2W9ZB

Crystal structure of cdk4 in complex with a d-type cyclin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
291
structure length
287
Chain Sequence
ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALAPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G1/S-SPECIFIC CYCLIN-D1
publication title Crystal Structure of Human Cdk4 in Complex with a D-Type Cyclin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 61
structure length 287
sequence length 291
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2w9zB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2w9zB01
4MVFA 2QR8A 3R7GA 2REIA 5HIBA 3BU5A 3C4FA 2VAGA 4BBEA 2BRGA 4OAVB 1JKKA 1OGUA 4TRLA 4DFUA 2OO8X 5ACBC 3NIZA 2R7IA 4EOPA 4QMTA 3FLSA 4ITJA 3UGCA 3NMUF 2W1ZA 2WOUA 5AP1A 3VBYA 3FLNC 3PJCA 4ZOGA 3VF9A 3ERKA 1OL1A 2EXMA 3V8WA 4YLKA 4XG8A 3U55A 4YJRA 3L9NA 3SKCA 3PPJA 5CEPA 5DMZA 3F5GA 2LGCA 3NCGA 4F7JA 4QMNA 3V3VA 5JFVA 1PY5A 1Q99A 4ANQA 2O64A 3AOXA 4JRVA 3LMHA 3KC3A 2UW9A 4PMPA 5EM5A 4GT4A 4LGGA 3R7UA 4OW8A 5BVKA 2YDJA 4F1TA 1WCCA 3PP1A 3CS9A 3DS6A 4G9CA 2OZOA 3EQIA 5HE2A 3QCSA 3FYKX 4PDOA 4AN3A 3KU2A 4NJDA 1J1CA 3MPTA 3Q9YA 3QC4A 3QKKA 4BICA 5BYYA 5LVMA 2VTSA 4RJ3A 5CSWA 1H07A 2VWZA 3PJ2A 1H01A 4QTCA 3ENMA 3RCJA 3OWPA 2VO3A 5AFVA 4MNEB 3ZUVA 5AUXA 5LXMA 3DBDA 2UVXA 4L42A 3D7ZA 4ZY4A 1O6LA 2C3IB 3O2MA 4DITA 3A60A 5DNRA 3OCGA 3SOAA 3R8VA 3ZH8A 4OLIA 4OTGA 5D41A 4YSMA 2PVLA 4FKOA 2CJMA 3TNQB 2PPQA 4H3BA 3C4WA 1YI3A 3R2YA 5J79A 3PG1A 3VC4A 1E9HA 2QLQA 3PVWA 3JXWA 3QZIA 4MBLA 5B2MA 2XIYA 3RTPA 5K0XA 4BCOA 5HTIA 4DLJA 5AP7A 5JFWA 3IGOA 3O8PA 4FL1A 4XV3A 2OXDA 5DWRA 4TXCA 3TCPA 2C6MA 2VO6A 3SDJA 3UC3A 5HE0A 3GENA 5ANOA 3PWYA 5HKMA 4DTBA 3VUIA 2BRMA 3E7OA 2IZRA 4Y73A 5IDPA 4IADA 3VAPA 3JR1A 4EUUA 2I1MA 4AS0A 3AD6A 4FTQA 3ZDUA 4F6SA 2HZNA 4JLCA 4W9WA 3JYAA 1HOWA 4QMQA 1J1BA 4F6UA 3EN6A 5AAEA 2OJJA 1K2PA 3C50A 4ANSA 3OC1A 4AOIA 3VNTA 2BIYA 2YZLA 4FVRA 1JOWB 5E8SA 2WZJA 2OZAA 5KO1A 3W8QA 5CSVA 4TTHB 1REKA 2X8DA 1OL6A 5JGAA 5EHYA 4ZLOA 1VJYA 5EG3A 5L8LA 4ENYA 2VTNA 4G6OA 5AP0A 2VTMA 1VEBA 4AW5A 4W4VA 2WFYA 3GEQA 5FRIA 5TOZA 5BX0A 4L7SA 4YGAA 3ZONA 4KA3A 3IECA 2WTIA 4BR3A 4XLIA 3D5VA 2JEDA 4FKUA 2BAKA 5E8XA 4PTEA 5DLSA 5I3OA 3ZXTA 4BHNA 4N70A 5HG9A 1M2RA 2CGWA 4M15A 4EH2A 1XJDA 1YHWA 2GHLA 4FICA 3TTJA 4BDEA 4E73A 4FMQA 3WILA 4K18A 3V5LA 4RIWB 4PPBA 4KS7A 4E26A 4J96A 4EHVA 5CEOA 5I9WA 5J7BA 1MP8A 1WBPA 3FPMA 2A0CX 2XEYA 1WBTA 1ZRZA 2G01A 2GS2A 2XJ0A 3PE2A 1OBDA 5LMBA 4JDHA 4FZ7A 5D10A 3MPAA 4I24A 3ORKA 5K5NA 1XH5A 4IANA 1GZ8A 3BEGA 4FZFB 2WTDA 3OD6X 5I3RA 5IEYA 4RVLA 3R7YA 2P55A 4C4EA 4O38A 2YCQA 4YPSA 2WQEA 5AP6A 4FL3A 3QC9A 4DFZE 3NUNA 3AC4A 5AV0A 5JMSA 5IMXA 4PP7A 4ACHA 4TY1A 3NDMA 4V01A 5CQWA 5CX9A 2XKDA 1JVPP 4AA0A 2B52A 3NVMB 4D9TA 5CANA 4FKPA 4C33A 5KBRA 2Y9QA 4HVIA 3QF9A 3QFVA 2ETRA 3MTFA 4EC9A 4RFYA 1URCA 5D12A 3MJ2A 4RBLA 4MXYA 5D9HA 5FBOA 4F6WA 4H3QA 4AFJA 3BHTA 2ACXA 2RF9A 3HRFA 3DDPA 2B9FA 4FIJA 4TYHB 2V7AA 2ZV8A 4BGGA 4U9AA 4KBKA 4QP9A 1SVGA 1H25A 2IN6A 3BBWA 4O0TA 3LIJA 1XO2B 5DFPA 4C2WA 1QCFA 2B55A 3KF4A 4OTIA 4C4HA 1L8TA 4IM3A 3POZA 5HTBA 3QLFA 5J1VA 1YWNA 4RIXA 5CI7A 1LR4A 1TQPA 1ND4A 3DKGA 3CGOA 4FNWA 4QYYA 5JRQA 1RJBA 4R7IA 4O21A 1LPUA 3NVKI 2ZYBA 3D15A 3H10A 5IA5A 3VUGA 3EKNA 2Z8CA 1DM2A 2XNBA 4UB7A 3IQ7A 4YJPA 2UZOA 1STCE 2WPAA 2LAVA 5AADA 3UNKA 1RE8A 1PXJA 4IX3A 4RC3A 3SGCA 4DT9A 2X81A 3ANQA 3HL7A 1CKPA 1V0OA 2PZ5A 3KK8A 3LCTA 3QAME 4Q5EA 3MB7A 3O50A 4EHZA 5JKGA 1UU7A 2RFNA 3CD8A 2H96A 5C8NA 1H08A 1GIJA 2WELA 5HBEA 3PE1A 3E5AA 2P0CA 3C1XA 5A4QA 3PXKA 3TV6A 3VUDA 3ZM9A 5J8IA 4D55A 2BDWA 3AC8A 4K6ZA 3UODA 3R8PA 1YW2A 3PYYA 3PXFA 3OXTA 4RA5A 4RT7A 5TT7A 3HMNA 4GK3A 3IG7A 3I60A 3CIKA 1H0VA 4IACA 4IBMA 3FLWA 4JQ8A 4AOTA 2WMXA 5IQDA 2F2CB 3R9OA 4GIHA 3ZO3A 5E8YA 3DCVA 1OIQA 1MRVA 1Z57A 4BCKA 3EJ1A 3QKMA 5IZFA 2ZVAA 3PJ3A 1H0WA 4EZ5A 5KHXA 4DF3A 4AT5A 4JAIA 3ZFMA 1AGWA 2IVTA 4IZYA 4WRGA 3KA0A 4APPA 2BR1A 2ZAZA 5H2UA 3TXOA 4YZCA 4FK3A 4AGWA 1BX6A 4D58A 5IH4A 2P33A 3QTIA 3SXRA 4UALA 5DT4A 4NK9A 3CTHA 4CQEA 1ZYCA 3BYSA 1NA7A 4RC4A 4EK5A 4A9UA 3ULZA 3TJDA 3EQDA 3QQFA 5D11A 2HZ0A 3IW5A 4ZSEA 5E8VA 4BI2A 4ZTLA 3PA4A 2WIHA 5CEQA 5GZAA 2ZB1A 4LG4A 1JKTA 4JT3A 4UMQA 4TZRA 4Y8DA 3IS5A 4II5A 2XB7A 4A9SA 3Q5IA 3QU0A 1BI7A 3GOKA 2JLDA 3MVJA 4EJNA 3D94A 4FSWA 4IVAA 3ROCA 2QHMA 4L52A 5AX3A 4O7TA 4GKIA 4ZZMA 1QPJA 4L68A 1BYGA 3O96A 3RNYA 5BNJA 3H9RA 2CGVA 3SOCA 3WBLA 3Q2MA 4YJVA 4CRLA 5DRDA 3R6XA 4XUFA 2BAQA 4WIHA 5C8KA 4FTMA 3WZKA 3EN9A 5LCKA 4QP1A 4TL0A 4TWCA 4MF0A 4OBQA 4PMTA 4QMLA 5FD2A 3ORZA 4C0TA 2BZJA 3R9DA 4AW2A 5CEMA 5HORA 1Q3WA 2WU6A 4IC7A 4KINA 4F9BA 4GIIA 4YHFA 4BYIA 1XH6A 2BDJA 5HG5A 4J95A 3BHUA 4RA4A 2PZYA 1DS5A 1U59A 4NKAA 4F0GA 2VWUA 4ONAA 1H24A 2OIQA 4DBXA 4EJ7A 3MIYA 4C34A 4AU8A 3UNJA 4YJTA 3V6SA 3IONA 4G9RA 4ITIA 4PV0A 4AW0A 4ACMA 5AV4A 5A4EA 4YZBA 4C36A 3O8TA 3G51A 1PXKA 1SVHA 4USDA 3G90X 3AT2A 3OWJA 3P5KA 3LFDA 3QWKA 2WHBA 3BQRA 4AA4A 4U0IA 4ZZNA 3W2CA 1XH8A 4O22A 5JQ8A 2JIVA 2X6DA 2YHVA 3SXSA 5KHWA 4O7SA 2R64A 4P7EA 3FZRA 2CKOA 3D7TA 2XNOA 5AIKA 3IOPA 4FIEA 5HLWA 2QU5A 3Q96A 3F3TA 4DG0E 4EH4A 1XHAA 4UWCA 4ZTRA 3Q32A 3V5TA 4RX5A 1G8AA 3K5VA 4HCUA 4TWNA 3CGFA 3FZSA 1H27A 2YM8A 3FI3A 3RAHA 4DFYA 1H00A 5BPYA 4WBBB 3RM6A 4Z3VA 4NFMA 2ITXA 4BTKA 5AM7A 3ZRKA 4CSVA 5HD4A 4BI0A 4EOQA 4RFMA 2QOCA 2JDSA 3FLQA 4KS8A 4YHJA 2C6OA 3RPRA 2UVZA 2BROA 2JDTA 3VS7A 4GYGA 5HNBA 3ZO2A 4BGHA 3P7BA 4MBIA 2WKMA 2W5BA 2ZM3A 3R0TA 2G2HA 4R5SA 1TKIA 5CAPA 3SHEA 2R3KA 3DTWA 1H1QA 1NXKA 4J52A 4PUZA 4AXAA 4BC6A 4BKYA 4C62A 4X3FA 4WOVA 2VTJA 5AR3A 5I0BA 4IXPA 3JUHA 4U40A 1A06A 3UDBA 4S32A 3L1SA 2GNHA 3H30A 4L6QA 4BDDA 5K4IA 2YAAA 5LWNA 1XR1A 3HV6A 5EI6A 3FDNA 4WG5A 2P2IA 5LVOA 2ITUA 2VTOA 1E1VA 4D1ZA 3W8LA 3GU6A 5CU0A 1IEPA 2IO6A 4IZ7A 3PJ1A 2CPKE 2W9ZB 4KKHA 2RFSA 4M69A 4RMZA 2UW5A 4DFNA 3EH9A 3HUBA 5E8UA 4D2TA 4HVDA 5FXRA 3OW4A 4NCTC 4CFUA 3P0MA 4EH6A 2AUHA 3EQPA 2YCRA 1UWHA 1Q97A 4N0SA 3HMIA 3REPA 4WNMA 3F2RA 4HGTA 2SRCA 4LRJA 4BDBA 3TDWA 5CTPA 4W4WA 3WF9A 3TNHA 2B1PA 3CSVA 5HEZA 4F63A 1F3MC 3LXKA 3QBNA 4UYNA 5B2LA 4YTHA 3CPCA 1YOLA 3ITZA 3RAKA 1VR2A 3HMMA 4MXZA 1O6KA 3POOA 4BDAA 3IW4A 3KMUA 4XBRA 4YJQA 4CYIA 5LWMA 4JBQA 2XEZA 3ALOA 3N9XA 2ZMDA 3QRIA 2EU9A 3S1HA 2PUUA 4ZTMA 4O7LA 4L01A 4ITHA 4B7TA 3NSZA 3OFMA 3UOJA 4I0TA 5LMAA 4QPMA 3WZUA 4O7NA 2VGOA 4JR3A 4X0MA 4QP8A 3FV8A 3DB8A 4NIFB 2F7XE 5CWZA 3MW1A 4GJ3A 2BILB 3NRMA 4QYFA 2QR7A 3RZFA 2W06A 3QD3A 1SMHA 3I0OA 3R9RA 3HZTA 4XLVA 1SNUA 4HZSA 4PL5A 3AD5A 5DIAA 4F4PA 4CTBA 4RX8A 5EK7A 2QKRA 2Z2WA 5DE2A 3KXZA 5GHVA 5C03A 2JFLA 3PIYA 4BDJA 3BLQA 5JT2A 2J90A 3Q4TA 3MPMA 1KWPA 2ITZA 3R1YA 4MX9A 4W9XA 4AF3A 1APME 1H8FA 1AQ1A 2HWPA 5HIEA 5J9LA 3QKLA 4FZAB 2C0IA 4JQ7A 3Q2JA 1WBVA 4J8MA 2GNGA 3CR0A 3GCPA 3I1AA 2J0IA 3WI6A 4B8MA 2J0KA 5LJJA 3FE3A 4FV1A 4TWPA 3W55A 5CNNA 5BYZA 5EH0A 3TIZA 3UOHA 1B38A 1UNHA 2ZV9A 1R78A 1FVVA 4G6NA 1K3AA 4KRCA 5AR2A 4CXAA 4IB3A 4JS8A 5KE0A 4GT5A 5M56A 2PZRA 2OICA 4I6QA 3CD3A 2EUFB 4RZWA 4O2ZA 2CKEA 2WTCA 5T3QA 2IVVA 4EH8A 1YXTA 3DBFA 4M97A 3SC1A 2QKWB 1JBPE 4O6EA 4CFFA 3EQRA 2RL5A 5EOLA 1FINA 4JBPA 4YUQA 3SRVB 5A6OA 3QTSA 3TV7A 1Y8GA 1NT2A 2C3KA 4C59A 5A9UA 1JPAA 3MB6A 3VULA 1W84A 2BKZA 2JFMA 3GC7A 2WO6A 4FYNA 4XMOA 4A9TA 3KREA 3VWAA 2XNNA 2VX1A 4H39A 4UMUA 4NKSA 3TJCA 1UKHA 4ZLZA 5CS6A 1FMOE 3R21A 4R8QA 3GQLA 2B7AA 5DPVA 4DBNA 3CEKA 2JBOA 3NNWA 4O0XA 4XG6A 2OLCA 5E8WA 4FGBA 1QMZA 3C51A 4WUAA 1CKIA 1U5QA 2Z7SA 4YJUA 5FG8A 4O91A 4MWIA 5IU2A 2O2UA 3LCSA 3Q60A 2J0LA 2F2UA 3HV4A 2YM4A 1DAWA 2E9OA 3BQCA 5CY3A 4BI1A 4MEDA 4D0XA 1WBWA 5K9IA 4XRLA 4M0ZA 4AP7A 3A8XA 2AC3A 2BPMA 2P3GX 3HVCA 5L8KA 4B4LA 4CNHA 4F7LA 5IQGA 4ID7A 3FBVA 2WMVA 4ZAUA 1VZOA 3KB7A 4QMXA 3QGWA 4DEEA 4K0YA 3BBTB 4DEDA 4C4JA 3RMFA 2W1GA 4DGOA 3C4ZA 3OBGA 3LLTA 3RPYA 4QQ5A 2O8YA 3PY1A 4MQ1A 4R1VA 5DRBA 4ZJJA 2WMAA 5C1QB 3HV7A 3GUBA 4UX9A 3TNWA 2DS1A 4U80A 3CKXA 1OUYA 3F3VA 4EH9A 2X4ZA 3U4UA 2E2BA 3H9FA 3MWUA 4XEYA 4FC0A 5CAOA 2FSMX 3G0EA 3QRUA 2F49A 5ANGA 4HZRA 2W1EA 4YURA 3GGFA 3W32A 4F0IA 3UIBA 3PXQA 5HLNA 3UOLA 3FKLA 2X2KA 2OSCA 3SX9A 3VBVA 1JWHA 4L7FA 4OR5A 5CZIA 3TI1A 4K11A 4YNEA 5B2KA 4HPTE 1KE9A 5AP5A 3T9IA 2R7BA 3U9CA 1X8BA 4FODA 4KIQA 2H9VA 3TKIA 3C7QA 3OWLA 4IWPA 3TTIA 5IQFA 2HW6A 3PSBA 1SNXA 3G0FA 2XIKA 2CGUA 3KRRA 3PIZA 3H9OA 4ANMA 4D5HA 4O7ZA 1H1SA 3U6HA 4D2PA 2C1AA 4MBJA 4FTJA 4TYEA 3F5UA 4NM3A 4F9CA 5JZJA 2VX0A 3OP5A 5CAVA 2VNWA 3B2TA 4CMOA 3EOCA 4IAIA 3UO5A 5CXHA 2GMXA 5KMMA 4Q5HA 1ZMWA 2ZB0A 3VF8A 3I79A 2YWVA 5JZNA 4NT4A 5GZ8A 4OBOA 1H28A 4E5WA 2YFXA 1M7NA 4G5JA 4XV2A 4RPVA 2QU6A 1JKSA 4JDJA 4CFMA 4RLKA 4A9YA 3KVWA 4WKQA 4G6LA 5EYCA 4FTCA 4G34A 3V01A 2YJSA 4ASEA 3NW6A 4RIOA 4XP2A 4AGCA 5CU4A 3V5PA 5CI6A 4LM5A 4ZP5A 1QL6A 4ZSJA 1FGIA 2JKMA 2C6IA 4PPAA 4AWIA 4YTFA 5ITAA 4AZEA 2R3HA 4FE2A 3WIKA 3F5XA 4RJ4A 5IA4A 5JGBA 2OXXA 3VS2A 3VUTA 4KBCA 4HJOA 1BI8A 2W0JA 3QYWA 4RJ7A 1R39A 2R3OA 4OTFA 5HCYA 2IVSA 4E6DA 5CQUA 4LL0A 4PY1A 4NM5A 4DA5A 1T45A 1OM1A 2XNGA 3GU8A 2WAJA 3WF8A 5HU3A 5DR2A 1K9AA 3PPKA 2G9XA 2R3JA 4TNBA 2GS6A 4R3RA 4FT0A 2UW6A 2PYWA 5DHJA 4IVCA 4QP2A 2HWOA 3R02A 3ZLYA 4HGSA 3OCBA 3FHRA 2DWBA 4BTMA 2GU8A 2GHMA 2XK3A 3FQSA 4EOKA 4L67A 2OZAB 4WG3A 4YBJA 3LCDA 5M44A 1PYXA 3DOGA 3ELJA 4M66A 3LFNA 3BELA 3VIDA 4JX7A 2C6TA 3U51A 4IX4A 4HNFA 4IDTA 3QWJA 3CLYA 4JDKA 1W82A 3VVHA 5M4FA 3U6JA 3E3BX 4EQCA 5JGDA 1J7IA 5DBXA 4I94A 4GCJA 3ATTA 4IEBA 3VUKA 4PRJA 2HOGA 4E6AA 3S4QA 1YXXA 3E93A 4IFCA 1Q5KA 3NW5A 5ETCA 5JK3A 4R78A 1Q62A 1XBCA 5KMNA 4YZ9A 3RNIA 3M2WA 2R0IA 2C5YA 4NM0A 4RWKA 3TG1A 3VQUA 3HLLA 3LPBA 4BVUA 3KMWA 3S2PA 3MTLA 3PVGA 3C9WA 1YHSA 3PFQA 4G5PA 2WD1A 4MXXA 1QPCA 4XG2A 4Y83A 2XVDA 4KRDA 5BYLA 4HCTA 2O63A 2YIYA 4ASDA 4DAWA 2A1AB 4O82A 4J8NA 4DH1A 3LQ8A 3W10A 3HEGA 3LCOA 4FV4A 2I0YA 3Q4UA 5LMKA 4BY9E 3R9HA 4G3CA 1ZOGA 2PMNX 2W4JA 3R8UA 3TUCA 4FEUA 3RK9A 1OIYA 2PTKA 2YEXA 1OKWA 1OUKA 4XP0A 5HE3A 5EYDA 3EFJA 5D7VA 4KB8A 5EFQA 4EI4A 4IAYA 1OKZA 3DA6A 5GZ9A 3M11A 4BCFA 5GIOE 4GEOA 3ZHPC 5IA0A 3KGAA 1L3RE 3GCUA 3V8SA 3DJ7A 3KN6A 4UYAA 3W2QA 3KL8A 3Q3BA 4QD6A 5H9BA 2QOLA 2C4GA 3W18A 2C5NA 5BUEA 4MHAA 1ZXEA 2GHGA 3ZLXA 5C4KA 3FC1X 1R1WA 5TO8A 1XH4A 4C8BA 3V8TA 1SYKA 2O0UA 4IWDA 1PXIA 3PY0A 4E4MA 4IFGA 4FOBA 4MD9E 2Z60A 2G1TA 5A4TA 5C26A 2YN8A 5HNIX 5E8ZA 3KCFA 4DEGA 4JG8A 5I9YA 4J1RA 3QD2B 4AFEA 1KE6A 2AC5A 1YXVA 5BVFA 4IE9A 4IB1A 3I7CA 1PRYA 3A8WA 1W0XC 4YZNA 5TE0A 2XNPA 4QQCA 4YC6A 1IA8A 2XKFA 5AAFA 2GNJA 2C5OA 5E90A 1OITA 2PE0A 3C0GA 5AWMA 3UPZA 2PVYA 4YZMA 4ALWA 4D4VA 5F95A 4DINA 2XK9A 2F4JA 3T8OA 2CN8A 1Q24A 4M68A 2Y8OA 3II5A 2ONLA 4RJ8A 2PL0A 4XOYA 4BYJA 4DH7A 3R8LA 2FSLX 4NW5A 3FI2A 3HMPA 3UO6A 2BRHA 1TVOA 3WF7A 3BHHA 3ZC5A 3OOGA 4M14A 1FPUA 4DCEA 4I21A 4RJ5A 4E3CA 3KMMA 4ASZA 4FR4A 5DN3A 5CSHA 5HNGA 5KZ0A 3VS3A 4C3RA 4DFLA 3DU8A 3FKNA 4I6HA 5HTCA 4UMRA 3PUPA 3FXXA 3OMVA 4DH8A 2V62A 4FZDB 2B9IA 1MQBA 2ITNA 3PA5A 3O71A 2GDOA 2WMTA 4I4EA 2VN9A 4BHZA 3RWPA 3GCSA 5HQ0A 3RGFA 4I20A 1H26A 4O96A 4XCUA 5E92A 2WTKB 3GP0A 1WMKA 4NEUA 4YO6A 3KULA 3LJ1A 4LYNA 4UMTA 4LI5A 3PSDA 1YI6A 1WVXA 5T6KA 2GS7A 3UVQA 4N4SA 2R3QA 2W96B 4P5QA 4L3LA 5EQPA 4HYHA 3DDQA 4IX6A 1PXNA 1H1WA 2BZKB 2UUEA 3LCKA 4S30A 4WNPA 4Z16A 4CTCA 4FV2A 4QO9A 3ZCLA 1F0QA 3MH2A 3KRXA 3P79A 4I5CA 4J71A 2ITYA 5ANDA 5FEQA 3ZM4A 4KUJA 4X2KA 4BIEA 2CGXA 2W7XA 2X8EA 3EN7A 3MYGA 4ZY5A 3CTJA 3QCXA 2FB8A 2WMBA 4RWLA 3RK5A 3DPKA 3FC2A 2PUIA 4QMPA 2QG7A 3FZ1A 4D2VA 2Q0NA 2XP2A 3PXYA 3NGAA 1ZYSA 3PJ8A 4H58A 1ZMUA 4RWJA 3FI8A 2WNTA 3DZOA 2PZPA 5L3AA 1NVRA 4FI1A 2JGZA 3BX5A 1Y8YA 2VV9A 2XKCA 4U42A 4ZTHA 3UNZA 3VO3A 4ZEGA 3NAXA 1PKDA 4AOJA 1M52A 4Z7HA 5L4QA 3G9LX 5HCXA 5HX8A 1BL6A 4U81A 4JG7A 3VRYA 5CSXA 1SVEA 3C5UA 4EBWA 3OY3A 4E1ZA 4XBUA 4IVBA 3U54A 1G5SA 3MS9A 3UQGA 1IG1A 4XYFA 4AZVA 3GB2A 2W5HA 4CMTA 5TR6A 3EN5A 3NUUA 4ZTQA 3PZEA 2X7GA 3LJ0A 2ITOA 2WTKC 5ETFA 3MI9A 4CCUA 4FZ6A 2W05A 3GI3A 4M12A 5CVFA 4XHKB 3R73A 4D4YA 2ZOQA 3LJ2A 1FQ1B 1R3CA 3NW7A 2I40A 3PLSA 3MV5A 5AP3A 3CQWA 1ERKA 3FMLA 4ACGA 5IQBA 3BKBA 3GBZA 4WHZA 1J7UA 4UBAA 2Z7LA 2R3RA 3QQLA 4O0WA 4K8AA 4RIYB 4DGLC 3N4UA 4XG9A 4ALVA 1TQIA 1ZY5A 3WF5A 3CY2A 4O84A 3PG3A 3QYZA 4FT9A 4EYJA 2C3JA 4A4OA 3N4VA 3GVUA 3G6HA 3HAMA 4EWHA 4EOSA 3HECA 3GU7A 1OKVA 4MAOA 5GNKA 3I6WA 1A9UA 4PP9A 4BL1A 2CCHA 3DXPA 2VTIA 4BDCA 4EOOA 4FTRA 5I9ZA 5M51A 2WEIA 4O86A 1WBOA 4TYJA 4IAAA 4MNEA 3QGYA 5F94A 5FTGA 3F82A 4KAOA 4ARKA 2O3PA 2VX3A 3EB0A 4FIIA 4JX3A 4WSQA 4HVGA 2QOIA 3HNGA 5I5ZA 5I9XA 4Y85A 2YA9A 3KY2A 3MA6A 3PY3A 3SV0A 5IISA 3R7OA 2P2HA 3BV2A 2E9NA 2JC6A 3GCQA 3MFTA 4X3FB 1URWA 2CN5A 3VS4A 3MGYA 4D4RA 2QO2A 4UZHA 3U9NA 3SW4A 4CFNA 3C4XA 5FM3A 4EOJA 4BCNA 3WZDA 4LV5A 5IUGA 5AUUA 4FEXA 3NEWA 4GMYA 4DH3A 4C4FA 3QRKA 4O7RA 4CRSA 3VW6A 4ZJIA 1HCLA 3AC5A 3ORTA 4B6LA 4AACA 2DYLA 1OL2A 2X1NA 3AC2A 4M69B 3RP9A 4CKIA 3NUPA 5BUJA 4FG8A 5IEVA 5JEBA 4GYIA 4IZ5A 4RVMA 4GK2A 4TYGA 3ZZEA 2XK6A 4M3QA 5CZHA 2R3IA 4NWMA 3Q5ZA 4FTIA 3L8VA 4N6ZA 4QT1A 4NJ3A 4TPTA 2ZV7A 4M84A 4LRKA 4HYSA 2GFCA 4O0SA 3LFFA 3LFSA 2YIQA 3EYHA 4TT7A 2DUVA 2PVJA 4XP3A 2PVNA 5HVYA 4UWBA 5EYMA 3RZBA 4A06A 4OTPA 2PE2A 3SLSA 4EK4A 1OIRA 2A27A 3OVVA 4FNZA 2HXLA 3QZFA 4UEUA 3OHTA 5H8BA 5A46A 4O83A 4C37A 5CT0A 4KNBA 1YOJA 3A7JA 4UWYA 1OPLA 5DT3A 3TWJA 4LV8A 3HMOA 4IIRA 2VNYA 4O0UA 5DGZA 3SG9A 5EI2A 1YOMA 2W9FB 3R1SA 4IWOA 1UU9A 5IG1A 3VUMA 3Q9ZA 2WMWA 2EB3A 4PL3A 1UWJA 1WBNA 4D9UA 3LZBA 1CDKA 4YZDA 5HESA 3ZUTA 4S31A 3IOKA 2XA4A 2J7TA 3QTZA 2R5TA 5AV3A 4Z55A 4BDHA 4JDIA 5FBNC 3MSSA 4FOCA 5HVKA 2HY81 3KVXA 4X3FC 3OT3A 3O17A 5A6NA 3FMKA 1PXPA 4MXCA 4CKJA 4O0VA 3MJ1A 3MY1A 2UVYA 2Y4IB 3DLZA 5AIRA 3FMMA 4O2PA 5EW3A 4KSPA 3DKCA 3DXNA 4Y95A 2UZBA 4L8MA 4MF1A 4Q9SA 1Q4LA 1OVEA 2FSTX 2GSFA 2JD5A 2R3GA 3DK6A 3DJ5A 2XCKA 3O51A 4I93A 1CMKE 4KIKB 3EQFA 4V0GA 4DFXE 3IPHA 3GC9A 3L9MA 4UY9A 3ULIA 4HOKA 3V5JA 4D1XA 4EZ7A 1JQHA 2PK9A 3QQJA 4MCVA 5HG7A 1UV5A 3RI1A 3NYVA 4JI9A 2HZ4A 4EHEA 1OKYA 1P4OA 4D5KA 3ZFYA 4PWNA 5M08A 3AT4A 3HV3A 3MVMA 4EQMA 5IH5A 3I5NA 4QMOA 4WSYA 4FTNA 3FMDA 5AR8A 2NNWB 2J9MA 2XNMA 2KULA 5AM6A 3LM5A 4NTTA 3HDMA 3WIGA 3AC1A 3QUDA 1WVYA 3VQHA 4FG9A 5HHWA 3W1FA 4XV9A 2GNLA 4R3CA 3KXHA 3N51A 4FV7A 2ITQA 4TYHA 5CVHA 4FIGA 2B9JA 4BBMA 4U45A 4HW7A 5CF4A 4AZSA 1Q8WA 4FSNA 4HYUA 5L6WL 5IDNA 3A4OX 4V04A 2QOQA 4BDFA 2XK7A 5DH3A 3H4JA 4EKKA 3NYOA 1U4DA 4H3PA 4DEHA 2W1IA 4FKIA 3R83A 3R8MA 4L46A 5C01A 5EM8A 1ZAOA 3QHWA 2YJRA 4APCA 3T9TA 2C6EA 3K5UA 1PXOA 2ESMA 4WUNA 4DT8A 4ZTSA 4E4XA 4G3FA 3TN8A 1YXUA 4FV3A 2BUJA 4LUDA 4GG5A 3UIXA 5AUZA 5EOBA 5CU3A 4UV0A 2WEVA 4ALUA 2BTSA 4X6QC 1YRPA 2Y4IC 4K77A 3ZC6A 5EQEA 5D1JA 5ANKA 3LW0A 2ITVA 5DYJA 4MTAA 3IK3A 4YTIA 4NZWB 4QMWA 3FQEA 3KKVA 5J5SA 2FSOX 4JIKA 1OL5A 3PP0A 3QCQA 2H6DA 2RG5A 1NVQA 4B9DA 5IQEA 4U97A 4EH7A 3SW7A 4DG3E 4QP7A 2JIUA 5J87A 2VZ6A 3ZSIA 3NNVA 4BCIA 3PWDA 3FXWA 2I7QA 1YWVA 4Y5QA 5DG5A 3BWJA 3VW8A 1BUHA 3CPBA 4FT5A 4P2KA 4ASXA 3BWFA 3JVRA 4FBXA 2DQ7X 2V5QA 5LOHA 5IA2A 5JFXA 3AMBA 5E1SA 4JR7A 1KV1A 3UG1A 4DEIA 5J9ZA 5EW9A 4H05A 2QOFA 4IM2A 2UZVA 4YP8A 3ZU7A 1TQMA 1YWRA 2BHEA 3ANRA 4LL5A 4FVPA 2C5VA 2WTVA 4QP4A 5DEWA 3R04A 3A2CA 5B0XA 3PVUA 3NNXA 5KBQA 4PX6A 5M57A 4PMSA 2WMUA 1PHKA 2VGPA 4FG7A 4J7BA 3RM7A 2XF0A 3RPSA 3P4KA 2OJGA 4QMZA 1CKJA 3NX8A 3PIXA 4H1MA 5IF1A 1IA9A 3JPVA 2EXCX 4FKJA 4QTAA 4L44A 3ZLSA 1GIHA 2C5XA 2XZSA 3BGQA 3F66A 4F7SA 2XBJA 2NP8A 2RFDA 3LXNA 3MESA 4BDGA 5HZNA 3DFAA 5K3YA 4FUYA 3GC0A 1VYWA 3COIA 3HRCA 3UE4A 3TEIA 2QOOA 3G2FA 3A4PA 3EHAA 3UOKA 2OJ9A 1ATPE 4DN5A 3MN3A 4JBOA 4EHGA 4YMJA 3C5IA 1Y6BA 3ID6C 4N57A 5F9EA 3KK9A 3BYMA 3RHXA 2YM5A 4B0GA 3ZRLA 4XG3A 2ZJWA 4LMUA 2QODA 3F3WA 3MH0A 3W16A 4ZMFA 4GS6A 3A7IA 4JL9A 3FMNA 1YKRA 4QP3A 3ZS5A 3ZOSA 1PXMA 5AR5A 2FYSA 4KD1A 4LFIA 5ANEA 1UKIA 1V0BA 1CTPE 4DYMA 2ZMCA 3R9NA 5L2TA 1YXSA 3E88A 4L43A 3IW8A 2R3PA 3QD4A 3AG9A 3K3JA 5FDXA 4AE9A 5J1WA 3ZSHA 2C30A 3M1SA 4EWQA 2VD5A 1JSUA 3DB6A 3RALA 1M2PA 2V0DA 2WMQA 4V05A 3UG2A 1B39A 3HYHA 2HAKA 3CJFA 3F88A 4FTKA 4J98A 4PDPA 4QOXA 4QNYA 1OECA 4RVKA 2PZIA 5AUVA 2J0JA 4CFVA 3I0QA 4NYEA 4JVGA 2BKKA 1IRKA 4LOQA 1T46A 2ZDTA 1RQQA 2YLEA 4I4FA 1KV2A 4IZAA 4YC8A 3TKUA 3WZEA 3ZSGA 4F0FA 3H0ZA 3QTXA 3COHA 4W8EA 3E87A 3PPZA 4QNAA 5A3XA 3VBWA 5HU9A 3DTCA 3FUPA 5HOAA 2X4FA 4E5BA 5FEEA 1XWSA 2QNJA 2R3MA 4G17A 3GOPA 3QTQA 4I1ZA 5G1XA 5AUTA 2JKQA 3A61A 4E93A 3ZTXA 1Q61A 3U4WA 4UXQA 3OTVA 2Q0BA 5A14A 5AA8A 3SQQA 3RVGA 4E7WA 5I9UA 2BAJA 5L8JA 4F64A 3RINA 5DR9A 4BCHA 3VRZA 5B7VA 4F9AA 3DQXA 5FLFA 4RC2A 3ZRMA 3BHYA 3EN4A 3DT1A 2BDFA 2QI8A 3NUSA 4GUEA 3PTGA 3KFAA 5A4CA 2UZEA 2H34A 5AP2A 5CAUA 2V22A 4D0WA 2CMWA 3DXQA 2YDIA 4QPAA 4X2FA 3EL7A 2RKUA 3LLAA 3K2LA 3ENHA 1BLXA 5ETIA 4Q9ZA 2F57A 2PMLX 3A7HA 4KIPA 1PMNA 3TZ8A 3UIMA 5BMSA 4I23A 1Z9XA 3LOKA 4R7BA 1Q8ZA 1OB3A 2BFXA 3JY9A 2W5AA 3E92A 1KE8A 3UMXA 2NPQA 3N4TA 2UZNA 4LUEA 2GTMA 3KXMA 2C69A 1ZMVA 5CF5A 2VWIA 2XK4A 3QQKA 4ZS0A 4EYMA 3TDVA 3PRFA 1Q41A 4F99A 5BVNA 4FTTA 5H8EA 5HD7A 4AZFA 1MRYA 3LE6A 2QOKA 4OT6A 3LFBA 4IB5A 3R2BA 2IG7A 2Y4PA 2QOBA 4ZLYA 5A54A 2JAVA 2VTHA 4AG8A 4UMPA 5EW8A 2OGVA 5JRSA 3W2SA 4OT5A 3NCZA 5IUHA 5JFSA 4BCQA 2ETKA 1PMEA 3QX4A 3U6IA 4YR8A 2R3FA 4Y46A 1EH4A 4B8LA 3VHKA 3V51A 4BFMA 3Q9WA 1KOAA 3AMYA 3UO4A 4YJOA 3P7AA 2R9SA 4M67A 1RW8A 4X2GA 4YC3A 4BB4A 2CNQA 5GJFA 1G3NA 3OXIA 1OMWA 4WG4A 4Y72A 3OF0A 5IUIA 5HGIA 4JOAA 3QZHA 2X0GA 4WA9A 2J50A 2W1FA 3COMA 2X8IA 3RAWA 2YISA 3GXLA 4QP6A 4E6QA 1WVWA 3QUEA 1IAHA 4CFXA 2EVAA 4P5ZA 4R5YA 2C1BA 4QQTA 4H1JA 2GPHA 2VWBA 4IC8A 2C68A 4YLLA 4FSUA 4YTCA 2W4OA 5CU6A 5G6VA 5BUIA 3BYOA 4GK4A 2JDVA 2IWIA 4GFMA 5M09A 1KE7A 2OKRA 3P23A 4XG4A 3E8CA 4OUCA 2VWYA 3T3UA 1W83A 2BZIB 2C0TA 4QMMA 2W99B 4JBVA 5LMKC 3L8PA 3NYNA 3S0OA 4XG7A 4IJ9A 5DI1A 3Q53A 3DK7A 3DNEA 4UN0C 1PMUA 2OK1A 3EMGA 3FXZA 3CCNA 3M42A 3FLYA 2PVRA 4G3DA 3TACA 1B6CB 3H3CA 4LRMA 3ZDIA 3QD0A 4O7VA 3ORIA 4DGMA 4IWQA 3CTQA 1S9JA 2BZHB 3MDYA 4I6BA 5E1EA 4XX9A 3S3IA 2XRUA 4FV8A 1XBAA 2C6DA 5FP6A 4C57A 4E8AA 2YZAA 3JS2A 2QURA 3R28A 1G8SA 3A7FA 3GNIB 4FV6A 4F9WA 5FUTA 2CNVA 3QALE 2WTWA 5F20A 1P4FA 2Y7JA 3CQEA 3SRVA 3KULB 5GIPE 3OCSA 3UQCA 3C4CA 2IZTA 5CF6A 4A9RA 2PWLA 3A62A 2BTRA 4FYOA 2R0UA 4MYGA 3VHEA 3WZJA 4AN2A 3L9PA 3UPXA 5KMOA 3ZO1A 2UZTA 3SAYA 4A4LA 4NU1A 5DVRA 4CV9A 4LGDA 4EEVA 1RDQE 1LEZA 2CHLA 3UMWA 4BRXA 3FZOA 2XK8A 4A07A 4E5AX 3I6UA 1LP4A 4L3PA 4RSSA 5GJGA 2O5KA 1U5RA 3RPVA 1F5QA 1LUFA 3HGKA 1ZWSA 3D5UA 2ONLC 3NWWA 5FP5A 5EHLA 2CNUA 4EKLA 2J5EA 5TF9A 4EZ3A 3GT8A 3VBXA 4QTBA 4DHFA 1J91A 3D4QA 3BIZA 3FLZA 4GFOA 5HIDA 4RWIA 5DR6A 4AW1A 4BCMA 3LAUA 4CT1A 2UZWE 4RJ6A 5AX9A 4L53A 2VTPA 4LOOA 1JSTA 4ANOA 2UV2A 4D2RA 1U54A 4FEWA 5CEKA 4DC2A 1Y57A 2Z7QA 2GQRA 3IDPA 4JG6A 2OJIA 3BV3A 3QQGA 1UA2A 5AP4A 2OBJA 3HX4A 3E8NA 2VWVA 4EOIA 4CV8A 2B53A 1DI8A 4TNDA 4OTRA 2EB2A 5T68A 3UYTA 5IA3A 2CSNA 3KCKA 4AAAA 2OH0E 1U46A 3FJQE 5BVWA 4C2VA 2OFUA 4J97A 5FDPA 5IPJA 2OF4A 5K4JA 1M7QA 4QTDA 3EYGA 3MVLA 4FKGA 3LMIA 2IW8A 2XJ1A 3WOWA 1I44A 5EKNA 4R6VA 3FWQA 4ERWA 3D9VA 2PMIA 2UW4A 2YIRA 5IH6A 5LVNA 3MBLA 4RIXB 4FSQA 4L9IA 2XNEA 2OU7A 3FSKA 2WOTA 3EWHA 5C4LA 2Q83A 3CQUA 3DNDA 4YU2A 3BRBA 5KMKA 2XCHA 4GFGA 3MFSA 4UZDA 3QLGA 5BVEA 4X7QA 4OTDA 4AUAA 2YACA 4HGLA 4BCPA 4EC8A 1FGKA 1HCKA 2XM9A 3BHVA 2UW7A 4CG9A 1E1XA 1ZZ2A 2VWXA 4EK6A 3QTRA 4BZNA 3COKA 1OZ1A 3PZHA 4WNOA 4F09A 5FXSA 1ZYLA 1AD5A 2RGPA 2CLXA 1CM8A 5KZIA 3TZ7A 2ZM1A 4AX8A 2I0HA 5J95A 2B0QA 5AR7A 3BPRA 4AT3A 1BL7A 1XQZA 4DE4A 2HK5A 3NUAA 2X9FA 3DQWA 3FZTA 4D1SA 3EZVA 5L6PA 2A2AA 3IDCA 4K33A 5HICA 4MH7A 4LQMA 2G2FA 4NSTA 4S34A 2XBAA 3R71A 3ZEWA 1NW1A 2YERA 3ALNA 3UZRA 1ZARA 3BLRA 1JLUE 4IAZA 2RFEA 4Z9LA 5HE1A 2XYUA 2HXQA 1XH7A 2C6LA 3D83A 3DAJA 4O6LA 2V55A 3BE2A 3Q9XA 4BDKA 3BCEA 2JDOA 3DJ6A 4GJ2A 4XV1A 2ITPA 3C0HA 4QMYA 4FSZA 3GCVA 4I0RA 3QRJA 2HY0A 3ZBXA 4BTFA 2AYPA 3B2WA 4FEQA 1J7LA 5HLPA 3UYSA 3C0IA 5EM6A 3EQHA 4HVHA 2I0VA 4I22A 4CLIA 5IKWA 4I6FA 2P4IA 2UW3A 2X2MA 3P7CA 5EI8A 4D4SA 5KKRB 4WD5A 2IW6A 3R22A 4DG2E 3IW7A 3LMGA 2PHKA 4KIOA 4YPDA 2QD9A 3UBDA 5DA3A 4R1YA 2Y0AA 2WU7A 4AZWA 5LCJA 1Q8TA 2EWAA 3ODYX 3G15A 2WIPA 3OWKA 1KSWA 4CYJA 2UZDA 3AGMA 3VS1A 2OWBA 4AN9A 3B8QA 3KEXA 5DEYA 4DEAA 2VO7A 4MKCA 3FSFA 3E63A 3KRWA 5FWKK 1GZKA 2ZDUA 3QXOA 4K1BA 3UZTA 2QLUA 5KMJA 2QHNA 3CKWA 2E9VA 2PVKA 3IKAA 3PSCA 1UU3A 4K9YA 4PPCA 4MXAA 5JQ5A 5E9EA 3HA8A 4BN1A 4ANBA 3RKBA 3ATSA 2RSVA 3BEAA 2BHHA 2GNFA 5EQYA 1OPKA 3QRTA 3KN5A 4U7ZA 5ETAA 3FI4A 1JSVA 5FQDC 5ICPA 2VO0A 4FV5A 5FTOA 4I5MA 3ZMMA 4DLIA 4YO4A 5HX6A 4ERKA 3G5DA 4ZMEA 3OS3A 2G2IA 3O7LD 3QTUA 3I4BA 4MD7E 4W4YA 4V0GB 4ZIMA 3OROA 4C61A 5KMLA 2XRWA 4P4CA 1SZMA 4F70A 4FIHA 3HV5A 3I81A 4GU6A 4XNEA 5M55A 3PVBA 2R3NA 3HRBA 5L6OA 4RFZA 3FY2A 3AD4A 3D7TB 3E8DA 3HA6A 1ZYDA 3JY0A 1KE5A 4PF4A 4R3PA 2XH5A 1GIIA 3E3PA 4FGRA 2IZUA 1XBBA 5LARA 4FKWA 5K0KA 3S95A 4X2JA 5KKRC 2PY3A 3EQBA 4D2SA 2OH4A 2CLQA 4YJNA 3OCTA 1GJOA 4YHTA 5M07A 4G1WA 4KWPA 3U87A 5AV1A 4QPSA 4FSMA 4C02A 5AEPA 3OUNB 3OY1A 4FV0A 3EFWA 1ZY4A 4X6RA 2W4KA 3KRLA 5KUPA 1UNGA 3GU4A 4FTLA 4IDVA 2RG6A 5CSPA 4WBOA 1GAGA 1YHVA 4JJRA 2PMOX 4RRVA 3PDTA 1PF8A 5C9CA 3WF6A 2X39A 3ROYA 3OUKA 2Z02A 2KTYA 4FL2A 3E64A 3G33A 5BVOA 4WNKA 1V0PA 2J0MB 3VS5A 2HENA 3F7WA 4AA5A 4G31A 3Q4ZA 1FBNA 5HI2A 1OIUA 1XKKA 1W8CA 3QX2A 4RG0A 4AZTA 3OEZA 3BYUA 1YI4A 3AGLA 3C4EA 1QPEA 3W2RA 4IJPA 1H1PA 3FYJX 2VTQA 2PVFA 5L2QA 4RGJA 2PSQA 4ZS4A 2F7ZE 4U41A 2BRBA 4IQ6A 4U3YA 5CASA 3P86A 1Q8YA 3UQFA 5E91A 4NW6A 4RVTA 2HYYA 1M2QA 3ZFXA 4FTUA 3TNPC 3VUHA 3EZRA 3MFRA 5IEXA 5LVLA 1YVJA 3ETAA 3NNUA 5HVJA 3VJNA 4AGUA 2V7OA 4BTJA 3NIEA 3KXGA 5L2IA 4M0YA 2OIBA 3LXPA 2FVDA 4MK0A 5FM2A 2W1CA 3HDNA 2QC6A 5ACKA 3B8RA 4RX7A 4B99A 4LMNA 5M4UA 4DTAA 1CSNA 1XH9A 4BWXA 3ET7A 4HPUE 4FKRA 2QO7A 3F2NA 2JIIA 5HO6A 2I6LA 1S9IA 1DAYA 3KQ7A 3QHRA 2WB8A 2OG8A 2CCIA 2X2LA 3EFLA 4KSQA 4W4XA 1PMVA 5EDRA 2PULA 4FKTA 3DAEA 3R00A 4CZUA 4O7WA 2J51A 4Y5HA 2GFSA 3MH1A 4ZSAA 4OTHA 3ACKA 2CKPA 4RIWA 1IAJA 2GCDA 5C8MA 5M4IA 3L8XA 4I92A 1DI9A 4KKEA 5HO8A 4EUTA 3UVPA 3H0YA 2PVHA 4EONA 1MQ4A 4N6YA 1WZYA 2YLFA 3AXWA 3BGZA 3PA3A 2YABA 2XS0A 3GU5A 3O7LB 4PDSA 2IPXA 3LQ5A 3FEGA 2WGJA 4CVAA 2BIKB 2OJFE 3QL8A 4ANLA 5L2SA 3GFWA 4IVDA 3OT8A 4DGNA 4E4NA 4FTAA 4CG8A 2X9EA 4FT7A 3R7EA 3FY0A 4HYIA 1M14A 5IQCA 4DTKA 4XOZA 3TUBA 4RLLA 1QPDA 2FO0A 3A99A 4DEBA 2QVSE 4E4LA 4EBVA 3S00A 4ZZOA 3D5WA 5CVGA 3W33A 1J3HA 4USEA 3LQ3A 2UW0A 4CEGA 2C3LA 4ZSGA 5IQHA 4DH5A 3G9NA 3D0EA 3KXXA 4CZTA 4ENXA 1KOBA 3V04A 3WYYA 3TNIA 2GQGA 1P14A 4CQGA 4F9YA 3ZEPA 4O1OA 3LXLA 4P90A 4D2WA 4HVSA 3IW6A 3R63A 4NFNA 3GQIA 3FQHA 2OW3A 4FA2A 4MQ2A 3FMEA 3FMJA 3AT3A 3F69A 3OW3A 3UZPA 2JKKA 2R4BA 5DOSA 1BKXA 4JNWA 2UW8A 3F6XA 3MH3A 4FUXA 4XJ0A 3FAAA 4BIBA 3RBWA 4BCJA 5AAGA 1H1RA 4PNKA 4DCAA 5ANIA 4NH1A 5CXZA 2VTAA 2IVUA 4RIYA 4YBKA 2HW7A 3Q6WA 3ZXZA 4F08A 4BKJA 3NUXA 1PKGA 3LVPA 4FF8A 4JAJA 4IMYA 4CLJA 5KX8A 2VTRA 1GY3A 1KUTA 3QXPA 3ZLWA 5BQ0A 3UJGA 4QYHA 3EL8A 4HCVA 3ORMA 3F2AA 4GU9A 3VBTA 2E9PA 4CMUA 4ZTNA 2I0EA 2IJMA 3KRJA 3U8WA 4IHPA 4CD0A 1NY3A 2ZM4A 4QYGA 4OGRA 2J4ZA 4FNXA 3THBA 4PTGA 4XRJA 4FV9A 5H3QA 3UC4A 4D28A 1YQJA 2HZIA 2BVAA 4MWHA 2A4LA 3EIDA 4EH3A 3RCDA 5M4CA 3NLBA 4U3ZA 4AQCA 3OXZA 4ZJVA 4F1MA 4MNFA 4G3EA 2YWPA 4I0SA 4KKGA 1WAKA 4C7TA 4X3JA 5CAQA 3NS9A 2HIWA 3AMAA 3TKHA 2GQSA 2NRYA 2J5FA 2X6EA 3QCYA 1FVTA 3QUPA 3MIAA 3GFEA 3R01A 4TYIA 4TW9A 3L8SA 3O23A 5AV2A 2XIXA 3SD0A 1IR3A 2VTLA 2XMYA 4F7NA 3QA8A 5HG8A 5C27A 4GW8A 1FVRA 4BDIA 5EHOA 3FMHA 2C47A 5JSMA 4IB0A 3ZBFA 5H8GA 5CLPA 5CYIA 2OXYA 3WE8A 3W2PA 5IA1A 3AQVA 4GVJA 2VUWA 1W7HA 3DBEA 3UIUA 3MY0A 5CENA 5J7HA 4CFWA 2GTNA 2OIDA 1Z5MA 2O65A 4JRNA 4M7IA 4PL4A 3VS6A 4GKHA 5E4HA 2WTJA 4MD8E 4DFBA 2XYNA 3F3ZA 3QTWA 4C3FA 2B54A 2BALA 4QTEA 4YSJA 4GRBA 1JNKA 4IM0A 5HCZA 1VYZA 3BYVA 1O6YA 2E9UA 2JBPA 1M17A 3R8ZA 1R0EA 3TT0A 4O7YA 4LOPA 2J2IB 4OAUC 4JIAA 4GH2A 4EOLA 2WXVA 2JITA 2G15A 3NYXA 1P5EA 5J5TA 5FTQA 2Y6OA 3CY3A 4I5PA 3GC8A 4L00A 4TN6A 3F7ZA 2QQ7A 1PYEA 1ZYJA 4FX3A 3QZGA 4IX5A 2JDRA 4QMVA 3V5QA 1FOTA 4O0RA 4BF2A 1OBGA 4BCGA 4FTOA 3DKOA 5IMEA 1W98A 3CXWA 3LFCA 3FL4A 3PLAE 2QG5A 4NTSA 2XM8A 4FSRA 3NZ0A 4AGDA 4JXFA 4G16A 4K2RA 1PJKA 2WQOA 1Q3DA 3Q04A 4U6RA 4S33A 2BRNA 4F65A 4ACCA 3P78A 3VJOA 3NUYA 4FKSA 3RJCA 1OL7A 2IZSA 3EFKA 2F7EE 4PQNA 2VRXA 4R77A 3QQUA 5CNOA 1OI9A 1MUOA 1YDSE 3PXZA 3DAKA 5ANJA 2X7OA 1GNGA 3AC3A 4LGHA 4EOMA 4XS2A 4F1OA 5A4LA 4MXOA 3UP7A 4IAFA 4KIKA 5EDQA 4OBPA 3RK7A 4M13A 4A7CA 2C6KA 2YAKA 4O27B 4EQUA 2IW9A 5AA9A 3Q52A 4NM7A 4YNOA 3DGKA 1JAMA 4FKQA 4NCTA 2YM3A 3WYXA 5LVPA 5CALA 1GZNA 4IH8A 3RAIA 2QO9A 2WQNA 4X21A 4YLJA 3D14A 4ZK5A 5JN2A 5E8TA 3ACJA 1JKLA 2OF2A 3C13A 4QQJA 4FIFA 4C58A 1Q8UA 4EORA 3WARA 2YM7A 2FH9A 5BMMA 3HUCA 3BE9A 3W2OA 4IW0A 4WRSA 2FGIA 3F3UA 4BWPA 4PMMA 2ETMA 3ZUUA 1OPJA 4FKLA 3VN9A 4GVAA 5J9YA 3DBQA 3L9LA 3R7VA 3SA0A 1P2AA 5F1ZA 4CZYB 3O0GA 5AUWA 3LHJA 3NR9A 3LFQA 5DT0A 3D2KA 3DFCB 5CU2A 5KMIA 3KXNA 5KNJA 3DK3A 1PXLA 4BKZA 2ERZE 3O8UA 3F9NA 4U5JA 4U8ZA 2YCSA 3QA0A 3ORPA 3PRIA 4CT2A 4TKSA 3IGGA 3P9JA 4R7HA 4AT4A 1ZOEA 3TV4A 4EK3A 4BBFA 4OTQA 3E62A 2HELA 4G2FA 3A7GA 3CBLA 5I4NA 5KCVA 3LM0A 3FKOA 5AUYA 3TZMA 2X7FA 2JAMA 3T3VA 4O81A 3CC6A 2YIXA 5EM7A 5IQAA 4WO5A 3LFAA 5EDPA 3RWQA 4FEVA 2ITWA 3ORNA 4S2ZA 3K3IA 4U44A 5D7AA 1O9UA 5JH6A 3MVHA 3HP5A 2OFVA 2UZLA 2XIRA 4BZDA 3OZ6A 3NAYA 2XJ2A 2VWWA 3P1AA 2R2PA 4QYEA 1GZOA 2W17A 3E8EA 3K54A 2Z7RA 3MY5A 4C3PA 4PTCA 3V6RA 3G6GA 4C35A 2YDKA 4HGEA 1A48A 2PU8A 1U54B 1ZZLA 3CJGA 4U79A 3BU6A 3BU3A 3DY7A 3JVSA 4C38A 1YDTE 5AJQA 2JKOA 4C4IA 3CP9A 4QMUA 1UNLA 1V1KA 4ZY6A 4FK6A 3BGPA 2RIOA 3ZZWA 4CGAA 3P08A 4L45A 3Q6UA 4O0YA 4I5HA 3HAVA 1BMKA 3E7VA 1ZLTA 3ORLA 5EYKA 3TIYA 4PDYA 1Y6AA 2XUUA 4FVQA 4IAKA 4JQEA 5FXQA 2YIWA 5HO7A 2Y6MA 1REJA 4BWKA 2EXEA 3I5ZA 5AMNA 2NO3A 3MA3A 3UP2A 4J53A 3V5WA 4U43A 4A4XA 5I9VA 2BCJA 4YJSA 4I41A 3IO7A 5M53A 2WMSA 3IDBA 2XKEA 4FKVA 4DGGA 2PUNA 1UVRA 1WBSA 4L3JA 4BIDA 4H36A 5E7RA 4EK8A 1PW2A 3HKOA 4NIFA 3TZ9A 5FEDA 3EQCA 1H4LA 1FMKA 2PE1A 3BZ3A 3R30A 4GG7A 3OEFX 3R1NA 2C0OA 4ZXTA 5K5XA 4G3GA 1MRUA 5CT7A 4GV1A 4E6CA 4CCBA 4RZVA 4WT6A 4KBAA 2FUMA 5F4NA 1YDRE 4KABA 3SVVA 2WQBA 4FT3A 2ITTA 2W1DA 4HNIA 4UXLA 4XH6A 5FGKA 3R7IA 3LFEA 3RHKA 3ODZX 4ORKA 2F9GA 3DV3A 3WE4A 4USFA 2GNIA 2ERKA 2CKQA 5TKDA 2H8HA 3KF7A 4FSYA 4ANNA 3RPOA 3F61A 3QQHA 2CDZA 5CEIA 3FL5A 4FNYA 5IQIA 3BI6A 3FPQA 2WMRA 1UU8A 3VBQA 3ORXA 2QCSA 3DZQA 2WQMA 4O1PA 3Q4CA 4GT3A 4Z7GA 3TL8A 1ZOHA 2VTTA 4RX9A 3UVRA 2OI4X 5LQFA 3FZPA 1GOLA 2R3LA 2HCKA 1I09A 3FHIA 3SG8A 5HBJA 4GL9A 2B4SB 2B9HA 2NRUA 3OG7A 1SM2A 3BLHA 3EKKA 5CF8A 4EL9A 4W8DA 4NL0A 2YM6A 4E20A 4FSTA 4EH5A 4TWOA 2QONA 3HP2A 5AR4A 4BGQA 4ACDA 5EKOA 3ZO4A 2BMCA 2ZV2A 5M06A 4OTWA 2XIZA 3OTUA 4Q2AA 4X2NA 4PNIA 2UZUE 3I7BA 3LKMA 4QRCA 5GINE 3EQGA 4GSBA 1Y91A 3MFUA 1LEWA 4J99A 5HBHA 5BVDA 1IASA 4QMSA 3TM0A 2A19B 4C4GA 3CE3A 1R0PA 3ZYAA 3D2IA 1NVSA 2VU3A 3D5XA 4RQKA 4AE6A 4BZOA 3OOMA 4CKRA 4I3ZA 3NPCA 2YITA 4ZSLA 4GUBA 2QOHA 4RQVA 2PVMA 3SXFA 3TUDA 5GJDA 2PUPA 3F5PA 2W1HA 5L2WA 3VS0A 3DBCA 3OBJA 2YCFA 2BFYA 2FA2A 4NUSA 2J6MA 3DKFA 3R1QA 3PXRA 4M8TA 3DLSA 1WFCA 3UTOA
chains in the Genus database with same CATH superfamily
4MVFA 2QR8A 3R7GA 2REIA 5HIBA 3BU5A 3C4FA 2VAGA 4BBEA 2BRGA 4OAVB 1JKKA 1OGUA 4TRLA 4DFUA 2OO8X 5ACBC 3NIZA 2R7IA 4EOPA 4QMTA 3FLSA 4ITJA 3UGCA 3NMUF 2W1ZA 2WOUA 5AP1A 3VBYA 3FLNC 3PJCA 4ZOGA 3VF9A 3ERKA 1OL1A 2EXMA 3V8WA 4YLKA 4XG8A 3U55A 4YJRA 3L9NA 3SKCA 3PPJA 5CEPA 5DMZA 2ZFYA 3NFFB 3F5GA 2LGCA 3NCGA 4F7JA 4QMNA 3V3VA 5JFVA 1PY5A 1Q99A 4ANQA 2O64A 3AOXA 4JRVA 3LMHA 3KC3A 2UW9A 4PMPA 5EM5A 4GT4A 4LGGA 3R7UA 4OW8A 5BVKA 2YDJA 4F1TA 1WCCA 3PP1A 3CS9A 3DS6A 4G9CA 2OZOA 3EQIA 5HE2A 3QCSA 3FYKX 4PDOA 4AN3A 3KU2A 4NJDA 1J1CA 3MPTA 3Q9YA 3QC4A 3QKKA 4BICA 5BYYA 5LVMA 2VTSA 4RJ3A 5CSWA 1H07A 2VWZA 3PJ2A 1H01A 4QTCA 3ENMA 3RCJA 3OWPA 2VO3A 5AFVA 4MNEB 3ZUVA 5AUXA 5LXMA 3W0SA 3DBDA 2UVXA 4L42A 3D7ZA 4ZY4A 1O6LA 2C3IB 3O2MA 4DITA 3A60A 5DNRA 3OCGA 3SOAA 3R8VA 3ZH8A 4OLIA 4OTGA 5D41A 1XMLA 4YSMA 2PVLA 4FKOA 2CJMA 3TNQB 2PPQA 4H3BA 3C4WA 1YI3A 3R2YA 5J79A 3PG1A 3VC4A 1E9HA 2QLQA 3PVWA 3JXWA 3QZIA 4MBLA 5B2MA 2XIYA 3RTPA 5K0XA 4BCOA 5HTIA 4DLJA 5AP7A 5JFWA 3IGOA 3O8PA 4FL1A 4XV3A 2OXDA 5DWRA 4TXCA 3TCPA 2C6MA 2VO6A 3SDJA 3UC3A 5HE0A 3GENA 5ANOA 3PWYA 5HKMA 4DTBA 3VUIA 2BRMA 3E7OA 2IZRA 4Y73A 5IDPA 4IADA 3VAPA 3JR1A 4EUUA 2I1MA 4AS0A 3AD6A 4FTQA 3ZDUA 4F6SA 2HZNA 4JLCA 4W9WA 3JYAA 1HOWA 4QMQA 1J1BA 4F6UA 3EN6A 5AAEA 2OJJA 1K2PA 3C50A 4ANSA 3OC1A 4AOIA 3VNTA 2BIYA 2YZLA 4FVRA 1JOWB 5E8SA 2WZJA 2OZAA 5KO1A 3W8QA 5CSVA 4TTHB 1REKA 2X8DA 1OL6A 5JGAA 5EHYA 4ZLOA 1VJYA 5EG3A 5L8LA 4ENYA 2VTNA 4G6OA 5AP0A 2VTMA 1VEBA 4AW5A 4W4VA 2WFYA 3GEQA 5FRIA 5TOZA 5BX0A 4L7SA 4YGAA 3ZONA 4KA3A 3IECA 2WTIA 4BR3A 4XLIA 3D5VA 2JEDA 4FKUA 2BAKA 5E8XA 4PTEA 5DLSA 5I3OA 3ZXTA 4BHNA 4N70A 5HG9A 1M2RA 2CGWA 4M15A 4EH2A 1XJDA 1YHWA 2GHLA 4FICA 3TTJA 4BDEA 4E73A 4FMQA 3WILA 4K18A 3V5LA 4RIWB 4PPBA 4KS7A 4E26A 4J96A 4EHVA 5CEOA 5I9WA 5J7BA 1MP8A 1WBPA 3FPMA 2A0CX 2XEYA 1WBTA 1ZRZA 2G01A 2GS2A 2XJ0A 3PE2A 1OBDA 5LMBA 4JDHA 2AEGA 4FZ7A 5D10A 3MPAA 4I24A 3ORKA 5K5NA 1XH5A 3ML1A 4IANA 1GZ8A 3BEGA 4FZFB 2WTDA 3OD6X 5I3RA 5IEYA 4RVLA 3R7YA 2P55A 4C4EA 4O38A 2YCQA 4YPSA 2WQEA 5AP6A 4FL3A 3QC9A 4DFZE 3NUNA 3AC4A 5AV0A 5JMSA 5IMXA 4PP7A 4I6LA 4O4FA 4ACHA 4TY1A 3NDMA 4V01A 5CQWA 5CX9A 2XKDA 1JVPP 4AA0A 2B52A 3NVMB 4D9TA 5CANA 4FKPA 4C33A 5KBRA 2Y9QA 4HVIA 3QF9A 3QFVA 2ETRA 3MTFA 4EC9A 4RFYA 1URCA 5D12A 3MJ2A 4RBLA 4MXYA 5D9HA 5FBOA 4F6WA 4H3QA 4AFJA 3BHTA 2ACXA 2RF9A 3HRFA 3DDPA 2B9FA 4FIJA 4TYHB 2V7AA 2ZV8A 4BGGA 4U9AA 4KBKA 4QP9A 1SVGA 1H25A 2IN6A 3BBWA 4O0TA 3LIJA 1XO2B 5DFPA 4C2WA 1QCFA 2B55A 3KF4A 4OTIA 4C4HA 1L8TA 4IM3A 3POZA 5HTBA 3QLFA 5J1VA 1YWNA 4RIXA 5CI7A 1LR4A 1TQPA 1ND4A 3DKGA 3CGOA 4FNWA 4QYYA 5JRQA 1RJBA 4R7IA 4O21A 1LPUA 3NVKI 2ZYBA 3D15A 3H10A 5IA5A 3VUGA 3EKNA 2Z8CA 1DM2A 2XNBA 4UB7A 3IQ7A 4YJPA 2UZOA 1STCE 2WPAA 2LAVA 5AADA 3UNKA 1RE8A 1PXJA 4IX3A 4RC3A 3SGCA 4DT9A 2X81A 3ANQA 3HL7A 1CKPA 1V0OA 2PZ5A 3KK8A 3LCTA 3QAME 4Q5EA 3MB7A 3O50A 4EHZA 5JKGA 1UU7A 2RFNA 3CD8A 2H96A 5C8NA 1H08A 1GIJA 2WELA 5HBEA 3NFGB 3PE1A 4AXFA 3E5AA 2P0CA 3C1XA 5A4QA 3PXKA 3TV6A 3VUDA 3ZM9A 5J8IA 4D55A 2BDWA 3AC8A 4K6ZA 3UODA 3R8PA 4MUQA 1YW2A 3PYYA 3PXFA 3OXTA 4RA5A 4RT7A 5TT7A 3HMNA 4GK3A 3IG7A 3I60A 3CIKA 1H0VA 2XANA 4IACA 4IBMA 3FLWA 4JQ8A 4AOTA 2WMXA 5IQDA 2F2CB 3R9OA 4GIHA 3ZO3A 5E8YA 3DCVA 1OIQA 1MRVA 1Z57A 4BCKA 3EJ1A 3QKMA 5IZFA 2ZVAA 3PJ3A 1H0WA 4EZ5A 5KHXA 4DF3A 4AT5A 4JAIA 3ZFMA 1AGWA 2IVTA 4IZYA 4WRGA 3KA0A 4APPA 2BR1A 2ZAZA 5H2UA 3TXOA 4YZCA 4FK3A 4AGWA 1BX6A 4D58A 4JMQA 5IH4A 2P33A 3QTIA 3SXRA 4UALA 5DT4A 4FRFA 4NK9A 3CTHA 4CQEA 1ZYCA 3BYSA 1NA7A 4RC4A 4EK5A 4A9UA 3ULZA 3TJDA 3EQDA 3QQFA 5D11A 2HZ0A 3IW5A 4ZSEA 5E8VA 4BI2A 4ZTLA 3PA4A 2WIHA 5CEQA 5GZAA 2ZB1A 4LG4A 1JKTA 4JT3A 4UMQA 2AQXA 4TZRA 4Y8DA 3IS5A 4II5A 2XB7A 4A9SA 3Q5IA 3QU0A 1BI7A 3GOKA 2JLDA 3MVJA 4EJNA 3D94A 4FSWA 4IVAA 3ROCA 2QHMA 4L52A 5AX3A 4O7TA 4GKIA 4ZZMA 1QPJA 4L68A 1BYGA 3O96A 3RNYA 5BNJA 3H9RA 2CGVA 3SOCA 3WBLA 3Q2MA 4YJVA 4CRLA 5DRDA 3R6XA 4XUFA 2BAQA 4WIHA 5C8KA 4FTMA 3WZKA 3EN9A 5LCKA 4QP1A 4TL0A 4TWCA 4MF0A 4OBQA 4PMTA 4QMLA 5FD2A 3ORZA 4C0TA 2BZJA 3R9DA 4AW2A 5CEMA 5HORA 1Q3WA 2WU6A 4IC7A 4KINA 4F9BA 4GIIA 4YHFA 4BYIA 1XH6A 2BDJA 5HG5A 4J95A 3BHUA 4RA4A 2PZYA 1DS5A 1U59A 4NKAA 4F0GA 2VWUA 4ONAA 1H24A 4BJJB 2OIQA 4DBXA 4EJ7A 3MIYA 4C34A 4AU8A 3UNJA 4YJTA 3V6SA 3IONA 4G9RA 4ITIA 4PV0A 4AW0A 4ACMA 5AV4A 5A4EA 4YZBA 4C36A 3O8TA 3G51A 1PXKA 1SVHA 4USDA 3G90X 3AT2A 3OWJA 3P5KA 3LFDA 3QWKA 2WHBA 3BQRA 4AA4A 4U0IA 4ZZNA 3W2CA 1XH8A 4O22A 5JQ8A 2JIVA 2X6DA 2YHVA 3SXSA 5KHWA 4O7SA 2R64A 4P7EA 3FZRA 2CKOA 3D7TA 2XNOA 5AIKA 3IOPA 4FIEA 5HLWA 2QU5A 3Q96A 3F3TA 4DG0E 4EH4A 1XHAA 4UWCA 4ZTRA 3Q32A 3V5TA 4RX5A 1G8AA 3K5VA 4HCUA 4TWNA 3CGFA 3FZSA 1H27A 2X0OA 2YM8A 3FI3A 3RAHA 4DFYA 1H00A 5BPYA 4WBBB 3RM6A 4Z3VA 4NFMA 2ITXA 4BTKA 5AM7A 3ZRKA 4CSVA 5HD4A 4BI0A 4EOQA 4RFMA 2QOCA 2JDSA 3FLQA 4KS8A 4YHJA 2C6OA 3RPRA 2UVZA 2BROA 2JDTA 3VS7A 4GYGA 5HNBA 3ZO2A 4BGHA 3P7BA 4MBIA 4QDEA 3BL7A 2WKMA 2W5BA 2ZM3A 3R0TA 2G2HA 4R5SA 1TKIA 5CAPA 3SHEA 2R3KA 3DTWA 1H1QA 1NXKA 4J52A 4PUZA 4AXAA 4BC6A 4BKYA 4C62A 4X3FA 4WOVA 2VTJA 5AR3A 5I0BA 4IXPA 3JUHA 4U40A 1A06A 3UDBA 4S32A 3L1SA 2GNHA 3H30A 4L6QA 4BDDA 5K4IA 2YAAA 5LWNA 4LDTA 1XR1A 3HV6A 5EI6A 3FDNA 4WG5A 2P2IA 5LVOA 2ITUA 2VTOA 1E1VA 4D1ZA 3W8LA 3GU6A 5CU0A 1IEPA 2IO6A 4IZ7A 3PJ1A 2CPKE 2W9ZB 4KKHA 2RFSA 4M69A 4RMZA 2UW5A 4DFNA 3EH9A 3HUBA 5E8UA 4D2TA 4HVDA 5FXRA 3OW4A 4NCTC 4CFUA 3P0MA 4EH6A 2AUHA 3EQPA 2YCRA 1UWHA 1Q97A 4N0SA 3HMIA 3REPA 4WNMA 3F2RA 4HGTA 2SRCA 4LRJA 4BDBA 3TDWA 5CTPA 4W4WA 3WF9A 3TNHA 2B1PA 3CSVA 5HEZA 4F63A 1F3MC 3LXKA 3QBNA 4UYNA 5B2LA 4YTHA 4AXEA 3BL9A 3CPCA 1YOLA 3ITZA 3RAKA 1VR2A 3HMMA 4MXZA 1O6KA 3POOA 4BDAA 4AXCA 3IW4A 3KMUA 4XBRA 4YJQA 4CYIA 5LWMA 4JBQA 2XEZA 3ALOA 3N9XA 2ZMDA 4DHIB 3QRIA 2EU9A 3S1HA 2PUUA 4ZTMA 4O7LA 4L01A 4ITHA 4B7TA 3NSZA 3OFMA 3UOJA 4I0TA 5LMAA 4QPMA 3WZUA 4O7NA 2VGOA 4JR3A 4X0MA 4QP8A 3FV8A 3DB8A 4NIFB 2F7XE 5CWZA 3MW1A 4GJ3A 2BILB 3NRMA 4QYFA 2QR7A 3RZFA 2W06A 3QD3A 1SMHA 3I0OA 3R9RA 3HZTA 4XLVA 1SNUA 4HZSA 4PL5A 3AD5A 5DIAA 4F4PA 4CTBA 4RX8A 5EK7A 2QKRA 2Z2WA 5DE2A 3KXZA 5GHVA 5C03A 2JFLA 3PIYA 4BDJA 3BLQA 5JT2A 2J90A 3Q4TA 3MPMA 1KWPA 2ITZA 3R1YA 4MX9A 4W9XA 4AF3A 1APME 1H8FA 1AQ1A 2HWPA 5HIEA 5J9LA 3QKLA 4FZAB 2C0IA 4JQ7A 2X0PA 3Q2JA 1WBVA 4J8MA 2GNGA 3CR0A 3GCPA 3I1AA 2J0IA 3WI6A 4B8MA 2J0KA 5LJJA 3FE3A 4FV1A 4TWPA 3W55A 5CNNA 5BYZA 5EH0A 3TIZA 3UOHA 1B38A 1UNHA 2ZV9A 1R78A 1FVVA 4G6NA 1K3AA 4KRCA 5AR2A 4CXAA 4IB3A 4JS8A 5KE0A 4GT5A 5M56A 2PZRA 2OICA 4I6QA 3CD3A 2EUFB 4RZWA 4O2ZA 2CKEA 2WTCA 5T3QA 2IVVA 4EH8A 1YXTA 3DBFA 4M97A 3SC1A 2QKWB 1JBPE 4O6EA 4CFFA 3EQRA 2RL5A 5EOLA 1FINA 4JBPA 4YUQA 3SRVB 5A6OA 3QTSA 3TV7A 1Y8GA 1NT2A 2C3KA 4C59A 5A9UA 1JPAA 3MB6A 3VULA 1W84A 2BKZA 2JFMA 3GC7A 2WO6A 4FYNA 4XMOA 4A9TA 3KREA 3VWAA 2XNNA 2VX1A 4H39A 4UMUA 4NKSA 3TJCA 1UKHA 4ZLZA 5CS6A 1FMOE 3R21A 4R8QA 3GQLA 2B7AA 5DPVA 4DBNA 3CEKA 2JBOA 3NNWA 4O0XA 4XG6A 2OLCA 5E8WA 4FGBA 1QMZA 3C51A 4WUAA 1CKIA 1U5QA 2Z7SA 4YJUA 5FG8A 4O91A 4MWIA 5IU2A 2O2UA 3LCSA 3Q60A 2J0LA 2F2UA 3HV4A 2YM4A 1DAWA 2E9OA 3BQCA 5CY3A 4BI1A 4MEDA 4D0XA 1WBWA 5K9IA 4XRLA 4M0ZA 4AP7A 3A8XA 2AC3A 2BPMA 2P3GX 3HVCA 5L8KA 4B4LA 4CNHA 4F7LA 5IQGA 4ID7A 3FBVA 2WMVA 4ZAUA 1VZOA 3KB7A 4QMXA 3QGWA 4DEEA 4K0YA 3BBTB 4DEDA 4C4JA 3RMFA 2W1GA 4DGOA 3C4ZA 3OBGA 3LLTA 3RPYA 4QQ5A 2O8YA 3PY1A 4MQ1A 4R1VA 5DRBA 4AXDA 4ZJJA 2WMAA 5C1QB 3HV7A 3GUBA 4UX9A 3TNWA 2DS1A 4U80A 3CKXA 1OUYA 3F3VA 4EH9A 2X4ZA 3U4UA 2E2BA 3H9FA 3MWUA 4XEYA 4FC0A 5CAOA 2FSMX 3G0EA 3QRUA 2F49A 5ANGA 4HZRA 2W1EA 4YURA 3GGFA 3W32A 4F0IA 3UIBA 3PXQA 5HLNA 3UOLA 3FKLA 2X2KA 2OSCA 3SX9A 3VBVA 1JWHA 4L7FA 4OR5A 5CZIA 3TI1A 4K11A 4O4CA 4YNEA 5B2KA 4HPTE 1KE9A 5AP5A 3T9IA 2R7BA 3U9CA 4AQKA 1X8BA 4FODA 4KIQA 2H9VA 3TKIA 3C7QA 3OWLA 4IWPA 4O4BB 3TTIA 5IQFA 2HW6A 3PSBA 1SNXA 3G0FA 2XIKA 2CGUA 3KRRA 3PIZA 3H9OA 4ANMA 4D5HA 4O7ZA 1H1SA 3U6HA 4D2PA 2C1AA 4MBJA 4FTJA 4TYEA 3F5UA 4NM3A 4F9CA 5JZJA 2VX0A 3OP5A 5CAVA 2VNWA 3B2TA 4CMOA 3EOCA 4IAIA 3UO5A 5CXHA 2GMXA 5KMMA 4Q5HA 1ZMWA 2ZB0A 3VF8A 3I79A 2YWVA 5JZNA 4NT4A 5GZ8A 4OBOA 1H28A 4E5WA 2YFXA 1M7NA 4G5JA 4XV2A 4RPVA 2QU6A 1JKSA 4JDJA 4CFMA 4RLKA 4A9YA 3KVWA 4WKQA 4G6LA 5EYCA 4FTCA 4G34A 3V01A 2YJSA 4ASEA 3NW6A 4RIOA 4XP2A 4AGCA 5CU4A 3V5PA 5CI6A 4LM5A 4ZP5A 1QL6A 4ZSJA 1FGIA 2JKMA 2C6IA 4PPAA 4AWIA 4YTFA 2X0QA 4AZEA 2R3HA 5ITAA 4FE2A 3WIKA 3F5XA 4RJ4A 5IA4A 5JGBA 2OXXA 3VS2A 3VUTA 4KBCA 4HJOA 1BI8A 2W0JA 3QYWA 4RJ7A 1R39A 2R3OA 4OTFA 5HCYA 2IVSA 4E6DA 5CQUA 4LL0A 4PY1A 4NM5A 4DA5A 1T45A 1OM1A 2XNGA 3GU8A 2WAJA 3WF8A 5HU3A 5DR2A 1K9AA 3PPKA 2G9XA 2R3JA 4TNBA 2GS6A 4R3RA 4FT0A 2UW6A 2PYWA 5DHJA 4IVCA 4QP2A 2HWOA 3R02A 3ZLYA 4HGSA 3OCBA 3FHRA 2DWBA 4BTMA 2GU8A 2GHMA 2XK3A 3FQSA 4EOKA 4L67A 2OZAB 4WG3A 4YBJA 3LCDA 5M44A 1PYXA 3DOGA 3ELJA 4M66A 3LFNA 3BELA 3VIDA 4JX7A 2C6TA 3U51A 4IX4A 4HNFA 4IDTA 3QWJA 3CLYA 4JDKA 1W82A 3VVHA 5M4FA 3U6JA 3E3BX 4EQCA 5JGDA 1J7IA 3BLAA 5DBXA 4I94A 4GCJA 3ATTA 4IEBA 3VUKA 4PRJA 2HOGA 4E6AA 3S4QA 1YXXA 3E93A 4IFCA 1Q5KA 3NW5A 5ETCA 5JK3A 4R78A 1Q62A 3W0NA 1XBCA 4LV7A 5KMNA 4YZ9A 3RNIA 3M2WA 2R0IA 2C5YA 4NM0A 4RWKA 3TG1A 3VQUA 3HLLA 3LPBA 4BVUA 3KMWA 3S2PA 3MTLA 3PVGA 3C9WA 1YHSA 3PFQA 4G5PA 2WD1A 4MXXA 1QPCA 4XG2A 4Y83A 2XVDA 4KRDA 5BYLA 4HCTA 2O63A 2YIYA 4ASDA 4DAWA 2A1AB 4O82A 4J8NA 4DH1A 3LQ8A 3W10A 3HEGA 3LCOA 4FV4A 2I0YA 3Q4UA 5LMKA 4BY9E 3R9HA 4G3CA 1ZOGA 2PMNX 2W4JA 3R8UA 3TUCA 4FEUA 3RK9A 1OIYA 4DHZA 2PTKA 2YEXA 1OKWA 1OUKA 4XP0A 5HE3A 5EYDA 3O5AA 3EFJA 5D7VA 4KB8A 5EFQA 4EI4A 4IAYA 1OKZA 3DA6A 5GZ9A 3M11A 4BCFA 5GIOE 4GEOA 3ZHPC 5IA0A 1TZDA 3KGAA 1L3RE 3GCUA 3V8SA 3DJ7A 3KN6A 4UYAA 3W2QA 3KL8A 3Q3BA 4QD6A 5H9BA 2QOLA 2C4GA 3W18A 2C5NA 5BUEA 1W2FA 4MHAA 1ZXEA 2GHGA 3ZLXA 5C4KA 3FC1X 1R1WA 5TO8A 1XH4A 4C8BA 4QDVA 3V8TA 1SYKA 2O0UA 4IWDA 1PXIA 3PY0A 4E4MA 4IFGA 4FOBA 4MD9E 2Z60A 2G1TA 5A4TA 5C26A 2YN8A 5HNIX 5E8ZA 3KCFA 4DEGA 4JG8A 5I9YA 4J1RA 3QD2B 4AFEA 1KE6A 2AC5A 1YXVA 5BVFA 4IE9A 4IB1A 3I7CA 1PRYA 3A8WA 1W0XC 4YZNA 5TE0A 2XNPA 4QQCA 4YC6A 1IA8A 2XKFA 5AAFA 2GNJA 2C5OA 3UDSA 5E90A 1OITA 2PE0A 3C0GA 5AWMA 3UPZA 2PVYA 4YZMA 4ALWA 4D4VA 5F95A 4DINA 2XK9A 2F4JA 3T8OA 2CN8A 1Q24A 4M68A 2Y8OA 3II5A 2ONLA 4RJ8A 2PL0A 4XOYA 4BYJA 4DH7A 3R8LA 2FSLX 4NW5A 3FI2A 3HMPA 3UO6A 2BRHA 1TVOA 3WF7A 3BHHA 3ZC5A 3OOGA 4M14A 1FPUA 4DCEA 4I21A 4RJ5A 4E3CA 3KMMA 4ASZA 4FR4A 5DN3A 5CSHA 5HNGA 5KZ0A 3VS3A 4C3RA 4DFLA 3DU8A 1G8JA 3FKNA 4I6HA 5HTCA 4UMRA 3PUPA 3FXXA 3OMVA 4DH8A 2V62A 4FZDB 2B9IA 1MQBA 2ITNA 3PA5A 3O71A 2GDOA 2WMTA 4I4EA 2VN9A 4BHZA 3RWPA 3GCSA 5HQ0A 3RGFA 4I20A 1H26A 4O96A 4XCUA 5E92A 2WTKB 3GP0A 1WMKA 4NEUA 4YO6A 3KULA 3LJ1A 4LYNA 4UMTA 4LI5A 3PSDA 1YI6A 1WVXA 5T6KA 2GS7A 2IEWA 3UVQA 4N4SA 2R3QA 2W96B 4P5QA 3KIOC 4L3LA 5EQPA 4HYHA 3DDQA 4IX6A 1PXNA 1H1WA 2BZKB 2UUEA 3LCKA 4S30A 4WNPA 4Z16A 4CTCA 4FV2A 4QO9A 3ZCLA 1F0QA 3MH2A 3KRXA 3P79A 4I5CA 4J71A 2ITYA 5ANDA 5FEQA 3ZM4A 4KUJA 4X2KA 4BIEA 2CGXA 2W7XA 2X8EA 3EN7A 3MYGA 3UDTA 4ZY5A 3CTJA 3QCXA 4DHJA 2FB8A 2WMBA 4RWLA 3RK5A 3DPKA 3FC2A 2PUIA 4QMPA 2QG7A 3FZ1A 4D2VA 2Q0NA 2XP2A 3PXYA 3NGAA 1ZYSA 3PJ8A 4H58A 1ZMUA 4RWJA 3FI8A 2WNTA 3DZOA 2PZPA 5L3AA 1NVRA 4FI1A 2JGZA 3BX5A 1Y8YA 2VV9A 2XKCA 4U42A 4ZTHA 3UNZA 3VO3A 4ZEGA 3NAXA 1PKDA 4AOJA 1M52A 4Z7HA 5L4QA 3G9LX 5HCXA 5HX8A 1BL6A 4U81A 4JG7A 3VRYA 5CSXA 1SVEA 3C5UA 4EBWA 3OY3A 4E1ZA 4XBUA 4IVBA 3U54A 1G5SA 3MS9A 3UQGA 1IG1A 4XYFA 4AZVA 3GB2A 2W5HA 4CMTA 5TR6A 3EN5A 3NUUA 4ZTQA 3PZEA 2X7GA 3LJ0A 2ITOA 1OGYA 2WTKC 5ETFA 3MI9A 4CCUA 4FZ6A 2W05A 3GI3A 4M12A 5CVFA 4XHKB 3R73A 4D4YA 2ZOQA 3LJ2A 1FQ1B 1R3CA 3NW7A 2I40A 3PLSA 3MV5A 5AP3A 3CQWA 1ERKA 3FMLA 4ACGA 5IQBA 3BKBA 3GBZA 4WHZA 1J7UA 4AAYA 4UBAA 2Z7LA 2R3RA 3QQLA 4O0WA 4K8AA 4RIYB 4DGLC 3N4UA 4XG9A 4ALVA 1TQIA 1ZY5A 3WF5A 3CY2A 4O84A 3PG3A 3QYZA 4FT9A 4EYJA 2C3JA 4A4OA 3N4VA 3GVUA 3G6HA 3HAMA 4EWHA 4EOSA 3HECA 3GU7A 1OKVA 4MAOA 5GNKA 3I6WA 1A9UA 4PP9A 4BL1A 2CCHA 3DXPA 2VTIA 4BDCA 4EOOA 4FTRA 5I9ZA 5M51A 2WEIA 4O86A 1WBOA 4TYJA 3VONA 4IAAA 4MNEA 3QGYA 5F94A 5FTGA 3F82A 4KAOA 4ARKA 2O3PA 2VX3A 3EB0A 4FIIA 4JX3A 4WSQA 4HVGA 2QOIA 3HNGA 5I5ZA 5I9XA 1XMMA 4Y85A 2YA9A 3KY2A 3MA6A 3PY3A 3SV0A 5IISA 3R7OA 2P2HA 3BV2A 2E9NA 2JC6A 3GCQA 3MFTA 4X3FB 1URWA 2CN5A 3VS4A 3MGYA 4D4RA 2QO2A 4UZHA 3U9NA 3SW4A 4CFNA 3C4XA 5FM3A 4EOJA 4BCNA 3WZDA 4LV5A 5IUGA 5AUUA 4FEXA 3NEWA 4GMYA 4DH3A 4C4FA 3QRKA 4O7RA 4CRSA 3VW6A 4ZJIA 1HCLA 3AC5A 3ORTA 4B6LA 4AACA 2DYLA 1OL2A 2X1NA 3AC2A 4M69B 3RP9A 4CKIA 3NUPA 5BUJA 4FG8A 5IEVA 5JEBA 4GYIA 4IZ5A 4RVMA 4GK2A 4TYGA 3ZZEA 2XK6A 4M3QA 5CZHA 2R3IA 4NWMA 3Q5ZA 4FTIA 3L8VA 4N6ZA 4QT1A 4NJ3A 4TPTA 2ZV7A 4M84A 4LRKA 4HYSA 2GFCA 4O0SA 3LFFA 3LFSA 2YIQA 3EYHA 4TT7A 2DUVA 2PVJA 4XP3A 2PVNA 5HVYA 4UWBA 5EYMA 3RZBA 4A06A 4OTPA 2XAOA 2PE2A 3SLSA 4EK4A 1OIRA 2A27A 3OVVA 4FNZA 2HXLA 3QZFA 4UEUA 3OHTA 5H8BA 5A46A 4O83A 4C37A 5CT0A 3W0PA 4KNBA 3A7JA 1YOJA 4UWYA 1OPLA 5DT3A 3TWJA 4LV8A 3HMOA 4IIRA 2VNYA 4O0UA 5DGZA 3SG9A 2XARA 5EI2A 1YOMA 2W9FB 3R1SA 4IWOA 1UU9A 5IG1A 3VUMA 3Q9ZA 2WMWA 2EB3A 4PL3A 1UWJA 1WBNA 4D9UA 3LZBA 1CDKA 4YZDA 5HESA 3ZUTA 4S31A 3IOKA 2XA4A 2J7TA 3QTZA 2R5TA 5AV3A 4Z55A 4BDHA 4JDIA 5FBNC 3MSSA 4FOCA 5HVKA 2HY81 3KVXA 4X3FC 3OT3A 3O17A 5A6NA 3FMKA 1PXPA 4MXCA 4CKJA 4O0VA 3MJ1A 3MY1A 2UVYA 2Y4IB 3DLZA 5AIRA 3FMMA 4O2PA 5EW3A 4KSPA 3DKCA 3DXNA 4Y95A 2UZBA 4L8MA 4MF1A 4Q9SA 1Q4LA 1OVEA 2FSTX 2GSFA 2JD5A 2R3GA 3DK6A 3DJ5A 2XCKA 3O51A 4I93A 1CMKE 4FJVA 4KIKB 3EQFA 4V0GA 4DFXE 3IPHA 3GC9A 3L9MA 4UY9A 3ULIA 4HOKA 3V5JA 4D1XA 4EZ7A 1JQHA 2PK9A 3QQJA 4MCVA 5HG7A 1UV5A 3RI1A 3NYVA 4JI9A 2HZ4A 4EHEA 1OKYA 1P4OA 4D5KA 3ZFYA 4PWNA 5M08A 3AT4A 3HV3A 3MVMA 4EQMA 5IH5A 4F78A 3I5NA