2W9ZB

Crystal structure of cdk4 in complex with a d-type cyclin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
291
structure length
287
Chain Sequence
ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALAPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Cdk4 in Complex with a D-Type Cyclin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords G1/S-SPECIFIC CYCLIN-D1
total genus 61
structure length 287
sequence length 291
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2w9zB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2w9zB01
4CFMA 4YC6A 3DQWA 2UZOA 4RRVA 4O0YA 5DVRA 2QOBA 2BDWA 3UZRA 1GIHA 4IXPA 3CBLA 3SRVA 4A9UA 3VS4A 4FNZA 4QNYA 2GNGA 1OL7A 4RFZA 1IASA 2X4ZA 3A8WA 3AC8A 3A8XA 2UUEA 4L7SA 3Q60A 5EQYA 3PJ1A 4XMOA 5M08A 1H1RA 3C4FA 3CEKA 3FXXA 3KRJA 4QMTA 3U9NA 4D28A 4K18A 4I5PA 5BVFA 3U6IA 4A7CA 3NRMA 2PVFA 4H36A 3ROCA 5KMNA 3HRFA 2Q83A 1W8CA 2QNJA 2R3IA 3IDPA 3KULB 4FOCA 4R1VA 3GC8A 4HGEA 5DIAA 3QTUA 1RW8A 5CEPA 3PXYA 3VUKA 3MBLA 2R5TA 5CALA 1QMZA 4IMYA 3D7TA 3H0ZA 3MTFA 4JIAA 3R7EA 4O7NA 3S95A 3TDVA 4YNEA 1OVEA 3I6WA 5ANEA 3COMA 3VWAA 4C33A 3LW0A 3K54A 2XK3A 4G5JA 3F7ZA 4M14A 4X0MA 2ZB1A 4FR4A 5IMEA 2JIUA 2VNYA 4E3CA 3I5ZA 3EFJA 5JRQA 3V6RA 1LEWA 2WOUA 3W2SA 2R3GA 3Q9XA 4JRNA 5AV2A 4L53A 3BBWA 3EHAA 3F5GA 3RWQA 3CQEA 3RPRA 4ANMA 2VWZA 3R9HA 4TT7A 3VW6A 4BGQA 4EOMA 3QXPA 3DBDA 4Q5EA 2ETMA 2JDOA 2O8YA 3MS9A 3P7BA 3PXQA 3Q3BA 4U9AA 4XG7A 4ZY5A 5CAQA 1CDKA 2XB7A 4E4XA 3VW8A 5CZHA 1MQ4A 3G6GA 1G5SA 3U6JA 3V8SA 4FT3A 3FL4A 3EQGA 5J7BA 3G90X 3TZ9A 1Y8GA 2G1TA 3ETAA 4JLCA 5JT2A 4FEVA 3RK9A 5J8IA 2BZJA 2C6OA 3DOGA 3AG9A 5L2QA 2DS1A 4I3ZA 2X6EA 4ZY4A 4U43A 4GK4A 4DLJA 1WZYA 3ZRKA 3RHXA 2C68A 5AX3A 5JFWA 4O2PA 2QO2A 2QCSA 1H28A 5AEPA 2WNTA 4ACCA 5DE2A 3TN8A 4BBEA 4BCIA 2X7FA 4QP7A 1RJBA 3VBVA 4MBLA 5B7VA 3O7LB 5HLNA 4PRJA 4QP6A 4IFGA 3FMLA 3MTLA 3Q32A 3I0OA 5C27A 5F94A 3F6XA 3ORKA 4WNOA 4HPUE 3MVLA 4OTPA 4TWPA 4ZJIA 4MKCA 5K5NA 3ZO2A 2F49A 4JBVA 3BE9A 3TUCA 4EOKA 3QCYA 4L6QA 4OTRA 2ZB0A 4U40A 3ZO1A 4QTEA 2VWVA 3IOPA 1RE8A 3BYUA 2GU8A 4GT4A 5C8MA 3FI3A 3KRLA 3SV0A 3T3UA 3ERKA 2EB2A 3OWJA 4PMTA 5CSWA 4AFEA 1KV2A 4J97A 3QRIA 3EQIA 4DGGA 4FG8A 4QYFA 4DAWA 5JMSA 3CTHA 3R28A 4ACDA 3UMWA 4DFUA 2WEVA 3JY0A 4L44A 3COKA 4OTIA 1M7NA 3PTGA 1OMWA 4U5JA 3RM7A 2PE0A 3NAYA 4AT4A 2A4LA 5IA4A 5L2WA 2C3JA 2XK9A 3FI8A 4MXZA 3ACKA 4MXAA 2OLCA 1FBNA 4J7BA 4RA4A 4X3FB 5EI8A 4A4OA 3QALE 1Q8ZA 2VX1A 4CTBA 3RINA 1REKA 3ANQA 2R7BA 3BV3A 3GOPA 1SMHA 3LFBA 1H07A 3BBTB 2FGIA 2LGCA 4AXAA 2ERKA 5E90A 3ZS5A 3CPBA 3B8QA 1JQHA 2JBPA 5CVHA 3VBQA 4QTDA 4PPCA 4DINA 3ODYX 4DFLA 2PVHA 3A7IA 5HZNA 4C38A 3HV4A 2UZEA 2VTRA 4H58A 4C4JA 5IQIA 5M06A 2O63A 4YHTA 2HWOA 4IX3A 5CLPA 2QU5A 4QP3A 2RF9A 4ALWA 1LEZA 4RPVA 2OIBA 5AR2A 1K3AA 4ANNA 5M44A 4EOOA 4FKGA 4M3QA 4FL1A 2ZMCA 1CSNA 3NDMA 3FI2A 3CY3A 2HYYA 3F5UA 3SAYA 2QU6A 2X9EA 4ZJJA 2W1ZA 4OUCA 3HDNA 5AJQA 4QP2A 4F6SA 5A6OA 4IAFA 2W5BA 4MTAA 4PTCA 3MY1A 2UW0A 2VTPA 4EC9A 3UVPA 4FTMA 4KKGA 4H05A 2XIRA 3O8PA 4E1ZA 4ZLOA 2C6KA 1OM1A 5LVNA 2W1EA 4IACA 3KN6A 1PKGA 3LFEA 1R1WA 3DKFA 4ZZNA 2CGXA 3H4JA 3Q53A 3CSVA 2WMVA 3NS9A 2B9IA 3P5KA 4RSSA 4HZRA 5A4CA 5JKGA 4HZSA 2GFSA 3COIA 3KULA 4J52A 2NNWB 3NZ0A 5DFPA 5IA2A 3LFSA 4I6BA 3DJ5A 3DV3A 2VTQA 4QD6A 4BL1A 4YO4A 2BTSA 1ZMVA 2Z8CA 5FP6A 3LCOA 4QTAA 3R7GA 2XM9A 1JKSA 2R3RA 4RIYB 3U6HA 3IECA 5AV0A 2R3LA 4BDDA 2Y6OA 2WEIA 3DKGA 3HRBA 1QPJA 4IC8A 5BYZA 2EU9A 2FSLX 3NUUA 5HTBA 2ZDTA 2CKQA 3GP0A 5AR8A 5H8BA 4BZNA 1W0XC 3SOAA 5CF6A 4EBWA 3F61A 4ZIMA 4ANLA 2QURA 2GNJA 2H96A 2R3NA 4GCJA 4AUAA 2AC3A 2CHLA 5JZJA 4DEBA 1DAWA 3GCSA 1Y8YA 2NP8A 5FWKK 4CCBA 2VZ6A 3PPKA 4X2FA 2KULA 3LFDA 3QQKA 3VBYA 1NVSA 4C57A 1YOLA 4G9RA 4LGHA 2XRWA 2UVXA 3QTWA 3C4ZA 4LGGA 5G6VA 2PZIA 4FTQA 5EYMA 3LFCA 3QC9A 4G5PA 3RK7A 3LMHA 5D11A 5LOHA 2Y4IB 3F3WA 5DYJA 2PMNX 5AM6A 4YZCA 2VGPA 3PG3A 3ZO3A 2QOQA 5IQBA 4WNPA 4QQJA 3VC4A 4O82A 3QXOA 4LQMA 1ZRZA 3FSKA 3KXHA 1CKJA 1Q8UA 3UC3A 2GNLA 2UW7A 5A3XA 4ALVA 4M15A 4E93A 3QZGA 1PXKA 4MQ2A 4H3QA 4O7WA 3WF5A 2X2KA 2X6DA 4KINA 4BICA 1FQ1B 2YM7A 4OR5A 5L8LA 4QPMA 3DFCB 3PVGA 4MCVA 3UO4A 4C36A 2PPQA 1MRVA 4DFYA 2ETRA 5AM7A 5E8SA 4M0YA 1H1SA 2WGJA 3FLZA 3R9RA 4OTHA 2QONA 2R3HA 3PUPA 4O27B 3UZPA 3BELA 3BWFA 5JSMA 3Q4TA 5JFXA 3AC1A 4YR8A 5KKRC 3S0OA 2BR1A 5EDQA 5AR4A 4EZ3A 4RWJA 4DEDA 4RVLA 2BDJA 5ETFA 1ZAOA 3CC6A 3TKHA 4BZOA 2IVVA 4LRKA 5AA8A 5KHWA 3MH0A 4JAIA 1PRYA 2BPMA 3EYGA 2XKCA 2R9SA 3S2PA 3V5LA 4I92A 4RA5A 4YSMA 3W33A 5B2MA 4L68A 4QYHA 2XBAA 3U87A 2FSOX 2QOOA 1UVRA 3EIDA 4IVAA 4CQEA 4CRLA 1J1BA 4FIEA 5CXHA 4Y73A 3ZRLA 5HNIX 4D9UA 4F7SA 5D7AA 4C3PA 4W8EA 3MW1A 3R8MA 2R3OA 5BUEA 4EBVA 3OG7A 2IO6A 1VR2A 3FPMA 4F4PA 4WUNA 4I6QA 3DS6A 4F9AA 1W82A 3LVPA 4LL5A 1U59A 3AGMA 3MV5A 4OTWA 5DT4A 5AP3A 2IWIA 3NNVA 5I5ZA 4Z16A 4EHEA 4FICA 3KKVA 4F9BA 2QOIA 2Y9QA 3P23A 2GS2A 3ZDUA 4D9TA 3F5XA 2J4ZA 3NSZA 3R7UA 2X7OA 3QRJA 1OITA 1OUYA 4BI1A 4D2WA 3R73A 4DG2E 2HWPA 2ERZE 3DCVA 4JBPA 2IVTA 5FDPA 3OOGA 4HCUA 4MBIA 5HD7A 3T8OA 2R7IA 4MVFA 4CYJA 5CNOA 4YJSA 3FKOA 2JGZA 4PDPA 4CT1A 1FGIA 1H00A 2C69A 1G8SA 5DPVA 4KS8A 3ZC6A 5IA3A 4JNWA 4AAAA 5A4EA 4CMTA 5BVOA 4G17A 1PXIA 3OZ6A 4M69B 5A9UA 3KF7A 2NO3A 4D4YA 2YISA 4X3JA 4DBXA 2JEDA 2W4KA 2UZBA 1YHVA 4X3FA 5HO8A 5CS6A 2IVSA 5HVJA 5I9UA 5IUGA 2Z7LA 3EQFA 5GIOE 4FGRA 1YDSE 4KSPA 4ZZMA 2OZOA 3R9DA 5C1QB 5HIDA 4BIDA 2JITA 4IAZA 5DN3A 2XYUA 3KCKA 4BTJA 5IU2A 3R0TA 4IWQA 3BQCA 1Y6AA 3V51A 4HYUA 3VUDA 1KWPA 3E63A 2W1FA 5HTIA 2ZV2A 4BI2A 4LI5A 2BRNA 4MF0A 5EOBA 3TXOA 5IEYA 4TW9A 2WTDA 3Q2MA 4N57A 4EHZA 3HMPA 4EUUA 5E8ZA 1HCKA 2DUVA 1K2PA 4C58A 3R8PA 4IZYA 5AV1A 4H39A 1BLXA 5EI2A 3GEQA 3KF4A 5AX9A 4XX9A 1M17A 4FKLA 3RJCA 3C51A 4I93A 4F09A 2BAQA 2YHVA 3IGOA 1PXLA 4OTQA 5JEBA 5KCVA 2QO9A 4OBPA 5GHVA 3TM0A 3QAME 4CV9A 1S9IA 3E8CA 4HPTE 4BR3A 3DTWA 4KS7A 4F6WA 3KB7A 3E92A 4AF3A 4AZEA 5L3AA 1IR3A 3OY1A 4NFMA 1Q41A 2YIQA 4UV0A 4P4CA 3BLHA 3BU3A 3SQQA 3HX4A 5HKMA 5HU9A 3DAEA 3CS9A 3H9OA 5EYDA 3VF9A 4P7EA 5H9BA 2XNNA 1YXTA 5CNNA 3V5TA 4FTIA 3F3UA 2PMIA 5E8WA 3OBJA 5LWMA 2YJSA 5C9CA 5CU2A 2BCJA 2J90A 2RG5A 3ORTA 5CI7A 4J1RA 5F9EA 5HE1A 3FZSA 4O96A 4YNOA 5M55A 4DHFA 3KREA 3EKKA 3JVRA 3AQVA 4YBJA 2WTJA 4AP7A 1KE8A 1SZMA 2C30A 1NW1A 2WMUA 4G6OA 3Q52A 3I7CA 4DGLC 5KMLA 3DZOA 2EVAA 5CEMA 1FVTA 2Z7QA 2HK5A 3DJ6A 4BDBA 3ANRA 5E1EA 5AV3A 1JVPP 2IZTA 2V0DA 2WOTA 4NJ3A 5DR2A 5KZIA 3UIXA 1KUTA 3JYAA 5DR9A 4I23A 3QD3A 3R2YA 3O8TA 4CRSA 4DH3A 1R78A 5IUHA 4MXYA 4LMUA 1GIIA 1V0BA 4IFCA 5GZ9A 3IPHA 2BDFA 1P5EA 3G51A 3QRUA 3WZJA 3U54A 4FKVA 4A4LA 5D12A 3RWPA 3DBQA 1FMOE 3FLYA 2V22A 4IQ6A 5L6OA 3RAHA 4IX4A 2GHGA 3BU5A 4IIRA 2XEYA 2GFCA 5M07A 3E8NA 5EHOA 3GFEA 4IAIA 4R7IA 3LXPA 3DK3A 4II5A 5LQFA 2NPQA 4CMOA 1J91A 4ARKA 2OF2A 2FSTX 4FNWA 4YMJA 3I79A 5BUIA 4R78A 2VTMA 3QHRA 3LCKA 1SM2A 2VO0A 3QBNA 4GIHA 2CNQA 4UZHA 1ZYJA 3UQFA 4V0GA 3BLQA 4FKIA 2A27A 2VTHA 4AT5A 3W16A 2YZLA 3OWKA 1UKHA 2WIHA 5FEQA 4YJPA 4N6ZA 5FQDC 3EN9A 4TYGA 1XWSA 1XH6A 3GT8A 5AAGA 2WMRA 1PMNA 1CKPA 4L8MA 4I4EA 4R5YA 4ZJVA 3LJ0A 4ZTMA 3EQCA 3SXFA 3ZLXA 2I7QA 4AZWA 1YXXA 4R7HA 3UMXA 1OIQA 4FNXA 3FMDA 4NM0A 4RBLA 2UW6A 3QUDA 4AW5A 2XMYA 1QPCA 2BFYA 4F1OA 2ITNA 4EK5A 3UZTA 2O2UA 2G15A 3EQDA 5CQUA 4EH6A 1W84A 5HG7A 2YCRA 4HVHA 3IDCA 2GHLA 2F57A 2UW3A 3QKLA 4KSQA 5F95A 2ZV8A 5L6PA 4XLIA 3ORZA 4IC7A 4EOJA 2EXEA 5J9YA 4RQKA 2FA2A 3G9NA 3C4XA 5HCXA 2WTKC 3ORIA 3FY0A 4MYGA 2HENA 4KIKB 3RBWA 4AWIA 5E8UA 1S9JA 1BMKA 2VX0A 4BBMA 2VWUA 2EXMA 1REJA 3QRKA 5IF1A 3PRIA 4D58A 1U5QA 1STCE 3KVWA 3O71A 3RZBA 1A9UA 1Q99A 4MQ1A 5H8EA 4MAOA 4AGDA 3HYHA 4EK8A 5JGBA 1L3RE 3TIYA 3FHRA 3HA8A 1PMVA 3VQUA 4FSUA 4U80A 4ZS4A 2EB3A 3UNKA 2JIVA 1QL6A 3BU6A 2XBJA 3FMEA 3R83A 2ONLA 3VUGA 2W96B 3C4CA 4NTSA 3PPZA 3QA8A 4O86A 3EWHA 4I41A 1YRPA 4C4FA 3VBTA 3PJ3A 3R71A 3UJGA 3ALNA 5FG8A 1SVGA 2I1MA 3AC3A 2CNUA 3W8LA 4NJDA 2X4FA 5J7HA 2YAAA 2B53A 4EONA 4QMXA 2ITUA 2A19B 3HZTA 4M68A 3C0HA 5J87A 4BCMA 5GZ8A 1M2RA 2QHNA 2WO6A 2VRXA 3FMHA 3CCNA 2JD5A 3PIYA 4LUDA 4F9YA 5J5TA 4LMNA 3EMGA 3QLFA 3C5IA 4JR3A 4DN5A 4QMMA 4K6ZA 3NUSA 3LQ8A 4L01A 5IQEA 5AR3A 1IAJA 3E7OA 3NW7A 3QU0A 1JOWB 2UW9A 4G31A 2R3MA 5E8TA 4EJ7A 2IZRA 4QOXA 4GW8A 5E4HA 5CEOA 1YVJA 3PXZA 2C4GA 3WZDA 3P86A 4JQ8A 4FSRA 4K0YA 5HBHA 1XQZA 4BBFA 3TDWA 3H10A 4RIWB 3O7LD 3C0IA 2J0JA 2JDTA 3PVWA 4U0IA 3VS7A 4FT5A 4PMPA 4XG9A 4O84A 1T45A 3RI1A 4JX7A 2YM5A 1EH4A 3QYWA 3W2OA 4X7QA 4F7LA 3F82A 1QPDA 2C5XA 4BCGA 4CKRA 5IG1A 4WNMA 5M51A 4J8MA 3BGPA 3WF9A 2PY3A 4C62A 3ZLWA 1P4OA 2XEZA 4FTLA 3V5PA 2WQMA 3HV6A 4Q9ZA 4AGUA 4FVQA 2CGUA 1QPEA 2OZAA 4AACA 4GSBA 4PL5A 4ERKA 4U6RA 4J8NA 4O91A 2C3IB 2CN5A 2PK9A 3G5DA 3ZEWA 3UOHA 2B54A 3F5PA 5C01A 1B39A 2WELA 3ZOSA 3NVMB 3F2RA 1YHWA 3BGQA 5EHYA 3OF0A 3BLRA 2X2MA 4IB5A 4RFYA 3F2NA 1OIUA 3JS2A 2ITYA 3AC4A 2WU6A 2Z7SA 3KMMA 2RIOA 3N51A 4W4XA 5BPYA 5LXMA 5HBEA 3PA3A 5HVYA 2YN8A 3H30A 1F3MC 2HZ0A 4V0GB 4YBKA 4WG5A 4QQTA 3GQIA 3FDNA 2B7AA 3NNXA 5IA1A 5EYCA 2BALA 3R22A 3OD6X 4KRDA 5T6KA 4AZFA 5CXZA 1M14A 4U41A 2HY81 4FNYA 2VAGA 2WTCA 5CU3A 4EUTA 4F0IA 4E7WA 3KCFA 4YZBA 4TYEA 1PYEA 1TQMA 4RVTA 1OECA 1URWA 4J98A 3ZFYA 2WKMA 3KFAA 1W83A 2ZM1A 2YITA 2V62A 3QTRA 5HLWA 2YIWA 4UBAA 2PZRA 4JDJA 4FTAA 3ZFXA 2F9GA 2OF4A 4TWNA 2VWIA 2GNIA 4DG3E 3AT4A 4ANBA 4B6LA 2BZIB 5HG8A 2O0UA 4PDSA 1XBBA 3GCQA 4FTKA 4RX7A 4KA3A 5I9XA 2R2PA 5IQHA 5KMKA 4Y85A 2WQNA 4YURA 2YA9A 4BKYA 3OW4A 2XA4A 3TNWA 4CFWA 4WD5A 3UODA 4C0TA 3I6UA 4C2VA 5I9WA 3Q6WA 2VTJA 3UO5A 4NK9A 4D4VA 3KRRA 4RZWA 4FV6A 2AYPA 2I0VA 3IW4A 4LRMA 4ENXA 4PX6A 4G3CA 4F64A 3BYVA 3OCSA 3ATTA 1IRKA 2XP2A 4W4VA 3IGGA 1P2AA 4IM0A 5CEQA 3TUDA 2GS7A 4XG3A 3C4WA 3NVKI 2ONLC 3OS3A 3BEAA 4OW8A 4RX8A 4E4NA 2PUIA 1HOWA 4XG8A 2XS0A 2I0YA 1JSVA 3BHUA 3QCXA 4YJOA 3R9OA 2BMCA 1E1VA 3FMKA 4FTTA 3E8DA 3Q96A 4JDIA 4W9XA 3OROA 4NIFB 3QX2A 5CTPA 4W8DA 1SVEA 3N4VA 5JQ8A 1ZMWA 4NU1A 4RJ3A 5HE2A 1R0EA 2VN9A 1GY3A 4IZ7A 3I5NA 4AOJA 3VUIA 1OIRA 5M4IA 4UXQA 3U51A 5HI2A 3UDBA 3MFRA 4AA0A 1IG1A 4A9RA 5EQEA 2C5VA 5CX9A 3RNYA 4DH1A 2QR8A 1OI9A 5IQGA 3KMWA 3MJ2A 3HAMA 1MQBA 4MBJA 4GT3A 4MXXA 1J7LA 5K4JA 1OBDA 3ZXZA 3AC2A 4UB7A 3D9VA 1J7UA 4R3CA 4BDFA 5JRSA 4CLJA 3KVXA 1XH7A 3REPA 3PXRA 4XOZA 5TO8A 2IZSA 4C4EA 4ONAA 5AUTA 5AAFA 3TTIA 5EHLA 4KUJA 3GI3A 3Q9WA 3ZLYA 4CYIA 2YAKA 3NYVA 4MX9A 5KMMA 1GAGA 4FZDB 3HMIA 1ZZLA 4NEUA 3H0YA 2X81A 4IAAA 3G0FA 3R7YA 4TY1A 5FBNC 4CZUA 5AUXA 4F99A 5K0KA 3CY2A 4XOYA 4JVGA 1YI3A 4MH7A 2UW5A 3DBCA 4GK2A 3HLLA 4M66A 3ORLA 2ITZA 1PHKA 1WBWA 1GNGA 3QQLA 1JSUA 3LE6A 1KSWA 1TKIA 1XH8A 3UTOA 4EEVA 3N4UA 4G9CA 4F08A 4LM5A 2X1NA 2HCKA 2XCHA 3FL5A 3DLZA 4AZSA 4DEAA 2J0KA 5AUVA 2DWBA 4GK3A 2YM8A 3E5AA 3PE1A 4A4XA 4O0WA 4XEYA 5DWRA 2X7GA 3QYZA 4CLIA 2WMAA 1WBOA 2JFLA 2PTKA 4B8LA 4KBAA 4PL4A 4CNHA 3WOWA 4Z7GA 1XO2B 3FMMA 3V5QA 5DI1A 5FEEA 5HX8A 4GFGA 3FQHA 4EORA 1M52A 2WTVA 3HMOA 3WE8A 1PJKA 3NW6A 5EG3A 3EKNA 3DNDA 2WPAA 3CPCA 4RMZA 3DT1A 4FL2A 4G34A 1H08A 3KK9A 4FKRA 4RIOA 4HVSA 5F4NA 5C4KA 4EK4A 4FEWA 3UC4A 1ZMUA 4Q2AA 1APME 4QPSA 2J50A 2VWXA 3PSDA 3MN3A 2JKKA 4O7TA 2RFSA 3D2IA 4KIPA 2W4OA 5LMKC 3R8UA 3NWWA 4A9SA 4UMTA 5HHWA 3QZIA 4CQGA 5J9LA 4E6QA 3V8WA 3IS5A 3SW4A 3EFWA 5M57A 5BVNA 1FPUA 4GJ3A 4R3PA 3VS5A 3ZFMA 1NT2A 2I40A 3WZUA 1WCCA 3ORNA 4QYEA 1NVQA 3E3BX 4UYNA 5CSPA 4BY9E 5ITAA 3DNEA 5KO1A 4JQEA 4DTAA 3U55A 2CGVA 3BYOA 2BRGA 5HGIA 5FXRA 1M2QA 3WZEA 4B8MA 5AIKA 3P08A 3KXNA 2C6TA 4W4WA 4UMQA 4AA5A 4BWKA 4C3FA 5CU4A 3F3ZA 4C7TA 4GEOA 2RKUA 4F70A 2V7AA 3OW3A 2GMXA 3P1AA 3QRTA 2RFNA 4XNEA 1UV5A 3MPTA 4AFJA 4BFMA 3A7JA 5DRDA 3FKLA 3NNWA 2P0CA 2YZAA 4AOTA 2OH0E 1VJYA 2PVMA 3A99A 3LFNA 4O83A 3QTSA 4PP7A 3DXNA 1WBSA 3MH3A 3L9MA 5CSVA 3DQXA 1F5QA 2XNPA 4EH2A 4TPTA 4KBCA 3IO7A 4MXOA 4L3PA 3GU4A 2PE1A 5DBXA 2OG8A 3ZCLA 3LKMA 2Y0AA 4QMUA 3LQ5A 1BUHA 4M97A 3UGCA 4C34A 2QOFA 4H3PA 2BIKB 2WMBA 3ZEPA 1PF8A 4FV7A 1DS5A 1CM8A 1R0PA 2ETKA 2JIIA 4MD7E 1ZOHA 4PV0A 3KRWA 5GJFA 5HCZA 4Y8DA 3ZO4A 2XK6A 3C7QA 3F2AA 1P4FA 5ICPA 3HMMA 3FMJA 1SNUA 1CMKE 3MIYA 2WTIA 4FIHA 4S2ZA 5LMAA 3P0MA 4O7RA 3VS3A 5J1VA 5EM7A 5HTCA 1OZ1A 2W1CA 4IVCA 4FKTA 2Y6MA 3UOKA 4AZVA 4BDIA 3HA6A 3Q4ZA 4DH5A 3OEFX 3LJ2A 2JBOA 2QKRA 2QI8A 4BCOA 3GC7A 4HCVA 4EH8A 4OAVB 4QTCA 1Y57A 3RHKA 3RPOA 5DOSA 4TKSA 5A4TA 1FMKA 2ITXA 4C61A 1H24A 2WFYA 4FKWA 5L2TA 4YP8A 4BGGA 3BHYA 5B0XA 3IW5A 1PMEA 2XIKA 4O81A 5EKNA 3W2PA 5KMIA 3EB0A 2NRUA 4I5MA 4IAYA 2J7TA 4XV2A 4B99A 4UMUA 1DI9A 3SHEA 4PDOA 2B4SB 3FBVA 2VTIA 4K77A 5I9YA 3HECA 3QKKA 5AWMA 3RP9A 4FV5A 3C0GA 4KIKA 4WSQA 2BTRA 2OW3A 2VO7A 4KABA 3ZZEA 2UZVA 4AW2A 4BI0A 4CSVA 4CV8A 4QMNA 4YO6A 1H1QA 1LP4A 3CKWA 4Q5HA 3DBFA 5J79A 3LLAA 4E4LA 2OFVA 2XH5A 1PXOA 4AN9A 4BCHA 4APPA 4NL0A 3MFTA 4I0SA 3AT2A 4ZTSA 5CAVA 3B2TA 3VS6A 2C5OA 5DR6A 5AP7A 3GU7A 4L43A 3ZSHA 4AW0A 2BIYA 2IW6A 3N9XA 3BPRA 3FZ1A 4L3JA 3SDJA 3KXXA 5LVLA 2OIQA 4FX3A 4IVDA 3KK8A 1WVXA 3NYXA 4F7JA 4BYJA 3NYOA 4YTHA 4CG8A 1NVRA 4FVRA 4G6NA 4I6FA 2XZSA 4JG8A 4XV9A 1YQJA 3POOA 4CG9A 2QQ7A 3HVCA 3QTQA 4EHVA 3IW8A 4I4FA 1LUFA 4BDKA 5IEVA 5F1ZA 2JAVA 3R7VA 3VVHA 4D2VA 4C4IA 5LVMA 2Q0BA 4IZ5A 4MXCA 3PWYA 4NT4A 2CCHA 4BVUA 5HCYA 4NYEA 4X21A 3FI4A 4JBOA 5AFVA 1SNXA 3UQCA 4DGOA 4ZSEA 4LL0A 2IG7A 1OKVA 4IWOA 2PVLA 4QMYA 5LARA 4IB0A 4EKKA 3BHTA 5F20A 3KXZA 3VHKA 4B7TA 2ZV9A 2BRHA 4BHZA 2PWLA 2DYLA 4D2PA 3TNHA 4JJRA 1U54B 3DTCA 4IAKA 4HW7A 5HIEA 3WZKA 2Q0NA 3ZM4A 3TZ7A 1OIYA 2PUUA 4EK6A 2CKPA 2F2UA 5AR5A 3ZSGA 4ASZA 5IA0A 4OT6A 3SOCA 4DGMA 4MF1A 4K9YA 4DYMA 1WFCA 3SXRA 4A07A 1GJOA 3K5VA 3ZHPC 3GOKA 3F7WA 4BCQA 2WXVA 2W0JA 2UZUE 3QX4A 3OMVA 3SLSA 5GJDA 3QWJA 3E93A 4TYHB 2H8HA 4I0TA 4FBXA 4OBQA 4XCUA 5CI6A 5EDPA 4AA4A 1H0WA 1UU3A 3GNIB 3I60A 4ENYA 2XK8A 3EN7A 3HV7A 3ZC5A 3IG7A 2JFMA 3C13A 1YXUA 1PKDA 4N4SA 4GVJA 2PSQA 3WYYA 4AT3A 1RDQE 2BZHB 3FE3A 5E7RA 2XNEA 4YJNA 2VUWA 3UVRA 2ITWA 1IAHA 2YLFA 2UVYA 3UO6A 2OXXA 5D9HA 4N6YA 1UKIA 2GS6A 4HJOA 2X9FA 3ZBXA 4R3RA 3JVSA 4WBBB 4Y95A 5FD2A 5C26A 5DEWA 5B2KA 3B8RA 5M4CA 4O38A 2VWWA 4ZAUA 2PYWA 4K8AA 3R1SA 4FV2A 1PXNA 3LMIA 5IH5A 4L67A 1XHAA 4WRGA 3EJ1A 4YPDA 4IEBA 2PVKA 4CTCA 5M56A 4FODA 5CT7A 4QMWA 5IPJA 4XUFA 2EUFB 3IDBA 2C0TA 4NKAA 3DJ7A 4KD1A 1IA9A 2ESMA 2VGOA 1VYZA 4RX9A 3TKUA 4D2RA 2VNWA 3CTQA 2OICA 2OJGA 3PY0A 3SXSA 4B0GA 1BX6A 3WYXA 1UU8A 3KC3A 2HZ4A 3W1FA 5IH6A 5GINE 5LWNA 3G33A 3M11A 5CAPA 4NFNA 4I5HA 1I09A 1A48A 5FP5A 2ITOA 3PLSA 4XG4A 2JKQA 3FZRA 4WO5A 5CY3A 4KBKA 5G1XA 2YCQA 4BIEA 5CF5A 2W1GA 3QQGA 3DFAA 3PP1A 4FIJA 4AGCA 5JH6A 3FYKX 5LMKA 5FEDA 1FVVA 2CPKE 3FC2A 5HE0A 5C03A 3TV7A 2VO3A 2GQGA 4L42A 4JDHA 4Q9SA 4D1ZA 4G1WA 2C6IA 2E9VA 3F3VA 2PL0A 3ZYAA 3SVVA 2EWAA 2P4IA 3S4QA 4QMOA 3VIDA 3UE4A 3R01A 1RQQA 2OU7A 2R3KA 3O51A 4FSZA 4U45A 4USEA 4M69A 3MYGA 1O9UA 3QQJA 5H8GA 4BCJA 2BZKB 4IX5A 4QMLA 5CF8A 4EWHA 1UU7A 3Q5ZA 2BAJA 3V01A 4PY1A 4NW6A 3M1SA 3CP9A 4JL9A 4QMZA 5HESA 3QUEA 4DEHA 5IH4A 1IEPA 1PW2A 4BTKA 1JKLA 4HVIA 5TOZA 5BMSA 4ZS0A 4EI4A 3SRVB 1Y6BA 4RLLA 4FTUA 3MFSA 2V7OA 1UNGA 3GU8A 3QWKA 4WRSA 3VBWA 1PXMA 2O65A 2W5HA 3C5UA 4PNKA 3QZFA 1MRUA 4H3BA 5AP5A 1ZXEA 4EZ5A 3KN5A 5EM8A 2XKEA 5CVGA 5HG9A 3W2RA 3VUTA 4O7ZA 4U3ZA 4C37A 2VV9A 4NW5A 5A4LA 4O6EA 3EQRA 5JQ5A 4ERWA 1LR4A 3A7HA 3NIEA 3UIUA 3JXWA 3C9WA 3D83A 2CKEA 2RL5A 1OL1A 3WE4A 3WF6A 2VD5A 5HNBA 3EFLA 2H6DA 3PIXA 3NUYA 1JBPE 2GNFA 4RJ4A 3S1HA 4ZSLA 4FL3A 3EOCA 1WBPA 5EYKA 4ASXA 4FT7A 3Q4UA 4MHAA 4YZ9A 4ZK5A 2GHMA 4EWQA 4CFNA 4EKLA 2ITVA 3SD0A 4EOPA 4QQCA 3QD4A 5H2UA 5KMJA 3OY3A 5LMBA 1OKYA 1YI4A 4DT8A 2E9UA 2PVRA 4O0VA 1V0OA 2OJJA 2IN6A 3GGFA 4X2JA 4YZDA 3PA4A 3BGZA 3TJCA 3TNPC 3IONA 5ANJA 4JS8A 2XNBA 5C8KA 5BQ0A 4LV8A 4HOKA 3CD8A 2QOHA 2ITTA 3ZRMA 4FKQA 4JI9A 3BHVA 2QR7A 2X2LA 4PTGA 4BKJA 4UMRA 5IDPA 3A4OX 4TYJA 5AR7A 1WBVA 5LVPA 3FKNA 2P33A 1PXJA 4RIYA 4QP9A 3ULIA 3NGAA 4FKJA 5HEZA 4EH4A 1FOTA 4IDVA 1GZOA 4C02A 1YWVA 5EKOA 5KE0A 5LCKA 1ND4A 4WKQA 4IANA 4IVBA 4Z55A 1OPJA 3DAJA 4G16A 3SC1A 4XRLA 1PYXA 4L00A 5CWZA 3VRYA 5A54A 1AD5A 2Z02A 4FGBA 5GJGA 3MESA 1GZNA 5D41A 4DLIA 3V5WA 3Q6UA 2RFDA 2QG7A 4ACHA 4X2KA 3K5UA 1ZYDA 5DRBA 3C50A 5HNGA 3G6HA 3U8WA 2E9NA 3RNIA 3BIZA 4PP9A 3SG8A 3GCUA 4ITIA 2UV2A 4CEGA 4M67A 1R39A 4FV0A 3WF7A 3OXZA 2XIZA 4J71A 4JRVA 5I4NA 3QUPA 4GFMA 3W2QA 2JKMA 4YUQA 2W7XA 2YM3A 2PVYA 2HXLA 3TNQB 2J0LA 2JDRA 1BL6A 2KTYA 4PL3A 3R8LA 4EHGA 4JG7A 3DXQA 4QYYA 4FZ6A 4WOVA 3QKMA 3GC9A 3PP0A 3L8SA 3P7CA 2PZ5A 3GCVA 3KQ7A 3QGYA 4RGJA 4PUZA 3F3TA 5GIPE 3CJGA 4S30A 4FZ7A 3R1NA 3W18A 4C4GA 3QC4A 4UWCA 4I5CA 1QCFA 4DCAA 4EOLA 2UZTA 5CYIA 4DC2A 3LCSA 3WARA 4RT7A 2GNHA 3PSCA 2CLXA 4WUAA 3NUPA 3LIJA 1G8AA 4DT9A 3MVMA 4HYIA 2PVNA 3MDYA 4V01A 4EH9A 4FSNA 4GH2A 4D2TA 5KBRA 5CU6A 3UBDA 4MNFA 3MPMA 1PMUA 1OL5A 4OAUC 4MD9E 2XIXA 2YM4A 4X6RA 1JAMA 4XBRA 5K4IA 2GTNA 2XK4A 4B4LA 4Z3VA 2IW9A 4CVAA 3ROYA 3DGKA 4F9WA 4TL0A 4YHFA 3O8UA 3FAAA 5I3RA 2QLQA 3ZMMA 2YACA 3DKCA 1XH4A 4U7ZA 3D5VA 4KKHA 4FC0A 3UP7A 2WMQA 4F0GA 1UWHA 3OWPA 4DF3A 4A06A 3A2CA 3A61A 4F1MA 4DG0E 3E3PA 3OHTA 4O7LA 4C59A 4QP4A 1MUOA 4WG3A 2F4JA 3LXLA 4RWLA 4JQ7A 1NY3A 3FHIA 4GG5A 4ZP5A 2R3JA 2XUUA 2BRMA 2Y4IC 2JDVA 4J95A 5KUPA 3L8PA 2BILB 1R3CA 3OCTA 3CJFA 3OCBA 1Q3WA 3R7IA 4F9CA 4FEUA 3VULA 5JK3A 3F9NA 3GFWA 1KE5A 1PY5A 3CGFA 4O0UA 2WAJA 3QFVA 4HVDA 5AUUA 4BCPA 4DFXE 5HORA 1MP8A 4FTOA 4CXAA 2O3PA 2C3KA 4PTEA 3TL8A 1BI8A 4HNIA 4Y5HA 2FVDA 2QD9A 3O17A 4L46A 3SX9A 2PZPA 5EW8A 3WILA 3PE2A 2H34A 2R3FA 3L9NA 3ELJA 2OWBA 4IADA 5ANDA 3ZUVA 2P55A 3A7FA 3O50A 3KL8A 4AN3A 3VS0A 5A14A 4MWHA 3RPSA 2OKRA 5TT7A 2W1HA 2Z60A 2Z7RA 2IZUA 4FKSA 4M84A 4ZEGA 1I44A 4ZSAA 3AD5A 3D15A 4ANSA 2V55A 2UW8A 3P9JA 3OTUA 2I6LA 3VO3A 5BUJA 2GQRA 2QO7A 4KIQA 4WBOA 4DEEA 4G3GA 3D5WA 4XP2A 1ZARA 3V6SA 3EYHA 4L45A 4V04A 3RKBA 5FTGA 4R1YA 4DH8A 4IB3A 3D7ZA 3DK7A 4E5BA 3DXPA 4CZYB 1KV1A 3GENA 4O0XA 5DMZA 2HZNA 3GB2A 4RJ7A 5TKDA 4CMUA 2FH9A 2CKOA 1DM2A 1WBTA 3H9FA 5FLFA 4TXCA 5HLPA 2LAVA 3OUKA 4O0TA 2YDKA 4OLIA 4XH6A 3SGCA 1Q24A 5EDRA 1U54A 4LOQA 5FTQA 3MB6A 4M7IA 5L8JA 1BL7A 4KAOA 2IPXA 3NUAA 2G9XA 3F69A 3R63A 1YDTE 4QPAA 2C1BA 3HRCA 1F0QA 5IQFA 3RAWA 3RK5A 3BQRA 2P2HA 4FKUA 3PZEA 5BX0A 5IDNA 3A62A 3OUNB 4BDGA 4I24A 3NR9A 1BKXA 3KXGA 1B6CB 3TEIA 3FZPA 4KKEA 4E5WA 4P90A 5AUYA 1BYGA 5AP0A 4FG9A 5JGDA 2ZYBA 5AIRA 5E8XA 2FUMA 3P79A 4TZRA 2VTOA 2HW6A 3PDTA 2G2HA 3HV3A 4U79A 1J3HA 3S00A 3KA0A 4OGRA 4XJ0A 3V8TA 3RALA 1E1XA 5AUZA 3FXZA 3RAKA 2F7EE 4A9YA 1XBCA 3NYNA 1YDRE 2B0QA 5IQDA 2HELA 3FQEA 3QTIA 2QKWB 3NCZA 5E92A 2YDJA 2WU7A 2R3PA 1AQ1A 2PHKA 5FBOA 4GIIA 5EM6A 2GDOA 3LCTA 4TRLA 3CR0A 2WTWA 1DI8A 3OBGA 4FMQA 4FK6A 4BDAA 4DTKA 4XBUA 4TWOA 3VBXA 4H1MA 4UWBA 3Q4CA 3D7TB 1J1CA 5HG5A 5AP4A 3Q5IA 3HV5A 1Y91A 4KIOA 4W4YA 3UIBA 4RJ5A 3NCGA 1P14A 3R6XA 3R00A 3BZ3A 3IK3A 5AP2A 4FTJA 4DITA 2PMOX 3KMUA 4JXFA 2GSFA 4RG0A 1OGUA 3A4PA 4AS0A 4ORKA 3QL8A 4EH3A 1YI6A 3AD4A 3FLWA 4FV9A 4WIHA 2VO6A 3ORXA 4FOBA 4QO9A 2IW8A 3CIKA 3K3IA 5EM5A 5HOAA 4ZZOA 5M53A 1OBGA 4G2FA 5HQ0A 4CZTA 5JN2A 3E62A 3LHJA 2XNOA 4J99A 4OT5A 4UALA 4PPBA 1V0PA 2Y4PA 5CENA 4AOIA 3EL7A 4FZFB 4GL9A 5I3OA 3ZUUA 3M2WA 5FM3A 4QTBA 3ZM9A 4S34A 2ZV7A 4XYFA 5I9VA 2OO8X 3PRFA 4DFNA 3R21A 1U5RA 4CGAA 3R8VA 1JLUE 3BV2A 3GC0A 4EOIA 3TV6A 3R9NA 3KY2A 2BHEA 3P4KA 5I9ZA 2OJIA 2VX3A 2I0HA 3MH1A 4O1PA 3R1QA 4YHJA 2UZDA 3OT8A 2C0IA 4RX5A 5M09A 2AC5A 4H1JA 2P2IA 3D5XA 1CKIA 4XHKB 2CCIA 3R1YA 3OCGA 3MY0A 5K5XA 4BHNA 5KX8A 2BRBA 3OP5A 4YLLA 1Q97A 1YOJA 2A1AB 4HVGA 3E7VA 4HYSA 3KGAA 4U44A 5DNRA 1ZWSA 4RFMA 2J5EA 3GU5A 4AN2A 4M12A 4LRJA 5L6WL 5GZAA 4AG8A 4ITHA 2X0GA 4I20A 5EI6A 5HU3A 2XRUA 4OBOA 3VS1A 4D4SA 2WMTA 3IW6A 3SKCA 4EOSA 5A4QA 1O6LA 4FIIA 1H01A 4JOAA 5CQWA 1OL2A 2YM6A 2R0UA 4YTFA 5FXQA 3MSSA 2G2IA 5EW3A 2BFXA 4V05A 4KB8A 4NKSA 3VF8A 2R0IA 2Y8OA 4HCTA 4I22A 1UA2A 4I0RA 3ID6C 3NNUA 2ZJWA 3ZSIA 2YCSA 3W55A 3LM0A 1O6KA 1GZKA 2H9VA 2J51A 2UVZA 1H0VA 3ENMA 3NW5A 5J5SA 3NLBA 1JKTA 2A0CX 4GVAA 4EYMA 5EQPA 3OFMA 3VHEA 4QNAA 4ALUA 3L9LA 2BUJA 4ZMFA 2OBJA 4QMSA 3QQFA 2W5AA 2YDIA 2VTLA 3F66A 3PJ8A 4TTHB 4GKHA 2ZVAA 3EQPA 3GUBA 3ZLSA 3M42A 4BGHA 4BTMA 1BI7A 2W9FB 4FTCA 3MFUA 4HYHA 2QOKA 4GJ2A 3R30A 4D4RA 3HDMA 4FVPA 5IQCA 3BE2A 1JNKA 4Z9LA 3QGWA 3PG1A 3UQGA 4TWCA 3U4WA 4EQUA 4ZLZA 4G6LA 5E1SA 1O6YA 4BDJA 4C2WA 4QYGA 1SYKA 4MNEA 4LOPA 3FLQA 3MA6A 2PUPA 2C1AA 2E9OA 1YHSA 2OGVA 2OXYA 5FM2A 1Z5MA 1H27A 4P5QA 5DGZA 4IM3A 4RC3A 5FGKA 4BYIA 1YKRA 4C35A 4D5KA 2XJ1A 5BMMA 3HAVA 4FSQA 2CJMA 3HMNA 1UU9A 2E9PA 2XVDA 3PVUA 4U3YA 5BYYA 4MD8E 3EN6A 4K1BA 2IVUA 2YEXA 3KRXA 1OL6A 2YIXA 1ZY5A 3ORMA 3BCEA 3PFQA 4GU9A 5EFQA 4OTGA 5CZIA 3ZH8A 3CD3A 3AMYA 3HL7A 2CGWA 3LMGA 4RIXA 4ZTQA 4FT9A 2QHMA 4FV4A 4ASEA 4EC8A 4GKIA 3H3CA 2SRCA 3ET7A 1M7QA 2R64A 5CSHA 4BZDA 2G2FA 5K0XA 3II5A 3BKBA 3K2LA 3FEGA 3MGYA 3VRZA 4S33A 3GCPA 4OTDA 1A06A 4BF2A 4ASDA 4DBNA 2ZM3A 3OTVA 4FV1A 2UW4A 3Q04A 3DDQA 3RCJA 5J1WA 3GU6A 4BIBA 3ZUTA 5ETCA 4RLKA 5T3QA 3G0EA 2YABA 2PULA 2X8EA 4NM5A 1J7IA 4FTRA 3NMUF 4E5AX 3PZHA 3P7AA 4IZAA 4RWKA 2GCDA 5LVOA 3QZHA 3OC1A 4XG2A 4EK3A 1ZYCA 2ZM4A 4QMVA 4APCA 5HIBA 4DEGA 5CEKA 5KNJA 3RVGA 4RC4A 4UYAA 2BHHA 2ITQA 2CDZA 3PLAE 4MWIA 4XS2A 3LM5A 3DK6A 4NWMA 1H1PA 4O22A 4XV3A 3PJ2A 4KRCA 4YJQA 3DDPA 4USDA 5DA3A 4UWYA 5ANGA 5E8YA 5CANA 4GV1A 4YTIA 3HNGA 3VUMA 4NM7A 3BI6A 4YC8A 5CASA 4PMMA 4FTNA 4HGTA 3ORPA 2J5FA 4RC2A 3IKAA 2JAMA 5CVFA 4DGNA 3AMBA 1JKKA 3IW7A 2OXDA 2YWPA 2WD1A 3SA0A 1GIJA 2X39A 3OXIA 1TVOA 2HY0A 3OT3A 1KOBA 4JBQA 3UG1A 5HO7A 4I94A 5CF4A 3AGLA 3FYJX 2ZDUA 4ANOA 1VZOA 4NZWB 3ZTXA 4DFZE 4W9WA 3CXWA 4UX9A 4YZNA 3FUPA 4IDTA 4M13A 3L9PA 3R8ZA 3WIGA 4QRCA 3DB6A 4TYHA 1XR1A 4EQCA 2PE2A 3C1XA 2CNVA 4ZSJA 2QOLA 1JPAA 4IJPA 3FLNC 1U46A 3HUBA 4L3LA 2JKOA 5J95A 1WVYA 5BNJA 3LLTA 1Q8TA 3I7BA 2VU3A 4WG4A 4E6CA 1B38A 4O21A 1XBAA 1OUKA 2W1DA 2PMLX 2XYNA 1ZOEA 3UPZA 4HGLA 4NH1A 4R5SA 4L9IA 4K33A 4UY9A 4IHPA 4U97A 4A9TA 4C8BA 4FV3A 3WI6A 3TACA 4CFFA 4F7NA 4PF4A 3G15A 3QD2B 4EH7A 3C4EA 3DAKA 4AGWA 2VWBA 3BWJA 4FI1A 4U81A 1GZ8A 3OWLA 1DAYA 2B55A 4O0RA 2V5QA 4O7YA 2R4BA 2AUHA 3TWJA 2WMSA 4FEQA 3HUCA 1JWHA 4KNBA 4QP1A 3L8VA 5M4UA 3Q9ZA 2PU8A 3LPBA 1JSTA 2A2AA 3A60A 3GXLA 4FSMA 4NM3A 5EH0A 3W10A 2WQOA 3GBZA 3RMFA 3ZBFA 4WHZA 3ULZA 3PY1A 3QQHA 4RZVA 3VN9A 4DA5A 5C8NA 4BCNA 2FO0A 5E8VA 4PQNA 2P3GX 1Q4LA 4O2ZA 4R8QA 2YIYA 3LCDA 3PPJA 3HP2A 1KE7A 2W05A 4BCFA 3W32A 2UZWE 3F88A 3EL8A 4FZAB 3T9TA 3NX8A 3U4UA 2OIDA 3R04A 3DBEA 5FTOA 2UZLA 1TQPA 2XM8A 2Z2WA 4BN1A 4CKIA 4QMQA 4FSWA 4X2NA 4YJUA 4YLKA 4YTCA 3W2CA 4YGAA 3GVUA 4X6QC 2ACXA 4LV5A 5D7VA 3LFQA 4P2KA 4CFVA 3BYSA 1WVWA 4CD0A 4O7VA 2C5NA 4FF8A 4ACMA 4DCEA 4FA2A 1W7HA 3ZZWA 2B9JA 1H4LA 2E2BA 3V3VA 1KE9A 3LXNA 3MVHA 1ZY4A 3ZU7A 3SW7A 3JR1A 4FE2A 3TI1A 2IJMA 4LYNA 4ZTNA 4AE9A 5KMOA 1YWNA 1W98A 2C6DA 3HP5A 1M2PA 4TYIA 3FZTA 2QLUA 3R7OA 3E8EA 4NSTA 1Q61A 3UOLA 3CLYA 3QQUA 4UN0C 4BDCA 2HXQA 3JY9A 2WMWA 3LZBA 4LFIA 2YIRA 2VTTA 3GQLA 1WAKA 3LAUA 4K2RA 4RVKA 3UPXA 4DH7A 4X2GA 3MI9A 4D5HA 2FYSA 4NCTC 5JFSA 4KWPA 3O2MA 4ZTRA 4YJRA 5CAUA 5C4LA 3ATSA 3E87A 5DHJA 4I21A 4GG7A 2RG6A 4IJ9A 4YC3A 3WBLA 5JZNA 4WNKA 1Q62A 5KZ0A 2W06A 4FV8A 5DH3A 4QMPA 5AV4A 4FSYA 4GFOA 5K9IA 4E8AA 2GQSA 3OEZA 3MJ1A 3NEWA 5HO6A 2XCKA 3RZFA 3VAPA 4C4HA 4DTBA 2W17A 4JDKA 5LJJA 3ODZX 1PXPA 3EFKA 4BDEA 3A7GA 4ZOGA 2J6MA 4BB4A 3LQ3A 5L4QA 4XP0A 3ALOA 3EH9A 4X3FC 1Q5KA 4IM2A 3UIMA 3MWUA 5EK7A 4ID7A 5AA9A 3CE3A 2OI4X 3BYMA 3FQSA 3EQHA 4IBMA 5ACKA 5CAOA 4USFA 3O96A 3FC1X 3HKOA 4BC6A 4F63A 3O0GA 3UP2A 3PWDA 4ZLYA 2QVSE 4E26A 3MB7A 3RM6A 2WIPA 4TNDA 5A6NA 1XKKA 4RVMA 3O23A 3UG2A 4BRXA 3MPAA 5JGAA 3VUHA 1ATPE 4GUEA 2YCFA 1KOAA 4YZMA 3K3JA 2CLQA 3D5UA 2G01A 4DFBA 3ACJA 3TV4A 2BVAA 4ANQA 2HZIA 4FIGA 3I81A 4FG7A 4XLVA 3KXMA 5H3QA 3UOJA 3CTJA 4R7BA 2C0OA 3R02A 1NXKA 4D1SA 5DT3A 4GRBA 2VWYA 2FB8A 2FSMX 5HVKA 3BRBA 5T68A 4UEUA 5M4FA 2X8IA 3PXFA 5L2IA 2VTNA 3BHHA 4L7FA 3ENHA 2B9FA 5B2LA 3D4QA 3MH2A 2WB8A 5BVEA 3TIZA 3JPVA 2OK1A 4FIFA 4DEIA 3FZOA 3MVJA 3IQ7A 4OTFA 1OPLA 3AOXA 3QF9A 3UYSA 3FJQE 2QG5A 4JG6A 5AMNA 3QTXA 3DY7A 5FRIA 4I1ZA 2ITPA 5ETAA 5E9EA 2B52A 1T46A 4FYOA 3TKIA 4ACGA 4S31A 3D2KA 5FUTA 3S3IA 2OJ9A 5ANIA 5A46A 5L2SA 2W4JA 3PY3A 5AP1A 1H26A 5TE0A 4I6HA 2O5KA 3OOMA 4MEDA 1YXSA 4PMSA 5D1JA 5FXSA 5HICA 4YSJA 2PUNA 1GOLA 2WZJA 3ZONA 2ZAZA 2XKDA 5BVKA 2BKKA 3NIZA 4JIKA 2GTMA 5AUWA 2HAKA 3FWQA 4FYNA 5ACBC 5HX6A 2XJ2A 2Y7JA 3TZ8A 3EQBA 4GS6A 5CSXA 2JC6A 3LFAA 4O6LA 3KU2A 2JLDA 3RAIA 3COHA 4XV1A 3PSBA 4NIFA 2C3LA 1XJDA 3LOKA 3I1AA 4EQMA 4ZMEA 2CSNA 3NAXA 4BKZA 4PDYA 3RCDA 3BX5A 3PJCA 4EH5A 1ERKA 3FY2A 2F7XE 5DEYA 3ZXTA 5I0BA 5LCJA 3FLSA 4R77A 4GU6A 2CN8A 3EN5A 3RGFA 2GPHA 3U9CA 1YOMA 2XK7A 3WIKA 4BWPA 2B9HA 3MA3A 3WF8A 4F65A 5E91A 4IWDA 5BVDA 5DLSA 3UNZA 4E4MA 1XH5A 4YJVA 3VQHA 3DA6A 2ZOQA 4Y5QA 3EZVA 3VJNA 2OFUA 2PVJA 4ITJA 4JR7A 1UNHA 3TNIA 1XH9A 5KKRB 3QD0A 2OH4A 1YW2A 4ZY6A 1E9HA 4RWIA 5L8KA 1SVHA 3QTZA 3AXWA 4IWPA 3AT3A 3QA0A 1CTPE 2RGPA 4C3RA 2QOCA 3T3VA 4WA9A 3TT0A 3P78A 5KBQA 4O0SA 4Y46A 5DT0A 2I0EA 2XIYA 4GUBA 4J96A 3PVBA 4XRJA 4FKOA 2UZNA 4YPSA 4F6UA 4GT5A 2RFEA 4RQVA 4TNBA 4CCUA 4E20A 4XP3A 2X8DA 4IB1A 3IOKA 2B1PA 3G9LX 1G3NA 3TG1A 5ANKA 1UWJA 4D2SA 3R2BA 5FDXA 4D0WA 1OKZA 3HEGA 1UNLA 2J0IA 4K11A 4WT6A 4BDHA 4HGSA 3DB8A 4R6VA 5HD4A 3TUBA 4D1XA 4O7SA 2RSVA 4PNIA 4NUSA 3EZRA 5K3YA 2XNMA 3TCPA 3TZMA 5GNKA 1HCLA 2QC6A 1OPKA 4CKJA 4JAJA 3VJOA 1FVRA 5BVWA 4AU8A 3FSFA 2W1IA 2XJ0A 1ZLTA 4FSTA 5EOLA 3PIZA 3DU8A 4UMPA 4G3FA 2VTSA 4FKPA 1Z57A 4YU2A 5HBJA 5AAEA 5BYLA 4RJ6A 2QODA 4JT3A 4YLJA 4GYIA 1LPUA 4G3EA 5IKWA 3FPQA 2BAKA 2J0MB 4D0XA 3CQUA 4BTFA 4RJ8A 4PPAA 4CFUA 5IISA 3V04A 2WHBA 2XNGA 3LJ1A 3OVVA 3CQWA 3PXKA 4EOQA 3POZA 1H1WA 2C47A 1Q8WA 3LXKA 4RIXB 4TN6A 4EL9A 4EJNA 3PYYA 3G2FA 1NA7A 2R3QA 2REIA 3QLGA 4HNFA 5IEXA 1ZOGA 3FXWA 1X8BA 4L52A 1MRYA 1Z9XA 1FGKA 3OXTA 3VS2A 4D55A 2JDSA 4Z7HA 5IMXA 4Y83A 1KE6A 4ZSGA 5HE3A 3FMNA 3JUHA 1OB3A 4JX3A 4QP8A 4N70A 2HW7A 4S32A 3Q9YA 2VTAA 2CMWA 4LUEA 2C5YA 3TJDA 2OJFE 2WMXA 4NTTA 2WQEA 3LFFA 4MNEB 1VEBA 2HIWA 2XF0A 2YWVA 2C6MA 1ZYSA 3RPYA 3RTPA 5DG5A 4YJTA 1Q3DA 4E6AA 4WSYA 3QCSA 4AQCA 4N0SA 4FK3A 3D0EA 3B2WA 5CEIA 2BKZA 1WMKA 4E6DA 3SG9A 2J2IB 5ETIA 1H25A 3PA5A 4J53A 5J9ZA 3VNTA 4AX8A 5JFVA 2YJRA 3AD6A 3H9RA 3KEXA 4AW1A 4UXLA 5KHXA 4DE4A 1VYWA 2WTKB 4EYJA 5AADA 4AE6A 5D10A 1V1KA 3NUNA 1ZYLA 1URCA 3DLSA 3CGOA 5CU0A 2F2CB 3UYTA 3MIAA 4QQ5A 3L8XA 3ZDIA 4CT2A 2OZAB 1Q8YA 4GYGA 3DPKA 3E64A 3AMAA 4AZTA 4MK0A 3T9IA 2YFXA 3L1SA 4IH8A 2F7ZE 4IW0A 1OKWA 5IQAA 2WQBA 4FT0A 3RPVA 4U8ZA 4QT1A 1YWRA 3QHWA 1TQIA 4P5ZA 4LGDA 2C6EA 2C6LA 4LG4A 3BEGA 2YERA 4RIWA 4NCTA 4BWXA 4ZTHA 5AP6A 4PWNA 2XKFA 3UVQA 4M8TA 5CT0A 1K9AA 4E73A 3ITZA 4O1OA 3W8QA 1WBNA 3UNJA 3I0QA 4B9DA 3QCQA 3E88A 4XG6A 4F0FA 4IX6A 1U4DA 3TTJA 5TF9A 3NUXA 1ZZ2A 4ZTLA 3AC5A 4M0ZA 3I4BA 3HGKA 2W99B 4GMYA 2BROA 3FV8A 5EW9A 2ZMDA 4CFXA 4EZ7A 1L8TA 4F1TA 2W9ZB 4UZDA 3THBA 4ZXTA 4BCKA 4G3DA 3MY5A 4FUYA 3D14A 1AGWA 3CKXA 3NPCA 2DQ7X 3N4TA 4IE9A 3DZQA 2J9MA 2HOGA 2YLEA 3EN4A 4Y72A 5TR6A 3DKOA 3Q2JA 4FUXA 4U42A 2OSCA 3D94A 3V5JA 1FINA 2O64A 4LOOA 5IZFA 2EXCX 1IA8A 2NRYA 5IA5A 2PZYA 5ANOA 4FEXA 1YXVA 1H8FA 5IUIA
chains in the Genus database with same CATH superfamily
4CFMA 4YC6A 3DQWA 2UZOA 4RRVA 4O0YA 5DVRA 2QOBA 2BDWA 3UZRA 1GIHA 4IXPA 3CBLA 3SRVA 4A9UA 3VS4A 4FNZA 4QNYA 2GNGA 1OL7A 4RFZA 1IASA 2X4ZA 3A8WA 3AC8A 3A8XA 2UUEA 4L7SA 3Q60A 5EQYA 3PJ1A 4XMOA 5M08A 1H1RA 3C4FA 3CEKA 3FXXA 3KRJA 4QMTA 3U9NA 4D28A 4K18A 4I5PA 5BVFA 3U6IA 4A7CA 3NRMA 2PVFA 4H36A 3ROCA 5KMNA 3HRFA 2Q83A 1W8CA 2QNJA 2R3IA 3IDPA 3KULB 4FOCA 4R1VA 3GC8A 4HGEA 5DIAA 3QTUA 1RW8A 5CEPA 3PXYA 3VUKA 3MBLA 2R5TA 5CALA 1QMZA 4IMYA 3D7TA 3H0ZA 3MTFA 4JIAA 3R7EA 4O7NA 3S95A 3TDVA 4YNEA 1OVEA 3I6WA 5ANEA 3COMA 3VWAA 4C33A 3LW0A 2IEWA 2XK3A 3K54A 4G5JA 3F7ZA 4M14A 4X0MA 2ZB1A 4FR4A 5IMEA 2JIUA 2VNYA 4E3CA 3I5ZA 3EFJA 5JRQA 3V6RA 1LEWA 2WOUA 3W2SA 2R3GA 3Q9XA 4JRNA 5AV2A 4L53A 3BBWA 3EHAA 3F5GA 3RWQA 3CQEA 3RPRA 4ANMA 2VWZA 3R9HA 4TT7A 3VW6A 4BGQA 4EOMA 3QXPA 3DBDA 4Q5EA 2ETMA 2JDOA 2O8YA 3MS9A 3P7BA 3PXQA 3Q3BA 4U9AA 4XG7A 4ZY5A 5CAQA 1CDKA 2XB7A 4E4XA 3VW8A 1G8JA 5CZHA 1MQ4A 3G6GA 1G5SA 3U6JA 3V8SA 4FT3A 3FL4A 3EQGA 5J7BA 3G90X 3TZ9A 1Y8GA 2G1TA 3ETAA 4JLCA 5JT2A 4FEVA 3RK9A 5J8IA 2BZJA 2C6OA 3DOGA 3AG9A 5L2QA 4DDIA 2DS1A 4I3ZA 2X6EA 4ZY4A 4O4CA 4U43A 4GK4A 4DLJA 1WZYA 3ZRKA 3RHXA 2C68A 5AX3A 5JFWA 4O2PA 2QO2A 2QCSA 1H28A 5AEPA 2WNTA 4ACCA 5DE2A 3TN8A 4BBEA 4BCIA 2X7FA 4QP7A 1RJBA 3VBVA 4MBLA 5B7VA 3O7LB 5HLNA 4PRJA 4QP6A 4IFGA 3FMLA 3MTLA 3Q32A 3I0OA 5C27A 5F94A 3F6XA 3ORKA 4WNOA 4HPUE 3MVLA 4OTPA 4TWPA 4ZJIA 4MKCA 5K5NA 3ZO2A 2F49A 1VLRA 4JBVA 3BE9A 3TUCA 4EOKA 3QCYA 4L6QA 4OTRA 4FJVA 2ZB0A 4U40A 3ZO1A 4QTEA 2VWVA 3IOPA 1RE8A 3BYUA 2GU8A 4GT4A 5C8MA 3FI3A 3KRLA 3SV0A 3T3UA 3ERKA 2EB2A 3OWJA 4PMTA 5CSWA 4AFEA 1KV2A 4J97A 3QRIA 3EQIA 4DGGA 4FG8A 4QYFA 4DAWA 5JMSA 3CTHA 3R28A 4ACDA 3UMWA 4DFUA 2WEVA 3JY0A 4L44A 3COKA 4OTIA 1M7NA 3PTGA 1OMWA 4U5JA 3RM7A 2PE0A 3NAYA 4AT4A 2A4LA 5IA4A 5L2WA 2C3JA 2XK9A 3FI8A 4MXZA 3ACKA 4MXAA 2OLCA 1FBNA 4J7BA 4RA4A 4X3FB 5EI8A 4A4OA 3QALE 1Q8ZA 2VX1A 4CTBA 3RINA 1REKA 3ANQA 2R7BA 3BV3A 3GOPA 1SMHA 3LFBA 1H07A 3BBTB 2FGIA 2LGCA 4AXAA 2ERKA 5E90A 3ZS5A 3CPBA 3B8QA 1JQHA 2JBPA 5CVHA 3VBQA 4QTDA 4PPCA 4DINA 3ODYX 4DFLA 2PVHA 3A7IA 5HZNA 4C38A 3HV4A 2UZEA 2VTRA 4H58A 4C4JA 5IQIA 5M06A 2O63A 4YHTA 2HWOA 4IX3A 5CLPA 2QU5A 4QP3A 2RF9A 4ALWA 1LEZA 4RPVA 2OIBA 5AR2A 1K3AA 4ANNA 5M44A 4O4DA 4EOOA 4FKGA 4M3QA 4FL1A 2ZMCA 1CSNA 3NDMA 3FI2A 3CY3A 2HYYA 3F5UA 3SAYA 2QU6A 2X9EA 4ZJJA 2W1ZA 4OUCA 3HDNA 5AJQA 4QP2A 4F6SA 5A6OA 4IAFA 2W5BA 4MTAA 4PTCA 3MY1A 2UW0A 2VTPA 4EC9A 3UVPA 4FTMA 4KKGA 4H05A 2XIRA 3O8PA 4E1ZA 4ZLOA 2C6KA 1OM1A 5LVNA 2W1EA 4IACA 3KN6A 1PKGA 3LFEA 1R1WA 3DKFA 4ZZNA 3VONA 2CGXA 3H4JA 3Q53A 3CSVA 2WMVA 3NS9A 2B9IA 3P5KA 4RSSA 4HZRA 5A4CA 5JKGA 4HZSA 2GFSA 3COIA 3KULA 4J52A 2NNWB 3NZ0A 5DFPA 5IA2A 3LFSA 4I6BA 3DJ5A 3DV3A 2VTQA 4QD6A 4BL1A 4YO4A 2BTSA 1ZMVA 2Z8CA 5FP6A 3LCOA 4QTAA 3R7GA 2XM9A 1JKSA 2R3RA 4RIYB 3U6HA 3IECA 5AV0A 3W0NA 2R3LA 4BDDA 2Y6OA 2WEIA 3DKGA 3HRBA 1QPJA 4IC8A 5BYZA 2EU9A 2FSLX 3NUUA 5HTBA 2ZDTA 2CKQA 3GP0A 5AR8A 5H8BA 4BZNA 1W0XC 3SOAA 5CF6A 4EBWA 4I6LA 3F61A 4ZIMA 4ANLA 2QURA 2GNJA 2H96A 2R3NA 4GCJA 4AUAA 2AC3A 2CHLA 5JZJA 4DEBA 1DAWA 3GCSA 1Y8YA 2NP8A 5FWKK 4CCBA 2VZ6A 3PPKA 4X2FA 2KULA 3LFDA 3QQKA 3VBYA 1NVSA 4C57A 1YOLA 4G9RA 4LGHA 2XRWA 2UVXA 3QTWA 3C4ZA 4LGGA 5G6VA 2PZIA 4FTQA 5EYMA 3LFCA 3QC9A 4G5PA 3RK7A 3LMHA 5D11A 5LOHA 2Y4IB 4BJJA 3F3WA 5DYJA 2PMNX 5AM6A 4YZCA 2VGPA 3PG3A 3ZO3A 2QOQA 5IQBA 4WNPA 4QQJA 3VC4A 4O82A 3QXOA 4LQMA 1ZRZA 3FSKA 3KXHA 1CKJA 1Q8UA 3UC3A 2GNLA 2UW7A 5A3XA 4ALVA 4M15A 4E93A 3QZGA 1PXKA 4MQ2A 4H3QA 4O7WA 3WF5A 2X2KA 2X6DA 4KINA 4BICA 1FQ1B 2YM7A 4OR5A 5L8LA 4QPMA 3DFCB 3PVGA 4MCVA 3UO4A 4C36A 2PPQA 1MRVA 4DFYA 2ETRA 4F78A 5AM7A 5E8SA 4M0YA 1H1SA 2WGJA 3FLZA 3R9RA 4OTHA 3P5JC 2QONA 2R3HA 3PUPA 4O27B 3UZPA 3BELA 3BWFA 5JSMA 3Q4TA 5JFXA 3AC1A 4YR8A 5KKRC 3S0OA 2BR1A 5EDQA 2XANA 5AR4A 4EZ3A 4RWJA 4DEDA 4RVLA 2BDJA 5ETFA 1ZAOA 3CC6A 3TKHA 4BZOA 1W2DA 2IVVA 4LRKA 5AA8A 3MH0A 4JAIA 5KHWA 1PRYA 2BPMA 3EYGA 2XKCA 2R9SA 3S2PA 3V5LA 4I92A 4RA5A 4YSMA 3W33A 5B2MA 4L68A 4QYHA 2XBAA 3U87A 2FSOX 2QOOA 1UVRA 3EIDA 2X0PA 4IVAA 4CQEA 4CRLA 1J1BA 4FIEA 3BL7A 5CXHA 4Y73A 3ZRLA 5HNIX 4D9UA 4F7SA 5D7AA 4C3PA 4W8EA 3MW1A 3R8MA 2R3OA 5BUEA 4EBVA 3OG7A 2IO6A 1VR2A 3FPMA 4F4PA 4WUNA 4I6QA 1TZDA 3DS6A 4F9AA 1W82A 3LVPA 4LL5A 1U59A 3AGMA 3MV5A 4OTWA 5DT4A 5AP3A 2IWIA 3NNVA 5I5ZA 4Z16A 4EHEA 4FICA 3KKVA 4F9BA 2QOIA 2Y9QA 3P23A 2GS2A 3ZDUA 4D9TA 3F5XA 2J4ZA 3NSZA 3R7UA 2X7OA 3QRJA 1OITA 1OUYA 4BI1A 4D2WA 3R73A 4DG2E 2HWPA 2ERZE 3DCVA 4JBPA 2IVTA 5FDPA 3OOGA 4HCUA 4MBIA 5HD7A 3T8OA 2R7IA 4MVFA 4CYJA 5CNOA 4YJSA 3FKOA 2JGZA 4PDPA 4CT1A 1FGIA 1H00A 2C69A 1G8SA 5DPVA 4KS8A 3ZC6A 5IA3A 4JNWA 4AAAA 5A4EA 4CMTA 5BVOA 4G17A 1PXIA 3OZ6A 4M69B 5A9UA 3KF7A 2NO3A 4D4YA 2YISA 4X3JA 4DBXA 2JEDA 2W4KA 2UZBA 1YHVA 4X3FA 5HO8A 5CS6A 2IVSA 5HVJA 5I9UA 5IUGA 2Z7LA 3EQFA 5GIOE 4FGRA 1YDSE 4KSPA 4ZZMA 2OZOA 3R9DA 5C1QB 5HIDA 4BIDA 2JITA 4IAZA 5DN3A 2XYUA 3KCKA 4BTJA 5IU2A 3R0TA 4IWQA 3BQCA 1Y6AA 3V51A 4HYUA 3VUDA 1KWPA 3E63A 2W1FA 5HTIA 3PFYA 2ZV2A 4BI2A 4LI5A 2BRNA 4MF0A 5EOBA 3TXOA 5IEYA 4TW9A 2WTDA 3Q2MA 4N57A 4EHZA 3HMPA 4EUUA 5E8ZA 1HCKA 2DUVA 1K2PA 4C58A 3R8PA 4IZYA 5AV1A 4H39A 1BLXA 5EI2A 3GEQA 3KF4A 5AX9A 4XX9A 1M17A 4FKLA 3RJCA 3C51A 4I93A 4F09A 3UDTA 2NYAA 2BAQA 2YHVA 3IGOA 1PXLA 4OTQA 5JEBA 5KCVA 2QO9A 4OBPA 5GHVA 3TM0A 3QAME 4CV9A 1S9IA 3E8CA 4HPTE 3UDZA 4BR3A 3DTWA 4KS7A 4F6WA 3KB7A 3E92A 4AF3A 4AZEA 5L3AA 1IR3A 3OY1A 4NFMA 1Q41A 2YIQA 2AQXA 4UV0A 4P4CA 3BLHA 3BU3A 3SQQA 3HX4A 5HKMA 5HU9A 3DAEA 3CS9A 3H9OA 5EYDA 3VF9A 4P7EA 5H9BA 2XNNA 1YXTA 5CNNA 3V5TA 4FTIA 3F3UA 2PMIA 5E8WA 3OBJA 5LWMA 2YJSA 5C9CA 5CU2A 2BCJA 2J90A 2A98A 2RG5A 3ORTA 5CI7A 4J1RA 5F9EA 5HE1A 3FZSA 4O96A 4YNOA 5M55A 4DHFA 3KREA 3EKKA 3JVRA 3AQVA 4YBJA 2WTJA 4AP7A 1KE8A 1SZMA 2C30A 1NW1A 2WMUA 4G6OA 3Q52A 3I7CA 4DGLC 5KMLA 3DZOA 2EVAA 5CEMA 1FVTA 2Z7QA 2HK5A 3DJ6A 4BDBA 3ANRA 5E1EA 5AV3A 1JVPP 2IZTA 2V0DA 2WOTA 4NJ3A 5DR2A 5KZIA 3UIXA 1KUTA 3JYAA 5DR9A 4I23A 3QD3A 3R2YA 3O8TA 4CRSA 4DH3A 1R78A 5IUHA 4MXYA 4LMUA 1GIIA 1V0BA 4IFCA 5GZ9A 3IPHA 2BDFA 1P5EA 3G51A 3QRUA 3WZJA 3U54A 4FKVA 4A4LA 5D12A 3RWPA 3DBQA 1FMOE 3FLYA 2V22A 4IQ6A 5L6OA 3RAHA 4IX4A 2GHGA 3BU5A 4IIRA 2XEYA 2GFCA 5M07A 3E8NA 5EHOA 3GFEA 4IAIA 1W2CA 4R7IA 3LXPA 3DK3A 4II5A 5LQFA 2NPQA 4CMOA 1J91A 4ARKA 2OF2A 2FSTX 4FNWA 4YMJA 3I79A 5BUIA 4R78A 2VTMA 3QHRA 3LCKA 1SM2A 2VO0A 3QBNA 4GIHA 2CNQA 4UZHA 1ZYJA 3UQFA 4V0GA 3BLQA 4FKIA 2A27A 2VTHA 4AT5A 3W16A 2YZLA 3OWKA 1UKHA 2WIHA 5FEQA 4YJPA 4N6ZA 5FQDC 3EN9A 4TYGA 1XWSA 1XH6A 3GT8A 5AAGA 2WMRA 1PMNA 1CKPA 4L8MA 4I4EA 4R5YA 4ZJVA 3LJ0A 4ZTMA 3EQCA 3SXFA 3ZLXA 2I7QA 4AZWA 1YXXA 4R7HA 3UMXA 1OIQA 4FNXA 3FMDA 4NM0A 4RBLA 2UW6A 3QUDA 4AW5A 2XMYA 1QPCA 2BFYA 4F1OA 2ITNA 4EK5A 3UZTA 2O2UA 2G15A 3EQDA 5CQUA 4EH6A 1W84A 5HG7A 2YCRA 4HVHA 3IDCA 2GHLA 2F57A 2UW3A 3QKLA 4KSQA 5F95A 2ZV8A 5L6PA 4XLIA 3ORZA 4IC7A 4EOJA 2EXEA 5J9YA 4RQKA 2FA2A 3G9NA 3C4XA 5HCXA 2WTKC 3ORIA 3FY0A 4MYGA 2HENA 4KIKB 3RBWA 4AWIA 5E8UA 1S9JA 1BMKA 2VX0A 4BBMA 2VWUA 2EXMA 1REJA 3QRKA 5IF1A 3PRIA 4D58A 1U5QA 1STCE 3KVWA 3O71A 3RZBA 1A9UA 1Q99A 4MQ1A 5H8EA 4MAOA 4AGDA 3HYHA 4EK8A 5JGBA 1L3RE 3TIYA 3FHRA 3BLAA 4MUQA 3HA8A 1PMVA 3VQUA 4FSUA 4U80A 4ZS4A 2EB3A 3UNKA 2JIVA 1QL6A 3BU6A 2XBJA 3FMEA 3R83A 2ONLA 3VUGA 2W96B 3C4CA 4NTSA 3PPZA 3QA8A 4O86A 3EWHA 4I41A 1YRPA 4C4FA 3VBTA 3PJ3A 3R71A 3UJGA 3ALNA 5FG8A 1SVGA 2I1MA 3AC3A 2CNUA 3W8LA 4NJDA 2X4FA 5J7HA 2YAAA 2B53A 4EONA 4QMXA 2ITUA 2A19B 3HZTA 4M68A 3C0HA 5J87A 4BCMA 5GZ8A 1M2RA 2QHNA 2WO6A 2VRXA 3FMHA 3CCNA 2JD5A 3PIYA 4LUDA 4F9YA 5J5TA 4LMNA 3EMGA 3QLFA 3C5IA 4JR3A 4DN5A 4QMMA 4K6ZA 3NUSA 3LQ8A 4L01A 5IQEA 5AR3A 1IAJA 3E7OA 3NW7A 3QU0A 1JOWB 2UW9A 4G31A 2R3MA 5E8TA 4EJ7A 2IZRA 4QOXA 4GW8A 5E4HA 5CEOA 1YVJA 3PXZA 2C4GA 3WZDA 3P86A 4JQ8A 4FSRA 4K0YA 5HBHA 1XQZA 4BBFA 3TDWA 3H10A 4RIWB 3O7LD 3C0IA 2J0JA 2JDTA 3PVWA 4U0IA 3VS7A 4FT5A 4PMPA 4XG9A 4O84A 1T45A 3RI1A 4JX7A 2YM5A 1EH4A 3QYWA 3W2OA 4X7QA 4F7LA 3F82A 1QPDA 2C5XA 4BCGA 4CKRA 5IG1A 4WNMA 5M51A 4J8MA 3BGPA 3WF9A 2PY3A 4C62A 3ZLWA 1P4OA 2XEZA 4FTLA 3V5PA 2WQMA 3HV6A 4Q9ZA 4AGUA 4FVQA 2CGUA 1QPEA 2OZAA 4AACA 4GSBA 4PL5A 4ERKA 4U6RA 4J8NA 4O91A 2C3IB 2CN5A 2PK9A 3G5DA 3ZEWA 3UOHA 2B54A 3F5PA 5C01A 1B39A 2WELA 3ZOSA 3NVMB 3F2RA 1YHWA 4O4EA 3BGQA 5EHYA 3OF0A 3BLRA 2X2MA 4IB5A 4RFYA 2XARA 3F2NA 1OIUA 3JS2A 2ITYA 3AC4A 2WU6A 2Z7SA 3KMMA 2RIOA 3N51A 4W4XA 5BPYA 5LXMA 2XAMA 5HBEA 3PA3A 5HVYA 2YN8A 3H30A 1F3MC 2HZ0A 4V0GB 4YBKA 4WG5A 4QQTA 3GQIA 3FDNA 2B7AA 3NNXA 5IA1A 4QDEA 5EYCA 2BALA 3R22A 3OD6X 4KRDA 5T6KA 4AZFA 5CXZA 1M14A 4U41A 2HY81 4FNYA 2VAGA 2WTCA 5CU3A 4EUTA 4F0IA 4E7WA 3KCFA 4YZBA 4TYEA 1PYEA 1TQMA 4RVTA 1OECA 1URWA 4J98A 3ZFYA 2WKMA 3KFAA 1W83A 2ZM1A 2YITA 2V62A 3QTRA 5HLWA 2YIWA 4UBAA 2PZRA 4JDJA 2IF8A 4FTAA 3ZFXA 2F9GA 2OF4A 4TWNA 2VWIA 2GNIA 4DG3E 3AT4A 4ANBA 4B6LA 2BZIB 5HG8A 2O0UA 4PDSA 1XBBA 3GCQA 4FTKA 4RX7A 4KA3A 5I9XA 2R2PA 5IQHA 5KMKA 4Y85A 2WQNA 4YURA 2YA9A 4BKYA 3OW4A 2XA4A 3TNWA 4CFWA 4WD5A 3UODA 4C0TA 3I6UA 4C2VA 5I9WA 3Q6WA 2VTJA 3UO5A 4NK9A 4D4VA 3KRRA 4RZWA 4FV6A 2AYPA 2I0VA 3IW4A 4LRMA 4ENXA 4PX6A 4G3CA 4F64A 3BYVA 3OCSA 3ATTA 1IRKA 2XP2A 4W4VA 3IGGA 1P2AA 4IM0A 5CEQA 3TUDA 2GS7A 4XG3A 3C4WA 3NVKI 2ONLC 3OS3A 3BEAA 4OW8A 4RX8A 4E4NA 2PUIA 1HOWA 4XG8A 2XS0A 2I0YA 1JSVA 3BHUA 3QCXA 4YJOA 3R9OA 2BMCA 1E1VA 3FMKA 4FTTA 3E8DA 3Q96A 4JDIA 4W9XA 3OROA 4NIFB 3QX2A 5CTPA 4W8DA 1SVEA 3N4VA 5JQ8A 1ZMWA 4NU1A 4RJ3A 5HE2A 1R0EA 2VN9A 1GY3A 4IZ7A 3I5NA 4AOJA 3VUIA 1OIRA 5M4IA 4UXQA 3U51A 5HI2A 3UDBA 3MFRA 4AA0A 1IG1A 4A9RA 5EQEA 2C5VA 5CX9A 3RNYA 4DH1A 2QR8A 1OI9A 3W0PA 3KMWA 5IQGA 3MJ2A 3HAMA 1MQBA 4MBJA 4GT3A 4MXXA 1J7LA 5K4JA 1OBDA 3ZXZA 3AC2A 4UB7A 3D9VA 1J7UA 4R3CA 4BDFA 5JRSA 4CLJA 3KVXA 1XH7A 3REPA 3PXRA 4XOZA 5TO8A 2IZSA 4C4EA 4ONAA 5AUTA 5AAFA 3TTIA 5EHLA 4KUJA 3GI3A 3Q9WA 3ZLYA 4CYIA 2YAKA 3NYVA 4MX9A 5KMMA 1GAGA 4FZDB 3HMIA 1ZZLA 4NEUA 3H0YA 2X81A 4IAAA 3G0FA 3R7YA 4TY1A 5FBNC 4CZUA 5AUXA 4F99A 5K0KA 3CY2A 4XOYA 4JVGA 1YI3A 4MH7A 2UW5A 3DBCA 4GK2A 3HLLA 4M66A 3ORLA 2ITZA 1PHKA 1WBWA 1GNGA 3QQLA 1JSUA 3LE6A 1KSWA 1TKIA 1XH8A 3UTOA 4EEVA 3N4UA 4G9CA 4F08A 4LM5A 2X1NA 2HCKA 2XCHA 3FL5A 3DLZA 4AZSA 4DEAA 2J0KA 5AUVA 2DWBA 4GK3A 2YM8A 3E5AA 3PE1A 4A4XA 4O0WA 4XEYA 5DWRA 2X7GA 3QYZA 4CLIA 2WMAA 1TFFA 1WBOA 2JFLA 2PTKA 4B8LA 4KBAA 4PL4A 4CNHA 3WOWA 4Z7GA 1XO2B 3FMMA 3V5QA 5DI1A 5FEEA 5HX8A 4GFGA 3FQHA 4EORA 1M52A 2WTVA 3HMOA 3WE8A 1PJKA 3NW6A 5EG3A 3EKNA 3DNDA 2WPAA 3CPCA 4RMZA 3DT1A 4FL2A 4G34A 1H08A 3KK9A 4FKRA 4RIOA 4HVSA 5F4NA 5C4KA 4EK4A 4FEWA 3UC4A 1ZMUA 4Q2AA 1APME 4QPSA 2J50A 2VWXA 3PSDA 3MN3A 2JKKA 4O7TA 2RFSA 3D2IA 4KIPA 2W4OA 5LMKC 3R8UA 3NWWA 4A9SA 4UMTA 5HHWA 3QZIA 4CQGA 5J9LA 4E6QA 3V8WA 3IS5A 3SW4A 3EFWA 5M57A 5BVNA 1FPUA 4GJ3A 4R3PA 3VS5A 3ZFMA 1NT2A 2I40A 3WZUA 1WCCA 3ORNA 4QYEA 1NVQA 3E3BX 4UYNA 5CSPA 4BY9E 5ITAA 3DNEA 5KO1A 4JQEA 4DTAA 3U55A 2CGVA 3BYOA 2BRGA 4DDGA 5HGIA 5FXRA 1M2QA 3WZEA 4B8MA 5AIKA 3P08A 4JMQA 3KXNA 2C6TA 4W4WA 4UMQA 4AA5A 4BWKA 4C3FA 5CU4A 3F3ZA 4C7TA 4GEOA 2RKUA 4F70A 2V7AA 3OW3A 2GMXA 3P1AA 3QRTA 2RFNA 4XNEA 1UV5A 3MPTA 4AFJA 4BFMA 3A7JA 5DRDA 3FKLA 3NNWA 2P0CA 2YZAA 4AOTA 2OH0E 1VJYA 2PVMA 3A99A 3LFNA 4O83A 3QTSA 4PP7A 3DXNA 1WBSA 3MH3A 3L9MA 5CSVA 3DQXA 1F5QA 2XNPA 4EH2A 4TPTA 4KBCA 3IO7A 4MXOA 4L3PA 3GU4A 2PE1A 5DBXA 2OG8A 3ZCLA 3LKMA 2Y0AA 4QMUA 3LQ5A 1BUHA 4M97A 3UGCA 4C34A 2QOFA 4H3PA 2BIKB 2WMBA 3ZEPA 1XMMA 1PF8A 4FV7A 1DS5A 1CM8A 1R0PA 2ETKA 2JIIA 4MD7E 1ZOHA 4PV0A 3KRWA 5GJFA 5HCZA 4Y8DA 3ZO4A 2XK6A 3C7QA 3F2AA 1P4FA 5ICPA 3HMMA 3FMJA 1SNUA 1CMKE 3MIYA 2WTIA 4FIHA 4S2ZA 5LMAA 3P0MA 4O7RA 3VS3A 5J1VA 5EM7A 5HTCA 1OZ1A 2W1CA 4IVCA 4FKTA 2Y6MA 3UOKA 4AZVA 4BDIA 3HA6A 3Q4ZA 4DH5A 3OEFX 3LJ2A 2JBOA 2QKRA 2QI8A 4BCOA 3GC7A 4HCVA 4EH8A 4OAVB 4QTCA 1Y57A 3RHKA 3RPOA 5DOSA 4TKSA 5A4TA 1FMKA 2ITXA 4C61A 1H24A 2WFYA 4FKWA 5L2TA 4YP8A 4BGGA 3BHYA 5B0XA 3IW5A 1PMEA 2XIKA 4O81A 5EKNA 3W2PA 5KMIA 3EB0A 2NRUA 4I5MA 4IAYA 2J7TA 4XV2A 4B99A 4UMUA 1DI9A 3SHEA 4PDOA 2B4SB 3FBVA 2VTIA 4K77A 5I9YA 3HECA 3QKKA 5AWMA 3RP9A 4FV5A 3C0GA 4KIKA 4WSQA 2BTRA 2OW3A 2VO7A 4KABA 3ZZEA 2UZVA 4AW2A 4BI0A 4CSVA 4CV8A 4QMNA 4YO6A 1H1QA 1LP4A 3CKWA 4Q5HA 3DBFA 5J79A 3LLAA 4E4LA 2OFVA 2XH5A 1PXOA 4AN9A 4BCHA 4APPA 4NL0A 3MFTA 4I0SA 3AT2A 4ZTSA 5CAVA 3B2TA 3VS6A 2C5OA 5DR6A 1W2FA 5AP7A 3GU7A 4L43A 3ZSHA 4AW0A 2BIYA 2IW6A 3N9XA 3BPRA 3FZ1A 4L3JA 3SDJA 3KXXA 5LVLA 2OIQA 4FX3A 4IVDA 3KK8A 1WVXA 3NYXA 4F7JA 4BYJA 3NYOA 4YTHA 4CG8A 1NVRA 4FVRA 4G6NA 4I6FA 2XZSA 4JG8A 4XV9A 1YQJA 3POOA 4CG9A 2QQ7A 3HVCA 3QTQA 4EHVA 3IW8A 4I4FA 1LUFA 4BDKA 5IEVA 5F1ZA 2JAVA 3R7VA 3VVHA 4D2VA 4C4IA 5LVMA 2Q0BA 4IZ5A 4MXCA 3PWYA 4NT4A 2CCHA 4BVUA 5HCYA 4NYEA 4X21A 3FI4A 3AKKA 4JBOA 5AFVA 1SNXA 3UQCA 4DGOA 4ZSEA 4LL0A 2IG7A 1OKVA 4IWOA 2PVLA 4QMYA 5LARA 4IB0A 4EKKA 3BHTA 5F20A 3KXZA 3VHKA 4B7TA 2ZV9A 2BRHA 4BHZA 2PWLA 2DYLA 4D2PA 3TNHA 4JJRA 1U54B 3DTCA 4IAKA 4HW7A 5HIEA 3WZKA 2Q0NA 3ZM4A 3TZ7A 1OIYA 2PUUA 4EK6A 2CKPA 2F2UA 5AR5A 3ZSGA 4ASZA 5IA0A 4OT6A 3SOCA 4DGMA 4MF1A 4K9YA 4DYMA 1WFCA 3SXRA 4A07A 1GJOA 3K5VA 3ZHPC 3GOKA 3F7WA 4BCQA 2WXVA 2W0JA 2UZUE 3QX4A 3OMVA 3SLSA 5GJDA 4QEBA 3QWJA 3E93A 4TYHB 2H8HA 4I0TA 4FBXA 4OBQA 4XCUA 5CI6A 5EDPA 4AA4A 1H0WA 1UU3A 3GNIB 3I60A 4ENYA 2XK8A 3EN7A 3HV7A 3ZC5A 3IG7A 2JFMA 3C13A 1YXUA 1PKDA 4N4SA 4GVJA 2PSQA 3WYYA 4AT3A 1RDQE 2BZHB 3FE3A 5E7RA 2XNEA 4YJNA 2VUWA 3UVRA 2ITWA 1IAHA 2YLFA 2UVYA 3UO6A 2OXXA 5D9HA 4N6YA 1UKIA 2GS6A 4HJOA 2X9FA 3ZBXA 4R3RA 3JVSA 4WBBB 4Y95A 5FD2A 5C26A 5DEWA 5B2KA 3B8RA 5M4CA 4O38A 2VWWA 4ZAUA 2PYWA 4K8AA 3R1SA 4FV2A 1PXNA 3LMIA 5IH5A 4L67A 1XHAA 4WRGA 3EJ1A 4YPDA 4IEBA