHBA 5JZJA 5BVKA 3EH9A 2BZKB 5CENA 2W1IA 3OROA 3A8XA 4MXYA 3K3IA 4QTCA 2UW4A 5BVEA 3QRKA 1FMKA 4U79A 3M1SA 4ZSEA 2ZM3A 3BU5A 3COIA 3FPQA 4ANOA 4EK4A 3AT2A 3P9JA 4K8AA 4CVAA 1WBWA 3HAMA 3EQDA 3C4FA 3HUBA 4EBVA 3TZ8A 5CI6A 4RJ3A 3T8OA 4QNAA 5I9XA 5M06A 2JIVA 3F3WA 2I40A 2KTYA 2GS7A 1PMNA 4XLVA 4XP3A 2PVFA 4C33A 5HU3A 3HRFA 3MWUA 4OGRA 3LCDA 5KHWA 1MRUA 4O0VA 4FEWA 3VHEA 4ZP5A 4Y85A 5M44A 2A4LA 4IAYA 3ZSHA 4FEXA 4TL0A 4IBMA 1OKYA 3BV2A 5HEZA 4RJ4A 2V5QA 2X6EA 3GFEA 5HBHA 4ZS4A 5DI1A 1A06A 4O7WA 4ZMEA 3LQ3A 1NVQA 2WTIA 3F3TA 5L4QA 1WBSA 4FTRA 3DZOA 4UZHA 3ZM4A 4ORKA 2CGVA 4F7SA 4Y5HA 4O7VA 4E6AA 5JH6A 1KE8A 3C51A 3IGOA 1BL6A 3B8QA 3GCUA 4LGHA 4CT2A 5CAPA 5M53A 3FY2A 4P5QA 4FSWA 3ORNA 2DWBA 1KUTA 4NUSA 4WNPA 5AV3A 2Z7RA 5M55A 4FL3A 2PMLX 3KU2A 3NR9A 3N9XA 1QL6A 4K18A 3UJGA 3UOHA 5ICPA 2PUNA 5JN2A 3KA0A 2YJSA 4GKIA 4GU9A 5D10A 5E4HA 2W99B 3C7QA 3I4BA 4CFFA 2WMRA 2YACA 4KBAA 5KE0A 3IW7A 1Z5MA 4QQCA 4QTDA 3R9DA 3D2KA 4FSRA 5C1QB 1GZOA 1YWNA 3CTQA 3D94A 2DS1A 4PQNA 2XKEA 3VBXA 2ZM4A 3W18A 1H1PA 1L3RE 4ZTHA 3VBYA 3D2IA 5M08A 2EXEA 3S3IA 3OWLA 3HV4A 5TR6A 3BHVA 5LMBA 2WMAA 5HICA 4CG8A 3TIYA 5M4CA 4JAIA 3W1FA 3QD4A 4BFMA 4FMQA 2QNJA 1XH5A 3IW8A 3OWKA 4L67A 3OY1A 3A7JA 3WE8A 4EKLA 1NY3A 3UP7A 2XNGA 3MPAA 3IPHA 4KWPA 2C0TA 1LEWA 2VTMA 4BWPA 3OP5A 4UZDA 2J2IB 3FY0A 4JT3A 1X8BA 4FKTA 4FTUA 4F63A 4FKOA 4FX3A 5C8NA 3DTWA 5G6VA 3CPCA 2E2BA 2XKDA 3UE4A 4BZNA 4O7YA 4F65A 3BE9A 3PPKA 3QTZA 4PPCA 3FZTA 4OUCA 4YZMA 4F6SA 3LXKA 4ZSGA 3ZUVA 3R02A 5DEYA 5GJDA 3V5LA 2VD5A 3R7VA 4IM3A 4D5KA 2C68A 1IEPA 3ULZA 4QP2A 5KCVA 3ITZA 3FLYA 1XBCA 5BVFA 4O7LA 3MBLA 3PY1A 3SC1A 3UNKA 3GFWA 4FIGA 3NVMB 4MF1A 3LMGA 4FIIA 4JQEA 2P55A 4CXAA 1M7QA 3QUEA 4DLIA 4EI4A 1J3HA 4N6ZA 1ZXEA 3S1HA 3CPBA 5HTIA 2YCSA 4U5JA 2JKOA 4QMUA 3TKHA 1H24A 4EYMA 5H3QA 4GUEA 3F82A 3NUYA 4UALA 1RDQE 3F7WA 3HP5A 4TNBA 4TNDA 4ZZNA 2VZ6A 3WIKA 2A27A 4F0FA 4DH5A 4RA4A 3ZH8A 3OT8A 2VWIA 3QD3A 4DH7A 5A54A 4A7CA 4F7NA 3GU7A 4KIOA 4LUEA 4I5MA 4FKQA 5CLPA 3U54A 3BELA 2OIQA 4YTIA 3RM6A 3TTIA 5IH4A 3U6HA 3PLAE 4D1SA 2UW9A 1PYEA 4PP9A 5CU3A 3SXSA 4YTFA 2O2UA 2HXQA 4G16A 3VUIA 4AUAA 4AOIA 4G3GA 3BU6A 1ZZ2A 5KZ0A 3QKMA 2G9XA 4MYGA 3NAYA 5LVOA 1WMKA 2XNBA 1YXTA 3DCVA 1U46A 4NM0A 3HAVA 3O51A 3KF4A 2X8DA 3LFCA 5IQBA 3DXQA 1Y8YA 2OF2A 2XKFA 4K33A 4U0IA 2UW7A 3ZXZA 1IA9A 1H0VA 4KA3A 1F3MC 4B99A 2R2PA 3GU5A 3OT3A 3KF7A 5DMZA 2RF9A 3WZKA 1Y6AA 4WOVA 5EHOA 4LI5A 4QO9A 3R30A 4L46A 4MQ2A 4O7NA 4DTAA 4GK2A 3VULA 3BZ3A 1WBNA 4EK5A 1SMHA 2WTDA 5KX8A 3FMJA 5GNKA 2WNTA 4CD0A 2ITXA 2ERZE 4ZY6A 2ZYBA 4A4XA 3MS9A 3HEGA 4TYIA 2VTQA 3WF5A 2BUJA 3I1AA 2XIKA 3D5XA 4YBJA 2HZIA 2OFUA 3LQ8A 3PVUA 3HLLA 1FVVA 4I4EA 3CP9A 3LE6A 4XMOA 5GIOE 3LCSA 5CXHA 1E1VA 4BB4A 4RWLA 5D12A 3PP0A 5IKWA 1FPUA 3BWJA 4RWJA 4H05A 4GKHA 2JKQA 4XOYA 1O9UA 4P7EA 3RAHA 4AF3A 3H4JA 4U97A 3DJ6A 3JY0A 4NK9A 1JKTA 2FH9A 4UMQA 5ANIA 3R63A 4L7FA 4LG4A 1PXMA 1H25A 4ASXA 2HY0A 2WMTA 3MA3A 4NKAA 4WNOA 3RP9A 1PMUA 1PKDA 1Q3DA 5C8KA 3R22A 4FTJA 3EQRA 1JKSA 4X3FB 4BDEA 2VX1A 3PA4A 4O0UA 4BDAA 4YTHA 1PXOA 4EOSA 5CEOA 2V7OA 4JBOA 1TVOA 3NUPA 5AP4A 5EHLA 5H8EA 5KMOA 4ASZA 5K3YA 3OEFX 2VAGA 4O22A 3MTLA 3JY9A 3GT8A 4X2JA 4G3FA 3LLTA 2YIQA 1LR4A 3V8TA 5I3OA 1Y6BA 4D9TA 4F9CA 4JVGA 4OTDA 2XF0A 5LOHA 3D4QA 3LM5A 4WO5A 3FQEA 2XM9A 3TACA 3MVLA 3OHTA 4YHFA 4XG3A 2CLQA 3GVUA 2B52A 2HELA 2C0IA 4PMTA 4F64A 2QG7A 3MY0A 3FHIA 2FVDA 4CKJA 1AQ1A 5HORA 2QR7A 2H6DA 2J0JA 4FT3A 1NT2A 3UOKA 5AIKA 2X8EA 2XYNA 1KE6A 1OVEA 2GNFA 3WF8A 5FXRA 1OKWA 3D5UA 3QAME 4EH5A 3A7FA 4ZSAA 3OMVA 4YBKA 4PPBA 3QTQA 4GVAA 2C4GA 3A2CA 3NW5A 4FOCA 4YO4A 4RA5A 2WEIA 4ZXTA 4D5HA 1J7LA 2J51A 5IQEA 2CKOA 1HCLA 3BGQA 4OBPA 4XHKB 2JDSA 3DTCA 4CZUA 5IQDA 2C6OA 2P3GX 4A9UA 4DFXE 3AC3A 1PMEA 2IJMA 1XJDA 3OXTA 5D7AA 5J7BA 4E4MA 5CAVA 1ZRZA 4DFZE
chains in the Genus database with same CATH superfamily
3IOKA 2UVYA 2QODA 4BKJA 4ZLOA 1M14A 5AM6A 4ZJJA 4YTCA 3FI2A 4U8ZA 3KMWA 4EOIA 4O0WA 3QTIA 4E4NA 5KKRB 4CZTA 3MA6A 4MX9A 3E62A 3PJ3A 4U9AA 1SVGA 2PHKA 3ENHA 1JAMA 4AQCA 4OTRA 4XG8A 4UWCA 4BICA 5HZNA 4L43A 3U9NA 3MESA 1Q24A 1ZZLA 4M12A 2BRBA 5HE3A 3NUNA 3FZPA 3E8NA 4LUDA 4LL5A 4RLLA 4TYEA 2PVLA 3TZ9A 4RG0A 5F94A 2JITA 1RW8A 2W4JA 4LOOA 3NRMA 2WOTA 2UZBA 3W0RA 3L9NA 4FSYA 4AGCA 3Q5IA 4NH1A 4E6CA 3OBGA 3ZOSA 3RGFA 4IAIA 5AR2A 4HCUA 1Q4LA 3VRYA 4EOMA 3QQGA 4QMLA 3Q3BA 3QWJA 1O6LA 4NTTA 3DFCB 4NEUA 3A7IA 4FKJA 2PVKA 2W5HA 2HZNA 3KXXA 4IB0A 5JZNA 3C4EA 5AX3A 3UO6A 5AR7A 4BJJB 4OTQA 1ERKA 4IJ9A 5DE2A 2C3KA 5L3AA 1V0PA 4IACA 3VONA 5DOSA 5DLSA 1JLUE 4K1BA 3VHKA 1XH6A 2HZ4A 3MIAA 4KD1A 4JNWA 4MTAA 1UU8A 5AA8A 3OXZA 4UBAA 1I44A 4PX6A 4KIQA 4HYHA 3R7YA 3NUSA 3CE3A 3B2TA 3PZHA 4BCMA 1UNGA 5EQPA 2WMWA 4NJDA 3ORXA 4G34A 3SXFA 4E4LA 5EHYA 3L8VA 2J50A 3O96A 4CFMA 3DBFA 3UIUA 4UY9A 4LGDA 4K77A 2WMUA 1ST4A 4D28A 2Q0BA 2QHNA 2OFVA 3NIEA 4J95A 3U8WA 4FKLA 2R3NA 3V8WA 3BHTA 3ALNA 1CKJA 3P7AA 3PIXA 4O2ZA 4QPAA 2CKQA 1UU9A 5AV1A 3P79A 3TNQB 3H9OA 5BYYA 4USFA 3M42A 5IQCA 4FGRA 3NNUA 2YEXA 3L9LA 1WBTA 3PJCA 4FGBA 2WMVA 3WI6A 3I60A 1P14A 2I0VA 2F7ZE 4Z9LA 2B7AA 4E1ZA 3OWJA 1YW2A 5E8SA 5FWKK 2B55A 3VJOA 3R01A 1H07A 3SOCA 3ORIA 3TTJA 4YLLA 3T3VA 1OPJA 2WMQA 4TTHB 4EKKA 5BUJA 2IZRA 1Q8TA 5HO7A 5L2WA 1Y8GA 2QKWB 3VBTA 3IK3A 3U6IA 1J1BA 1Q41A 2C0OA 3E88A 3UOJA 3QCYA 4BCPA 2YIXA 4N57A 2AQXA 4IZ5A 2P2HA 3MJ2A 4U3YA 3CLYA 5IMXA 4FK6A 2OG8A 3PWDA 1A9UA 1RJBA 5HIDA 2R3RA 4OW8A 3P7BA 3GI3A 4PF4A 4BBMA 4D4SA 4R5YA 4FBXA 2GQSA 4GVJA 4XUFA 4WRGA 4EZ5A 2F2CB 5K4IA 3NW6A 4TYHA 3G51A 3QZIA 3PXFA 4BRXA 3PP1A 3C9WA 4FZDB 4A07A 5I0BA 3ERKA 4ENXA 5M4IA 3O0GA 4G17A 3SLSA 2XAMA 3TJDA 5HTCA 2PE2A 3DKOA 2PMOX 4IXPA 4GV1A 4O81A 4I21A 4EQUA 4B8MA 2ZVAA 4I4FA 2B9FA 4OR5A 3DJ5A 3QU0A 3UPXA 4QDVA 5IZFA 3SDJA 3PLSA 2XIYA 3OUNB 4RIWB 4AOJA 4QNYA 5CXZA 2ITZA 3O8UA 1M2QA 4FTOA 3R73A 3ODZX 5AUXA 3IW4A 4RC3A 4M0YA 2C1AA 3QCSA 3RAWA 3WF6A 5EYMA 4A9RA 4C2WA 5HIEA 4BDIA 1QPCA 4BKYA 4F1MA 5GZ8A 2RFDA 2ONLA 2XJ2A 4K2RA 2QI8A 3Q4CA 2OU7A 2WTCA 3R6XA 4RZWA 4W4WA 4N0SA 2OIDA 4C2VA 3FXWA 4GUBA 4NTSA 4DHFA 4GK4A 4RQVA 2E9OA 1GAGA 4JS8A 3A4PA 2B9HA 3ZBXA 3LFNA 5AIRA 3BBWA 5AP7A 5FM3A 2WMBA 2XBJA 3HV3A 4KUJA 3BLAA 3FMLA 4LRJA 3UNZA 3BL9A 1W2DA 4NYEA 4Y46A 4IAZA 2IZTA 2ZOQA 3CD8A 3NAXA 4AT5A 3G9NA 5A3XA 4JQ8A 3QHWA 3VRZA 2A98A 1M7NA 1WCCA 4RJ6A 2Y4IB 3KRLA 3SRVA 3VN9A 4APPA 3FYKX 3VS6A 4F9BA 3Q4TA 5HG5A 5FEDA 3OTUA 5TO8A 4AZVA 3W8LA 2B0QA 1H8FA 4U43A 2ITNA 5E7RA 1W7HA 1PHKA 3BQRA 4FTNA 3JS2A 2R9SA 3PA5A 4AFJA 2BMCA 4KIPA 3FLSA 1KE7A 4RQKA 5AP1A 5GJGA 3IG7A 4H39A 4GT5A 4EQMA 4QMWA 2OF4A 5FEQA 2QOCA 3R9RA 3MPTA 4HGEA 1PMVA 1MRVA 5IQHA 4UXQA 4QOXA 3PUFC 5CNOA 2W1DA 5HNBA 4ASEA 3PZEA 4QMVA 5HOAA 4USDA 5J5SA 3LM0A 2PTKA 2CNVA 4DEAA 4EOPA 2GHGA 3FQHA 4O4EA 4WSQA 4FG7A 1YI3A 1PW2A 1VZOA 2J90A 2W1EA 2XNPA 3FMEA 4JL9A 4DBXA 3SQQA 2WO6A 4LMUA 2AC3A 3GCVA 4S33A 2BDFA 4ACCA 3UPZA 2X81A 4IM0A 4JJRA 2CSNA 3EQIA 1P4FA 4U81A 4JX7A 3V5WA 2XEYA 3H9FA 3PJ2A 4DGOA 5CWZA 2F49A 2ZMCA 2EU9A 4XS2A 5AUTA 3NCGA 1OL6A 2BCJA 3B8RA 3KXNA 3QC9A 4MNEA 1LP4A 4OTGA 5HCXA 4ACHA 4L3JA 4C4FA 2CKPA 2CN5A 2O65A 3C0GA 3D15A 4KRCA 3ROYA 3C0HA 4FI1A 3HMPA 5AP6A 2A2AA 2BILB 5EYCA 5M51A 4PDSA 4QEBA 4RPVA 5HLWA 1GIHA 5AM7A 1GIJA 5C03A 3ZEWA 3BGZA 4OTHA 3C13A 2VTTA 4TYHB 5BUIA 3EN9A 3IDBA 4CTCA 3RTPA 2Z02A 2XB7A 4PL3A 4EONA 3QQUA 4FSMA 5TE0A 5JFVA 1OBGA 1H1WA 4ZTLA 3EFKA 3R7IA 4E4XA 2ITTA 4EL9A 5B2KA 2BROA 2G2FA 4WKQA 4L3PA 5HGIA 4C4GA 3KULA 1NW1A 1OUYA 4L9IA 3ZO1A 5AWMA 2PUIA 3EFJA 2PY3A 4DFLA 2YITA 3CJGA 2CLXA 2X2LA 2RIOA 2C6DA 3E63A 2YABA 3F3ZA 3P86A 3LW0A 1WAKA 4RFYA 4WBOA 5CU2A 2UZDA 3VAPA 4AX8A 2C5VA 4WT6A 3AGLA 3P0MA 3POZA 4RX5A 3PY0A 1OPKA 3AC1A 4RFZA 3ZRLA 3QRJA 2I7QA 3TNHA 3DT1A 2C3JA 2X7GA 4G5PA 4BYJA 4EHZA 2G1TA 3ZFYA 2QD9A 3QWKA 4I6HA 3TDVA 3I0QA 4FKGA 2WD1A 4UEUA 1YHWA 4AT4A 1YXVA 3GOPA 4YZ9A 4FRFA 4FA2A 4R1YA 5A6OA 5CYIA 4WUAA 3VBVA 4ANLA 2BVAA 3ID6C 1KE9A 2VN9A 3W33A 4TWPA 3RNIA 3E7OA 3V8SA 3SRVB 5FRIA 3CQUA 3CIKA 4RWKA 4CCUA 3OF0A 3PG1A 1NVSA 3BE2A 3LQ5A 4QTAA 4BI1A 3RKBA 3RPRA 3U4WA 3V6SA 4Z55A 5IQAA 4EOOA 3C4ZA 4BCOA 4LYNA 2XAOA 4YGAA 2XJ1A 2C3IB 5EM5A 5LCJA 4X7QA 5E1EA 4EOJA 3JXWA 4PDPA 3G33A 3QZFA 2CKEA 3CQEA 3B2WA 1OBDA 4RJ8A 4C57A 5CEMA 4OTIA 5JQ8A 1H0WA 4G3CA 4AW2A 3W32A 1L8TA 3FSKA 5DEWA 4XX9A 4BIBA 3BRBA 3DV3A 4E7WA 5K4JA 3ZFMA 3TUCA 4IX6A 5HKMA 2W9ZB 4Y8DA 3DXPA 2G01A 3GOKA 3IO7A 2WMXA 3R83A 1SYKA 2BIYA 4KNBA 2X4ZA 4HVDA 4ZK5A 2ZB0A 5I3RA 3QTRA 3VUDA 5I9YA 4D9UA 3K5UA 4CZYB 2OZAB 2W1CA 3QXPA 5CAOA 4G3DA 3HA6A 4WUNA 4A9TA 4USEA 2ITYA 3QZGA 4IB1A 4BKZA 2V62A 2YWPA 3MH0A 3VIDA 4DINA 2PU8A 4FV9A 3UTOA 4XP0A 3C4WA 4NIFA 3HMMA 5FUTA 2VTJA 1DAYA 3KL8A 3PJ8A 4MNEB 2Q0NA 3QHRA 3PTGA 2OXXA 3CQWA 2OJFE 4H36A 3I5NA 4C3FA 1OB3A 2I0YA 3KQ7A 1OL5A 4DGGA 3ZO4A 3BIZA 2J0MB 4EK8A 2PVMA 3RI1A 2Y6MA 2ZM1A 4GIHA 4S32A 3VC4A 1XR1A 2GHLA 5C8MA 3RAKA 3OUKA 3A99A 2QLQA 3MY1A 1JBPE 2VX0A 1J7UA 3SGCA 5D11A 3K2LA 3COHA 4X3FC 1Q62A 4HVSA 2IVUA 4QP1A 5CAQA 3D83A 4IX4A 3QQLA 3SHEA 5I4NA 3BX5A 2ACXA 5IEXA 3AKKA 2VO3A 3MVMA 3A60A 3KULB 4AA5A 4CLJA 4M69A 3RWQA 4C4JA 3VQUA 3H0YA 4YPSA 3P23A 2X4FA 2X0QA 3PA3A 2IW9A 3WZDA 3GEQA 3AD5A 4UYNA 4DTKA 4AFEA 1PYXA 2XH5A 3PVWA 5HI2A 5BNJA 2OJ9A 3TV6A 4E6DA 5GINE 1Q8YA 2F4JA 2QCSA 4Z3VA 1SVHA 3DOGA 3LXLA 4ZJIA 2RFNA 3RBWA 4PNKA 4E5WA 1KSWA 3K5VA 3GNIB 2ITWA 3KXHA 3OY3A 3TCPA 2PE0A 3EL7A 3GP0A 5FD2A 4CSVA 2EB2A 5F1ZA 4UX9A 2ZV8A 2W1ZA 4MCVA 4WG3A 3WOWA 3E8EA 2CPKE 2PVHA 1OL7A 4FNZA 3EKKA 5EFQA 3H10A 4FSTA 3BL7A 3DAKA 3NDMA 4L68A 4PRJA 3ZFXA 3GBZA 2ZJWA 2R3KA 2UZEA 5GZAA 3UG2A 3W2OA 2GCDA 3ENMA 3NMUF 3REPA 2PUPA 3UGCA 5D1JA 3AD6A 4GK3A 1ND4A 3HRCA 5IF1A 2I0HA 1WVYA 2JIUA 4AGUA 4BTJA 3FC1X 3WF9A 3F2RA 2JIIA 3TUBA 2BTSA 2GTMA 2UW0A 3WARA 1UV5A 2C5YA 4ZAUA 4DFUA 5CZIA 4ACGA 3QTUA 4AWIA 3DK6A 4OTPA 4FKVA 2Z7QA 3AT4A 1WBPA 4YJUA 4FV6A 2H8HA 4O1PA 3RM7A 5E8WA 5JFXA 4AXCA 4Q5EA 5KKRC 5AJQA 4Q9SA 5D7VA 4IC8A 5KMIA 3EYHA 4CFUA 3GQLA 3MFRA 4IVCA 1ZYSA 3RHXA 2BKZA 1CM8A 3MTFA 4MBJA 1OKZA 2OSCA 3WIGA 1B38A 1Q8ZA 3BYUA 4UMTA 4X21A 1URWA 2QU5A 4IDTA 3MVJA 3WYXA 4ZZOA 1G5SA 4L44A 2PVNA 4FIJA 1J91A 2OI4X 3R9HA 3BLRA 3MVHA 3ZC5A 4DG0E 4O82A 3C50A 5HBJA 3KXGA 3JPVA 4NIFB 5CY3A 4XG9A 3QGWA 4FE2A 4TRLA 4BDDA 3D9VA 1OIYA 3C5UA 2BZHB 3I7BA 4XRJA 5EW8A 4O4FA 4UXLA 2UVZA 5IA3A 3KB7A 5FG8A 4FK3A 4XLIA 4KBCA 4FYNA 1H27A 4BCKA 3ZUTA 1KOBA 3BEAA 3OVVA 3LXNA 1ZARA 4X3FA 5AP3A 2VO6A 2J5EA 4GFOA 1PF8A 4PNIA 4L6QA 1YWRA 3DY7A 3LAUA 3ULIA 5HVKA 3UIBA 5H9BA 3CEKA 1R3CA 3PXYA 3WF7A 2HCKA 4X2NA 3KK9A 4C35A 3NX8A 4X3JA 4O0RA 3RCDA 5I9UA 5C9CA 1P4OA 5ACBC 4TPTA 2WAJA 4IAKA 5A14A 5BV3A 3AC2A 4M69B 5AMNA 3A8WA 2NNWB 1ZYJA 3D7ZA 4NSTA 3TV7A 4U3ZA 3LFSA 3R8ZA 4WIHA 4HGTA 4JMQA 3EL8A 4FKRA 2XK9A 4K11A 1YOLA 1REJA 1IG1A 2UZTA 1WFCA 3A4OX 3KCKA 3MYGA 5DR2A 3ZC6A 4F0GA 2YWVA 3QBNA 4WRSA 1M2PA 2BTRA 2VTPA 1PKGA 2W4KA 3GENA 3R2BA 1MP8A 1CTPE 2HXLA 5ETIA 5A6NA 3H0ZA 2A1AB 3W0NA 1ZOGA 2BRGA 3Q6UA 1SM2A 3T9TA 2XRWA 1WZYA 4QQTA 5EM6A 3DBCA 5CQUA 4TW9A 3EB0A 5A4LA 4PL5A 4AAYA 5J9ZA 2HW6A 2CHLA 4BTMA 4NL0A 3PFQA 5HO6A 4XNEA 5H2UA 4G5JA 3LJ2A 4LL0A 4DYMA 3BCEA 3ZSIA 3CGOA 4I24A 3P08A 1UKHA 3RZBA 2NRYA 4NM3A 4BVUA 4YZNA 1WBOA 2JFMA 2ZB1A 4ZMFA 2GNJA 4QYYA 3ORKA 2Y9QA 5AR4A 3N4UA 2RG6A 3NGAA 1G8SA 2ZDTA 4I0TA 4YZDA 3OC1A 5KMJA 4IQ6A 5H8GA 1O6YA 4S30A 1Q5KA 2HWOA 1H1SA 1JOWB 2PMNX 3MN3A 3KRRA 4ONAA 2HENA 5ETFA 4YSMA 3F66A 3MPMA 3V5PA 1YVJA 2BR1A 2C47A 3EWHA 2FSTX 5FTGA 3DXNA 2YM5A 3BLHA 1R0EA 3R00A 4OBQA 2A0CX 4FT9A 4GT4A 3E64A 5HHWA 5DH3A 4C4IA 4FT5A 3QD2B 3U55A 3AGMA 3EN4A 4IZYA 2WQOA 3WZJA 4B9DA 4OAUC 1S9IA 3NCZA 2WOUA 1IRKA 4PDOA 2V55A 5DIAA 1XH9A 2JBOA 4O0TA 3L9MA 4R3RA 4AZEA 3UDTA 3W2CA 3OZ6A 3HMOA 4AN3A 1XWSA 5H8BA 3VF8A 4NT4A 1JNKA 2X2MA 2WIHA 5HU9A 2C5OA 2YM3A 3AKLA 5L8JA 2RSVA 1JQHA 4RIXA 4DC2A 4XEYA 2QC6A 5L2QA 3FPMA 4FUYA 4C37A 4HYIA 4JDIA 4R7BA 1DI8A 4C4HA 1Q3WA 4QMOA 4YLKA 2UZOA 5C4KA 3W0OA 2YJRA 1YXUA 2GQGA 2C6IA 3QQHA 4PL4A 4QP6A 4YJRA 2WQNA 3CSVA 3R8MA 5J87A 4AZSA 2Y4IC 3MI9A 4ZIMA 4C62A 4HVGA 3EIDA 5ANDA 3DPKA 4RGJA 4FG8A 4NFNA 1IAJA 4MWIA 1GY3A 1YXSA 4ANNA 3MFUA 2WU6A 3CTJA 3LZBA 4I0SA 3L1SA 3R0TA 3ACJA 3GC8A 4F7LA 3VS4A 3HUCA 4XG7A 3P4KA 5IG1A 4ZLYA 2OXDA 4LRKA 5HO8A 5BMMA 1OECA 3UG1A 4ID7A 2X9EA 5FQDC 3QX2A 5E9EA 2P33A 3W0SA 4JRVA 1TQIA 4QRCA 2Y7JA 3HMNA 2VTRA 3FMKA 5GZ9A 3ZTXA 1PXJA 3AT3A 3G0FA 5L6PA 4YU2A 4I5CA 5IQIA 3TT0A 5KUPA 3EZVA 1UWJA 3ORLA 2W0JA 3HGKA 1Q99A 5DVRA 1IASA 3FMHA 4QYFA 1Z9XA 3LFAA 4EC8A 5CT0A 1PXKA 3PUPA 3E3PA 4U41A 4F99A 4QP8A 5IPJA 4P90A 5AR5A 1U59A 3FMNA 1CSNA 2GPHA 3EQPA 2C1BA 2VU3A 2E9NA 4WG4A 1CDKA 4G6OA 4D1ZA 4HNIA 4O0SA 3U9CA 3UIXA 5BPYA 3KVXA 3O5AA 4J99A 4RX9A 1T45A 2B1PA 4XP2A 3UYSA 3NIZA 4IMYA 4FZ6A 2WFYA 2B54A 3O7LB 4AT3A 4FIEA 4R8QA 5HE0A 5CF6A 2VWUA 3Q5ZA 2J5FA 4JI9A 1OKVA 4DCAA 3ALOA 4M97A 2YM4A 5EG3A 5CEQA 1FINA 2XCHA 4BC6A 5J9YA 4Y73A 2GNHA 3G6HA 3G2FA 3UZTA 2UZLA 2WU7A 3MY5A 4DDIA 3NNXA 2IF8A 3LXPA 4I6QA 5KMKA 3ACKA 4XOZA 2LGCA 4TKSA 4ZEGA 4JBPA 2YZAA 2ZAZA 4NZWB 4RIWA 4BF2A 2XALA 3ORPA 5EQYA 4BHNA 1YI4A 3OCBA 5AUUA 4BCGA 2QOFA 5HG8A 5L2TA 5KNJA 3UZPA 4ERKA 4CG9A 3BI6A 1ZMVA 2C5XA 4IADA 4E93A 5IEVA 2VWYA 4ZSLA 4IWOA 3L9PA 2PWLA 4AXEA 1XO2B 4FVRA 4KBKA 2Y6OA 3SW4A 5EKNA 5L2SA 1M2RA 3BYOA 4G2FA 4C61A 3ZSGA 2XA4A 2ONLC 2XJ0A 4QTEA 5DN3A 5F4NA 4IM2A 5FXQA 2X0GA 4CQEA 2NRUA 3QA8A 3ZLSA 4RIXB 4I6LA 1J7IA 2GDOA 4ZTQA 3FXXA 3HNGA 1B6CB 1OIUA 3BGPA 1BLXA 5C4LA 2ZDUA 3K3JA 3UZRA 2G2IA 3ODYX 2ZV9A 3R8LA 4JR3A 4DEEA 5IA0A 1OMWA 2O63A 3DB8A 3NPCA 5IUGA 5LMKA 4ALUA 3CBLA 4QYHA 3PXRA 5FLFA 3O8PA 3LIJA 4MEDA 5CSXA 3DKCA 4L7SA 1XH7A 1OZ1A 2HK5A 2OJGA 4MD8E 3EN7A 4CFWA 4GJ2A 1XH8A 4PV0A 2XUUA 1U54A 3PPJA 3KRJA 3ZLYA 2UZVA 4TT7A 2X7OA 5CALA 2XVDA 5I9WA 4FL2A 2BAJA 3BPRA 2IW6A 1ZY4A 3UQCA 5A4QA 3ET7A 4OLIA 3WE4A 4HVIA 2H96A 4O7ZA 4UMUA 5B2LA 4DITA 3FMDA 2VX3A 3QUDA 3SG8A 3AC8A 5BVNA 3PDTA 4M15A 1REKA 4AZFA 4IVBA 2W1GA 3KXZA 4KIKA 2PPQA 2X8IA 3Q53A 3UQFA 5DR9A 2BFYA 3AMAA 4EJNA 2OO8X 3NSZA 2GQRA 4DFBA 5JT2A 1LUFA 4I0RA 4AZTA 5IA4A 3GCQA 2VTAA 3EQCA 2UZNA 3F3UA 4M0ZA 1YDTE 2QO7A 3RPSA 4AGDA 2AUHA 3H30A 3PIZA 4J1RA 5LVPA 5HTBA 1W83A 2ITVA 4ITHA 2XANA 4EZ7A 4QMNA 4OBOA 4L8MA 3JR1A 4LMNA 4DA5A 2F2UA 4TN6A 2HZ0A 1TKIA 3FL4A 4XCUA 5CT7A 3BEGA 1XHAA 3ROCA 2OICA 2Z7SA 4DCEA 4TYJA 5HE1A 2VTSA 3RK7A 4M66A 3ZDIA 4F0IA 4ZSJA 5LQFA 1ATPE 2E9PA 3IKAA 4G3EA 5IQFA 4E3CA 1OL2A 3C4CA 4C3PA 4B7TA 4DE4A 3DB6A 3NFGB 2FGIA 5EI6A 1EH4A 3F5GA 3RZFA 2UVXA 1OITA 4F08A 2QR8A 1XBAA 5B2MA 4AXFA 1YDRE 2WPAA 4O0XA 4EK3A 3QA0A 5AP0A 2Y0AA 3CCNA 3T9IA 2VRXA 3OOGA 3R2YA 4CKIA 4L52A 4C34A 1XKKA 4O21A 1BI8A 2PSQA 2CJMA 3QGYA 3JVRA 3TNPC 1FGIA 4J52A 3V01A 2OKRA 5FP6A 4BDHA 5IH6A 5KMMA 2WGJA 2F9GA 4FKUA 3S95A 5CVGA 3FHRA 2X9FA 2PZIA 5LVMA 3PYYA 5AR3A 2W17A 2VTOA 2R5TA 3D5WA 3ZO2A 4M7IA 5EK7A 4FTCA 5B7VA 3E87A 5HCYA 3QKKA 4IB5A 2BZJA 2GS6A 3EN6A 4IVAA 4ENYA 5EI2A 5TT7A 4AZWA 3KRXA 3Q9WA 2W5AA 4RLKA 3UQGA 3DK3A 4FYOA 4C8BA 4Z16A 4LV5A 2XKCA 3R7GA 5HX8A 5AUWA 4KKEA 5HNIX 5JEBA 5M07A 2R3PA 4JIAA 4BCFA 3GCSA 3VVHA 2GTNA 4FV4A 3N4VA 2WKMA 2REIA 1VYZA 3LFQA 4RMZA 3TWJA 3W2PA 5JFWA 4AXDA 5DA3A 2CGUA 5DNRA 3II5A 1Q97A 1MQBA 1H08A 3AC5A 3ZXTA 2IG7A 4GFMA 4BGGA 4U7ZA 4F4PA 4FV3A 3NS9A 4UV0A 4D1XA 4JQ7A 2GFSA 1M52A 5GJFA 3IS5A 5KMLA 4LV8A 3EJ1A 4QMZA 5DRDA 3R04A 5FP5A 3C5IA 3CY3A 4YNOA 4CV8A 2QG5A 5E8ZA 4DLJA 1LEZA 4FKSA 4FSQA 1U54B 5I9ZA 1OM1A 3DA6A 4BTKA 4FNXA 3HDMA 3NYVA 4KSPA 4BZDA 4XG2A 2X2KA 4HYUA 4JG7A 2YDIA 3V04A 4NM5A 5A46A 1KV2A 2Y4PA 5DRBA 2NPQA 3RHKA 1GZNA 2WEVA 4Y95A 4G6NA 4L53A 1U5RA 3KRWA 4N70A 4BCHA 5CNNA 2QONA 4HZRA 1GJOA 5EM7A 4HNFA 4KIKB 4CFVA 2OZAA 5GHVA 5CX9A 4WNKA 2XZSA 1H01A 3D14A 3WZUA 4BI2A 4TYGA 3MDYA 5FXSA 4XH6A 4EYJA 1SNXA 3EMGA 4DH3A 5IU2A 4EC9A 2JKMA 3M2WA 4H58A 4CGAA 4J97A 3SW7A 3QCXA 3TNIA 1FVTA 3VO3A 4C02A 3ATSA 5M57A 3TXOA 1OIQA 1QPJA 2X6DA 4KB8A 3G90X 5J8IA 2XEZA 4RC4A 4D0WA 3EFLA 3SXRA 3TIZA 3PE2A 4XRLA 5EW3A 3FC2A 4MD7E 4AN2A 2ITUA 2YDJA 5EI8A 3U6JA 2YISA 4B0GA 1JSVA 1DI9A 2W5BA 3BYVA 5CEIA 4AACA 5DGZA 3W2SA 4CEGA 4PMPA 4GL9A 3IONA 3FZOA 4C58A 4ZY4A 3MH1A 3PSCA 1XH4A 5LVLA 3G6GA 4HPTE 4R7IA 5EQEA 2O3PA 4D4VA 2AYPA 3EQFA 3DKGA 4ZS0A 3MV5A 3UVRA 4TY1A 3PSDA 5E92A 2VWBA 3CD3A 4J8MA 1WVXA 3IOPA 1LPUA 4B4LA 5EDPA 3RAIA 4BL1A 2CNQA 4D58A 3ZHPC 4EORA 4CMTA 3KC3A 5CS6A 4A9YA 4C36A 3QQFA 4GU6A 5HQ0A 1BL7A 3U87A 4A06A 4XV1A 4MXZA 4X6QC 4M13A 4YJOA 5T68A 5CEKA 4GFGA 5DHJA 5LWMA 2W96B 1OUKA 2PVJA 3F69A 3FZRA 2PUUA 4EH9A 2ZFYA 4BHZA 1XQZA 4F1TA 3CXWA 2GNIA 4X2KA 4IEBA 1CMKE 1ZMWA 4PWNA 5LVNA 3FLNC 4CKRA 1MRYA 3OS3A 4IW0A 3BLQA 3Q9XA 3KMUA 4WA9A 5DT0A 1DM2A 4RT7A 4TZRA 3DAJA 3IGGA 4FUXA 4L01A 4M67A 4O86A 3JUHA 4M8TA 5K0KA 3TV4A 2X0PA 4CNHA 4EK6A 3DJ7A 5ITAA 3FSFA 3PE1A 1KV1A 2JDRA 3ANQA 3GB2A 3U51A 2WQEA 1CKIA 1ZMUA 2W06A 4F7JA 4FZAB 1FVRA 3G0EA 5CF8A 3H9RA 2PE1A 4PUZA 4Q2AA 2ZMDA 4W8DA 4H1JA 3AXWA 2X0OA 3Q32A 3Q9YA 2XNEA 4GT3A 5DG5A 4EH8A 3ZUUA 5HX6A 3P7CA 4FTIA 4EH7A 4ITJA 4CFXA 3UVQA 5LJJA 2WQBA 5CASA 3RWPA 3P5JC 4G9RA 1UWHA 1GNGA 4Y5QA 4YC3A 4O4CA 3ZMMA 3I6WA 3RCJA 3TZ7A 2WTWA 5G1XA 2A19B 2ETRA 2Q83A 4MD9E 4WSYA 3ML1A 4MXAA 1G8AA 5M09A 5JGAA 1YOJA 4OT6A 3V5JA 3Q4ZA 2XIXA 5IISA 2V7AA 2YCQA 3I81A 3OEZA 2UW8A 3F88A 3CKWA 3HECA 5AV0A 3HMIA 2O5KA 2VNYA 4GYGA 4HGLA 4XBUA 3BYMA 4YJVA 2I1MA 2XIZA 2H34A 1ST0A 1Y91A 5HG7A 3F5PA 4DBNA 3OD6X 2O0UA 5BVOA 2WTKB 4LGGA 4P5ZA 2C6TA 4D2VA 4NFMA 3R9OA 5AFVA 4C7TA 4E73A 5AV4A 1PXIA 1UVRA 2C6LA 3ZU7A 3E5AA 2BHHA 4MH7A 1OPLA 1GOLA 5L8LA 3OFMA 4FC0A 4QMSA 3KIOC 3EQHA 4KKHA 3CC6A 4R3CA 4V04A 3RNYA 2OWBA 3I0OA 5EOBA