4QP7A

Crystal structure of erk2 in complex with 2-(1h-pyrazol-4-yl)-5h-pyrrolo[2,3-b]pyrazine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
345
structure length
337
Chain Sequence
b'MVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Fragment-based discovery of potent ERK2 pyrrolopyrazine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 107
structure length 337
sequence length 345
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qp7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qp7A01
1PRYA 3FMJA 3NNWA 1STCE 4ALWA 3P5KA 3FXXA 2QOFA 4AXAA 3HDMA 4BGHA 2OI4X 4ORKA 4BDFA 4R1VA 3R7YA 3VBQA 2R3RA 2RFDA 3ORLA 1KV1A 4RIYB 2XK4A 4DG0E 2CNUA 3WI6A 1XH8A 3NNXA 4DFZE 5BPYA 3QCYA 4PMTA 3GVUA 3UOJA 2EUFB 4C0TA 4CTCA 2ZMDA 3FYJX 3JXWA 5CNOA 2WGJA 4MTAA 4YBJA 2Z60A 4D9UA 3ZUTA 5J9ZA 1J7IA 4PL5A 3TZ9A 4ZSLA 4UXQA 1SVHA 4G3GA 1Q41A 3MY5A 3QXPA 1GZOA 3EZRA 4LGGA 4U81A 3QHRA 4FZAB 4O22A 3BGQA 3AG9A 2G15A 1U4DA 1OGUA 4G6LA 2PUNA 2QO7A 4KD1A 4NFMA 4GUEA 4DFBA 1PYEA 1KV2A 2BIYA 4J8MA 4X7QA 2VWIA 4C62A 2HWPA 3H10A 5AM7A 5BYZA 4GSBA 3H4JA 3FC1X 1W8CA 5ACBC 5LCKA 4ITHA 4BHZA 4V0GA 3NGAA 1NVRA 2WMBA 2GNLA 2F4JA 4GKHA 4DAWA 3ZDIA 3GFWA 3PG3A 5M4IA 1MQ4A 3P4KA 5ANDA 2JD5A 4II5A 4K2RA 5BUIA 5HO7A 1OIRA 1PXIA 4D0WA 5LVOA 3MY0A 3VHKA 5BYLA 3BBTB 3KFAA 4YBKA 5ANOA 5IA0A 2RFEA 4F1OA 3WZDA 2XUUA 3DLZA 3DTCA 3BGZA 2A27A 3O7LD 3VBVA 2Z2WA 3OUNB 1JNKA 5ANEA 4TWPA 2XNOA 3KXNA 3MFRA 4FTNA 4RC3A 5CEPA 1YKRA 5KX8A 2XNNA 3JY0A 1PW2A 1V0PA 4NTTA 4MBJA 5AR3A 4FKJA 3T3UA 4RBLA 4M8TA 5FD2A 2ZM1A 4H1MA 2B53A 3DFAA 3O0GA 3UNJA 3OW3A 4O7RA 4PPAA 3VS5A 3QBNA 4EKLA 4OUCA 2EXMA 3PTGA 3QA0A 3V5JA 4W9XA 4C4GA 4NCTA 4B8MA 5EFQA 3LXPA 2CNVA 4JIAA 3IPHA 3VS2A 2ZYBA 1E9HA 3POZA 3RPSA 4JXFA 2JGZA 4MD7E 4L43A 3R9OA 2XK6A 3W2OA 5LVMA 5M4CA 1A48A 3VBWA 3Q4ZA 2X9FA 3DZOA 1R1WA 4GS6A 5LVPA 2GQRA 3P9JA 5D9HA 3FLZA 4TTHB 5L2SA 4FTTA 2OJIA 1PXLA 2VWYA 3NCZA 3WF5A 3K54A 3DJ5A 2HWOA 3F7WA 2UW0A 4FTUA 4I0RA 3OBGA 4NUSA 3RHXA 4GG7A 4KRDA 3FLQA 4O6LA 3MY1A 4E6AA 3LVPA 4QYHA 3BKBA 4ID7A 4ZTMA 2QONA 2PVLA 3RGFA 4EH8A 5IQBA 1J1CA 1JPAA 3F2AA 5I9YA 2QO9A 4LRMA 5L6OA 1G8SA 4M69B 5C4LA 3QL8A 4FX3A 4IBMA 2E9VA 3HKOA 1R3CA 4QMMA 1W82A 3W1FA 5JKGA 2HW6A 4BBFA 3NWWA 5EW8A 5A6OA 4RZVA 3JVRA 4L7SA 2XCHA 3FPQA 4CSVA 4E7WA 4Z16A 4JBVA 3DXPA 4BDDA 3C51A 2EB3A 4KIOA 4GJ2A 3Q2MA 3QALE 1GAGA 1DI9A 3DT1A 1XHAA 4H3BA 5ANKA 4F0IA 3VS4A 4MF1A 2Q83A 2OICA 4X6RA 1E1VA 5BVKA 4EOMA 1ND4A 4IVDA 4R6VA 3K5VA 3KULB 3M2WA 3FMNA 3LMIA 1H0WA 3AMBA 2XK9A 4ITJA 4ALUA 4R1YA 3R73A 3UZRA 4WHZA 3C7QA 4E1ZA 4F64A 2FSLX 2WIHA 3I0QA 3LJ1A 2QOIA 4FIGA 4J53A 3KRWA 4YZDA 5JRSA 2QR8A 3BU6A 3D2KA 2ITYA 4DG3E 2BROA 3P7CA 3NW7A 4GH2A 3NVKI 2V22A 2ACXA 5IA3A 3C1XA 5HIDA 2PZRA 1QL6A 4NFNA 4WG3A 3FL5A 2XIXA 5L8LA 3BWJA 5EKNA 5LMBA 2J0LA 4YJNA 1UNGA 1V1KA 5I9VA 4EOKA 2IWIA 5KMNA 3HMPA 1OUYA 4KA3A 4ZP5A 3S2PA 3SDJA 4AA0A 4CD0A 4DITA 4MWHA 4CFNA 3F61A 2GS6A 4OTIA 3A7FA 3LCSA 1F0QA 3A99A 3KQ7A 4G5PA 4QMLA 3SAYA 2W9ZB 2CN8A 3ENHA 3QGWA 1LP4A 4D2RA 2XEYA 2BHEA 3F3WA 2YJSA 3GC9A 4DEAA 4FUYA 2OXYA 1E1XA 1SVEA 4ZS0A 2RG6A 3HRBA 4HZRA 3RI1A 5EG3A 3FZTA 5CU2A 4R5YA 2VGPA 4OBPA 4AACA 2PE0A 4EEVA 5IEXA 5J7HA 5GNKA 3R7GA 3TACA 2W1GA 4TN6A 5BYYA 1WBVA 5HD4A 4KNBA 4U7ZA 5BVDA 5M51A 4E4XA 3PJ2A 3PE2A 1G3NA 4WT6A 3UOKA 5HD7A 2CLXA 4AN3A 4UX9A 1WBNA 1YI4A 3COHA 4TXCA 3JPVA 3ZDUA 3NYOA 4YSMA 3LCKA 5AAEA 5A3XA 1SNXA 2PVMA 3W33A 3ZHPC 2BRBA 4U43A 4MXOA 4PDOA 4ZAUA 4ZJJA 4EORA 3PSDA 3D5WA 4D4RA 3KN5A 4QMSA 1FVRA 4RVKA 4WRGA 2Y9QA 3GGFA 1SYKA 2PMIA 4I93A 4G3FA 4U3ZA 5JFXA 2OH0E 4BDBA 1MQBA 1ZYDA 3FBVA 3NUSA 3LFNA 4QP2A 4C61A 3UPXA 1OL1A 4RVLA 2QQ7A 1GNGA 5IH5A 4HVGA 3PUPA 2W06A 3Q60A 2YLFA 4LV8A 5L2IA 4GG5A 3FWQA 1JKSA 4RGJA 4XJ0A 1RDQE 2VO0A 2CN5A 3FL4A 3OS3A 4GK3A 5CQWA 1UU8A 1BX6A 3EMGA 3C13A 3H30A 5DIAA 5M56A 5H8GA 3KL8A 2IZRA 2R3PA 3UNKA 3DZQA 3C5UA 5GHVA 3RNIA 3QF9A 4FG7A 3JY9A 4ANNA 4U80A 2XBJA 4F7SA 1Q99A 4I4EA 3KU2A 4G16A 4TZRA 5HVJA 2C6DA 4C3FA 2UZTA 1VZOA 2WQOA 1PXPA 4HGSA 1AGWA 4PL4A 3UIMA 3F69A 2YIQA 3VBTA 5HBHA 4FV6A 4EC9A 2V7AA 2XVDA 1XH6A 4LUEA 4EOPA 5AJQA 3VN9A 2YA9A 4L52A 3TTIA 3QD2B 4U41A 3WZEA 3QC9A 2YAAA 3P1AA 1PMEA 3UTOA 4ALVA 4DEDA 2W7XA 4NW6A 2VTQA 4QP9A 3ID6C 2H9VA 4YUQA 3MVJA 4UWYA 3R6XA 2YWVA 2IO6A 1UNLA 4AZSA 2IW6A 4XP2A 4FTAA 1JSVA 3THBA 4DGOA 4W9WA 5CF5A 5AV3A 5IA4A 4CYIA 4C59A 4TL0A 2PUIA 4G2FA 1DAWA 3FMHA 5DE2A 4EKKA 3FZSA 5HU9A 4CGAA 4CV9A 4GFGA 4QTCA 3UVPA 2V5QA 4NM3A 4CZUA 5AAGA 5B2KA 3ALNA 3NEWA 3PSBA 4DFLA 3Q4CA 3U51A 4L9IA 2BCJA 3HV5A 3R8LA 4N57A 2PMNX 2ITQA 4FV2A 4EJNA 5KMIA 5H8EA 2FSMX 4A4XA 1KE7A 3UYSA 4EOJA 3AC2A 4QMNA 4AOTA 4BY9E 3L9PA 1I44A 2XIKA 1Y8YA 4YHFA 5K5XA 4FTQA 3E92A 4RZWA 5J7BA 4ZTSA 4EJ7A 2XIRA 1YOLA 4U9AA 2BMCA 2IJMA 4EZ3A 4ZTNA 3QKKA 4J98A 4LOPA 4FIIA 2RFSA 5BUJA 4QT1A 4FKSA 3LFBA 5HVYA 3OHTA 2W96B 3PXZA 1FGIA 1OKWA 2UW4A 4C36A 5KCVA 3WZJA 3HVCA 1Y91A 3QKLA 4BZNA 5K5NA 5T3QA 2XBAA 5KKRC 2OF2A 2W1EA 4I94A 4XG8A 4D2VA 4FGBA 2LGCA 2VWXA 4FL1A 2UZLA 2QC6A 4LYNA 4QQJA 5ANIA 1YDSE 4DGLC 4QMYA 4ERWA 5JQ8A 2PE2A 2IG7A 3H3CA 4MXAA 3FY2A 1OI9A 5CWZA 5AUTA 1LR4A 3DY7A 4BBEA 5AP2A 3ELJA 2OH4A 1J1BA 5A4TA 2HELA 3GCVA 4WNMA 5KZIA 3ORXA 3P86A 3QTZA 3VS7A 4QP4A 4O81A 5EYMA 4MF0A 3LOKA 2CKOA 3R1QA 4EOIA 4D1SA 3UP2A 1IR3A 2HY0A 1H0VA 1YRPA 4L6QA 1JAMA 4U40A 2OGVA 2R3MA 2YABA 2OO8X 3RWQA 4O0WA 2VTAA 4J52A 4PUZA 5CX9A 4AAAA 5IQEA 4G6OA 3DK7A 2YM4A 5EHOA 4GFMA 5C03A 4B6LA 5GZAA 4FGRA 4FKLA 5TO8A 2Z7QA 5IEYA 2XNPA 3UPZA 4C2WA 4I5CA 4AFJA 3S3IA 3ZFYA 4G3CA 4DA5A 2B52A 3KMMA 3NLBA 4FE2A 2F7ZE 3HYHA 3AC3A 4BTKA 3C9WA 4PTEA 1Q8WA 2J4ZA 4FBXA 4RJ5A 1KE9A 3DDPA 3EWHA 4FTRA 3WBLA 4EI4A 1DAYA 1O6KA 2UW6A 3DBEA 1V0BA 4FT7A 4LOQA 3UIUA 4JG7A 5B7VA 4XBRA 1JKTA 4RC2A 3KMUA 3KMWA 4GFOA 4MYGA 1CM8A 4DHFA 2C6EA 3GC8A 3S00A 2YISA 3BHTA 2HAKA 3HMNA 4XOYA 3ZM9A 1ZY4A 3OOGA 2QOQA 2RG5A 3BLRA 4PX6A 3H9OA 4W8DA 1VYZA 3PXYA 1YXTA 3N4UA 3QXOA 2CDZA 1H00A 2R0UA 4FIEA 5DN3A 1MP8A 4QPAA 3T8OA 4UY9A 3HEGA 4ACHA 4JL9A 3ORNA 4IWOA 3FSKA 3BQCA 3PFQA 2R3IA 3EQPA 2ZB0A 2F9GA 5D7AA 5KZ0A 3LM5A 4O7LA 1JOWB 5AUVA 2A1AB 5HTBA 4EOLA 4TYJA 1WVWA 3NZ0A 2I0YA 4YC3A 2ITVA 5LOHA 3PJ1A 4YZCA 2WEVA 4EOOA 3R22A 5ACKA 4C4EA 3OD6X 3PVGA 2J7TA 1HCLA 3UVQA 4FTJA 2UZEA 1ZYSA 4F9YA 5H8BA 3DKGA 3P23A 5EQYA 2ETKA 3E88A 3PRIA 1RW8A 5E1EA 2BIKB 3GU8A 3WE4A 4Y8DA 1L8TA 4I21A 5IUGA 5FTOA 2OBJA 3ERKA 2VTRA 3Q5ZA 3RALA 2C47A 3CTQA 4QTBA 2QCSA 2IVVA 1KE8A 3SD0A 3ZONA 5AUUA 3KC3A 5KKRB 4RMZA 2Z02A 4AFEA 2UW5A 2O2UA 3KXHA 3MI9A 3K5UA 2HZ4A 5FXQA 3LKMA 5HICA 2ITOA 2WQEA 4XG4A 3PJ8A 5AWMA 3K3JA 5L2QA 2J0IA 2WMUA 3F88A 2J0JA 3HV3A 3HA6A 4D1ZA 1OL6A 1I09A 2GQGA 3CLYA 4G1WA 4FKRA 3L8PA 3NIZA 4E5BA 5EK7A 4RFZA 4Q5EA 3DDQA 5IZFA 4YSJA 3Q9YA 5HIBA 4PNKA 5FTQA 4XEYA 2R3KA 3AMAA 2NRUA 4YHJA 3VQUA 2WAJA 4B9DA 3CGFA 4RPVA 4E4NA 1Y6AA 2UVZA 3EL7A 2QOCA 3HL7A 2PK9A 1U46A 2V7OA 4IAIA 5CT7A 4DGGA 2O3PA 4XOZA 4ERKA 2OZAB 4RX9A 2B9FA 2ZAZA 4HZSA 3QQUA 2Y6OA 1W83A 3HV4A 4FG9A 4O7ZA 3IQ7A 3ZH8A 4FSTA 4N0SA 4DTBA 4FSUA 4JX7A 4CMOA 4QMZA 4PDYA 4L7FA 3LFFA 5CU0A 4USFA 5HBEA 4R3RA 4S34A 4IVCA 4MKCA 5EDRA 2XM9A 1UU7A 2JAVA 5HTCA 4FTLA 3KXMA 1XKKA 4MXYA 2P55A 5CAVA 5I5ZA 3GQIA 5CLPA 4YNOA 2QODA 3FXWA 4BCHA 2WMXA 3FMEA 3L8VA 3OMVA 2R3OA 4DGNA 4BDEA 2P3GX 4KIQA 5L2WA 4FK6A 5HG5A 2XF0A 5CALA 4BDGA 2ITZA 4QPMA 3RZBA 4R7BA 2UW8A 4CQEA 1X8BA 3PPKA 1H1SA 4JIKA 4KIKA 4TYEA 4DFUA 1BLXA 5M08A 3ZM4A 2ZOQA 2XIYA 3F5UA 4JR3A 4IW0A 1XO2B 3IOKA 4YLJA 5DR9A 3V6SA 4PMSA 3FC2A 4U6RA 1NVQA 4FSQA 5C27A 1BL6A 5I0BA 5IMXA 4N4SA 2VTIA 2Y0AA 3QX4A 4PPBA 4OAVB 3PLAE 3LW0A 3GP0A 5DNRA 4OTGA 4DH1A 4QMTA 3SRVA 5AR8A 2X6DA 1OL2A 4JJRA 4EHEA 3PSCA 3ZC5A 3OWLA 1K3AA 2Q0BA 1IASA 4IM0A 4A9TA 3NW6A 2WHBA 2RSVA 5HESA 3CP9A 4QOXA 1BKXA 1YWRA 3NIEA 4CNHA 5FDPA 2CKQA 1ZARA 2JC6A 5EDPA 3PPJA 2I1MA 3R63A 1QCFA 2ZV9A 3QKMA 3R8UA 4GCJA 5C8MA 4YZMA 5J1VA 2JBPA 2HW7A 3VS6A 1GIHA 4AW0A 3GCQA 4K11A 4YJOA 1KOAA 4JNWA 1GZKA 4IANA 3ZXTA 4R3CA 4U45A 1RQQA 4BCGA 3ZUVA 2C6MA 3VHEA 3WE8A 4CKIA 1HCKA 5CTPA 5CXHA 5AP1A 4Y73A 3RINA 3S4QA 1UWHA 2XYUA 4BRXA 5A9UA 1IA9A 2VWBA 2G2HA 2WIPA 3MWUA 2CGXA 1RE8A 3KRJA 3O8PA 3ORPA 3Q32A 4FL2A 1SMHA 3COIA 4NSTA 3QTRA 5E8UA 5HLWA 3RM7A 2GQSA 4YZNA 1EH4A 4F63A 5HNIX 3W8LA 2BUJA 2VD5A 4FVPA 4YTHA 4I20A 4AZWA 1IA8A 3O51A 3VUIA 4O1PA 4USEA 1AD5A 3G5DA 3C0HA 3CD8A 4F4PA 4A9SA 5M09A 5HO8A 4CCUA 4AU8A 5ICPA 1FBNA 4QRCA 3V5LA 3MTLA 4C4HA 4DEGA 4PV0A 3JS2A 2YLEA 3QQJA 4E4MA 3DBQA 3FAAA 4YZ9A 4RA5A 5AEPA 3P79A 3EQGA 3OWJA 3BV3A 2NNWB 4JDJA 3ZZWA 3IW6A 5GZ9A 3PP0A 2BHHA 3VUDA 5BNJA 2OLCA 1Q3WA 3PWYA 5CANA 4F0FA 3MJ2A 4WIHA 4ZLZA 5J5SA 2XNGA 5JFSA 4TPTA 4ZLOA 4AW2A 1YDRE 2W1DA 3V8SA 3ZSGA 2QO2A 2UZDA 3GENA 3E7VA 4ZTQA 4AGWA 3E8DA 3R04A 5A54A 4D1XA 3E8EA 5IG1A 3PJ3A 1PMVA 5FGKA 2R3NA 1XQZA 2C6LA 3ZTXA 3KVWA 4NTSA 4UB7A 1XR1A 3CD3A 4L67A 5DWRA 4ZTLA 3UQGA 5CF6A 2WXVA 3ENMA 3P7AA 4HGLA 2FVDA 2XNMA 5KMKA 2C0TA 2W05A 4OTDA 4Y72A 3S95A 4PWNA 4GRBA 3WZKA 1H1RA 3GOKA 5HKMA 2G01A 5LMKC 2JLDA 3E64A 1OVEA 3Q6WA 3IG7A 5FRIA 4O86A 3FE3A 1Q61A 2YM7A 2BDWA 2AYPA 4FEUA 4G17A 5C1QB 3WOWA 4I23A 3BEAA 2GPHA 4FSZA 5ETIA 5D1JA 2Z7RA 3TUBA 4MAOA 5DA3A 3PDTA 4UEUA 3UMWA 2BRNA 3CJFA 4AE6A 3WIKA 5CQUA 4QP6A 3UO6A 3QWKA 5HEZA 2C68A 2F7XE 2Z8CA 3VIDA 3TKIA 5AV2A 2DS1A 4X2JA 1PHKA 1UWJA 5EW3A 3BE2A 2V0DA 1H01A 2UZNA 4W4WA 3MB6A 4IVAA 3UG1A 5HORA 2BZJA 4Z3VA 1OIUA 5EW9A 4AZTA 5TE0A 1ZYLA 3AQVA 5CSWA 2PU8A 5ITAA 4MXCA 4Y83A 3WF7A 1YWVA 3IW5A 2J6MA 3QQHA 4IVBA 3DTWA 3LFQA 4FIHA 3W18A 3SW7A 4X3JA 2J0KA 3OUKA 2FSTX 1A06A 2WU6A 3FKNA 4UYNA 5E90A 4OTHA 1JBPE 2BILB 4MHAA 4YP8A 3SXFA 2W99B 3C50A 2ONLA 4RIOA 4LL0A 4RFMA 4FTIA 5BMSA 4EBWA 4NWMA 3FQHA 3RAKA 5HOAA 4R77A 1DI8A 4XBUA 4KSQA 4I5PA 5KHXA 3QTIA 1BYGA 3E62A 4GEOA 1OPKA 3A7GA 3LFEA 5HNGA 3KF7A 4ZJIA 3B2WA 3I5NA 5AADA 3E87A 4IXPA 1WAKA 2BAKA 3D9VA 2C69A 2GHGA 4JBPA 5AMNA 4QMPA 4NCTC 4ZIMA 1MRVA 3MH3A 4ZS4A 4I0TA 4WSQA 3HNGA 2R3FA 4PF4A 5CAPA 1O6YA 1YOMA 1PXMA 2WO6A 3KGAA 3A4OX 3VS0A 2E9UA 3UP7A 2ETMA 2AUHA 2XM8A 4YTIA 4C7TA 1CMKE 3ACKA 4QMOA 4ZJVA 5J9LA 2QU6A 3ZLXA 4F6SA 2XB7A 5AAFA 3W8QA 4DLIA 4RLLA 4ZK5A 3FEGA 4QMWA 3QQKA 3R00A 4AP7A 2XK7A 4M97A 4OTQA 4FZDB 5GJDA 3BHYA 4NYEA 4BWXA 1MRYA 5IUHA 4O7WA 1UA2A 4O2PA 5JZNA 1YHVA 4BR3A 4W4XA 2V62A 5HG9A 4BDAA 3DK6A 4R7IA 3ROYA 4V05A 4XV3A 4D58A 3F6XA 4BDIA 3R7VA 3L9MA 4XLIA 4C4JA 4J97A 4E73A 3R28A 5DVRA 1J91A 4BTFA 2NP8A 5IDNA 2XJ1A 2NRYA 4CMTA 2CKPA 1RJBA 4WG4A 3PPZA 3BRBA 4TYHB 2R64A 4L00A 1R78A 3QX2A 5T68A 2VWZA 4FKTA 4TKSA 4OW8A 3HA8A 3QUPA 1URCA 4M67A 4AX8A 1FPUA 2CNQA 3C5IA 3KREA 4HGEA 3DPKA 4FODA 2ITNA 2B7AA 4IWQA 4FT5A 4R3PA 4DF3A 3CQUA 4RIWA 2XK8A 3TNIA 4YJUA 1JWHA 2ZDUA 4C38A 2BKKA 4PRJA 2CHLA 2BVAA 4X2KA 4AT3A 3OZ6A 2C4GA 3BYVA 4RX7A 4YLLA 3NVMB 3LAUA 4FI1A 2YITA 4O96A 3UBDA 2FUMA 2PVKA 5EQEA 2CMWA 3KK9A 3ZLYA 1G5SA 3L9NA 1HOWA 1AQ1A 1GZ8A 5KMJA 5L3AA 4FF8A 1YWNA 2E9NA 4JDIA 4RJ4A 4V0GB 3R7IA 3WZUA 2C3IB 5K0KA 4AWIA 4LUDA 4IWDA 4TNBA 1BI7A 4IDTA 3MGYA 4ACCA 3PA5A 1TKIA 3E7OA 3BYSA 1ZY5A 4FTCA 5E8VA 3IDPA 3EKKA 4IC7A 2I6LA 3O96A 4DYMA 4M66A 4MBIA 4CT2A 4IZ7A 4DEHA 2XRWA 2XIZA 2PSQA 3MFTA 3VQHA 3D94A 3UQCA 4E6CA 1P5EA 3C4CA 3OOMA 1R0EA 4E20A 3D15A 2J0MB 2R4BA 3M11A 4GIHA 4MEDA 2WELA 4UBAA 3EH9A 1KWPA 2VGOA 2R3QA 3HX4A 4XCUA 5HG8A 5ETFA 5HQ0A 1VR2A 3GT8A 5LMAA 5ANJA 1NA7A 5IMEA 4HYUA 2QLQA 2DWBA 1ZMVA 4WRSA 3H0ZA 5M57A 3I7BA 5HI2A 2A2AA 4C37A 4YZBA 2B9JA 2ZDTA 3E63A 4E6QA 4XV2A 2ERZE 5KO1A 3BEGA 4IDVA 4TWCA 4O84A 5F9EA 3LJ2A 2W5BA 3DAKA 5DG5A 4ACMA 4O7SA 4MD8E 3K2LA 3RAHA 4G6NA 2GNIA 4JQ7A 4NIFB 3TZMA 2VTPA 4KKGA 5CI7A 3OBJA 3HMMA 1IAHA 3ZS5A 4DCEA 2WMVA 4YPSA 2ITPA 5DEWA 3NR9A 3W2SA 4BBMA 5A4EA 5HBJA 5L8KA 1Z9XA 4PPCA 4BC6A 4O38A 4BB4A 5JRQA 3A4PA 2JKOA 2YEXA 5I9XA 3IECA 3LE6A 3DA6A 5BQ0A 4D2WA 1WBPA 4IB3A 4OT5A 4RT7A 1QPDA 2R0IA 4MNFA 4XH6A 3KKVA 3CE3A 4KB8A 4OTWA 4HVIA 1PXJA 4FTMA 5IQIA 4X21A 2PZYA 3IKAA 3QRJA 2J50A 3TEIA 4DINA 5IA1A 4FKOA 4CFFA 2X4ZA 1JKLA 4PL3A 3TCPA 4K6ZA 4CG8A 2VTSA 3E3PA 3PY3A 4IZ5A 5BVFA 4X2FA 4XUFA 5E8SA 2DYLA 4BIDA 5A6NA 4M0ZA 4BTJA 3KK8A 4RJ6A 4U8ZA 2RKUA 3FZRA 3D4QA 2C5NA 4RC4A 4JBOA 4MVFA 4BFMA 3EN9A 4XLVA 5BVEA 3RPYA 3D14A 3R8ZA 2GHLA 5I4NA 3Q5IA 4H39A 4JS8A 4DH7A 3NUNA 4JG8A 3LQ3A 5DT0A 4IB1A 2VTTA 2XCKA 4QTAA 5EM8A 4BVUA 3TV7A 1JKKA 4YPDA 3EQBA 2QG5A 3O8TA 4WUAA 2OIDA 4J95A 4EHVA 2I40A 3EL8A 4BZOA 5CAOA 4OR5A 2ZJWA 2C6KA 3EFLA 4EOSA 3A62A 4TNDA 4I24A 2W4JA 4L68A 3F5XA 4CFVA 2OFUA 4DTAA 4F08A 3BELA 2WTKC 1VEBA 4UMRA 2ZMCA 3BHVA 5GIPE 3VULA 5K4IA 5F4NA 4S32A 4K18A 4Z7HA 5KBQA 3BYMA 3H0YA 4GW8A 4JDKA 2A19B 4LMUA 1F3MC 2Y4PA 3NAYA 5CSHA 5E8XA 2QNJA 3ODYX 1M2PA 3EN7A 4AA5A 4E5AX 3CKXA 4D5KA 4EQMA 5A4LA 4ZSJA 4XG7A 4D4SA 3FY0A 3CY2A 3Q9XA 5EKOA 4WSYA 3JVSA 2I0EA 4BIBA 4AOIA 3SG9A 4FV8A 2I7QA 3D5UA 1T46A 4JR7A 1WBTA 2QOKA 4RJ7A 3V5TA 4A4OA 5DT4A 4BCPA 2VAGA 2VO3A 3G0FA 3RWPA 2GNJA 4F6WA 2GU8A 3BCEA 3D2IA 4P7EA 2O65A 2ZVAA 3DU8A 3I79A 3KXZA 3NW5A 3C4ZA 4GU6A 4HPUE 5CEQA 5FXRA 1BUHA 3Q4UA 4WBBB 4L45A 4QYFA 4MNEA 2FA2A 4ZMEA 3QU0A 4O1OA 2PVYA 3QYZA 4BCOA 1IRKA 2Y7JA 2WB8A 1K9AA 2X9EA 4FV9A 3RP9A 5C8NA 5LWMA 1OITA 1UU9A 4UN0C 1UU3A 3RPRA 3R0TA 2RF9A 2W4OA 2BR1A 3LCDA 4AW5A 4GK4A 4XV1A 3PIXA 3DJ6A 4FTOA 2VV9A 2VTLA 3Q4TA 3FV8A 2XKEA 3R8MA 4KUJA 4E4LA 3ODZX 2C5YA 3EN5A 4ONAA 4YURA 5IDPA 3MSSA 4R7HA 4RG0A 4F0GA 4GT3A 4PNIA 5BUEA 3QD4A 3DKCA 2WEIA 4KWPA 5CAUA 4BKZA 1K2PA 4XX9A 2OW3A 3ZFXA 4BCJA 3MESA 3BIZA 4FEXA 3VUTA 4YU2A 1M14A 4CCBA 3UOLA 1H1QA 2J90A 4AE9A 4FIJA 5M44A 3FMDA 3MFSA 3HMIA 1KE5A 4YO6A 2Y6MA 3AMYA 4FT3A 3QZIA 1LEZA 3DXNA 3QGYA 4J7BA 4CFWA 4FKPA 2X2MA 2XP2A 1PXOA 4AN2A 1FVVA 2HXLA 2UW3A 1PYXA 4NEUA 3PG1A 3UDBA 3FKLA 3ET7A 4EQUA 3FKOA 4BCMA 3ANQA 2R7BA 1M7NA 2F57A 3FZPA 2JDTA 2JDOA 3L8XA 4YR8A 2QU5A 2VRXA 2ITUA 3QTSA 4ZXTA 3NUXA 5B2MA 2J51A 2CKEA 3CPCA 3Q2JA 5HVKA 2C0OA 3NS9A 5DR2A 2BTSA 4YMJA 2BAQA 4GT5A 1UVRA 4C4IA 4HCUA 5DRDA 3AT3A 3I6UA 3MW1A 2QURA 1GY3A 5FXSA 1ZOHA 2W5HA 3VBXA 3WYXA 2CPKE 5AR5A 4GMYA 5LXMA 2WTKB 4EHGA 3BPRA 4R5SA 3AGMA 4AGCA 2VO6A 4EH5A 1PXKA 4EK4A 3R2BA 2P4IA 5EYDA 5CEKA 2WMSA 5HE2A 3W16A 3SLSA 5FBOA 3SG8A 5HCYA 4G3EA 2WTCA 3M1SA 2JFMA 4P90A 1QPCA 3OVVA 3LPBA 1ATPE 3QA8A 4CKJA 3FQEA 3ZLSA 3BYOA 3TL8A 2DQ7X 4UMPA 4UALA 2UV2A 4PTGA 5F95A 1U54A 5CZIA 5F20A 3I1AA 1ZRZA 3QD3A 4ZY5A 4IAAA 4GJ3A 5D41A 4B8LA 3PRFA 5TT7A 4BZDA 2F2CB 5M06A 3DBDA 2FH9A 4FKGA 1P2AA 3EQIA 4XNEA 5L4QA 2IPXA 4FV0A 3DNDA 4TYIA 2EXCX 4OTRA 3PXRA 5CYIA 2UZWE 3T9TA 1F5QA 4DC2A 4O0UA 3BWFA 3AT2A 3ULZA 3FLSA 5CVHA 3TZ8A 3VUKA 5E9EA 1L3RE 3EIDA 3HDNA 3C4WA 5FWKK 3OXIA 5E1SA 1Y8GA 2YN8A 4YO4A 4FV4A 4LMNA 3KXXA 3ZEWA 4FSWA 4F9WA 1XWSA 4C35A 1NW1A 2VO7A 2X4FA 2GTMA 4Z9LA 3SX9A 4EK8A 4KKEA 2YDKA 5EQPA 4F7NA 1ZMWA 3B8RA 4R8QA 1H1PA 4UZHA 3G90X 3V8WA 2VN9A 1Q8ZA 4APPA 4X3FA 3II5A 1Y57A 2J5FA 4DCAA 4BCNA 1V0OA 3HLLA 5E8ZA 1FGKA 1XBBA 4EONA 5DMZA 4QNAA 2UUEA 3H9FA 4N6YA 3SHEA 1LEWA 2VUWA 3BZ3A 4FNWA 2YZLA 4G31A 3MH1A 3CJGA 3ZRKA 4HNIA 2R2PA 5IQDA 2SRCA 4IM2A 2WOTA 1H26A 3I7CA 5K3YA 5LQFA 4Q9ZA 4WBOA 4CFXA 4XP0A 1YHWA 3HZTA 3W2RA 5DR6A 1TQPA 3ATTA 4WNPA 2P33A 3QZFA 5EM7A 3TJDA 1TQMA 4AZVA 4RWLA 3UNZA 2C3JA 4H58A 4CZYB 2XS0A 2GS2A 4KS8A 4NW5A 4CMUA 2OKRA 3DB6A 4QTEA 4QMQA 1LPUA 4GIIA 3QTXA 5DI1A 2WQNA 4LGDA 3D83A 2PY3A 3R30A 4MWIA 1Q8YA 3FI2A 4ASXA 5BVNA 3S1HA 5M07A 1W0XC 5CVGA 3CBLA 3E3BX 3RZFA 5AP4A 1NVSA 3RM6A 4PMMA 5J87A 3WIGA 1WCCA 5I3OA 2WU7A 5JMSA 4OT6A 4AG8A 1OBDA 4DE4A 4EH9A 3RKBA 3NX8A 5IEVA 5JN2A 4O0YA 3MPTA 3Q9WA 1M52A 3EHAA 3AD5A 3FDNA 4KRCA 1TQIA 2P0CA 5DYJA 4BGQA 3TXOA 1APME 4E93A 3U6HA 5AFVA 1XBCA 1P4OA 3F3UA 1JVPP 2NO3A 4U79A 5HNBA 4ZY6A 5CU6A 3V3VA 4BYIA 5C8KA 3FYKX 4YJPA 1P14A 3WF9A 4CYJA 4FKVA 2B4SB 3LLAA 3V01A 3KCFA 4UMUA 3D7TA 5JFVA 4FV3A 3ZEPA 5IQGA 2UZOA 4FZFB 2WTJA 4E8AA 1JSUA 3C4XA 4FR4A 3AD6A 1U59A 4XRLA 3MVLA 3EQDA 4H3QA 1H1WA 3F82A 5HX8A 1CKPA 2XEZA 4WD5A 3T9IA 4ZY4A 3IDBA 1XH5A 3VUHA 5K9IA 3NUUA 2PMOX 4KINA 1CTPE 5HLPA 3ZZEA 4AQCA 4F9AA 4IC8A 4OBQA 3OP5A 3MIAA 4BWPA 3QRIA 1CSNA 3ITZA 2X39A 4QPSA 3V5WA 3OFMA 4FOBA 3OCGA 4HCTA 4WNOA 4BCFA 4BI2A 2G9XA 1UKIA 1S9JA 2C1BA 2IZTA 3R8PA 3W55A 4KBCA 3RK5A 3DS6A 4A9RA 4ACDA 3SW4A 3TNPC 3OROA 4Y5HA 4BDJA 1FQ1B 2VTOA 4YC8A 3WYYA 4RIXA 5FG8A 4FV5A 3PWDA 3Q9ZA 2HY81 5H9BA 4JDHA 3V5PA 2PZPA 4DGMA 4G9CA 4S30A 3QCXA 3TUCA 5FP5A 3NRMA 4O0SA 3ULIA 3TJCA 4AUAA 3AGLA 4MH7A 3DKFA 3I6WA 3TI1A 4K33A 3FZOA 4RWKA 4ANMA 4IH8A 5GZ8A 1H07A 5KHWA 3DXQA 4JRVA 4W4YA 2QOOA 3EOCA 3GNIB 3KVXA 4QMVA 5F94A 4NM7A 1PMUA 4IX6A 1OPJA 5C9CA 1JLUE 1PJKA 3AOXA 1MRUA 4XG9A 5CEIA 4IACA 4BI0A 2P2IA 4M84A 3DAJA 4KIKB 3ORMA 4AN9A 3F3TA 4C3PA 3R71A 4YHTA 3M42A 2O64A 5AP7A 1OECA 5ETAA 4XYFA 3SKCA 4F65A 3R2YA 4ZEGA 3TNQB 3BHUA 1OL7A 4RRVA 1OKYA 2P2HA 4TWOA 4QQTA 3SRVB 3E8CA 2H8HA 3DQWA 3G9NA 4V04A 2LAVA 3HUBA 5CXZA 5EI2A 2PHKA 3FUPA 2F7EE 2QI8A 2HYYA 2VWWA 2ERKA 3FI3A 5B0XA 4HVSA 2RFNA 4O0XA 3VAPA 3SQQA 1OKVA 2BRGA 3LXKA 4EHZA 3MIYA 5FEQA 2CGVA 4D55A 4F7JA 2JAMA 4FOCA 3UG2A 3KEXA 4Z55A 4TWNA 5CS6A 3RPOA 3UOHA 4TYGA 2ESMA 3COKA 4YJTA 3AT4A 3EJ1A 3GC7A 3N51A 4GVAA 4LV5A 2QHMA 5C4KA 1XH7A 4P5QA 2YCRA 3UIBA 4ARKA 4XV9A 1CKIA 5EOLA 2I0HA 4PY1A 1VYWA 4F1TA 3UC4A 2O63A 2C3LA 2B9HA 3A61A 3BYUA 5DEYA 3UODA 4IX4A 4I41A 5I9UA 3MVMA 4ANSA 5B2LA 5GJGA 4XG2A 4ASZA 3OWPA 4IJ9A 3MH0A 5H3QA 3HP2A 2VNYA 3QAME 4IFGA 4F9CA 4YGAA 5KMMA 2I0VA 4XMOA 3C0IA 3EYGA 4FICA 4NK9A 3RBWA 2ONLC 5CSXA 3U6JA 2XKCA 1GZNA 4I4FA 5CU3A 1P4FA 1REJA 3MPMA 2FO0A 5FLFA 2X7OA 4I22A 3F7ZA 3IGOA 4AZFA 5AA9A 4CFMA 1J7UA 3BU3A 2C5XA 4RJ3A 5J1WA 2FSOX 2B9IA 4RQKA 2ZV2A 4YJVA 2F2UA 1M2QA 4LGHA 5FP6A 4D4YA 2IW8A 2BZHB 5BMMA 4C57A 3MA6A 1JSTA 2WMQA 5IQCA 3QQFA 3OXTA 3LFDA 1W84A 3G51A 5FQDC 3ZRMA 3QUDA 3QUEA 5CEMA 1WFCA 3LCOA 2OXXA 4DG2E 2OJFE 1BL7A 3ORIA 4HVDA 4ZZMA 2WD1A 3GEQA 3GQLA 3OY1A 1WVXA 4JI9A 3DFCB 5CU4A 2DUVA 2H6DA 3NNUA 2OWBA 3SOCA 5TKDA 3CIKA 5IH6A 3VW6A 4FZ6A 3L1SA 4OBOA 5AP5A 1U5RA 3W32A 5HX6A 3ZBXA 4I6QA 4RIYA 2REIA 5CF8A 3GU7A 1YXVA 2B1PA 4AS0A 3ORKA 1ZXEA 4O21A 5EM5A 3RAIA 3CY3A 3P08A 3PZEA 2VU3A 3VW8A 5A4CA 2JIUA 4FK3A 5EH0A 1Z5MA 4BL1A 2IZSA 2HIWA 2O0UA 3MVHA 4FIFA 1GJOA 3AC1A 4FSRA 2IW9A 1TVOA 3UVRA 2JBOA 4KABA 2X81A 3TV4A 4PP9A 4U42A 3OT3A 4GV1A 3R1SA 1REKA 5EYCA 5CENA 3K3IA 2YCSA 3I0OA 3BE9A 3QD0A 5E92A 2X8DA 1NXKA 4GU9A 3EQRA 3RPVA 1O9UA 4CZTA 5FM3A 5JK3A 1Q97A 2EVAA 3O50A 2GFCA 3TM0A 2R3HA 2BFXA 4O7TA 1ZYCA 3U8WA 5HE1A 5HCZA 3KRXA 3EKNA 1PF8A 2WFYA 4YTFA 4F1MA 2NPQA 3ALOA 3R9RA 3EFJA 1WMKA 5E7RA 1XBAA 3LXNA 4JBQA 5CY3A 3R7OA 2Y4IC 1YI6A 1H25A 4HOKA 2YIRA 3NUAA 5AUZA 3F5GA 2YHVA 1UKHA 4IADA 4U44A 4X2GA 3U4UA 4EH2A 2PVRA 2C5VA 4QQCA 2X1NA 5J95A 3UIXA 3O71A 4B4LA 4JRNA 3SC1A 3VRYA 2UZVA 2G2FA 3Q96A 4FYNA 3SXRA 3ZCLA 3R02A 2A4LA 4YJRA 2ITXA 4TYHA 5LMKA 4FNZA 5AX3A 3LFAA 4FZ7A 5DPVA 4DEBA 5DH3A 4AT5A 1Q5KA 2C6IA 4Y5QA 4BYJA 4ANLA 3AC5A 4YJSA 3DK3A 1G8AA 3TKUA 4CT1A 1KSWA 3FLWA 4K9YA 5LVLA 4KIPA 5AV0A 2QD9A 3CQWA 4QMXA 4ZSGA 4IAFA 4JT3A 4Q9SA 3WARA 5J9YA 1ERKA 3C4EA 2BPMA 2FYSA 2OIBA 2W1FA 2XRUA 3S0OA 3ACJA 1CKJA 3PYYA 3ETAA 3U87A 4FVRA 5HCXA 2PVHA 4DFXE 4KS7A 3ZMMA 2W4KA 2J2IB 5C26A 4BICA 3POOA 5M55A 3QZHA 4FVQA 4S2ZA 2ZB1A 2QOLA 4M12A 5EHLA 5G1XA 3C4FA 1SZMA 3CCNA 4KSPA 4DEEA 3E93A 2VX0A 2OJJA 2CGWA 4FYOA 4BKJA 4CLJA 4I6BA 3BQRA 3VWAA 3A7IA 3MV5A 4S33A 3PIZA 4DFYA 2QKWB 4GL9A 3DV3A 3PXFA 3F5PA 3RCJA 1H8FA 4F09A 3A60A 4DT8A 4IQ6A 5C01A 4GK2A 3TV6A 2OG8A 5EM6A 2OFVA 3DAEA 2VWVA 4M7IA 4NH1A 4M69A 4O0VA 2XNBA 5AUXA 4ASEA 5K0XA 3LLTA 2BTRA 2EWAA 3C0GA 3HRCA 3RVGA 1H24A 2E2BA 5HLNA 3BGPA 4IZYA 4L3PA 4L8MA 4GVJA 1PKDA 1ZWSA 4W4VA 3HV7A 2VZ6A 3IGGA 2YM8A 1YXXA 2OXDA 3QTQA 3R01A 4FEWA 3EN4A 4K77A 4U97A 5AM6A 4HYSA 2HZIA 2YZAA 3PVUA 5DLSA 5IUIA 5JQ5A 1M2RA 3F2RA 4EUTA 3GU5A 3EQCA 3GI3A 4RIWB 4O2ZA 4QP7A 2BZIB 3SV0A 3KULA 4CXAA 4F9BA 3PXQA 2Z7SA 4UWBA 3ZSHA 3HECA 4FSYA 4ZOGA 1OMWA 4YLKA 5EHYA 5TOZA 3FSFA 1XH4A 2GS7A 3EB0A 5BX0A 3G0EA 2YCQA 3D5XA 4NIFA 4QMUA 1NY3A 4C58A 2JIIA 5HZNA 2Y4IB 4QQ5A 2C30A 2EU9A 2PUUA 3NDMA 2YM6A 3VJNA 3BX5A 3QQGA 1YXUA 2BALA 5DRBA 4MBLA 3VF9A 2ETRA 4RX8A 5AX9A 4JX3A 4DH3A 3VF8A 4A07A 2R5TA 4D9TA 4TY1A 4BN1A 4TW9A 3R9HA 3TZ7A 3OW4A 4QNYA 3ORTA 5GJFA 3VNTA 3TIYA 5TR6A 4AF3A 2B55A 4ANQA 5IQFA 5HIEA 3TDWA 4MXZA 2CGUA 3DLSA 2C6OA 4IWPA 4ANOA 4NU1A 3GU6A 4I1ZA 4CFUA 2IVUA 1QPEA 3P78A 1R0PA 2CJMA 3MA3A 5G6VA 4UZDA 5L6PA 3ATSA 3DBCA 1JQHA 1SNUA 3OEZA 1H4LA 4XS2A 3UZTA 2UZUE 2QHNA 5CSPA 2OF4A 2XJ2A 3EFWA 3MS9A 3KRLA 3UO4A 1Y6BA 1YOJA 3UO5A 5FTGA 5A4QA 4O91A 5DFPA 3MYGA 4CG9A 4JG6A 5DBXA 3CTJA 4L44A 2VTJA 5D12A 4BI1A 4D4VA 3RHKA 5CEOA 4CRLA 4DN5A 4R78A 4K0YA 2QVSE 2OU7A 2IN6A 1QPJA 3EQFA 2X2LA 3FHIA 3RAWA 3REPA 4DEIA 3PP1A 4GT4A 4IB0A 3R8VA 3RCDA 4NJDA 2GCDA 4QP8A 3ZU7A 5JEBA 1R39A 2JDRA 2R3GA 3EZVA 3OWKA 2WTWA 1YVJA 2UVYA 2X0GA 4QD6A 4LRKA 4AA4A 5KE0A 2CCIA 2O8YA 5IF1A 3N4TA 4UV0A 2R7IA 4L42A 2G1TA 3F2NA 4IAYA 4NM0A 4FNYA 5FM2A 2FGIA 1Q3DA 2JFLA 3Q6UA 4O7VA 4ITIA 4ZTHA 3UMXA 3QFVA 2BFYA 3LIJA 4EZ7A 5J8IA 4GKIA 3TUDA 4I0SA 4G34A 4B0GA 3VS3A 3FPMA 5KMLA 4F70A 4IHPA 4CKRA 3FI4A 3TWJA 2WMAA 3CGOA 4IZAA 1XJDA 1FINA 4LQMA 5IPJA 2BZKB 2PTKA 2WMRA 2YFXA 4RSSA 4UMTA 4A9YA 2OSCA 4RLKA 2RGPA 4PQNA 4BKYA 4WA9A 3NAXA 4U5JA 4FEVA 4EH3A 2XKDA 3PVBA 3KF4A 4I6FA 4FKQA 3W10A 4YTCA 5AIKA 2H96A 3A2CA 3AC4A 4BCQA 3FMKA 2BAJA 5M4UA 1J3HA 1FVTA 5HO6A 4RX5A 3BV2A 3QRKA 3LQ5A 4DBXA 3ROCA 1OB3A 4ENYA 4CEGA 4OTPA 1ZMUA 1O6LA 3WILA 1UNHA 4FKWA 4PTCA 4XRJA 2W1HA 4LM5A 3SOAA 4RVMA 4OGRA 4HVHA 1GIIA 2YWPA 4AOJA 3TN8A 3QRTA 2PZIA 4WKQA 3BU5A 4EK6A 3HRFA 1XH9A 5HHWA 4BCIA 1FMOE 2R3LA 1DM2A 4S31A 4C2VA 4BF2A 3CS9A 4RA4A 5I9WA 2C5OA 2UW7A 2BKZA 1IG1A 3A8WA 3ZLWA 2OIQA 3MDYA 3NCGA 3O17A 3PY1A 4M13A 2IZUA 2R9SA 2QKRA 4ZZNA 4JOAA 5D10A 3PJCA 2GNGA 4EUUA 4O7NA 1B38A 2GSFA 2PL0A 3F9NA 4RQVA 4CV8A 5FDXA 3CEKA 5H2UA 4O6EA 3PXKA 3P7BA 2WNTA 3GXLA 1OPLA 1B6CB 1WBOA 4DFNA 3RK9A 1J7LA 4XHKB 1YXSA 3IONA 2IVTA 3QHWA 4N6ZA 4L53A 4UYAA 5LCJA 3R9NA 1H28A 3ZRLA 5JH6A 2CLQA 3QWJA 4ZSEA 4APCA 4FKIA 5ANGA 3R9DA 2XYNA 4MD9E 3V5QA 4WOVA 5CF4A 2IVSA 3BLQA 4IAZA 1W98A 4QO9A 2B54A 2QLUA 4QP1A 3F3ZA 2BRMA 3DGKA 1LUFA 4FEQA 2E9OA 4U0IA 2UW9A 5IKWA 5ETCA 3TT0A 2UVXA 4K8AA 5A46A 3GOPA 5CSVA 5F1ZA 3ZBFA 1Q8TA 2AC3A 4V01A 3IW8A 3LFCA 3KA0A 2XJ0A 5AR2A 5T6KA 3DQXA 5JT2A 5KUPA 3HMOA 3RMFA 1B39A 4MNEB 4IIRA 4BTMA 4E26A 3QYWA 1OIYA 5CNNA 3B8QA 4B99A 3IDCA 2C6TA 3ZUUA 5CVFA 4UWCA 3IW7A 1MUOA 4PDPA 3LCTA 5E4HA 1YDTE 3G6HA 3O8UA 4RFYA 2J9MA 3F66A 4A4LA 2JDVA 3TTJA 2YIXA 3KB7A 4DH5A 1PKGA 4O0RA 4FV1A 3LMGA 5IQAA 1OKZA 5FBNC 2C0IA 2GNFA 4HCVA 3DJ7A 1T45A 4DBNA 4OAUC 3CC6A 4BHNA 5IISA 4O0TA 3QRUA 3PVWA 5KMOA 4KKHA 4X3FC 4H05A 4UXLA 3ANRA 2F49A 2WQMA 3LJ0A 4EQCA 3U9CA 3ZC6A 5DGZA 4A06A 2YM3A 4D28A 3U55A 3JR1A 4DH8A 1YI3A 5K4JA 3EYHA 4C3RA 4EYMA 4WNKA 3FMMA 5JGDA 5IU2A 2VTNA 5L2TA 2PULA 5IH4A 3U9NA 3GB2A 5HGIA 4FMQA 3Q52A 4L3LA 2WTVA 4C4FA 3WF8A 5TF9A 3O2MA 4CTBA 2JKKA 3G15A 4HPTE 4HYHA 4X6QC 4P4CA 4WG5A 3DB8A 3TIZA 4CQGA 3G33A 2H34A 4QP3A 4CRSA 2ZV7A 2X8EA 3GUBA 4MXXA 1M17A 3OCBA 4QTDA 3FZ1A 4WUNA 5AUYA 3WF6A 3BBWA 3VS1A 2PVJA 3OCSA 4FSNA 1ZYJA 3SA0A 5HTIA 4P2KA 3MN3A 3QLFA 4F99A 4LG4A 3JYAA 2X6EA 1YQJA 4K1BA 4M3QA 3RK7A 2Q0NA 3VUMA 4IX5A 3ZFMA 3DCVA 3R1YA 2WOUA 3VUGA 2HZ0A 4EC8A 5HU3A 5JFWA 3G9LX 3PA4A 2GHMA 5GINE 2BDFA 4LI5A 3MPAA 5AV4A 3L8SA 3Q3BA 4EOQA 4AGDA 3EFKA 2V55A 3NMUF 5AP6A 4EWQA 5E8WA 2PZ5A 3IS5A 3G2FA 5E91A 4Y46A 2OK1A 5AV1A 3VRZA 5JGBA 3FQSA 5IA2A 5KNJA 3BLHA 3NNVA 4FT9A 4LRJA 5AUWA 5LWNA 4YJQA 5HE0A 1U54B 3QCQA 4EH4A 2PPQA 3W2PA 2GMXA 4ZLYA 3T3VA 4X0MA 4C8BA 3GCPA 3N9XA 2GFSA 3CTHA 3LM0A 4I92A 3PLSA 4J99A 4RWIA 4XG3A 4TT7A 5JZJA 5FEDA 2JIVA 2VTMA 4I3ZA 4E3CA 3A8XA 3FLNC 3QTUA 4L01A 4QYGA 4FV7A 4NT4A 3ORZA 4XP3A 2Y8OA 1ZAOA 3HGKA 1PXNA 3KN6A 4BDHA 2E9PA 4U3YA 3D7ZA 2HK5A 3ZO3A 3QQLA 3TG1A 1SVGA 4IE9A 2PE1A 4HW7A 3U54A 4ENXA 4MQ2A 5IA5A 5CT0A 5DOSA 4ZSAA 3HAMA 2X7FA 4IAKA 2C3KA 4Y95A 5CI6A 3R7EA 4JAIA 2A0CX 3VBYA 3RTPA 2PMLX 4A9UA 4C02A 2WZJA 4EK3A 5AA8A 4H3PA 3KY2A 4GYGA 3PZHA 1ZOEA 4P5ZA 3COMA 4PDSA 5FEEA 4ANBA 3OTVA 1QMZA 2OZAA 2XH5A 3DNEA 3E8NA 4AGUA 4X3FB 1ZOGA 4XG6A 4D5HA 1W7HA 5J5TA 2BRHA 4Q5HA 4HNFA 3P0MA 2RIOA 2BDJA 1S9IA 3ZYAA 3PY0A 1KE6A 4BIEA 2AC5A 1WVYA 3LMHA 2ITTA 2YACA 4ZZOA 3F3VA 4J8NA 3OXZA 4IMYA 3CR0A 3CPBA 4HYIA 3Q04A 2CSNA 1WZYA 2WMTA 5AIRA 1OM1A 4ASDA 2PUPA 4OLIA 2YERA 4OTFA 3BI6A 3ZOSA 1VJYA 4EZ5A 3UQFA 3LFSA 5L8JA 2YIWA 3GBZA 3LXLA 3R7UA 4FL3A 4PP7A 4O83A 3UJGA 2VWUA 4ZMFA 3MBLA 3HV6A 2X7GA 3R1NA 3UZPA 2KTYA 2O5KA 2YM5A 4IM3A 3KCKA 2R3JA 1U5QA 3W2QA 3AXWA 4MK0A 4QYEA 3FLYA 4H1JA 4A7CA 4L3JA 1ZZLA 3IO7A 4RWJA 2PVNA 3DKOA 3OCTA 2UZBA 4DTKA 3I4BA 4I5HA 3CKWA 2B0QA 1NT2A 4AT4A 4PMPA 4O7YA 2JKMA 4QYYA 3SVVA 4MX9A 2W1CA 2YAKA 3MFUA 4EL9A 2WQBA 2J5EA 5I9ZA 2VTHA 1ZZ2A 5L6WL 3L9LA 5I3RA 2KULA 4IJPA 5BVWA 3SXSA 3G6GA 2X8IA 4YNEA 2W0JA 3N4VA 4HGTA 2G2IA 4AZEA 4G3DA 3MH2A 4LFIA 4BCKA 3SGCA 3KXGA 4Y85A 4MCVA 1OIQA 1BMKA 4JLCA 3LHJA 4IEBA 2Z7LA 2JDSA 3PE1A 3OTUA 3I5ZA 4WO5A 4EH7A 4NKSA 3UC3A 2YJRA 4TRLA 3GFEA 2YDJA 4KBKA 5IQHA 1OZ1A 4DLJA 3D7TB 3TDVA 5AP0A 4FNXA 4I6HA 3HP5A 4EK5A 1SM2A 5CAQA 3MB7A 1KUTA 3NUYA 4NL0A 3I81A 5EOBA 3W2CA 4JVGA 3U4WA 2ZM4A 2C1AA 4G5JA 3MTFA 5AP3A 2RL5A 4EYJA 2W1ZA 1IAJA 1M7QA 2XMYA 4RJ8A 3VC4A 3HUCA 2HZNA 2QR7A 4NKAA 3Q53A 3RNYA 3ZXZA 5JSMA 4Q2AA 3QCSA 4J71A 2XA4A 1H08A 4HJOA 4IB5A 4L46A 5M4FA 3TKHA 3TNHA 4ACGA 3CSVA 2QOBA 4E6DA 2WMWA 4M0YA 3UGCA 1FMKA 2OJGA 4X2NA 5AR7A 3DOGA 1FOTA 4FC0A 4KAOA 4F7LA 3D5VA 4RIXB 2JKQA 4EH6A 1A9UA 3QTWA 3V8TA 2HCKA 2CCHA 4FKUA 3OG7A 2HXQA 2WTIA 1OUKA 4IX3A 4LL5A 4IFCA 1WBSA 1IEPA 3CXWA 2VX3A 2EB2A 2XK3A 1Q62A 3QZGA 5D7VA 1PY5A 1H27A 2OZOA 2JEDA 3AD4A 3NYVA 2YCFA 5EI8A 4O27B 2ITWA 3RJCA 3U6IA 2EXEA 3D0EA 3AC8A 4M15A 3V51A 1OBGA 4EBVA 5JGAA 4JAJA 5CZHA 3A7JA 5M53A 3E5AA 3UYTA 3QLGA 4JQEA 2PVFA 5CASA 4M14A 4B7TA 3KRRA 5BVOA 2OJ9A 4EWHA 4M68A 5A14A 4USDA 4F6UA 2W5AA 1WBWA 2PWLA 3BHHA 3VVHA 2GNHA 4D2TA 3OY3A 3R21A 2X2KA 3FHRA 3H9RA 3I60A 3QC4A 5LARA 4CVAA 5KBRA 5LVNA 2XZSA 3TNWA 4BGGA 4NM5A 5EYKA 2W17A 1ZLTA 5LJJA 2FB8A 2GTNA 3GC0A 3JUHA 4RVTA 3FJQE 2VX1A 3IW4A 5DT3A 5EDQA 5AR4A 2ZM3A 1Q24A 1YHSA 4H36A 4N70A 5HG7A 4FSMA 4UMQA 4I5MA 4E5WA 2ZV8A 3OT8A 1OL5A 3IK3A 1Z57A 3CQEA 4C34A 3PA3A 4FA2A 3IOPA 4J96A 5EI6A 2PYWA 2WPAA 4YC6A 2YIYA 4GUBA 4J1RA 4G9RA 3PIYA 5GIOE 2QG7A 1YW2A 3O7LB 3R83A 4D2PA 1PMNA 3ZO1A 3DBFA 4D2SA 1GOLA 4Z7GA 4W8EA 4O82A 1UV5A 3HAVA 2VNWA 3FMLA 4FG8A 4KBAA 5FUTA 3LZBA 3MJ1A 2W9FB 3NSZA 3GU4A 4GYIA 3FXZA 3UE4A 1BI8A 4D0XA 3NYXA 2GDOA 3NUPA 3NYNA 3OEFX 2QOHA 3B2TA 4BDKA 4DT9A 5E8YA 4FUXA 5E8TA 5HE3A 3ZO4A 4FT0A 2HENA 2JITA 3EN6A 4NJ3A 3ZO2A 5DHJA 3GCUA 2XKFA 2WTDA 4BDCA 3FI8A 4AW1A 1DS5A 2HOGA 3GCSA 4NZWB 1Q4LA 1KOBA 3V04A 5D11A 2XNEA 1CDKA 3NPCA 4FTKA 2WKMA 1GIJA 4MQ1A 3OC1A 2W1IA 3VO3A 4ZTRA 5J79A 3ZSIA 1Q8UA 3EQHA 3LQ8A 1URWA 3OF0A 4JQ8A 4LOOA 4C33A 4CLIA 4BWKA 2YDIA 3VJOA 3A7HA 3V6RA 3O23A
chains in the Genus database with same CATH superfamily
1PRYA 3FMJA 3NNWA 1STCE 4ALWA 3P5KA 3FXXA 2QOFA 4AXAA 3HDMA 4BGHA 2OI4X 4ORKA 4BDFA 4R1VA 3R7YA 3VBQA 2R3RA 2RFDA 3ORLA 1KV1A 4RIYB 2XK4A 4DG0E 2CNUA 3WI6A 1XH8A 3NNXA 4DFZE 5BPYA 3QCYA 4PMTA 3GVUA 3UOJA 2EUFB 4C0TA 4CTCA 2ZMDA 3FYJX 3JXWA 5CNOA 2WGJA 4MTAA 4YBJA 2Z60A 4D9UA 3ZUTA 5J9ZA 1J7IA 4AXFA 4PL5A 3TZ9A 4ZSLA 4UXQA 1SVHA 4G3GA 1Q41A 3MY5A 3QXPA 1GZOA 3EZRA 4LGGA 4U81A 3QHRA 4FZAB 4O22A 3BGQA 3AG9A 2G15A 1U4DA 1OGUA 4G6LA 2PUNA 2QO7A 4KD1A 4NFMA 4GUEA 3PUFC 1PYEA 1KV2A 4DFBA 2BIYA 4AXDA 4J8MA 4X7QA 2VWIA 4C62A 2HWPA 3H10A 5AM7A 5BYZA 4GSBA 3H4JA 3FC1X 1W8CA 5ACBC 5LCKA 4ITHA 4BHZA 4V0GA 3NGAA 1NVRA 2WMBA 2GNLA 2F4JA 4GKHA 4DAWA 3ZDIA 3GFWA 3PG3A 5M4IA 1MQ4A 3P4KA 1W2FA 2JD5A 5ANDA 4II5A 4K2RA 5BUIA 5HO7A 1OIRA 1PXIA 4D0WA 5LVOA 3MY0A 3VHKA 5BYLA 3BBTB 3KFAA 4YBKA 5ANOA 5IA0A 2RFEA 4F1OA 3WZDA 2XUUA 3DLZA 3DTCA 3BGZA 2A27A 3O7LD 3VBVA 2Z2WA 3OUNB 1JNKA 5ANEA 4TWPA 2XNOA 3KXNA 3MFRA 4FTNA 4RC3A 5CEPA 2XARA 1YKRA 5KX8A 2XNNA 3JY0A 1PW2A 1V0PA 4NTTA 4MBJA 5AR3A 4FKJA 3T3UA 4RBLA 4M8TA 5FD2A 2ZM1A 4H1MA 2B53A 3DFAA 3O0GA 3UNJA 3OW3A 4O7RA 4PPAA 3VS5A 3QBNA 4EKLA 4OUCA 2EXMA 3PTGA 3QA0A 3V5JA 4W9XA 4C4GA 4NCTA 4B8MA 5EFQA 3LXPA 2CNVA 4JIAA 3IPHA 3VS2A 2ZYBA 1E9HA 3POZA 3RPSA 2X0PA 4JXFA 2JGZA 4MD7E 4L43A 3R9OA 2XK6A 3W2OA 5LVMA 5M4CA 1A48A 3VBWA 3Q4ZA 2X9FA 3DZOA 1R1WA 4GS6A 5LVPA 2GQRA 3P9JA 5D9HA 3FLZA 4TTHB 5L2SA 4FTTA 2OJIA 1PXLA 2VWYA 3NCZA 3WF5A 3K54A 3DJ5A 2HWOA 3F7WA 2UW0A 4FTUA 4I0RA 3OBGA 4NUSA 3RHXA 4GG7A 4KRDA 3FLQA 4O6LA 3MY1A 4E6AA 3LVPA 4QYHA 3BKBA 4ID7A 4ZTMA 2QONA 2PVLA 3RGFA 4EH8A 5IQBA 1J1CA 1JPAA 3F2AA 5I9YA 2QO9A 4LRMA 5L6OA 1G8SA 4M69B 5C4LA 3QL8A 4FX3A 4IBMA 2E9VA 3HKOA 1R3CA 4QMMA 1W82A 3W1FA 5JKGA 2HW6A 4BBFA 3NWWA 5EW8A 5A6OA 4RZVA 3JVRA 4L7SA 2XCHA 3FPQA 4CSVA 4E7WA 4Z16A 4JBVA 3DXPA 4BDDA 3C51A 2EB3A 4KIOA 4GJ2A 3Q2MA 3QALE 1GAGA 1DI9A 3DT1A 1XHAA 4H3BA 5ANKA 4F0IA 3VS4A 4MF1A 2Q83A 2OICA 4X6RA 1E1VA 3AKJA 5BVKA 4EOMA 1ND4A 4IVDA 4R6VA 3K5VA 3KULB 3M2WA 3FMNA 3LMIA 1H0WA 3AMBA 2XK9A 4ITJA 4O4FA 4ALUA 4R1YA 3R73A 3UZRA 4WHZA 3C7QA 4E1ZA 4F64A 2FSLX 2WIHA 3I0QA 3LJ1A 2QOIA 4FIGA 4J53A 3KRWA 4YZDA 5JRSA 2QR8A 3BU6A 3D2KA 2ITYA 4DG3E 2BROA 3P7CA 3NW7A 4GH2A 3NVKI 2V22A 2ACXA 5IA3A 3C1XA 5HIDA 2PZRA 1QL6A 4NFNA 4WG3A 3FL5A 2XIXA 5L8LA 3BWJA 5EKNA 5LMBA 2J0LA 4YJNA 4BJJA 1UNGA 1V1KA 5I9VA 4EOKA 2IWIA 5KMNA 3HMPA 1OUYA 4KA3A 4ZP5A 3S2PA 3SDJA 4AA0A 4CD0A 4DITA 2XALA 4MWHA 4CFNA 3F61A 2GS6A 4OTIA 3A7FA 3LCSA 1F0QA 3A99A 3KQ7A 4G5PA 4QMLA 3SAYA 2W9ZB 2CN8A 3ENHA 3QGWA 1LP4A 4D2RA 2XEYA 2BHEA 3F3WA 2YJSA 3GC9A 4DEAA 4FUYA 2OXYA 1E1XA 1SVEA 4ZS0A 2RG6A 3HRBA 4HZRA 3RI1A 5EG3A 3FZTA 5CU2A 4R5YA 2VGPA 4OBPA 4AACA 2PE0A 4EEVA 5IEXA 5J7HA 5GNKA 3R7GA 3TACA 2W1GA 4TN6A 5BYYA 1WBVA 5HD4A 4KNBA 4U7ZA 2X0OA 5BVDA 5M51A 4E4XA 3PJ2A 3PE2A 1G3NA 4WT6A 3UOKA 5HD7A 2CLXA 4AN3A 4UX9A 1WBNA 1YI4A 3COHA 4TXCA 3JPVA 3ZDUA 3NYOA 4YSMA 3LCKA 5AAEA 5A3XA 1SNXA 2PVMA 3W33A 3ZHPC 2BRBA 4U43A 4MXOA 4PDOA 4ZAUA 4ZJJA 4EORA 3PSDA 3D5WA 4D4RA 3KN5A 4QMSA 1FVRA 4RVKA 4WRGA 2Y9QA 3GGFA 1SYKA 2PMIA 4I93A 4G3FA 4U3ZA 5JFXA 2OH0E 4BDBA 1MQBA 1ZYDA 3FBVA 3NUSA 2AEGA 3LFNA 4QP2A 4C61A 3UPXA 1OL1A 4RVLA 2QQ7A 1GNGA 5IH5A 4HVGA 3PUPA 2W06A 3Q60A 2YLFA 4LV8A 5L2IA 4GG5A 3FWQA 1JKSA 4RGJA 4XJ0A 1RDQE 2VO0A 2CN5A 3FL4A 3OS3A 4GK3A 5CQWA 1UU8A 1BX6A 3EMGA 3C13A 3H30A 5DIAA 5M56A 5H8GA 3KL8A 2IZRA 2R3PA 3UNKA 3DZQA 3C5UA 5GHVA 3RNIA 3QF9A 4FG7A 3JY9A 4ANNA 4U80A 2XBJA 4F7SA 1Q99A 4I4EA 3KU2A 4G16A 4TZRA 5HVJA 2C6DA 4C3FA 2UZTA 1VZOA 2WQOA 1PXPA 4HGSA 1AGWA 4PL4A 3UIMA 3F69A 2YIQA 3VBTA 5HBHA 4FV6A 4EC9A 2V7AA 2XVDA 1XH6A 4LUEA 4EOPA 5AJQA 3VN9A 2YA9A 4L52A 3TTIA 3QD2B 4U41A 3WZEA 3QC9A 2YAAA 3P1AA 1PMEA 3UTOA 4ALVA 4DEDA 2W7XA 4NW6A 2VTQA 4QP9A 3ID6C 2H9VA 4YUQA 3MVJA 4UWYA 3R6XA 2YWVA 2IO6A 1UNLA 4AZSA 2IW6A 4XP2A 4FTAA 1JSVA 3THBA 4DGOA 4W9WA 5CF5A 5AV3A 5IA4A 4CYIA 4DHZA 4C59A 4TL0A 2PUIA 4G2FA 1DAWA 3FMHA 5DE2A 4EKKA 3FZSA 5HU9A 4CGAA 4CV9A 4GFGA 4QTCA 3UVPA 2V5QA 4NM3A 4CZUA 5AAGA 5B2KA 3ALNA 3NEWA 3PSBA 4DFLA 3Q4CA 3U51A 4L9IA 2BCJA 3HV5A 3R8LA 4N57A 2PMNX 2ITQA 4FV2A 4EJNA 5KMIA 5H8EA 2FSMX 4A4XA 1KE7A 3UYSA 4EOJA 3AC2A 4QMNA 4AOTA 4BY9E 3L9PA 1I44A 2XIKA 1Y8YA 1OGYA 4YHFA 5K5XA 4FTQA 3E92A 4RZWA 5J7BA 4ZTSA 4EJ7A 2XIRA 1YOLA 4U9AA 2BMCA 2IJMA 4EZ3A 4ZTNA 3QKKA 4J98A 4LOPA 4FIIA 2RFSA 5BUJA 4QT1A 4FKSA 3LFBA 5HVYA 3OHTA 1G8KA 2W96B 3PXZA 1FGIA 1OKWA 2UW4A 4C36A 5KCVA 3WZJA 3HVCA 1Y91A 3QKLA 4BZNA 5K5NA 5T3QA 2XBAA 5KKRC 2OF2A 2W1EA 4I94A 4XG8A 4D2VA 4FGBA 2LGCA 4O4BB 2VWXA 4FL1A 2UZLA 2QC6A 4LYNA 4QQJA 5ANIA 1YDSE 4DGLC 4QMYA 4ERWA 5JQ8A 2PE2A 2IG7A 3H3CA 4MXAA 3FY2A 1OI9A 5CWZA 5AUTA 1LR4A 3DY7A 4BBEA 5AP2A 3ELJA 2OH4A 1J1BA 5A4TA 2HELA 3GCVA 4WNMA 5KZIA 3ORXA 3P86A 3QTZA 3VS7A 4QP4A 4O81A 5EYMA 4MF0A 3LOKA 2CKOA 3R1QA 4EOIA 4D1SA 3UP2A 1IR3A 2HY0A 1H0VA 1YRPA 4L6QA 1JAMA 4U40A 2OGVA 2R3MA 2YABA 2OO8X 3RWQA 4O0WA 2VTAA 4J52A 4PUZA 5CX9A 4AAAA 5IQEA 4G6OA 3DK7A 2YM4A 5EHOA 4GFMA 5C03A 4B6LA 5GZAA 4FGRA 4QEBA 4FKLA 5TO8A 2Z7QA 5IEYA 2XNPA 3UPZA 4C2WA 4I5CA 4AFJA 3S3IA 3ZFYA 4G3CA 4DA5A 2B52A 3KMMA 3NLBA 4FE2A 2F7ZE 3HYHA 3AC3A 4BTKA 3C9WA 4PTEA 1Q8WA 2J4ZA 4FBXA 4RJ5A 1KE9A 3DDPA 3EWHA 4FTRA 3WBLA 4EI4A 1DAYA 1O6KA 2UW6A 3DBEA 1V0BA 4FT7A 4LOQA 3UIUA 4JG7A 5B7VA 4XBRA 1JKTA 4RC2A 3KMUA 3KMWA 4GFOA 4MYGA 1CM8A 4DHFA 2C6EA 2IEWA 3GC8A 3S00A 2YISA 3BHTA 2HAKA 3HMNA 4XOYA 3ZM9A 1ZY4A 3OOGA 2QOQA 2RG5A 3BLRA 4PX6A 3H9OA 4W8DA 1VYZA 3PXYA 1YXTA 3N4UA 3QXOA 2CDZA 1H00A 2R0UA 4FIEA 5DN3A 1MP8A 4QPAA 3T8OA 4UY9A 3HEGA 4ACHA 4JL9A 3ORNA 4IWOA 3FSKA 3BQCA 3PFQA 2R3IA 3EQPA 2ZB0A 2F9GA 5D7AA 5KZ0A 3LM5A 4O7LA 1JOWB 5AUVA 2A1AB 5HTBA 4EOLA 4TYJA 4AXEA 1WVWA 3NZ0A 2I0YA 4YC3A 2ITVA 5LOHA 3PJ1A 4YZCA 2WEVA 4EOOA 3R22A 5ACKA 4C4EA 3OD6X 3PVGA 2J7TA 2IF8A 1HCLA 3UVQA 4FTJA 2UZEA 1ZYSA 4F9YA 5H8BA 3DKGA 3P23A 5EQYA 2ETKA 3E88A 3PRIA 1RW8A 5E1EA 2BIKB 3GU8A 3WE4A 4Y8DA 1L8TA 4I21A 5IUGA 5FTOA 2OBJA 3ERKA 2VTRA 3Q5ZA 3RALA 2C47A 3CTQA 4QTBA 2QCSA 2IVVA 1KE8A 3SD0A 3ZONA 5AUUA 3KC3A 5KKRB 4RMZA 2Z02A 4AFEA 2UW5A 2O2UA 3KXHA 3MI9A 3K5UA 2HZ4A 5FXQA 3LKMA 5HICA 2ITOA 2WQEA 4XG4A 3PJ8A 5AWMA 3K3JA 5L2QA 2J0IA 2WMUA 3F88A 2J0JA 3HV3A 3HA6A 4D1ZA 1OL6A 1I09A 2GQGA 3CLYA 4G1WA 4FKRA 3L8PA 3NIZA 4E5BA 5EK7A 4RFZA 4Q5EA 3DDQA 5IZFA 4YSJA 3Q9YA 5HIBA 4PNKA 5FTQA 4XEYA 2R3KA 3AMAA 2NRUA 4YHJA 3VQUA 2WAJA 4B9DA 3CGFA 4RPVA 4E4NA 3AKKA 1Y6AA 2UVZA 3EL7A 2QOCA 3HL7A 2PK9A 1U46A 2V7OA 4IAIA 5CT7A 4DGGA 2O3PA 4XOZA 4ERKA 2OZAB 4RX9A 2B9FA 2ZAZA 4HZSA 3QQUA 2Y6OA 1W83A 3HV4A 4FG9A 4O7ZA 3IQ7A 3ZH8A 4FSTA 4N0SA 4DTBA 4FSUA 4JX7A 4CMOA 4QMZA 4PDYA 4L7FA 3LFFA 5CU0A 4USFA 5HBEA 4R3RA 4S34A 4IVCA 4MKCA 5EDRA 2XM9A 1UU7A 2JAVA 5HTCA 4FTLA 3KXMA 1XKKA 4MXYA 2P55A 5CAVA 5I5ZA 3GQIA 5CLPA 4YNOA 2QODA 3FXWA 4BCHA 2WMXA 3FMEA 3L8VA 3OMVA 2R3OA 4DGNA 4BDEA 2P3GX 4KIQA 5L2WA 4FK6A 5HG5A 2XF0A 5CALA 4BDGA 2ITZA 4QPMA 3RZBA 4R7BA 2UW8A 4CQEA 1X8BA 3PPKA 1H1SA 4JIKA 4KIKA 4TYEA 3W0SA 1BLXA 4DFUA 5M08A 3ZM4A 2ZOQA 2XIYA 3F5UA 4JR3A 4IW0A 1XO2B 3IOKA 4YLJA 5DR9A 3V6SA 4PMSA 3FC2A 4U6RA 1NVQA 4FSQA 5C27A 1BL6A 5I0BA 5IMXA 4N4SA 2VTIA 2Y0AA 3QX4A 4PPBA 4OAVB 3PLAE 3LW0A 3GP0A 5DNRA 4OTGA 4DH1A 4QMTA 3SRVA 5AR8A 2X6DA 1OL2A 4JJRA 4EHEA 3PSCA 3ZC5A 3OWLA 1K3AA 2Q0BA 1IASA 4IM0A 4A9TA 3NW6A 2WHBA 2RSVA 5HESA 3CP9A 4QOXA 1BKXA 1YWRA 3NIEA 4CNHA 5FDPA 2CKQA 1ZARA 2JC6A 5EDPA 3PPJA 2I1MA 3R63A 1QCFA 2ZV9A 3QKMA 3R8UA 4GCJA 5C8MA 4YZMA 5J1VA 2JBPA 2HW7A 3VS6A 1GIHA 4AW0A 3GCQA 4K11A 4YJOA 1KOAA 4JNWA 1GZKA 4IANA 3ZXTA 4R3CA 4U45A 1RQQA 4BCGA 3ZUVA 2C6MA 3VHEA 3WE8A 4CKIA 1HCKA 5CTPA 5CXHA 5AP1A 4Y73A 3RINA 3S4QA 1UWHA 2XYUA 4BRXA 5A9UA 1IA9A 2VWBA 2G2HA 2AQXA 2WIPA 3MWUA 2CGXA 1RE8A 3KRJA 3O8PA 3ORPA 3Q32A 4FL2A 1SMHA 3COIA 4NSTA 3QTRA 5E8UA 5HLWA 3RM7A 2GQSA 4YZNA 1EH4A 4F63A 5HNIX 3W8LA 2BUJA 2VD5A 4FVPA 4YTHA 4I20A 4AZWA 1IA8A 3O51A 3VUIA 4O1PA 4USEA 1AD5A 3G5DA 3C0HA 3CD8A 4F4PA 4A9SA 5M09A 5HO8A 4CCUA 4AU8A 5ICPA 1FBNA 4QRCA 3V5LA 3MTLA 4C4HA 4DEGA 4PV0A 3JS2A 2YLEA 3QQJA 4E4MA 3DBQA 3FAAA 4YZ9A 4RA5A 5AEPA 3P79A 3EQGA 3OWJA 3BV3A 2NNWB 4JDJA 3ZZWA 3IW6A 5GZ9A 3PP0A 2BHHA 3VUDA 5BNJA 2OLCA 1Q3WA 3PWYA 5CANA 4F0FA 3MJ2A 4WIHA 4ZLZA 5J5SA 2XNGA 5JFSA 4TPTA 4ZLOA 4AW2A 1YDRE 2W1DA 3V8SA 3ZSGA 2QO2A 2UZDA 3GENA 3E7VA 4ZTQA 4AGWA 3E8DA 3R04A 5A54A 4D1XA 3E8EA 5IG1A 3PJ3A 1PMVA 5FGKA 2R3NA 1XQZA 2C6LA 3ZTXA 1TFFA 3KVWA 4NTSA 4UB7A 1XR1A 3CD3A 4L67A 5DWRA 4ZTLA 3UQGA 5CF6A 2WXVA 3ENMA 3P7AA 4HGLA 2FVDA 2XNMA 5KMKA 2C0TA 2W05A 4OTDA 4Y72A 3S95A 4PWNA 4GRBA 3WZKA 1H1RA 3GOKA 5HKMA 2G01A 5LMKC 2JLDA 3E64A 1OVEA 3Q6WA 3IG7A 5FRIA 4O86A 3FE3A 1Q61A 2YM7A 2BDWA 2AYPA 4FEUA 4G17A 2XANA 5C1QB 3WOWA 4I23A 3BEAA 2GPHA 4FSZA 5ETIA 5D1JA 2Z7RA 3TUBA 4MAOA 5DA3A 3PDTA 4UEUA 3UMWA 2BRNA 3CJFA 4AE6A 3WIKA 5CQUA 4QP6A 3UO6A 3QWKA 5HEZA 2C68A 2F7XE 2Z8CA 3VIDA 3TKIA 5AV2A 2DS1A 4X2JA 1PHKA 1UWJA 5EW3A 3BE2A 2V0DA 1H01A 2UZNA 4W4WA 3MB6A 4IVAA 3UG1A 5HORA 2BZJA 4Z3VA 1OIUA 5EW9A 4AZTA 5TE0A 1ZYLA 3AQVA 5CSWA 2PU8A 5ITAA 4MXCA 4Y83A 3WF7A 1YWVA 3IW5A 2J6MA 3QQHA 4IVBA 3DTWA 3LFQA 4AAYA 4FIHA 3W18A 3SW7A 4X3JA 2J0KA 3OUKA 2FSTX 4LDTA 1A06A 2WU6A 3FKNA 4UYNA 5E90A 4OTHA 3AKLA 1JBPE 2BILB 4MHAA 4YP8A 3SXFA 2W99B 3C50A 2ONLA 4RIOA 4LL0A 4RFMA 4FTIA 5BMSA 4EBWA 4NWMA 3FQHA 3RAKA 5HOAA 4R77A 1DI8A 4XBUA 3UDSA 4KSQA 4I5PA 5KHXA 3QTIA 1BYGA 3E62A 4GEOA 1OPKA 3A7GA 3LFEA 5HNGA 3KF7A 4ZJIA 3B2WA 3I5NA 5AADA 3E87A 4IXPA 1WAKA 2BAKA 3D9VA 2C69A 2GHGA 4JBPA 5AMNA 4QMPA 4NCTC 4ZIMA 1MRVA 3MH3A 4ZS4A 4I0TA 4WSQA 3TMOA 3HNGA 2R3FA 4PF4A 5CAPA 1O6YA 1YOMA 1PXMA 2WO6A 3KGAA 3A4OX 3VS0A 2E9UA 3UP7A 2ETMA 2AUHA 2ZFYA 2XM8A 4YTIA 4C7TA 1CMKE 3ACKA 4QMOA 4ZJVA 5J9LA 2QU6A 3ZLXA 4F6SA 2XB7A 5AAFA 3W8QA 4DLIA 4RLLA 4ZK5A 3FEGA 1ST4A 4QMWA 3QQKA 3R00A 4AP7A 2XK7A 4M97A 4OTQA 4FZDB 5GJDA 3BHYA 4NYEA 4BWXA 1MRYA 5IUHA 4O7WA 1UA2A 4O2PA 5JZNA 1YHVA 4BR3A 4W4XA 2V62A 5HG9A 4BDAA 3DK6A 4R7IA 3ROYA 4V05A 4XV3A 4D58A 3F6XA 4BDIA 3R7VA 3L9MA 4XLIA 4C4JA 4J97A 4E73A 3R28A 5DVRA 1J91A 4BTFA 2NP8A 5IDNA 2XJ1A 2NRYA 4CMTA 2CKPA 1RJBA 4WG4A 3PPZA 3BRBA 4TYHB 2R64A 4L00A 1R78A 3QX2A 5T68A 2VWZA 4FKTA 4TKSA 4OW8A 3HA8A 3QUPA 1URCA 4M67A 4AX8A 1FPUA 2CNQA 3C5IA 3KREA 4HGEA 3DPKA 4FODA 2ITNA 2B7AA 4IWQA 4FT5A 4R3PA 4DF3A 3CQUA 4RIWA 2XK8A 3TNIA 4YJUA 1JWHA 2ZDUA 4C38A 2BKKA 4PRJA 2CHLA 2BVAA 4X2KA 4AT3A 3OZ6A 2C4GA 3BYVA 4RX7A 4YLLA 3NVMB 3LAUA 4FI1A 2YITA 4O96A 3UBDA 2FUMA 2PVKA 5EQEA 2CMWA 3KK9A 3ZLYA 1G5SA 3L9NA 1HOWA 1AQ1A 1GZ8A 5KMJA 5L3AA 4FF8A 1YWNA 2E9NA 4JDIA 4RJ4A 4V0GB 3R7IA 3WZUA 2C3IB 5K0KA 4AWIA 4LUDA 4IWDA 4TNBA 1BI7A 4IDTA 3MGYA 4ACCA 3PA5A 1TKIA 3E7OA 3BYSA 1ZY5A 4FTCA 5E8VA 3IDPA 3EKKA 4IC7A 2I6LA 3O96A 4DYMA 4M66A 4MBIA 4CT2A 4IZ7A 4DEHA 2XRWA 2XIZA 2PSQA 3MFTA 3VQHA 3D94A 3UQCA 4E6CA 1P5EA 3C4CA 3OOMA 1R0EA 4E20A 3D15A 2J0MB 2R4BA 3M11A 4GIHA 4MEDA 2WELA 4UBAA 3EH9A 1KWPA 2VGOA 2R3QA 3HX4A 4XCUA 5HG8A 5ETFA 5HQ0A 1VR2A 3GT8A 5LMAA 5ANJA 1NA7A 5IMEA 4HYUA 2QLQA 2DWBA 1ZMVA 4WRSA 3H0ZA 5M57A 3I7BA 5HI2A 2A2AA 4C37A 4YZBA 2B9JA 2ZDTA 3E63A 4E6QA 4XV2A 2ERZE 5KO1A 3BEGA 4IDVA 4TWCA 4O84A 5F9EA 3LJ2A 2W5BA 3DAKA 5DG5A 4ACMA 4O7SA 4MD8E 3K2LA 3RAHA 4G6NA 2GNIA 4JQ7A 4NIFB 3TZMA 2VTPA 4KKGA 5CI7A 3OBJA 3HMMA 1IAHA 3ZS5A 4DCEA 2WMVA 4YPSA 2ITPA 5DEWA 3NR9A 3W2SA 4BBMA 5A4EA 5HBJA 5L8KA 1Z9XA 4PPCA 4BC6A 4O38A 4BB4A 5JRQA 3A4PA 2JKOA 2YEXA 5I9XA 3IECA 3LE6A 3DA6A 5BQ0A 4D2WA 1WBPA 4IB3A 4OT5A 4RT7A 1QPDA 2R0IA 4MNFA 4XH6A 3KKVA 3CE3A 4KB8A 4OTWA 4HVIA 1PXJA 4FTMA 5IQIA 4X21A 2PZYA 3IKAA 3QRJA 2J50A 3TEIA 4DINA 5IA1A 4FKOA 4CFFA 2X4ZA 1JKLA 4PL3A 3TCPA 4K6ZA 4CG8A 2VTSA 3E3PA 3PY3A 4IZ5A 5BVFA 4X2FA 4XUFA 5E8SA 2DYLA 4BIDA 5A6NA 4M0ZA 4BTJA 3KK8A 4RJ6A 4O4EA 4U8ZA 2RKUA 3FZRA 3D4QA 2C5NA 4RC4A 4JBOA 4MVFA 4BFMA 3EN9A 4XLVA 5BVEA 3RPYA 3D14A 3R8ZA 2GHLA 5I4NA 3Q5IA 4H39A 4JS8A 4DH7A 3NUNA 4JG8A 2X0QA 3LQ3A 5DT0A 4IB1A 2VTTA 2XCKA 4QTAA 5EM8A 4BVUA 3TV7A 1JKKA 4YPDA 3EQBA 2QG5A 3O8TA 4WUAA 4BJJB 2OIDA 4J95A 4EHVA 2I40A 3EL8A 4BZOA 5CAOA 4OR5A 2ZJWA 2C6KA 4F78A 3EFLA 4EOSA 3A62A 4TNDA 4I24A 2W4JA 4L68A 3F5XA 4CFVA 2OFUA 1VLRA 4F08A 4DTAA 3BELA 2WTKC 1VEBA 4UMRA 2ZMCA 3BHVA 5GIPE 3VULA 5K4IA 5F4NA 4S32A 4K18A 4Z7HA 5KBQA 3BYMA 3H0YA 4GW8A 4JDKA 2A19B 4LMUA 1F3MC 2Y4PA 3NAYA 5CSHA 5E8XA 2QNJA 3ODYX 1M2PA 3EN7A 4AA5A 4E5AX 3CKXA 4D5KA 4EQMA 5A4LA 4ZSJA 4XG7A 4D4SA 3FY0A 3CY2A 3Q9XA 5EKOA 4WSYA 3JVSA 2I0EA 4BIBA 4AOIA 3SG9A 4FV8A 2I7QA 3D5UA 1T46A 4JR7A 1WBTA 2QOKA 4RJ7A 3V5TA 4A4OA 5DT4A 4BCPA 2VAGA 2VO3A 3G0FA 3RWPA 2GNJA 4F6WA 2GU8A 3BCEA 3D2IA 4P7EA 2O65A 2ZVAA 3DU8A 3I79A 3KXZA 3NW5A 3C4ZA 4GU6A 4HPUE 5CEQA 5FXRA 1BUHA 3Q4UA 4WBBB 4L45A 4QYFA 4MNEA 2FA2A 4ZMEA 3QU0A 4O1OA 2PVYA 3QYZA 4BCOA 1IRKA 2Y7JA 2WB8A 1K9AA 2X9EA 4FV9A 3RP9A 5C8NA 5LWMA 1OITA 1UU9A 4UN0C 1UU3A 3RPRA 3R0TA 2RF9A 2W4OA 2BR1A 3LCDA 4AW5A 4GK4A 4XV1A 3PIXA 1XMMA 3BL7A 3DJ6A 4FTOA 2VV9A 2VTLA 3Q4TA 3FV8A 2XKEA 3R8MA 4KUJA 4E4LA 3ODZX 2C5YA 3EN5A 4ONAA 4YURA 5IDPA 3MSSA 4R7HA 4RG0A 4F0GA 4GT3A 4PNIA 5BUEA 3QD4A 3DKCA 2WEIA 4KWPA 5CAUA 4BKZA 1K2PA 4XX9A 2OW3A 3ZFXA 4BCJA 3MESA 3BIZA 4FEXA 3VUTA 4YU2A 1M14A 4CCBA 3UOLA 1H1QA 2J90A 4AE9A 4FIJA 5M44A 3FMDA 3MFSA 4MUQA 3HMIA 1KE5A 4YO6A 2Y6MA 3AMYA 4FT3A 4FJVA 3QZIA 1LEZA 3DXNA 3QGYA 4J7BA 4CFWA 4FKPA 2X2MA 2XP2A 1PXOA 4AN2A 1FVVA 2HXLA 2UW3A 1PYXA 4NEUA 3PG1A 3UDBA 3FKLA 3ET7A 4EQUA 3FKOA 4BCMA 3ANQA 2R7BA 1M7NA 2F57A 3FZPA 2JDTA 2JDOA 3L8XA 4YR8A 2QU5A 2VRXA 2ITUA 3QTSA 4ZXTA 3NUXA 5B2MA 2J51A 2CKEA 3CPCA 3Q2JA 5HVKA 2C0OA 3NS9A 5DR2A 2BTSA 4YMJA 2BAQA 4GT5A 1UVRA 4C4IA 4HCUA 5DRDA 3AT3A 3I6UA 3MW1A 2QURA