4TT7A

Crystal structure of human alk with a covalent modification
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
307
structure length
291
Chain Sequence
MNYCFAGKTSSISDLKEVPRKNITLIRGLGGEVYEGQVSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK tyrosine kinase receptor
publication title Novel covalent modification of human anaplastic lymphoma kinase (ALK) and potentiation of crizotinib-mediated inhibition of ALK activity by BNP7787.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 291
sequence length 307
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4tt7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4tt7A01
3NNWA 3QZFA 5DGZA 4F08A 5DFPA 1OL7A 1UU7A 5HI2A 4IAZA 4UXLA 4WD5A 4FX3A 2DUVA 4FKIA 4XHKB 3QQGA 4BBEA 2JFMA 4RFYA 2BTSA 5J7HA 4QNYA 2PYWA 4FNYA 1YQJA 3MYGA 4HGTA 3G90X 5CI6A 4OTQA 4NM5A 4QMNA 2GCDA 2YITA 4YU2A 1QPJA 3NEWA 3PG3A 4DA5A 1YOLA 4N4SA 3ZLSA 4IC7A 2YDIA 2HZ4A 3F3TA 3FHRA 5HESA 1ZXEA 2OJ9A 4QP6A 4I92A 3GCUA 3OUKA 3EFKA 5E1SA 3QUEA 4PNKA 5BYZA 4LUEA 5AR5A 2SRCA 4DHFA 4DBXA 5E8WA 1I44A 5T6KA 3EN4A 4Q2AA 2JBOA 4FL1A 2VTSA 5JEBA 3LCKA 4WG3A 3ORZA 3IDPA 2QOCA 3IDCA 3FMNA 1KE5A 3PPZA 1PMNA 3B8RA 4E4LA 3NW6A 5J1WA 4R7BA 3BQCA 5E4HA 3LHJA 2UZUE 3DDPA 2PVLA 3E8DA 1OUKA 1YHSA 3C7QA 4V0GB 5EOBA 4O0WA 1Q8YA 4XH6A 5LVOA 3BKBA 3N4TA 3FBVA 4G9RA 3UIMA 4O83A 4FSWA 4H05A 2R3FA 3FLZA 2QOQA 3CTHA 2R3QA 4LM5A 5CEQA 1OB3A 5HLWA 4HYUA 5AV2A 3UOKA 2PMOX 4C59A 4A4OA 3R9RA 4NFNA 5AUUA 3RK9A 4FKJA 1P14A 1Y57A 3OHTA 1MUOA 3BZ3A 3R8LA 3ZFMA 3AGMA 3F2NA 2H9VA 3AC1A 3ERKA 5JSMA 4DCAA 3BU6A 4FG7A 4NM3A 1KUTA 3CQEA 2YJSA 4ONAA 1BUHA 4DAWA 3RPVA 5HE2A 4JX7A 3M11A 4I6QA 4WKQA 1H28A 3Q4CA 4EK3A 3NUPA 2ETKA 2R3KA 4L46A 3WF7A 4PDYA 3W8QA 3R28A 2PMLX 2I6LA 3EKNA 4ASZA 4K1BA 3QXPA 4D58A 2XB7A 3I0OA 4I5MA 4FG8A 5AP3A 2UZBA 4X2KA 4IQ6A 1XBAA 2EXCX 1K9AA 4KSPA 2P33A 4YSJA 3B2WA 4DH7A 1J91A 1WBVA 3ORPA 4RQKA 5IQIA 2BKZA 3HUBA 5EYKA 4WO5A 2GS7A 4O2PA 3QX2A 1M2QA 3LQ3A 3KN5A 4QQJA 4EOLA 3O8TA 4C3PA 4W4WA 3PIZA 2UW8A 4FSRA 2X6DA 3E64A 3FZOA 1JKTA 5FGKA 3W16A 3KN6A 4YGAA 4MXAA 3VS6A 4YJPA 2BDWA 2UVXA 2QR8A 2QD9A 3O2MA 3L9LA 4AXAA 4YBJA 4I20A 4F09A 3FLSA 3UTOA 5J9YA 3WYXA 3V8WA 1ZOGA 3EQRA 4G17A 4KBCA 2IJMA 4GVAA 4CQEA 5J1VA 1ATPE 4EKLA 3ZLYA 5BVFA 3KF4A 1OM1A 3CJFA 5T3QA 4DEDA 5JZNA 3ORLA 3VBVA 1Q5KA 5E9EA 2ERKA 2J4ZA 3CGFA 3DQWA 3JR1A 4QT1A 4UWCA 4PY1A 4X7QA 2XRUA 3JUHA 2X8EA 2BHEA 2YDJA 3I7CA 4IIRA 1F5QA 3G15A 5EI6A 4QYGA 2C6KA 3KXZA 2BIYA 4DFNA 4QTEA 2VO3A 3UBDA 2OIDA 4TWCA 4FT3A 4C33A 4XNEA 1APME 3FQSA 2PE0A 1RE8A 2HZNA 4MXOA 5IMXA 3DZOA 2VZ6A 2W0JA 4TYHA 3LQ8A 4O1OA 3R9NA 3FXXA 4ZZNA 1Q99A 2QO7A 4I24A 5FXQA 4FZ7A 2BKKA 4EBVA 5HGIA 2ZB1A 5BNJA 4FA2A 3QAME 2VWXA 1JNKA 2XMYA 1O6YA 2B55A 3UO6A 3QZGA 4D0WA 2ZDUA 2OJIA 4AGWA 2Z8CA 4JJRA 1M7QA 2IZTA 3KMMA 3CC6A 3C4ZA 3GFEA 2ZV7A 4KIKB 3R7VA 4ZLOA 1YVJA 1OKYA 1STCE 3BHUA 4EL9A 5GHVA 5KX8A 5LQFA 1URWA 3ACJA 3LCSA 5HKMA 4IEBA 3TG1A 4RC4A 4CT1A 2CMWA 1OECA 4E73A 3R7YA 3R2YA 5K5NA 4RZWA 3LLAA 1FMKA 3ZO2A 3ZSIA 4RT7A 3KC3A 3BGZA 1R39A 4A7CA 3HVCA 3QFVA 4C0TA 3FL5A 5B2KA 4EZ5A 2IPXA 4OBOA 5EDRA 4L6QA 2P2HA 4XG6A 5JGAA 4Y83A 4V05A 4EH7A 5M51A 3F7WA 4DH8A 4I23A 3D94A 4MWIA 4ZTRA 4EK6A 5EYCA 4UMUA 2JBPA 4FZDB 4QMQA 4O1PA 3UPXA 2BFYA 2ESMA 4L3PA 3ZONA 5CEOA 2O64A 2Y0AA 3LCOA 4TYEA 5FWKK 3WIGA 4USEA 2C5OA 1JSUA 2YIYA 1IEPA 1P4FA 1ZMUA 4E4NA 4O86A 1KE9A 3QHWA 5HBHA 2VTHA 4ANOA 5K0KA 1JVPP 5K5XA 5L2SA 3UNJA 1ZZ2A 3MJ1A 3OCBA 5F20A 3KY2A 3V8TA 4Z16A 4J96A 2G01A 1RW8A 3R8UA 4J8MA 4HPTE 1NVQA 3FPMA 4NM7A 3UIXA 1ZZLA 3COKA 2G2HA 2QOFA 3BYSA 2QURA 4J52A 3AT2A 1JAMA 4K9YA 3ZO1A 1FGIA 4RWKA 3K3JA 4YP8A 5BVKA 3Q2JA 3R6XA 2QODA 4RIWB 4F7NA 4FODA 2X8IA 1XH9A 3LM5A 4TNBA 4XEYA 3ZMMA 4HVSA 2PZ5A 3F3ZA 3ROCA 2W9ZB 4LYNA 4TRLA 3HLLA 3S3IA 4EH5A 3Q9WA 4FVQA 4UZHA 1Q8ZA 2C6IA 3OUNB 4IVBA 4M13A 4RZVA 3UYTA 3VUKA 4YJSA 3RWQA 3OBJA 1J7UA 4JG8A 4FI1A 4UWYA 2J5FA 1PXKA 3PPJA 3QC9A 4EK5A 4M8TA 4Z7HA 1OMWA 3OROA 4A4LA 3R7OA 4MHAA 4AZFA 4FUXA 3SVVA 2BRGA 3CY2A 3PTGA 3V51A 4AA5A 3FZPA 5BUJA 3HAMA 4BVUA 1OKWA 2C0TA 3DQXA 1VYZA 2XS0A 3V01A 3ATSA 3QRUA 4YJVA 4JRNA 2UZOA 3D7ZA 4BDJA 2FA2A 1RQQA 3DKCA 3QX4A 4V01A 4BN1A 3PVGA 4A9RA 2BR1A 3P23A 1XO2B 2WIPA 4OAVB 4FTOA 5HNIX 4JNWA 4NJDA 4IB5A 3OWJA 4E3CA 3HV5A 4HNIA 3FKNA 2QKWB 3MVMA 2GHLA 3D7TB 2UW0A 3QA8A 3DKFA 4Y72A 2VRXA 2QO9A 4GU6A 3F7ZA 3Q9ZA 4G3FA 4FVRA 4OTPA 4RA5A 2QVSE 4UY9A 3R9OA 3VQUA 3ZO4A 5FEQA 3ALNA 3QA0A 2OZOA 4QQ5A 3GOKA 2FH9A 1NXKA 2FSTX 3LFCA 3FSFA 4G16A 3RINA 5B7VA 5K0XA 3NSZA 2O5KA 3ODYX 2WTJA 4A9TA 1CMKE 2WMWA 4UWBA 2XNPA 3TZMA 2CKPA 2PVMA 3I0QA 3CSVA 2NRYA 4QYFA 2WMXA 1YI3A 2X7FA 3BI6A 5CY3A 5IUHA 1K2PA 3WF9A 4FKOA 4PRJA 5H9BA 4BCFA 4NKSA 5AUWA 4DFBA 1HCKA 5HG9A 4D4RA 1PXNA 5CEPA 4FNXA 2X9EA 5M08A 4V0GA 3MBLA 3EIDA 4AWIA 3SQQA 4M3QA 2R3MA 4TYIA 4OTHA 2AC5A 5CNOA 2W05A 3V5LA 3NDMA 3F5PA 2C3KA 3HNGA 5D7AA 4Z3VA 5GIOE 2XJ1A 4MBLA 2C6MA 3E8CA 2VWUA 4HNFA 3N4UA 4RWIA 5K4JA 2XJ2A 3SKCA 4KRCA 4BBMA 3VNTA 1YXVA 4BCPA 1Q24A 5KO1A 2VTJA 4EI4A 5CU0A 3E5AA 4DFUA 2XNBA 4KB8A 1Q3WA 4NTSA 1JKLA 5C8MA 3ZBXA 2BTRA 2BZKB 3FI4A 5K4IA 3AG9A 5CF4A 2J0MB 2UW5A 4YTHA 5CT0A 3UG1A 3LJ2A 4NL0A 4L45A 3KRJA 3NYVA 4FGBA 1GOLA 1WZYA 4DTBA 3EFWA 1H25A 5LVMA 1F3MC 3FXZA 4RVMA 2WGJA 3ZOSA 5IA2A 4LRMA 2WTKB 1KV2A 4ARKA 3RALA 3CJGA 4NIFB 3C13A 3MJ2A 4F6SA 3MB7A 5C8NA 5KMKA 3SX9A 3ZSGA 2YISA 3MIYA 3HV6A 2X2LA 2CLXA 4LOPA 4IZ7A 4ITJA 4FV1A 4QD6A 4M15A 4J97A 2O8YA 4FKQA 4AF3A 3UP2A 4MX9A 3VS2A 3WYYA 4PWNA 5AIRA 4EOJA 3PXRA 5C1QB 4BCKA 2QONA 2XP2A 3FJQE 3U9NA 3GI3A 4PMTA 1GZOA 2VTNA 1DAYA 4TY1A 5IUIA 1RJBA 1X8BA 3EFLA 5FTQA 4C58A 1XH6A 5FD2A 4AE6A 4NKAA 3C1XA 4IB3A 4AZVA 2R7IA 4DFYA 5CI7A 3QQUA 3HA8A 3VJOA 3QLGA 4JBOA 2GU8A 2QOLA 3QGWA 3O96A 4ZOGA 3ZC5A 3EN9A 3ZZEA 4C7TA 5EKNA 5J7BA 5I9YA 3I7BA 5AUYA 3RZBA 4D5HA 1VR2A 2IN6A 4EH8A 5E90A 2X8DA 5J9ZA 4HOKA 5HNBA 1R0EA 4MTAA 2YACA 2WZJA 2XEYA 4RJ7A 3GC0A 2GS2A 5EHOA 2W1DA 5GZ9A 4BKJA 5IISA 5ANGA 4Z55A 3TIYA 2Z7QA 5JN2A 4PL5A 4C4JA 2EB3A 2ITUA 1G8SA 4QNAA 3EQGA 4IJPA 4Y85A 3R7EA 2X7OA 3TNQB 5CSHA 3POOA 5IEYA 3SW4A 5HU3A 3ZLWA 4YLLA 4EWHA 3E3PA 2WTKC 4O2ZA 2UUEA 4ITHA 2B9HA 4L8MA 4ACMA 4BTKA 2WQMA 4GT3A 3VS5A 4CCUA 4IAAA 2R3LA 3R1YA 5EHLA 1K3AA 2GQGA 3PY1A 3NZ0A 4MNFA 5CU2A 2W06A 4USDA 3PSDA 5HBEA 2GNLA 3QTIA 4CV9A 1L8TA 2ETRA 4CG9A 1OL1A 4XP0A 3HYHA 4IVAA 5DVRA 5EYDA 3E93A 3D15A 4NM0A 4EOOA 3ORTA 2RG5A 4QMMA 4FEWA 2I1MA 2V7AA 3HV7A 2VN9A 2JKQA 4DEEA 2CLQA 3BWJA 4YZDA 4A07A 3JS2A 1OL5A 2R3IA 2YIXA 4ACCA 2VX1A 2ZMCA 4XG8A 5M56A 3QC4A 4FT0A 4FNWA 3SC1A 1LUFA 4MF0A 1SYKA 5G1XA 4CEGA 3LFDA 3R04A 4YR8A 3BU5A 4KIKA 2PHKA 4O7WA 4FV4A 3FHIA 2WXVA 3A62A 3PE1A 5ANJA 3MA6A 4BICA 3GU6A 4JXFA 1GZNA 4AUAA 3WZKA 4BY9E 5F1ZA 5HLPA 5AX9A 2VTOA 1H24A 4CVAA 3ORIA 3F88A 5GZAA 4BTJA 4OUCA 2UZTA 3IS5A 4YLJA 4PL4A 4ASDA 3BWFA 2XNOA 4APPA 3A7FA 2YJRA 2W7XA 2QU6A 2PVFA 4H58A 3THBA 2FB8A 4XX9A 5BVOA 5EKOA 5LXMA 4FSTA 3MW1A 3F3VA 2BMCA 4JBPA 4FKWA 4C8BA 4L53A 4U3ZA 2XBJA 4I94A 2FGIA 3VULA 5FG8A 3EH9A 3NW5A 3BYUA 1PY5A 5AP2A 3ORNA 2WNTA 3UOJA 3DKOA 4CGAA 1VEBA 4HVDA 5AUTA 3W2CA 4M14A 3C50A 3U54A 1A06A 5FXRA 3I6UA 2JDTA 4TWOA 4PMPA 2H96A 2HCKA 3OT3A 4D55A 3NGAA 4CYIA 2IZUA 1Y6BA 2XEZA 4QP7A 2RSVA 4Y46A 3IW7A 4M0ZA 2YLEA 5HQ0A 2CN5A 4X21A 5EM8A 5I4NA 1ZYCA 4PV0A 1W7HA 3DB6A 3IPHA 5IEVA 5LCJA 4RRVA 3HDNA 4E6QA 4ZY5A 5I9WA 4M7IA 4RIWA 3FMJA 4WG4A 3F82A 4XLVA 4YJUA 4CFNA 3QQHA 1ZYDA 3JXWA 3TUBA 2WU6A 1NY3A 3PXZA 4KUJA 5GIPE 2VGPA 3LFAA 2VTLA 2CHLA 3L8VA 4I6HA 4U0IA 3P7CA 3PPKA 3QRTA 4FK6A 1IAHA 4E93A 1KE7A 3KXHA 4JG6A 3FI8A 3BU3A 3HMIA 3MN3A 3T9TA 3OW4A 3F9NA 1M17A 2QU5A 3HV4A 3BE2A 3IGGA 2I0VA 4KIQA 4C62A 3Q32A 2VWYA 2OXYA 3RNYA 2WKMA 2ZAZA 5HIDA 3CY3A 4DC2A 4X3FB 2ZVAA 4IADA 1PXIA 4YZCA 1Q3DA 4GSBA 4X2GA 3TNWA 5JK3A 4AZEA 4Z7GA 4O81A 4CRSA 4MKCA 3HV3A 4YZ9A 4FIFA 4BWPA 4BHZA 4RA4A 2UW4A 4L68A 1REJA 3HX4A 1TQIA 4JDKA 4BIEA 3O8PA 4V04A 3KCKA 3VUTA 4CZUA 4B7TA 3R2BA 1W83A 2YWPA 4UALA 3TNHA 5EW8A 4BDHA 3GVUA 1OVEA 3D7TA 4DLIA 5BMSA 4W9WA 4YURA 4FK3A 4USFA 3KK8A 4O7VA 2OXDA 4EH9A 4TWNA 4OTFA 4CTBA 5FUTA 2WD1A 4IWDA 2JDVA 3KVWA 4CFXA 2YM7A 4E6DA 3VO3A 4ZJVA 5J87A 3S2PA 4GEOA 5FTGA 2VWBA 4G3DA 3QCSA 3GQIA 2VAGA 3PRIA 4WNPA 2PPQA 3GBZA 5A6NA 2XK4A 3R7GA 4FBXA 4R77A 1Z5MA 2Y4IB 3QZHA 1OBDA 4G6NA 3PSCA 3FDNA 3D5XA 4NEUA 3FZTA 3JY0A 5AAFA 4AZWA 3M1SA 2J0JA 3MFSA 3HP2A 2WHBA 3PIXA 3TEIA 4FEVA 5LVPA 2WFYA 3LFSA 3OOGA 3R9HA 3UNKA 4D28A 5C9CA 4FMQA 5E8ZA 2G9XA 4I22A 4ANLA 1L3RE 2ZV9A 2YFXA 4HYHA 5KHWA 4X3FC 3PXYA 4GJ2A 4WNKA 2R2PA 3Q53A 2BFXA 3K5UA 3QCYA 4QMWA 2C5XA 4ZS4A 5KUPA 5CAQA 5M4FA 1REKA 2XF0A 3LXPA 5EQEA 2GMXA 3PJ3A 4APCA 4NW6A 4EHEA 4H3PA 5CQWA 1EH4A 4MAOA 3Q9XA 4M67A 3IONA 2PU8A 3MV5A 2BAKA 1BI8A 2FUMA 4O0XA 4FSQA 3WZUA 5A4TA 2WMBA 4HGLA 3SOCA 2VWVA 3H0YA 4QMVA 3UOLA 3HMMA 3H9RA 4KNBA 1YWRA 4NIFA 2Q83A 2V7OA 4S31A 4U97A 2BROA 5TR6A 2X2KA 3V5PA 2A19B 4AA0A 5T68A 3MPMA 3KCFA 4QPAA 2YEXA 5EYMA 2PUIA 3FLWA 4AGCA 3UQGA 2E9PA 4RWJA 3W2SA 1R0PA 2VX0A 2Y4IC 3MY0A 3DB8A 4RLLA 3R7UA 3VRYA 4JBQA 4GVJA 3A7IA 5HG5A 3PP0A 4DEBA 3VS1A 2BPMA 2X2MA 4ANMA 4PP7A 2RFEA 3IW5A 4TYGA 3N4VA 3F61A 3I81A 4AS0A 3VBQA 3TKHA 3CQUA 4JT3A 3GU7A 4JRVA 5BVNA 5BUEA 2ITXA 4ZSAA 3BHHA 3KULA 4D2TA 2JDSA 3DBEA 3DNEA 3ZUUA 2HXLA 3AC2A 4QP3A 4W4VA 5HORA 1OPLA 3COIA 3HECA 1MRYA 2VTTA 4GV1A 4QMUA 5EW9A 3VQHA 3Q4TA 2J0IA 3LFEA 3UYSA 4CKJA 2X6EA 4QTCA 3NUNA 1IG1A 2Z2WA 3NUXA 4I1ZA 4B4LA 1OPKA 3SV0A 3QWJA 2H34A 3QD2B 2HELA 4MNEB 3ZTXA 5M09A 3OY3A 4FOCA 3P1AA 4E4XA 3VHKA 4DH3A 2X39A 3HUCA 5A4LA 1T46A 4FTQA 1SVHA 4O6LA 4ZIMA 5HLNA 4R8QA 3U9CA 2ITZA 3QXOA 4FL3A 3OC1A 3AQVA 4GW8A 4U40A 4GKHA 3PA5A 2Y4PA 4G9CA 4DG0E 4FG9A 3AD5A 4MK0A 5I9XA 3O51A 4DBNA 5FEEA 3R8PA 5KMMA 2IVVA 3ZLXA 3PDTA 1H07A 4FIHA 5FBOA 3VIDA 5CZHA 5EHYA 4EOSA 1YOJA 4CZYB 1V0BA 2PZRA 3PP1A 3CLYA 5I0BA 3NNUA 4BCOA 3DKGA 4IJ9A 4F0FA 4Y5HA 3NWWA 3VBTA 4WRGA 1XBBA 3UP7A 4R3CA 4EH6A 2PWLA 2HWOA 5ANEA 4F4PA 2JAMA 2R3RA 2B4SB 4CD0A 4ZTHA 3EB0A 4TTHB 5HEZA 2GFCA 4LGDA 3PIYA 3Q96A 4AG8A 4O22A 4N70A 4QTBA 3D14A 4KRDA 1JOWB 4B99A 3UE4A 4D2RA 4RC2A 4RVTA 1GAGA 1NT2A 3OTVA 2IVSA 1PXOA 4ITIA 3TXOA 5DPVA 3F5GA 5AV0A 3RNIA 1DM2A 4X3JA 2OF2A 4RVKA 5EM7A 2R0IA 4XG3A 3AGLA 3CD3A 4FTTA 4ASEA 3NLBA 4RX9A 4C4GA 4ACGA 4BZDA 5BYLA 4GG5A 2VX3A 3A61A 1OITA 4YZMA 4PDOA 3WILA 4BF2A 3QTRA 4F1OA 2XK6A 3QCXA 4GU9A 5IA0A 3WF5A 5F94A 4ALVA 5C01A 4YTIA 3QQLA 1CTPE 5ETAA 1BMKA 3FMEA 4LGHA 2YAKA 4CMTA 4LV8A 4NYEA 3DXNA 2B9FA 1CM8A 3KKVA 4EC9A 4B8LA 3MH2A 3O17A 5CU3A 4BC6A 2E9UA 3C0IA 3OXZA 4NUSA 3FI2A 5AP4A 2KTYA 2DQ7X 4FSNA 3ZS5A 1ZOHA 3QKKA 4U81A 5J5TA 4QMTA 2OSCA 2ITVA 4F9YA 4BDDA 4RX5A 1XH4A 2UZWE 4FC0A 3VC4A 4UMRA 5EFQA 4K11A 3U6IA 3NVKI 1ZMVA 3EN6A 2W99B 4RFZA 4BIDA 2CJMA 1DI8A 3P7BA 1CKJA 3VS0A 5DYJA 3WIKA 5CWZA 5IQHA 4FL2A 2XUUA 3WZDA 1PHKA 4J53A 5LWMA 5A46A 3QTXA 5KZ0A 2ITWA 2QCSA 4RJ3A 2BDFA 5DT3A 2HZIA 3GC8A 4I5HA 5L4QA 3TTJA 4DGNA 4F1TA 2Y6MA 2BUJA 3GB2A 1Q62A 5JQ5A 3I4BA 4AP7A 4MH7A 1ZOEA 3TN8A 1H08A 2WAJA 1TKIA 4X6RA 4KD1A 2Y8OA 4BGHA 4C37A 3MI9A 3RBWA 5CEMA 1UU8A 4ZMFA 2PY3A 5AV1A 5A6OA 5KBRA 4UV0A 5ITAA 5CF5A 3CEKA 3ACKA 2PE1A 4ACHA 1GZKA 2ZM3A 3UNZA 4M69B 4X3FA 1BX6A 2XKDA 1M7NA 4E8AA 3ZBFA 1LP4A 3CXWA 4AGUA 1YHVA 1ND4A 3PLAE 5DR2A 2VTQA 3WZJA 3NNXA 3DXQA 3BGPA 5B2LA 3DNDA 4YSMA 2PUNA 3RPOA 2P4IA 4IH8A 4BTMA 4LFIA 5DHJA 4E26A 3QYWA 2IZSA 2UZLA 3HRCA 4I41A 4P90A 5FRIA 3DFAA 3ULZA 3SW7A 4R5YA 4YO6A 3KXMA 4JBVA 3BX5A 5I5ZA 5M57A 3II5A 5AM6A 3ZXTA 4J98A 3V3VA 4PPCA 2QO2A 4JAJA 3DAEA 4B8MA 4DYMA 2WTCA 2ZB0A 3CD8A 1UKIA 3LE6A 1B6CB 1FQ1B 2F49A 2O65A 5J9LA 3BGQA 2JKOA 2W9FB 4WRSA 4ZY6A 1JQHA 4NFMA 4LQMA 3HRFA 3ID6C 3PRFA 1ZYJA 4H39A 4D2SA 5IQCA 3D2IA 2I0HA 4EOMA 1IAJA 1PYXA 4D1XA 4DGOA 5IF1A 4FIIA 2E9NA 3OEFX 5IZFA 2X4ZA 4ZLYA 5LJJA 2PVRA 2OGVA 4TWPA 4TN6A 3MESA 5DI1A 5HG7A 1O9UA 1KWPA 3M2WA 3LAUA 4G6OA 1YRPA 3LIJA 4PMMA 3QGYA 4ZXTA 4Q9ZA 3AC8A 3FY2A 3AD4A 3SRVB 3W55A 3ZYAA 5I9VA 4O7TA 3QKLA 4FF8A 2HOGA 3EQIA 4KWPA 3FV8A 3QTQA 3LFNA 4JIAA 1YW2A 1YHWA 3TTIA 2W1ZA 3TZ7A 4DFXE 1UKHA 2F9GA 3FL4A 1U54A 1WBWA 2XKCA 3F69A 5LMAA 1PMEA 3S0OA 2J2IB 3QQJA 2XNGA 4DH5A 3Q5ZA 2YZAA 4FTAA 5TE0A 2PZYA 4DEGA 4FSMA 2PZPA 4FTLA 1CKPA 2W5BA 4PNIA 3DK6A 3ZFYA 4Y95A 3MH1A 5IDNA 4YTCA 3LXNA 3KEXA 5L8LA 5CAPA 2YN8A 4M66A 3AC5A 3ENHA 4YPSA 3R83A 2XIKA 4A9SA 4BI1A 3RMFA 4O0SA 2VGOA 4FIEA 4IAIA 4HZSA 1LEZA 3R00A 4R3RA 4A4XA 4IB0A 2BHHA 5L2WA 2WMQA 3U6JA 4NTTA 4OLIA 3FUPA 2XNMA 3KF7A 2J7TA 1TQMA 3UIUA 2EXMA 4JR7A 2WEVA 3VJNA 4DEIA 4C3RA 3KL8A 2JIUA 3NAYA 2NO3A 5JRSA 5FDXA 1E1VA 1PXLA 4EOKA 2A4LA 4W9XA 1LEWA 3PE2A 3ULIA 4ZMEA 4O0YA 1FMOE 3GP0A 3ZEPA 2WMRA 2YM8A 2C6TA 4W4YA 4JLCA 3KRWA 5IH5A 4FIJA 2OO8X 2VNWA 4KA3A 2XK9A 3KREA 4KIPA 2R9SA 4HYIA 1A48A 4C3FA 2B52A 5M4CA 3OCSA 2OU7A 2X9FA 3OOMA 2J51A 2W4JA 2YIRA 4YTFA 3ZC6A 3KK9A 4XG9A 3W18A 4F0GA 5CNNA 5KZIA 3N9XA 3V5QA 1MQ4A 2F7EE 3GGFA 2P2IA 1DS5A 4MNEA 4AZSA 1BL7A 1YDTE 4ZY4A 2HY81 4DINA 4ERKA 3RAIA 4RMZA 4Y73A 5JRQA 4IVCA 3DLSA 1XJDA 4YJTA 4OW8A 1URCA 4WNOA 4EUTA 4FZFB 2VV9A 2CGWA 5HVYA 3DFCB 3I5ZA 3DPKA 1OIUA 5L2IA 3T9IA 1G3NA 4X2FA 3KRXA 3H4JA 4C35A 1IRKA 3UG2A 3VUIA 4RIOA 3TNPC 2OI4X 4GYIA 5HX8A 4DT8A 2J50A 2VTMA 4GYGA 2FO0A 5DOSA 2YM4A 4N6YA 1HOWA 4QPMA 2F7XE 2HWPA 3PFQA 2O63A 4GK3A 4BCQA 2WIHA 4BI0A 2LAVA 4RJ4A 3FMHA 3R1QA 3OD6X 4IFGA 3D9VA 3D5VA 2BZJA 3RGFA 4F7JA 3FYJX 4U6RA 4X6QC 5CU4A 4E5BA 2E9VA 3MWUA 1H1PA 4O6EA 5AV3A 3ET7A 3VS3A 3R9DA 4YJOA 1XH5A 4KKGA 4YNEA 3TKIA 2IZRA 3LPBA 4FV7A 5CLPA 4O7SA 3BHVA 2V62A 3TV7A 1YXXA 4P2KA 1AQ1A 2UZEA 4G2FA 4LL5A 2OWBA 4P5QA 2XM8A 4ZZOA 3NUAA 2B53A 4U45A 3KQ7A 3UIBA 3GFWA 3C4CA 3MPTA 3QTSA 3O50A 5AR4A 1W98A 4NSTA 4XP2A 3VUGA 5EH0A 4CNHA 3R21A 1GIIA 3EHAA 5HE3A 4Y5QA 1V0OA 3MTLA 3TI1A 4R3PA 3D83A 4TZRA 3PA3A 2YM5A 3NNVA 2C6EA 4UMTA 4AAAA 5CF8A 1QL6A 1IR3A 5AUZA 3V5TA 2ZM1A 3T8OA 3U51A 2B0QA 4I6FA 4XYFA 4XG2A 2PVNA 3G9NA 4KKHA 3VHEA 4BBFA 3QLFA 3IW8A 2E9OA 2QQ7A 2ITPA 5AM7A 3BV3A 2R5TA 1H27A 4GIHA 3QTZA 4K2RA 5J79A 4P7EA 4QMLA 3A7GA 1ZY4A 4LOQA 5KMJA 5GINE 3D4QA 3EN5A 3F2AA 4MYGA 1LR4A 5AP1A 3UVPA 4D5KA 3FMDA 4FT9A 2C69A 4EH3A 1H1SA 3RI1A 4F70A 3FY0A 5E7RA 4BWXA 5L6PA 2WPAA 3KXXA 3OBGA 3Q52A 4GH2A 2R64A 1G5SA 2WQEA 3DCVA 3PVWA 3DK3A 3QD0A 4ZSGA 4AW2A 3IGOA 1FVVA 3OXTA 4PF4A 4LL0A 3DA6A 5HTIA 2JFLA 4I3ZA 2I0EA 2I7QA 2W1HA 3PVBA 4YHJA 2W5AA 5DG5A 5AWMA 4ZEGA 3SAYA 5HCZA 4GFOA 4X2JA 4QMZA 4YC6A 3LJ1A 2HZ0A 2WMUA 2YDKA 2JDRA 4DCEA 3CKXA 4LI5A 4PQNA 4LMUA 4AN3A 3HKOA 5C26A 4U3YA 2C1AA 3WF8A 5DR9A 4HCVA 5GZ8A 4U41A 4LGGA 4X0MA 2WMAA 4JG7A 3NAXA 3NIEA 4D2PA 2JLDA 1RDQE 4QQTA 2OICA 5HO8A 4NU1A 2QNJA 4AN9A 4D0XA 4JAIA 5AAEA 4M69A 3L8SA 1OKZA 4R7HA 2XYNA 2IVTA 3OTUA 4GT4A 4UBAA 2WELA 5HIEA 3A7HA 4BDKA 3FZRA 4MBJA 4BCJA 1NVSA 3NS9A 3OZ6A 3R73A 3OCGA 3ZRLA 3PWDA 2X7GA 3NMUF 3H9OA 3TDWA 4YHFA 4FYNA 3RHXA 2C4GA 1CDKA 3LVPA 4U79A 4RWLA 1KE8A 2O0UA 1UV5A 2J0LA 4XG7A 2UV2A 4N0SA 2OXXA 3MH0A 1Z57A 1XHAA 2KULA 2OG8A 5BMMA 3VUHA 5JGDA 4FEXA 5ACKA 1R3CA 4IZAA 4DLJA 2R3GA 3DJ7A 3NCZA 1MRUA 4PX6A 4WT6A 1R78A 5GJFA 3W2PA 4BZOA 5EOLA 4IX4A 4KIOA 3OG7A 4MQ2A 5C03A 2VO6A 5IQBA 4DGMA 4JS8A 4ID7A 4U80A 3TNIA 5IQDA 4J8NA 2YZLA 5IEXA 4ZTSA 3FZSA 5IKWA 4K77A 3F66A 4IM3A 3I1AA 3TL8A 3QALE 1QPEA 3PLSA 5KMLA 2QC6A 1R1WA 4CSVA 4WSYA 5DMZA 3A2CA 5E91A 4F99A 2ITNA 3FSKA 3SRVA 4KAOA 3EWHA 3CPBA 4IM2A 4EZ3A 3KA0A 4L42A 5IQGA 5KHXA 5M4IA 1QMZA 2JKMA 3BYVA 4S30A 4ZTMA 4O7LA 3JYAA 4GG7A 3VF8A 4ZSJA 5IQAA 3LMGA 3E63A 4ALWA 2FVDA 3E7VA 3OF0A 5BPYA 3A60A 3DY7A 3EQBA 3OS3A 5ANKA 4DEHA 4ZTNA 3COHA 4TYJA 3ODZX 3VBYA 2BZHB 1WBTA 4EEVA 2BRBA 3FAAA 4PTEA 4MXCA 1OL2A 4L44A 4WNMA 2OKRA 4D9UA 3G51A 4U8ZA 5DT4A 2QLUA 3DU8A 2GNIA 2HXQA 5E8YA 5CEIA 4P4CA 5HTBA 1OUYA 5FQDC 2R3HA 5LMBA 4C61A 4DF3A 4TT7A 1YXUA 4DG3E 4F9BA 3BLRA 2ETMA 1Q41A 3EL7A 3C5UA 3TZ8A 2XIZA 1JSTA 2NP8A 3TCPA 4QRCA 5AIKA 4JOAA 2QHMA 2QKRA 3VS4A 2VWWA 4K6ZA 2AYPA 3BBWA 5GJGA 1PKGA 3EYHA 3RM7A 2PSQA 1WVXA 2C5NA 4S34A 1XH7A 4EYMA 4AACA 1PW2A 2YIWA 4C36A 2O3PA 3HDMA 3KGAA 4R6VA 4XRJA 5ETFA 4D4VA 5JKGA 5D9HA 4C38A 2J90A 4JQ7A 2VWZA 3CP9A 2VO0A 4FTMA 4QMXA 1XQZA 3ZDUA 1FVTA 3RK7A 3JY9A 2CKEA 3ZRKA 4W4XA 4EH2A 2WTWA 3R1NA 5FBNC 4EHGA 4JQ8A 4U5JA 3O8UA 3AMYA 2I0YA 2OF4A 2R4BA 3DBDA 5D12A 5CALA 4YZNA 4ZP5A 1JKSA 3LCDA 2WEIA 2WO6A 4MD9E 4DE4A 5FP5A 4BKZA 1M52A 3RJCA 1MP8A 3QWKA 4HJOA 3V8SA 4FZAB 4TW9A 2CSNA 4CMUA 3BPRA 4F64A 4DITA 2C6DA 2GTNA 4RG0A 3BYOA 4BIBA 3GT8A 4IZYA 2HW6A 3VBWA 4BRXA 4N57A 4QP4A 3HAVA 4FT7A 3QUPA 4RC3A 2IW8A 5HNGA 2QOIA 5M06A 5ETCA 3FI3A 5TT7A 5E1EA 4BB4A 2RL5A 1QPCA 1BL6A 4O0TA 4D4SA 1OPJA 2UW9A 3CPCA 1UNHA 4RSSA 2EXEA 5CF6A 2GS6A 3DOGA 3LXLA 4M0YA 3UOHA 5CTPA 3LCTA 4H1JA 1YXSA 3E8EA 3ITZA 4P5ZA 4C2VA 3AXWA 3PJ8A 3UZRA 1AD5A 3A8WA 3RAKA 1V1KA 1YKRA 1S9JA 3ORMA 2R3JA 4FUYA 4QP2A 3W33A 2R0UA 3N51A 3RPYA 3GC7A 2YA9A 2VTRA 3P86A 3Q4UA 3Q4ZA 1UU3A 4HVIA 1IASA 2QOBA 2FSMX 3ZXZA 5M44A 1YI6A 3QTUA 2HK5A 4TYHB 4BDGA 2H8HA 2XRWA 3IECA 2JIIA 3A8XA 3AOXA 4EBWA 1OBGA 3D0EA 3IOKA 1Q97A 2BAQA 4QYYA 2BIKB 3LQ5A 5HD4A 4NWMA 3R0TA 2EUFB 2CGVA 3ZSHA 3LLTA 2B7AA 4MVFA 2JGZA 1KOAA 4RJ5A 5FLFA 4BDIA 4J99A 3MIAA 2X4FA 4OGRA 5FM2A 4TXCA 2OFVA 1PXJA 5CAUA 4L7SA 4EZ7A 3TUCA 3R71A 3ROYA 4NJ3A 5DLSA 1NA7A 4C4FA 3BLQA 2LGCA 1P4OA 3TT0A 4Z9LA 2V0DA 5IQEA 4ACDA 5J8IA 5CENA 1M2PA 3MFTA 2C3JA 1E9HA 3QYZA 3IOPA 4FKRA 3Q5IA 1XKKA 2C5VA 5DT0A 4HGSA 5H3QA 3RHKA 5I9UA 4UYAA 3P0MA 3JPVA 2OJGA 1GZ8A 2J5EA 3AC3A 3QD3A 4OT5A 3LMIA 3PXKA 2YLFA 3MB6A 4A9YA 2H6DA 4OTRA 3E3BX 2HY0A 2OZAB 3UO4A 1ZY5A 3ANQA 3OWPA 3RAHA 5TF9A 4D1SA 3CBLA 3ATTA 4WUAA 3O7LD 1CKIA 4F7LA 3UVRA 4WHZA 4DTAA 4ZS0A 1ZYSA 3WZEA 2WB8A 3F5UA 3GU5A 1W0XC 5L6WL 1KOBA 4IM0A 4E6CA 1A9UA 5CVFA 4BHNA 4DH1A 4QPSA 4MBIA 2PK9A 3NYNA 4O27B 4EORA 2UZNA 3F6XA 1SNXA 4XP3A 1FVRA 2XIRA 2YHVA 2Z7RA 1Z9XA 4GFGA 5D11A 3UMWA 4GL9A 4RIYB 4H3QA 3GEQA 3OCTA 3BV2A 3PYYA 2B9JA 4FKSA 2WQBA 3QQFA 4FTIA 2B54A 1W8CA 1WVYA 1WBNA 2I40A 5AMNA 3KB7A 5HTCA 5L3AA 4M68A 5AFVA 4HCUA 4MD8E 2VTPA 1YDSE 1FPUA 1BI7A 4HGEA 4S2ZA 5L8JA 1VJYA 4WUNA 3IW6A 5LMKC 4EK8A 5A3XA 3QZIA 2PL0A 2EB2A 2ITOA 4JDJA 4OTIA 5FP6A 3UDBA 2XH5A 3A99A 4U42A 5LVLA 4AN2A 5A4QA 1WMKA 2IVUA 5KCVA 4YZBA 2P55A 3ZDIA 1SMHA 3DGKA 4UMPA 1JBPE 4EOPA 4B9DA 5D41A 4L3JA 4WSQA 5DIAA 4HZRA 4YJQA 3GUBA 1UWJA 4CLJA 3FLQA 2XNEA 2HW7A 4G3GA 2PUUA 3AT4A 2Y6OA 4FV8A 4FV3A 5CQUA 3GU4A 3QL8A 3TM0A 2XCHA 4RLKA 5CSPA 3MH3A 2YWVA 3O7LB 2FYSA 4L00A 2GNJA 4FSZA 5JFWA 4ZJIA 3SXSA 4BDAA 3CR0A 1UVRA 2IWIA 4PUZA 5C4LA 3VW6A 4M84A 3JVSA 5G6VA 2ONLC 4QQCA 4ENXA 2CNVA 3QUDA 3DLZA 2IW9A 2XK8A 3P7AA 5H8BA 2XIYA 5ICPA 4PDSA 1PKDA 4YMJA 4C02A 5CXHA 3QF9A 3FXWA 4IANA 4XUFA 5AUVA 3UZTA 4I5PA 3ALOA 4RQVA 4EH4A 3H9FA 4I6BA 4FYOA 4JI9A 5HHWA 3ZZWA 3Q2MA 4E5AX 3UPZA 3R22A 4K8AA 4FV9A 4F65A 4RBLA 3S1HA 5IH4A 4O84A 2ERZE 1ZARA 3VAPA 2G1TA 3C9WA 4ANBA 3KU2A 2GNFA 5AP7A 2X0GA 3IQ7A 3W10A 2F2CB 5JH6A 2CNUA 3FMLA 2NNWB 2ITYA 4FVPA 4I4EA 5EM5A 4W8DA 3RM6A 5TKDA 5JZJA 4J71A 3TJDA 2BALA 3LJ0A 5EQPA 4BTFA 3H10A 5M4UA 4ZTLA 4AW0A 4AOTA 5JMSA 2IG7A 5HICA 4D4YA 1Q8TA 2OW3A 3LFFA 1ZYLA 5DWRA 2FSOX 4QO9A 3SGCA 2YCQA 3R63A 4ZK5A 4IAFA 3ZO3A 4EQMA 5KMOA 4Q5EA 5C27A 3EQDA 3LW0A 1YWNA 2BAJA 2W96B 4WG5A 5KNJA 4QMSA 2G2FA 1H26A 2V55A 4L67A 3SLSA 3TKUA 4PL3A 3DXPA 5HIBA 3FEGA 3HZTA 4HVGA 4OR5A 5CSVA 2CKQA 5E92A 4TPTA 1Q61A 5EW3A 3C5IA 2YM6A 2WMSA 4FR4A 5B0XA 4EWQA 3G33A 1H1WA 3S00A 4AZTA 2HYYA 1KV1A 4FZ6A 4C4HA 3IKAA 2W1GA 3GCQA 4FKPA 4RIXB 2CPKE 4L43A 1WAKA 4YHTA 3VUMA 2CKOA 3PZHA 3RCDA 2WMVA 4O38A 4BI2A 5D10A 3S4QA 2XM9A 3B8QA 4BDBA 2E2BA 3FZ1A 3G0EA 4FNZA 1GIHA 1SM2A 2C47A 2HIWA 3VUDA 4G31A 4PPBA 3UC4A 5AADA 2NRUA 2WOUA 2VTIA 3HP5A 4IFCA 3W32A 4YPDA 5E8VA 2BILB 5KE0A 2CNQA 4LOOA 4Q5HA 3PUPA 3R01A 4AQCA 3ZUVA 5EDQA 1B38A 5A4CA 3UODA 3MVHA 4GK4A 4KBKA 2ZMDA 1H0VA 3S95A 1VYWA 3EYGA 4I0TA 4A9UA 5DNRA 1ZMWA 3C4XA 3VW8A 4RGJA 1Q4LA 1ERKA 3WBLA 4BDCA 5IA3A 3ENMA 4G1WA 1BKXA 4NH1A 4GKIA 3G6GA 4GCJA 4DEAA 1OIYA 2WMTA 2VUWA 4UZDA 5DBXA 3RZFA 5CVHA 4FV6A 4GJ3A 3OP5A 1FGKA 3EJ1A 5IMEA 4MF1A 2IO6A 4I0SA 3U8WA 4AA4A 2YAAA 4MQ1A 1FBNA 3ZEWA 3IG7A 2W17A 4ALUA 1PMUA 3GCSA 4E7WA 3L9NA 2WTVA 3KFAA 5DEWA 3BBTB 3TIZA 1UNGA 2AUHA 2F57A 3DJ5A 3MS9A 3QRJA 3TJCA 3EFJA 1OZ1A 4LMNA 4XG4A 2BRHA 3SG9A 3ZFXA 3O0GA 5JT2A 3LM0A 2R7BA 4GUEA 4O7ZA 4W8EA 2XJ0A 5AX3A 3H0ZA 5IA5A 1JSVA 1S9IA 2ZJWA 3K5VA 4L01A 2WOTA 5D1JA 2F7ZE 2EWAA 3PY3A 3DBCA 3DT1A 2X1NA 5DA3A 4IWPA 4EHZA 3C51A 3U87A 4UB7A 4GS6A 3R8MA 2C30A 4I0RA 5EDPA 3QHRA 3NVMB 2W1EA 2RFSA 4WOVA 5IA1A 3IDBA 3GNIB 3O71A 5HVJA 4BDEA 2UW3A 3CCNA 1JKKA 2RKUA 2EVAA 3I6WA 2CGXA 4BYIA 3U4UA 3PJ2A 1PF8A 3U4WA 2P3GX 4ZLZA 3TDVA 3PVUA 3UO5A 1W82A 2OFUA 3TACA 5D7VA 3VF9A 4XV1A 4KKEA 3BLHA 3LOKA 2DYLA 2C0OA 1OI9A 2UZVA 2GHMA 4ZJJA 4HPUE 2PVKA 4R78A 3RWPA 4AT3A 4F6WA 5LMKA 3KRLA 4AT4A 3E88A 2XCKA 4PTCA 2W4KA 1YWVA 2XZSA 4XMOA 5IG1A 5ANOA 2J6MA 3LFQA 3P9JA 4EUUA 4BCIA 3GOPA 2J0KA 4PTGA 2PVHA 5HCXA 3FC2A 2CN8A 3FQEA 3AMBA 3ZRMA 5BYYA 1NW1A 4JVGA 4QTAA 4BDFA 2XKEA 2JC6A 4DG2E 1U59A 4O82A 3C0HA 4J7BA 2OZAA 4C34A 3QTWA 3ELJA 1KSWA 4KS7A 4EC8A 4AW5A 3FMKA 4ENYA 3EMGA 4B6LA 3MY1A 4KABA 4IHPA 3EQHA 3GXLA 4RPVA 4L3LA 4H1MA 5J95A 1U5RA 5E8SA 1PXMA 2O2UA 4XV9A 5BX0A 5IPJA 3LMHA 3REPA 1XH8A 4O7NA 2JEDA 1TVOA 3W2QA 3SHEA 4F9AA 4XCUA 2BVAA 2XK3A 5CSWA 3BRBA 1E1XA 4I4FA 3MDYA 2ONLA 4MXYA 5HZNA 4WBOA 4GUBA 1Q8WA 4EONA 2A2AA 2Y9QA 3C4EA 3DBQA 3OT8A 4RIYA 4QP8A 1NVRA 2DWBA 3K3IA 2GSFA 5LOHA 1FINA 3F2RA 3RK5A 3D5UA 4F63A 4AFJA 2C68A 4IXPA 4YJRA 5CAVA 3PSBA 2Z02A 2ZV2A 3SXRA 1TQPA 1H4LA 2ITQA 5LARA 4BR3A 2BRMA 3BEAA 4I21A 5IUGA 4YO4A 3QBNA 5KMIA 3MSSA 3EQCA 3R30A 4YUQA 4FKTA 4NW5A 3FWQA 4PMSA 2P0CA 3QCQA 3VVHA 1DAWA 3OY1A 3V5WA 3OVVA 1J3HA 2OH0E 4CKIA 4MXXA 4R1YA 5E8XA 4E5WA 3ORKA 3W8LA 4GFMA 3E8NA 4OAUC 5FM3A 3GU8A 4HW7A 3I60A 3VN9A 2GDOA 4HCTA 5DN3A 4XLIA 4F7SA 2Q0NA 4YJNA 5HCYA 5A4EA 3A4OX 4IX5A 1ZAOA 5BUIA 4EJ7A 4IB1A 1IA8A 5GNKA 4KBAA 2QG5A 3NYOA 5IH6A 3ORXA 5I9ZA 4EOQA 3ETAA 4IE9A 3RKBA 4C2WA 3LKMA 3AD6A 5CVGA 1WVWA 3AC4A 1YI4A 5FDPA 4ANSA 3AT3A 3P08A 3FKOA 3SD0A 1Y6AA 2FSLX 4FKVA 5CSXA 3VS7A 2NPQA 5A9UA 1Y8GA 4QYHA 2WTIA 3NW7A 2JITA 3PXFA 3VRZA 4LRKA 3FKLA 3W1FA 3NRMA 4IDTA 5F9EA 3D2KA 3UMXA 3M42A 4BFMA 4UN0C 3QRKA 5CANA 3PZEA 4ANNA 3MTFA 4IDVA 2JDOA 5C8KA 3CGOA 5HO6A 5AAGA 3ZHPC 4AOJA 4F9CA 4M12A 4CYJA 3FYKX 2R3NA 2XVDA 4E4MA 2XKFA 4L52A 1J7IA 4UYNA 4X2NA 3MFRA 4BCNA 4PP9A 1OL6A 3GQLA 3JVRA 4EQUA 2ZM4A 2JKKA 2VD5A 5ANIA 2QG7A 2C5YA 1H1RA 4XBRA 2Y7JA 4FV5A 4QYEA 4D2WA 2RIOA 3L9PA 4PDPA 4FTKA 1GY3A 2GNHA 4UXQA 4BGGA 4CFUA 4FT5A 3HMNA 2PTKA 4IACA 2B1PA 5FXSA 3TV6A 4A06A 5HBJA 1OIQA 4O7RA 4BCHA 2HENA 2YCSA 2ZV8A 3GCVA 2XNNA 4CFVA 2OH4A 2PUPA 2G2IA 4RX8A 4WIHA 4EYJA 2VNYA 4QP1A 4UX9A 3K2LA 3ZCLA 1PJKA 2UW7A 2XBAA 5C4KA 1G8AA 2AC3A 1H01A 1MQBA 4OTGA 3V6SA 5AR8A 4FOBA 5DEYA 2PVYA 2QOHA 4D9TA 3KMWA 3DK7A 3GENA 3NYXA 5I3OA 5CU6A 3V04A 4AGDA 4AX8A 2W1CA 3HGKA 5TO8A 1OKVA 4LG4A 3HMOA 5CASA 2WQNA 2XK7A 4G3EA 3VBXA 4CFFA 3PA4A 4EK4A 5CX9A 3SOAA 4CMOA 4R7IA 4BL1A 4RIXA 3C0GA 4MEDA 2C3LA 2ZYBA 5AR3A 3SXFA 3T3VA 3L9MA 3P4KA 4FSUA 4QMPA 3DBFA 4E1ZA 3FPQA 3DAKA 1YXTA 4ZTQA 4NT4A 1ZLTA 4JQEA 3MFUA 4U9AA 4XV3A 3FMMA 4F1MA 5BVDA 2UW6A 1F0QA 3OEZA 4G5JA 3GC9A 1GJOA 1H8FA 3POZA 2F4JA 3BEGA 4CLIA 3NCGA 3G2FA 1W84A 3IK3A 4CFMA 2BRNA 5A14A 4K18A 4XJ0A 5HX6A 1WBSA 5HG8A 1I09A 4NCTC 2QR7A 3OWLA 5IDPA 1B39A 3KULB 1SZMA 2R3PA 3SDJA 1U46A 3CIKA 1ZWSA 5CEKA 4EJNA 3HL7A 1UA2A 4TKSA 4AOIA 4XBUA 3RVGA 2YABA 4ZAUA 1JPAA 4G34A 1QPDA 4KINA 3QU0A 4O0RA 4RVLA 5AV4A 1Y8YA 3E87A 1V0PA 4O0UA 4XS2A 2GHGA 4UMQA 3G5DA 3UGCA 4C57A 3BE9A 3I5NA 3P5KA 5EK7A 4XRLA 5CXZA 2W5HA 5HVKA 3K54A 3HEGA 3PJCA 4GRBA 4S32A 4FTCA 4XOZA 5HE0A 2XIXA 4OTWA 3UC3A 3P78A 4J95A 4F0IA 3MA3A 2F2UA 3FLYA 2BCJA 4AE9A 3IO7A 4N6ZA 2A27A 4C4IA 3C4WA 3DTCA 3DDQA 2JAVA 4IWQA 3DZQA 5CS6A 2C3IB 3L8XA 3UQCA 5ETIA 3TWJA 1M2RA 1AGWA 3RPSA 5TOZA 4CT2A 4FTJA 3CS9A 4U7ZA 2RFNA 3CTJA 4JIKA 4ANQA 3WI6A 3OXIA 2PMNX 2VTAA 3EQPA 3Q9YA 3UVQA 4GMYA 4CRLA 4DTKA 1ZRZA 3NPCA 3CE3A 5F95A 3UQFA 4IVDA 2VU3A 3LFBA 2X81A 2WTDA 3QKMA 3ZM9A 2CCHA 5KBQA 4FKGA 2C6OA 4ZZMA 3B2TA 1J7LA 5E8TA 4I93A 3RAWA 5AP6A 3OW3A 2QI8A 1WFCA 1FOTA 3OWKA 2IW6A 5JQ8A 2WQOA 2OBJA 4GIIA 5E8UA 5AA8A 5IA4A 4DFZE 2QLQA 3G6HA 3ZM4A 3CTQA 3R8ZA 1MRVA 4KS8A 1O6KA 4QOXA 5ANDA 1HCLA 4M97A 5GJDA 4H36A 4O96A 3R8VA 5JFXA 2PULA 4EQCA 3TV4A 1XR1A 2XYUA 5BVWA 1M14A 3PG1A 5LVNA 3SA0A 1H00A 1H0WA 3BHTA 4E20A 3MVJA 3EZRA 4FV0A 4NK9A 4BWKA 5AEPA 5JGBA 3KXNA 4DGLC 4OTDA 3TUDA 3H30A 4ERWA 2PVJA 1BYGA 3LXKA 2C1BA 2OK1A 4JDIA 1XWSA 1DI9A 2RF9A 4UEUA 4FKLA 4RJ8A 3G9LX 1PMVA 4FSYA 4IWOA 2CDZA 2PE2A 4FTUA 4L7FA 3RCJA 3RTPA 4ASXA 2YERA 4TL0A 2QOOA 1IA9A 2GTMA 5AA9A 4IC8A 4RX7A 5BVEA 3T3UA 4DN5A 1YDRE 4KSQA 4AU8A 4O21A 4K0YA 4IZ5A 3BHYA 4IBMA 3U6HA 3KMUA 4Y8DA 2RFDA 5H2UA 1JLUE 3G0FA 2OIQA 4IW0A 2Q0BA 2A1AB 2BDJA 1U4DA 1UNLA 4FE2A 4AT5A 4XV2A 1O6LA 1UWHA 2CGUA 1KE6A 4U43A 2QHNA 4HYSA 2Z60A 5EI2A 1WBOA 3PXQA 2ITTA 2OJJA 3DAJA 3FE3A 4BGQA 2VO7A 5JFSA 5L6OA 2PZIA 3DS6A 5HE1A 4IAYA 2REIA 3PY0A 1U5QA 3EZVA 1T45A 4F6UA 2DS1A 3ZH8A 5BQ0A 3BCEA 5M53A 4FICA 3SG8A 3EKKA 5KKRB 4BKYA 3EOCA 4CFWA 4D2VA 4YC8A 3HRBA 4XOYA 5LCKA 4TNDA 3FLNC 4YBKA 1VZOA 3LZBA 1LPUA 2YIQA 4CQGA 4HVHA 2BZIB 4OBQA 4E6AA 3CQWA 3ZU7A 4FEUA 1SVEA 5DE2A 3BQRA 4BCMA 3NUUA 2RGPA 3NUSA 3PJ1A 3MY5A 4FTNA 5LWNA 5M07A 1GIJA 4K33A 5ACBC 2A0CX 4YNOA 4B0GA 4C4EA 2GNGA 3QQKA 4DT9A 4ZSLA 4OBPA 4EOIA 3MVLA 4CKRA 3L1SA 3L8PA 3NX8A 3CKWA 4F9WA 2VWIA 1J1CA 3AMAA 3BYMA 3F3WA 4O0VA 3WF6A 3HMPA 4MWHA 3H3CA 3DJ6A 5FTOA 4RFMA 2GFSA 4G6LA 3ANRA 4JR3A 1QCFA 3R1SA 2G15A 2OIBA 4ZSEA 1PYEA 2GQSA 5CZIA 3FQHA 3DTWA 3COMA 4II5A 4S33A 4I5CA 5M55A 3I79A 3QRIA 4FIGA 5IQFA 2GPHA 4JL9A 3WE8A 3TZ9A 2YM3A 3Q04A 2V5QA 5H8EA 4O7YA 2W1IA 1CSNA 2JIVA 4GT5A 3A7JA 4LRJA 4OT6A 5EG3A 3F5XA 1H1QA 2HAKA 3EN7A 3V5JA 5DRBA 2B9IA 4BZNA 4G5PA 5KKRC 5EM6A 3KVXA 3GCPA 2CCIA 4YLKA 5DRDA 3RP9A 5HO7A 2ZDTA 5JFVA 4IMYA 3W2RA 1WBPA 4MD7E 5AP5A 2OLCA 1SNUA 3ZUTA 3A4PA 4IX6A 4QP9A 2OJFE 3P79A 2R3OA 3E92A 5J5SA 3UJGA 2J9MA 2C6LA 3KRRA 4NCTA 1JWHA 5EQYA 4BYJA 5HU9A 3Q6UA 5L8KA 2WU7A 3NR9A 3D5WA 2ZOQA 3HA6A 4BCGA 2YCFA 3V6RA 5CAOA 4JX3A 1GNGA 3RPRA 4G3CA 5KMNA 3DV3A 2Z7SA 4CXAA 1Q8UA 4CG8A 5K9IA 1P5EA 5AJQA 5FEDA 4CCBA 4DGGA 5HOAA 3F3UA 3EL8A 5HD7A 1U54B 2W1FA 5I3RA 2ACXA 4FKUA 3MPAA 4CV8A 2Z7LA 2UVYA 2PMIA 1Y91A 3FC1X 3NIZA 4LV5A 5IU2A 5F4NA 3R02A 4MXZA 1BLXA 3C4FA 4EHVA 2XA4A 4Q9SA 4R1VA 5CT7A 5L2TA 4AFEA 1J1BA 4FTRA 2JD5A 4CTCA 1WCCA 1UU9A 3EQFA 4WA9A 4QMOA 5EI8A 3WE4A 3WOWA 2EU9A 4MCVA 3E7OA 3UZPA 3Q6WA 3NUYA 5AUXA 4R5SA 3PWYA 2GQRA 4JDHA 4PPAA 5AR7A 4EKKA 3BELA 3W2OA 4YC3A 5DR6A 5DH3A 4D1ZA 2UZDA 1P2AA 3E62A 1YOMA 1PXPA 3Q60A 3QD4A 4IAKA 4IX3A 3O23A 4AW1A 4U44A 2QOKA 1OGUA 3R7IA 5K3YA 2V22A 4L9IA 1SVGA 4FGRA 3OFMA 4QMYA 4WBBB 5B2MA 4FEQA 4ORKA 1OIRA 3Q3BA 4NZWB 5AR2A 3VWAA 3KXGA 1XBCA 2UVZA 3MGYA 3WARA 3IW4A 2W4OA 4O91A 3U55A 4H3BA 2RG6A 4GK2A 5L2QA 4CZTA 4FV2A 4LUDA 5CYIA 3BIZA 4QTDA 5AP0A 2C0IA 5A54A 1PRYA 5H8GA 4RJ6A 2YCRA 4DFLA 3OMVA 4J1RA
chains in the Genus database with same CATH superfamily
3NNWA 3QZFA 5DGZA 4F08A 5DFPA 1OL7A 1UU7A 5HI2A 4IAZA 4UXLA 4WD5A 1G8KA 4FX3A 2DUVA 4FKIA 4XHKB 3QQGA 4BBEA 2JFMA 4RFYA 2BTSA 5J7HA 4QNYA 2PYWA 4FNYA 1YQJA 3MYGA 4HGTA 3G90X 5CI6A 4OTQA 4NM5A 4QMNA 2GCDA 2YITA 4YU2A 1QPJA 3NEWA 3PG3A 4DA5A 1YOLA 4N4SA 3ZLSA 4IC7A 2YDIA 2HZ4A 4AW2A 3F3TA 3FHRA 5HESA 1ZXEA 2OJ9A 4QP6A 4I92A 3GCUA 3OUKA 3AKKA 3EFKA 5E1SA 3QUEA 4PNKA 5BYZA 4LUEA 5AR5A 2SRCA 4DHFA 4JMQA 5E8WA 1I44A 5T6KA 4DBXA 3EN4A 4Q2AA 2JBOA 4FL1A 2VTSA 3KIOC 5JEBA 3LCKA 4WG3A 3ORZA 3IDPA 2QOCA 3IDCA 3FMNA 1KE5A 3PPZA 1PMNA 3B8RA 4LDTA 4E4LA 3NW6A 3TYKA 5J1WA 4R7BA 3BQCA 5E4HA 3LHJA 2UZUE 3DDPA 2PVLA 3E8DA 1OUKA 1YHSA 3C7QA 4V0GB 5EOBA 4O0WA 1Q8YA 4XH6A 5LVOA 3BKBA 3N4TA 3FBVA 4G9RA 1VLRA 3UIMA 4O83A 4FSWA 4H05A 2R3FA 3FLZA 2QOQA 3CTHA 2R3QA 4LM5A 5CEQA 1OB3A 5HLWA 4HYUA 5AV2A 3UOKA 2PMOX 4C59A 4A4OA 3R9RA 4NFNA 3PUFC 5AUUA 3RK9A 4FKJA 1P14A 1Y57A 3OHTA 1MUOA 3BZ3A 3R8LA 3ZFMA 3AGMA 3F2NA 2H9VA 3AC1A 3ERKA 5JSMA 4DCAA 3BU6A 4FG7A 4NM3A 1KUTA 3CQEA 2YJSA 4ONAA 1BUHA 4DAWA 3RPVA 5HE2A 4JX7A 3M11A 4I6QA 4WKQA 1H28A 3Q4CA 4EK3A 3NUPA 2ETKA 2R3KA 4L46A 3WF7A 4PDYA 3W8QA 3R28A 2PMLX 2I6LA 3EKNA 4ASZA 4K1BA 3QXPA 4D58A 2XB7A 3I0OA 4I6LA 4I5MA 4FG8A 5AP3A 2UZBA 4X2KA 4IQ6A 1XBAA 2EXCX 1K9AA 4KSPA 2P33A 4YSJA 3B2WA 4DH7A 1J91A 1WBVA 3ORPA 4RQKA 5IQIA 2BKZA 3HUBA 5EYKA 4WO5A 1XMLA 2GS7A 4O2PA 3QX2A 1M2QA 4AXFA 3LQ3A 3KN5A 4QQJA 4EOLA 3O8TA 4C3PA 4W4WA 3W0QA 3PIZA 2UW8A 4FSRA 2X6DA 3E64A 3FZOA 1JKTA 5FGKA 3W16A 3KN6A 4YGAA 4MXAA 3VS6A 4YJPA 2BDWA 2UVXA 2QR8A 2QD9A 3O2MA 3L9LA 4AXAA 4YBJA 4I20A 4F09A 3FLSA 3UTOA 5J9YA 3WYXA 3V8WA 1ZOGA 3EQRA 4G17A 4KBCA 2IJMA 4GVAA 4CQEA 5J1VA 1ATPE 4EKLA 3ZLYA 5BVFA 3KF4A 1OM1A 3CJFA 4DHJA 5BV3A 5T3QA 4DEDA 5JZNA 3ORLA 3VBVA 1Q5KA 5E9EA 2ERKA 2J4ZA 3CGFA 3DQWA 3JR1A 4QT1A 4UWCA 4PY1A 4X7QA 2XRUA 3JUHA 2X8EA 2BHEA 2YDJA 3I7CA 4IIRA 3BLAA 1F5QA 3G15A 5EI6A 4QYGA 2C6KA 3KXZA 2BIYA 4DFNA 4QTEA 2VO3A 3UBDA 2OIDA 4TWCA 4FT3A 4C33A 4XNEA 1APME 3FQSA 2PE0A 1RE8A 2HZNA 4MXOA 5IMXA 3DZOA 2VZ6A 2W0JA 4TYHA 3LQ8A 4O1OA 3R9NA 3FXXA 4ZZNA 1Q99A 2QO7A 4I24A 5FXQA 4FZ7A 2BKKA 4EBVA 5HGIA 2ZB1A 5BNJA 4FA2A 3QAME 2VWXA 1JNKA 2XMYA 1O6YA 2B55A 3UO6A 3QZGA 4D0WA 2ZDUA 2OJIA 4AGWA 2Z8CA 4JJRA 1M7QA 2IZTA 3KMMA 3CC6A 3C4ZA 3GFEA 2ZV7A 4KIKB 3R7VA 4ZLOA 1YVJA 1OKYA 1STCE 3BHUA 4EL9A 5GHVA 5KX8A 5LQFA 1URWA 3ACJA 3LCSA 5HKMA 4IEBA 3TG1A 4RC4A 4CT1A 2CMWA 1OECA 4E73A 3R7YA 3R2YA 5K5NA 4RZWA 4QDVA 3LLAA 1FMKA 3ZO2A 3ZSIA 4RT7A 3KC3A 3BGZA 1R39A 4A7CA 3HVCA 3QFVA 4C0TA 3FL5A 5B2KA 4EZ5A 2IPXA 4OBOA 5EDRA 4L6QA 2P2HA 4XG6A 5JGAA 4Y83A 4V05A 4EH7A 5M51A 3F7WA 4DH8A 4I23A 3D94A 4MWIA 4ZTRA 4EK6A 5EYCA 4UMUA 3TMOA 2JBPA 4FZDB 4QMQA 4O1PA 3UPXA 2BFYA 2ESMA 4L3PA 3ZONA 5CEOA 2O64A 2Y0AA 3LCOA 4TYEA 5FWKK 3WIGA 4USEA 2C5OA 1JSUA 2YIYA 1IEPA 1P4FA 1ZMUA 4E4NA 4O86A 1KE9A 3QHWA 5HBHA 2VTHA 4ANOA 5K0KA 1JVPP 5K5XA 5L2SA 3UNJA 1ZZ2A 3MJ1A 3OCBA 5F20A 3KY2A 3V8TA 4Z16A 4J96A 2G01A 1RW8A 3R8UA 4J8MA 4HPTE 1NVQA 3FPMA 4NM7A 3UIXA 1ZZLA 3COKA 2G2HA 2QOFA 3BYSA 2QURA 4J52A 3AT2A 1JAMA 4K9YA 3ZO1A 1FGIA 4RWKA 3K3JA 4YP8A 5BVKA 3Q2JA 3R6XA 2QODA 4RIWB 4F7NA 4FODA 2X8IA 1XH9A 3LM5A 4TNBA 4XEYA 3ZMMA 4HVSA 2PZ5A 3F3ZA 3ROCA 2W9ZB 4LYNA 4AXDA 4TRLA 3HLLA 3S3IA 4EH5A 3Q9WA 4FVQA 4UZHA 1Q8ZA 2C6IA 3OUNB 4IVBA 4M13A 4RZVA 3UYTA 3VUKA 4YJSA 3RWQA 3OBJA 1J7UA 4JG8A 4FI1A 4UWYA 2J5FA 1PXKA 3PPJA 3QC9A 4EK5A 4M8TA 4Z7HA 1OMWA 3OROA 4A4LA 3R7OA 4MHAA 4AZFA 4FUXA 3SVVA 2BRGA 3CY2A 3PTGA 3V51A 4AA5A 3FZPA 5BUJA 3HAMA 4BVUA 1OKWA 2C0TA 3DQXA 1VYZA 2XS0A 3V01A 3ATSA 3QRUA 4YJVA 4JRNA 2UZOA 3D7ZA 4BDJA 2FA2A 1RQQA 3DKCA 3QX4A 4V01A 4BN1A 3PVGA 4A9RA 2BR1A 3P23A 1XO2B 2WIPA 4OAVB 4FTOA 5HNIX 4JNWA 4NJDA 4IB5A 3OWJA 4E3CA 3HV5A 4HNIA 3FKNA 2QKWB 3MVMA 2GHLA 2NYAA 3D7TB 2UW0A 2X0PA 3QA8A 3DKFA 4Y72A 2VRXA 2QO9A 4GU6A 3F7ZA 3Q9ZA 4G3FA 4FVRA 4OTPA 4RA5A 2QVSE 4UY9A 3R9OA 3VQUA 3ZO4A 5FEQA 3ALNA 3QA0A 2OZOA 4QQ5A 3GOKA 2FH9A 1NXKA 2FSTX 3LFCA 3FSFA 4G16A 3RINA 5B7VA 5K0XA 3NSZA 2O5KA 3ODYX 2WTJA 4A9TA 1CMKE 2WMWA 4UWBA 2XNPA 3TZMA 2CKPA 2PVMA 3I0QA 3CSVA 2NRYA 4QYFA 2WMXA 1YI3A 2X7FA 3BI6A 5CY3A 5IUHA 1K2PA 3WF9A 4FKOA 4PRJA 5H9BA 4BCFA 4NKSA 5AUWA 4DFBA 1HCKA 5HG9A 4D4RA 1PXNA 5CEPA 4FNXA 2X9EA 5M08A 4V0GA 3MBLA 3EIDA 4AWIA 3SQQA 4M3QA 2R3MA 4TYIA 4OTHA 2AC5A 5CNOA 2W05A 3V5LA 3NDMA 3F5PA 2C3KA 3HNGA 5D7AA 4Z3VA 5GIOE 2XJ1A 4MBLA 2C6MA 3E8CA 2VWUA 4HNFA 3N4UA 4RWIA 5K4JA 2XJ2A 3SKCA 4KRCA 4BBMA 3VONA 3VNTA 1YXVA 4BCPA 1Q24A 5KO1A 2VTJA 4EI4A 5CU0A 3E5AA 4DFUA 2XNBA 4KB8A 1Q3WA 4NTSA 1JKLA 5C8MA 3ZBXA 2BTRA 2BZKB 3FI4A 5K4IA 3AG9A 5CF4A 2J0MB 2UW5A 4YTHA 5CT0A 3UG1A 3LJ2A 4NL0A 4L45A 3KRJA 3NYVA 4FGBA 1GOLA 1WZYA 4DTBA 3EFWA 1H25A 5LVMA 1F3MC 3FXZA 4RVMA 2WGJA 3ZOSA 5IA2A 4LRMA 2WTKB 1KV2A 4ARKA 3RALA 3BL7A 3CJGA 4NIFB 3C13A 3MJ2A 4F6SA 3MB7A 5C8NA 5KMKA 3SX9A 3ZSGA 2YISA 3MIYA 3HV6A 2X2LA 2CLXA 4LOPA 4IZ7A 4ITJA 4FV1A 4QD6A 4M15A 4J97A 2O8YA 4FKQA 4AF3A 3UP2A 4MX9A 3VS2A 3WYYA 4PWNA 5AIRA 4EOJA 3PXRA 5C1QB 4BCKA 2QONA 2XP2A 3FJQE 3U9NA 3GI3A 4PMTA 1GZOA 2VTNA 1DAYA 4TY1A 5IUIA 1RJBA 1X8BA 3EFLA 5FTQA 4C58A 1XH6A 5FD2A 4AE6A 4NKAA 3C1XA 4IB3A 4AZVA 2R7IA 4DFYA 3NFGB 5CI7A 3QQUA 3HA8A 3VJOA 3QLGA 4JBOA 2GU8A 2QOLA 3QGWA 3O96A 4ZOGA 3ZC5A 3EN9A 3ZZEA 4C7TA 5EKNA 5J7BA 5I9YA 3I7BA 5AUYA 3RZBA 4D5HA 1VR2A 2IN6A 4EH8A 5E90A 2X8DA 5J9ZA 4HOKA 5HNBA 1R0EA 4MTAA 2YACA 2WZJA 2XEYA 4RJ7A 3GC0A 2GS2A 5EHOA 2W1DA 5GZ9A 4BKJA 5IISA 5ANGA 4Z55A 3TIYA 2Z7QA 5JN2A 4PL5A 4C4JA 2EB3A 2ITUA 1G8SA 4QNAA 3EQGA 4IJPA 4Y85A 3R7EA 2X7OA 3TNQB 5CSHA 3POOA 5IEYA 3SW4A 5HU3A 3ZLWA 4YLLA 4EWHA 3E3PA 2WTKC 4O2ZA 2UUEA 4ITHA 2B9HA 4L8MA 4ACMA 4BTKA 2WQMA 4GT3A 3VS5A 4CCUA 4IAAA 2R3LA 3R1YA 5EHLA 1K3AA 2GQGA 3PY1A 3NZ0A 4MNFA 5CU2A 2W06A 4USDA 3PSDA 5HBEA 2GNLA 3QTIA 4CV9A 1L8TA 2ETRA 4CG9A 1OL1A 4XP0A 3HYHA 4IVAA 5DVRA 5EYDA 3E93A 3D15A 4NM0A 4EOOA 3ORTA 2RG5A 4QMMA 4FEWA 2I1MA 2V7AA 3HV7A 2VN9A 2JKQA 4DEEA 2CLQA 3BWJA 4YZDA 4A07A 3JS2A 1OL5A 2R3IA 2YIXA 4ACCA 2VX1A 2ZMCA 4XG8A 5M56A 3QC4A 4FT0A 4FNWA 3SC1A 1LUFA 4MF0A 1SYKA 5G1XA 4CEGA 3LFDA 3R04A 4YR8A 3BU5A 4KIKA 2PHKA 4O7WA 4FV4A 3FHIA 2WXVA 3A62A 3PE1A 5ANJA 3MA6A 4BICA 3GU6A 4JXFA 1GZNA 4AUAA 3WZKA 4BY9E 5F1ZA 5HLPA 5AX9A 2VTOA 1H24A 4CVAA 3ORIA 3F88A 5GZAA 4BTJA 4OUCA 2UZTA 3IS5A 4YLJA 4PL4A 4ASDA 3BWFA 2XNOA 4APPA 3A7FA 2YJRA 2W7XA 2QU6A 2PVFA 4H58A 3THBA 2FB8A 4XX9A 5BVOA 5EKOA 5LXMA 4FSTA 3MW1A 3F3VA 2BMCA 4JBPA 4FKWA 4C8BA 4L53A 4U3ZA 2XBJA 4I94A 2FGIA 3VULA 5FG8A 3EH9A 3NW5A 3BYUA 1PY5A 5AP2A 3ORNA 2WNTA 3UOJA 3DKOA 4CGAA 1VEBA 4HVDA 5AUTA 3W2CA 4M14A 3C50A 3U54A 1A06A 5FXRA 3I6UA 2JDTA 4TWOA 4PMPA 2H96A 2HCKA 3OT3A 4D55A 3NGAA 4CYIA 2IZUA 1Y6BA 2XEZA 4QP7A 2RSVA 4Y46A 3P5JC 3IW7A 4M0ZA 2YLEA 5HQ0A 2CN5A 4X21A 5EM8A 5I4NA 1ZYCA 4PV0A 1W7HA 2XANA 3DB6A 3IPHA 5IEVA 5LCJA 4RRVA 3HDNA 4E6QA 4ZY5A 5I9WA 4M7IA 4RIWA 3FMJA 4WG4A 3F82A 4XLVA 4YJUA 4CFNA 3QQHA 1ZYDA 3JXWA 3TUBA 2WU6A 1NY3A 3PXZA 4KUJA 5GIPE 2VGPA 3LFAA 2VTLA 4O4FA 2CHLA 3L8VA 4I6HA 4U0IA 3P7CA 3PPKA 3QRTA 4FK6A 1IAHA 4E93A 1KE7A 3KXHA 4JG6A 3FI8A 3BU3A 3HMIA 3MN3A 3T9TA 3OW4A 3F9NA 1M17A 2QU5A 3HV4A 3BE2A 3IGGA 2I0VA 4KIQA 4C62A 3Q32A 2VWYA 2OXYA 3RNYA 2WKMA 2ZAZA 5HIDA 3CY3A 2AEGA 4DC2A 4X3FB 2ZVAA 4IADA 1PXIA 4YZCA 1Q3DA 4GSBA 4X2GA 3TNWA 5JK3A 4AZEA 4Z7GA 4O81A 4CRSA 4MKCA 3HV3A 4YZ9A 4FIFA 4BWPA 4BHZA 4RA4A 2UW4A 4L68A 1REJA 3HX4A 1TQIA 4JDKA 4BIEA 3O8PA 4V04A 3KCKA 3VUTA 4CZUA 4B7TA 3R2BA 1W83A 2YWPA 4UALA 3TNHA 5EW8A 4BDHA 3GVUA 1OVEA 3D7TA 4DLIA 5BMSA 4W9WA 4YURA 4FK3A 4USFA 3KK8A 4O7VA 2OXDA 4EH9A 4TWNA 4OTFA 4CTBA 5FUTA 3ML1A 2WD1A 4IWDA 2JDVA 3BL9A 3KVWA 4CFXA 2YM7A 4E6DA 3VO3A 4ZJVA 5J87A 3S2PA 4GEOA 5FTGA 2VWBA 4G3DA 3QCSA 3GQIA 2VAGA 3PRIA 4WNPA 2PPQA 3GBZA 5A6NA 2XK4A 3R7GA 4FBXA 4R77A 1Z5MA 2Y4IB 3QZHA 1OBDA 4G6NA 3PSCA 3FDNA 3D5XA 4NEUA 3FZTA 3JY0A 5AAFA 4AZWA 3M1SA 2J0JA 3MFSA 3HP2A 2WHBA 3PIXA 3TEIA 4FEVA 5LVPA 2WFYA 3LFSA 3OOGA 3R9HA 3UNKA 4D28A 5C9CA 4FMQA 5E8ZA 2G9XA 4I22A 4ANLA 1L3RE 2ZV9A 2YFXA 4HYHA 5KHWA 4X3FC 3PXYA 4GJ2A 4WNKA 2R2PA 3Q53A 2BFXA 3K5UA 3QCYA 4QMWA 2C5XA 4ZS4A 5KUPA 5CAQA 5M4FA 1REKA 2XF0A 3LXPA 5EQEA 2GMXA 3PJ3A 4APCA 4NW6A 4EHEA 4H3PA 5CQWA 4BJJB 1EH4A 4MAOA 3Q9XA 4M67A 3IONA 2PU8A 3MV5A 2BAKA 1BI8A 2FUMA 4O0XA 4FSQA 3WZUA 5A4TA 2WMBA 4HGLA 3SOCA 2VWVA 3H0YA 4QMVA 3UOLA 3HMMA 3H9RA 4KNBA 1YWRA 4NIFA 3PFYA 2Q83A 2V7OA 4S31A 4U97A 2BROA 5TR6A 2X2KA 3V5PA 2A19B 4AA0A 5T68A 3MPMA 3KCFA 4QPAA 2YEXA 5EYMA 2PUIA 3FLWA 4AGCA 3UQGA 2E9PA 4RWJA 3W2SA 1R0PA 2VX0A 2Y4IC 3MY0A 3DB8A 4RLLA 3R7UA 3VRYA 4JBQA 4GVJA 3A7IA 5HG5A 3PP0A 4DEBA 3VS1A 2BPMA 2X2MA 4ANMA 4PP7A 2RFEA 3IW5A 4TYGA 3N4VA 3F61A 3I81A 4AS0A 3VBQA 3TKHA 3CQUA 4JT3A 3GU7A 4JRVA 5BVNA 5BUEA 2ITXA 4ZSAA 3BHHA 3KULA 4D2TA 2JDSA 3DBEA 3DNEA 3ZUUA 2HXLA 3AC2A 4QP3A 4W4VA 5HORA 1OPLA 3COIA 3AKLA 3HECA 1MRYA 2VTTA 4GV1A 4QMUA 5EW9A 3VQHA 3Q4TA 2J0IA 3LFEA 3UYSA 4CKJA 1OGYA 2X6EA 4QTCA 3NUNA 1IG1A 2Z2WA 3NUXA 4I1ZA 4B4LA 1OPKA 3SV0A 3QWJA 2H34A 3QD2B 2HELA 4MNEB 3ZTXA 5M09A 3OY3A 4FOCA 3P1AA 4E4XA 3VHKA 4DH3A 2X39A 3HUCA 5A4LA 1T46A 4FTQA 1SVHA 4O6LA 4ZIMA 5HLNA 4R8QA 3U9CA 2ITZA 3QXOA 4FL3A 3OC1A 3AQVA 4GW8A 4U40A 4GKHA 3PA5A 2Y4PA 4G9CA 4DG0E 4FG9A 3AD5A 4MK0A 5I9XA 3O51A 4DBNA 5FEEA 3R8PA 5KMMA 2IVVA 3ZLXA 3PDTA 1H07A 4FIHA 5FBOA 3VIDA 5CZHA 5EHYA 4EOSA 1YOJA 4CZYB 1V0BA 2PZRA 3PP1A 3CLYA 5I0BA 3NNUA 4BCOA 3DKGA 4IJ9A 4F0FA 4Y5HA 3NWWA 3VBTA 4WRGA 1XBBA 3UP7A 4R3CA 4EH6A 2PWLA 2HWOA 5ANEA 4F4PA 2JAMA 2R3RA 2B4SB 4CD0A 4ZTHA 3EB0A 4TTHB 5HEZA 2GFCA 4LGDA 3PIYA 3Q96A 4AG8A 4O22A 4N70A 4QTBA 3D14A 4KRDA 1JOWB 4B99A 3UE4A 4D2RA 4RC2A 4RVTA 1GAGA 1NT2A 3OTVA 2IVSA 1PXOA 4ITIA 3TXOA 5DPVA 3F5GA 5AV0A 3RNIA 1DM2A 4X3JA 2OF2A 4RVKA 5EM7A 2R0IA 4XG3A 3AGLA 3CD3A 4FTTA 4ASEA 3NLBA 4RX9A 4C4GA 4ACGA 4BZDA 5BYLA 4GG5A 2VX3A 3A61A 1OITA 4YZMA 4PDOA 3WILA 4BF2A 3QTRA 4F1OA 2XK6A 3QCXA 4GU9A 5IA0A 3WF5A 5F94A 4ALVA 5C01A 4YTIA 3QQLA 1CTPE 5ETAA 1BMKA 3FMEA 4LGHA 2YAKA 4CMTA 4LV8A 4NYEA 3DXNA 2B9FA 1CM8A 3KKVA 4EC9A 4B8LA 3MH2A 3O17A 5CU3A 4BC6A 2E9UA 3C0IA 3OXZA 4NUSA 3FI2A 5AP4A 2KTYA 4AXCA 2DQ7X 4FSNA 3ZS5A 1ZOHA 3QKKA 4U81A 5J5TA 4QMTA 2OSCA 2ITVA 4F9YA 4BDDA 4RX5A 1XH4A 2UZWE 4FC0A 3VC4A 4UMRA 5EFQA 4K11A 3U6IA 3NVKI 1ZMVA 3EN6A 2W99B 4RFZA 4BIDA 2CJMA 1DI8A 3P7BA 1CKJA 3VS0A 5DYJA 3WIKA 5CWZA 5IQHA 4FL2A 2XUUA 3WZDA 1PHKA 4J53A 5LWMA 5A46A 3QTXA 5KZ0A 2ITWA 2QCSA 4RJ3A 2BDFA 5DT3A 2HZIA 3GC8A 4I5HA 5L4QA 3TTJA 4DGNA 4F1TA 2Y6MA 2BUJA 3GB2A 1Q62A 5JQ5A 3I4BA 4AP7A 4MH7A 1ZOEA 3TN8A 1H08A 2WAJA 1TKIA 4X6RA 4KD1A 2Y8OA 4BGHA 4C37A 3MI9A 3RBWA 5CEMA 1UU8A 4ZMFA 2PY3A 5AV1A 5A6OA 5KBRA 4UV0A 5ITAA 5CF5A 3UDZA 3CEKA 3ACKA 2PE1A 4ACHA 1GZKA 2ZM3A 3UNZA 4M69B 4X3FA 1BX6A 2XKDA 4O4DA 1M7NA 4E8AA 3ZBFA 1LP4A 3CXWA 4AGUA 1YHVA 1ND4A 3PLAE 5DR2A 2VTQA 3WZJA 3NNXA 3DXQA 3BGPA 5B2LA 4QDEA 3DNDA 4YSMA 2PUNA 3RPOA 2P4IA 4IH8A 4BTMA 4LFIA 5DHJA 4E26A 3UDSA 3QYWA 2IZSA 2UZLA 3HRCA 4I41A 4P90A 5FRIA 3DFAA 3ULZA 3SW7A 4R5YA 4YO6A 1G8JA 3KXMA 4JBVA 3BX5A 5I5ZA 5M57A 3II5A 5AM6A 3ZXTA 4J98A 3V3VA 4PPCA 2QO2A 4JAJA 3DAEA 4B8MA 4DYMA 2WTCA 2ZB0A 3CD8A 1UKIA 3LE6A 1B6CB 1FQ1B 2F49A 2O65A 5J9LA 3BGQA 2JKOA 2W9FB 2XAOA 4WRSA 4ZY6A 1JQHA 4NFMA 4LQMA 3HRFA 3ID6C 3PRFA 1ZYJA 4H39A 4D2SA 5IQCA 1W2DA 2I0HA 3D2IA 4EOMA 1PYXA 1IAJA 4D1XA 4DGOA 5IF1A 4FIIA 2E9NA 3OEFX 5IZFA 2X4ZA 4ZLYA 5LJJA 2PVRA 2OGVA 4TWPA 4TN6A 3MESA 5DI1A 5HG7A 1O9UA 1KWPA 3M2WA 3LAUA 4G6OA 1YRPA 3LIJA 4PMMA 3QGYA 4ZXTA 4Q9ZA 3AC8A 3FY2A 3AD4A 3SRVB 3W55A 3ZYAA 5I9VA 4O7TA 3QKLA 4FF8A 2HOGA 3EQIA 4KWPA 3FV8A 3QTQA 3LFNA 4JIAA 1YW2A 1YHWA 3TTIA 2W1ZA 3TZ7A 4DFXE 1UKHA 2F9GA 3FL4A 1U54A 1WBWA 2XKCA 3F69A 5LMAA 4AXEA 1PMEA 3S0OA 2J2IB 4BJJA 3QQJA 2XNGA 4DH5A 3Q5ZA 2YZAA 4FTAA 5TE0A 2PZYA 4DEGA 4FSMA 2PZPA 4FTLA 1CKPA 2W5BA 4PNIA 3DK6A 3ZFYA 4Y95A 3MH1A 5IDNA 4YTCA 3LXNA 3KEXA 5L8LA 5CAPA 2YN8A 4M66A 3AC5A 3ENHA 4YPSA 3R83A 2XIKA 4A9SA 4BI1A 3RMFA 4O0SA 2VGOA 4FIEA 4IAIA 4HZSA 1LEZA 3R00A 4R3RA 4A4XA 4IB0A 2BHHA 5L2WA 2WMQA 3U6JA 4NTTA 4OLIA 3FUPA 2XNMA 3KF7A 2J7TA 1TQMA 3UIUA 2EXMA 4JR7A 2WEVA 3VJNA 4DEIA 4C3RA 3KL8A 2JIUA 3NAYA 2NO3A 5JRSA 5FDXA 1E1VA 1PXLA 4EOKA 2A4LA 4W9XA 1LEWA 3PE2A 3ULIA 4ZMEA 4O0YA 1FMOE 3GP0A 3ZEPA 2WMRA 2YM8A 2C6TA 4W4YA 4JLCA 3KRWA 5IH5A 4FIJA 2OO8X 2VNWA 4KA3A 2XK9A 3KREA 4KIPA 2R9SA 4HYIA 1A48A 4C3FA 2B52A 5M4CA 3OCSA 2OU7A 2X9FA 3OOMA 2J51A 2W4JA 2YIRA 4YTFA 3ZC6A 3KK9A 4XG9A 3W18A 4F0GA 5CNNA 5KZIA 3N9XA 3V5QA 1MQ4A 2F7EE 3GGFA 2P2IA 1DS5A 4MNEA 4AZSA 1BL7A 1YDTE 4ZY4A 2HY81 4DINA 4ERKA 3RAIA 4RMZA 4Y73A 5JRQA 4IVCA 3DLSA 1XJDA 4YJTA 4OW8A 1URCA 4WNOA 4EUTA 4FZFB 2VV9A 2CGWA 5HVYA 3DFCB 3I5ZA 3DPKA 1OIUA 5L2IA 3T9IA 1G3NA 4X2FA 3KRXA 3H4JA 4C35A 1IRKA 3UG2A 3VUIA 4RIOA 3TNPC 2OI4X 4GYIA 5HX8A 4DT8A 2J50A 2VTMA 4GYGA 2FO0A 5DOSA 2YM4A 4N6YA 1HOWA 4QPMA 2F7XE 2HWPA 3PFQA 2O63A 4GK3A 4BCQA 2WIHA 4BI0A 2LAVA 4RJ4A 3FMHA 3R1QA 2A98A 3OD6X 4IFGA 3D9VA 3D5VA 2BZJA 3RGFA 4F7JA 3FYJX 4U6RA 4X6QC 5CU4A 4E5BA 2E9VA 3MWUA 1H1PA 4O6EA 5AV3A 3ET7A 3VS3A 3R9DA 4YJOA 1XH5A 4KKGA 4YNEA 3TKIA 2IZRA 3LPBA 4FV7A 5CLPA 4O7SA 3BHVA 2V62A 3TV7A 1YXXA 4P2KA 1AQ1A 2UZEA 4G2FA 4LL5A 2OWBA 4P5QA 2XM8A 4ZZOA 3NUAA 2B53A 4U45A 3KQ7A 3UIBA 3GFWA 3C4CA 3MPTA 3QTSA 3O50A 5AR4A 1W98A 4NSTA 4XP2A 3VUGA 5EH0A 4CNHA 3R21A 1GIIA 3EHAA 5HE3A 3UDTA 4Y5QA 1V0OA 3MTLA 3TI1A 4R3PA 3D83A 4TZRA 3PA3A 2YM5A 3NNVA 2C6EA 4UMTA 4AAAA 5CF8A 1QL6A 1IR3A 5AUZA 3V5TA 2ZM1A 3T8OA 3U51A 2B0QA 4I6FA 4XYFA 4XG2A 2PVNA 3G9NA 4KKHA 3VHEA 4BBFA 3QLFA 3IW8A 2E9OA 2QQ7A 2ITPA 5AM7A 3BV3A 2R5TA 1H27A 4GIHA 3QTZA 4K2RA 5J79A 4P7EA 4QMLA 3A7GA 1ZY4A 4LOQA 5KMJA 5GINE 3D4QA 3EN5A 3F2AA 4MYGA 1LR4A 5AP1A 3UVPA 4D5KA 3FMDA 4FT9A 2C69A 4EH3A 1H1SA 3RI1A 4F70A 3FY0A