4QP7A

Crystal structure of erk2 in complex with 2-(1h-pyrazol-4-yl)-5h-pyrrolo[2,3-b]pyrazine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
345
structure length
337
Chain Sequence
MVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based discovery of potent ERK2 pyrrolopyrazine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
total genus 107
structure length 337
sequence length 345
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qp7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qp7A01
4IWQA 2C1AA 5FXSA 5DNRA 2G2HA 3V6SA 1XH9A 5IDPA 3GCPA 3IW6A 3QKLA 4RA4A 4L7SA 2R3QA 2FVDA 4Q5HA 2XNMA 2QO9A 2DWBA 3GOKA 4CEGA 4UWBA 4OGRA 3CIKA 3LE6A 4I24A 2WGJA 4U6RA 2B54A 2O65A 3FC2A 3GU5A 3F7ZA 3L8XA 5TO8A 4DGGA 2PVNA 4ZS0A 4ZSJA 1YXXA 3O17A 1JKTA 4CFUA 3QCXA 4CMTA 4RIXB 3ZZWA 1ZARA 4BGGA 5HVYA 1KE7A 3PYYA 4WD5A 2OG8A 4QMYA 4FV2A 1XH7A 3DJ5A 3ZSGA 1WBOA 3WIKA 5M09A 3I0OA 4FTTA 3VS6A 2C0IA 4PMPA 3UQCA 2R64A 3KULB 4O6EA 3GBZA 3UTOA 1NW1A 4GIIA 4D55A 4NH1A 2ZB0A 4GT4A 5E1EA 4JL9A 3AMAA 1KE6A 3D5VA 3R6XA 4FT3A 2WU7A 4F70A 3GCQA 3NZ0A 3ZYAA 4BBFA 4OTHA 4AACA 3BU5A 2XBJA 1ZYCA 4MNFA 2ITQA 2BRMA 4N0SA 2X6DA 4WRSA 5IF1A 5DRDA 3IECA 3QHWA 4IC8A 2GQSA 4JS8A 2PVLA 3NIEA 2ITTA 4GG7A 4O22A 3D5UA 5CAPA 5BVEA 4IZYA 3BHYA 4AF3A 2PZ5A 4D28A 2GTNA 4U40A 4M3QA 1SZMA 3ZO1A 1FVRA 2QONA 3SLSA 5TE0A 4PQNA 2GNFA 3VBXA 4GU9A 2GNGA 4J52A 4XV9A 5ETIA 3A7FA 3IG7A 2XK8A 3E88A 2C5OA 3IKAA 2WD1A 2W5BA 4YTCA 4DCAA 4O7LA 4ZEGA 4C4IA 5DBXA 2HENA 2I0YA 2W1EA 3QTUA 3ZLYA 3A4PA 4FKWA 1O6YA 1UU8A 1DI9A 2QR8A 4FVPA 4I22A 3TKIA 4NIFB 4YR8A 3FEGA 1M2PA 4KIKB 2GNLA 3CE3A 4DAWA 4CFNA 4MHAA 3VJOA 2OKRA 3W8QA 4EOIA 1P4OA 3DXNA 4FIJA 4HJOA 3DKCA 4O83A 4EHVA 1YKRA 3I81A 1SVGA 3PG1A 4MVFA 5HE2A 4ZTMA 5JN2A 5J87A 2JFMA 1IA8A 3U54A 3TNHA 1U5RA 5L6PA 4O81A 2XS0A 4P2KA 4YJRA 3WF8A 5AP0A 2UVYA 4G9RA 5HZNA 5BUJA 2WQNA 3TNQB 3FAAA 2BIYA 4F99A 1PXNA 4H1JA 2XKCA 4BWXA 2Y6OA 3VULA 3R02A 3TKUA 2RIOA 4BKYA 2CNVA 1PXLA 4CVAA 3QYWA 1PXJA 1IAHA 2YM5A 4MH7A 4K1BA 3NVMB 1NY3A 3VAPA 4O82A 3I6UA 4D4SA 3QD2B 1PKDA 2OWBA 5L8JA 3R1NA 2FUMA 3DBCA 3TDWA 5E8SA 3VUIA 4ZMFA 4QTDA 2WTVA 4EEVA 3QQJA 4QMZA 3ROCA 4FZFB 4HGSA 2XCKA 4LGDA 4ZAUA 1FVTA 4FZAB 4CD0A 3RTPA 1L3RE 4EC9A 4XBUA 3EFLA 3R2YA 2XNPA 2XJ0A 3PE1A 3ORNA 4GJ2A 2YIRA 4PNIA 2I1MA 3DNEA 2HW7A 1JBPE 4MTAA 4M0ZA 5D11A 3JR1A 2HZ4A 2X8IA 1OIYA 4BTFA 4EQMA 1Y6AA 3FSKA 4FKTA 3GQLA 5A4EA 3QQKA 2JDTA 3TN8A 1GNGA 4DA5A 2O64A 4G3FA 4GH2A 5AIRA 3W2RA 3EQHA 3PVWA 3KF4A 4BRXA 3EIDA 4LFIA 4RG0A 2B1PA 2BRBA 2WQEA 5FQDC 3U4UA 2FO0A 5AR8A 4F9BA 5HTIA 4RWLA 5J1VA 4C4EA 4LRJA 4CZUA 3EN7A 2OGVA 4XG2A 3UJGA 3CKWA 1W83A 3GVUA 3ZXTA 3KC3A 3LKMA 2BALA 3I6WA 4JI9A 1Q97A 3CJFA 4ZJVA 2XNEA 3ZC6A 4WO5A 3UC4A 5KKRB 1H1PA 1Q3DA 1V0OA 1ZXEA 3R21A 2EXMA 3NDMA 3PZHA 2XKEA 4Y8DA 5BX0A 3VBWA 3ZDIA 5EHOA 2G15A 5AFVA 4CRLA 2UZUE 3DLSA 3AD4A 2ERKA 4D58A 3P5KA 4O7ZA 3BELA 5DLSA 1PYXA 3PVUA 4TW9A 4L67A 4AFJA 5EM6A 5K3YA 4HCUA 3OWJA 4Y72A 2X7OA 2Y0AA 4X6RA 4DEGA 4BC6A 2G9XA 4JX3A 2RFEA 4W8EA 4OTQA 4IHPA 4XV1A 4N6ZA 4YJTA 4BBEA 4BDHA 5FTGA 2CGUA 4BFMA 2F7ZE 4G31A 3AQVA 5E9EA 4ZZOA 2F4JA 2F2CB 5ANDA 4C7TA 4FICA 3F7WA 4QRCA 3AXWA 4IZ7A 5H2UA 3RAHA 1PMNA 1OKYA 4TPTA 4LI5A 5CAOA 4MD7E 5HORA 3SG8A 1RJBA 4QPSA 4PPBA 3DTCA 3PE2A 1Y6BA 1M2QA 4I5PA 2OXDA 4EOQA 2RFSA 1GJOA 2FA2A 5BVDA 4WNKA 3RCDA 4IFCA 2JLDA 3Q4CA 5BVNA 2B4SB 3RNYA 2YLFA 3CSVA 4IADA 1OIRA 5FBOA 3U6HA 4XHKB 5EQEA 3LQ5A 2W1FA 4R5SA 3TG1A 3CKXA 3VO3A 4KS7A 1OGUA 3V01A 3D7TB 3KQ7A 4TYEA 2G01A 4S34A 1BYGA 3MESA 1UU9A 4C2WA 4KKGA 4ACGA 1J3HA 3FHRA 2C4GA 4B8LA 3LMIA 1WVXA 3S3IA 3PZEA 3N4VA 3NW7A 4BCNA 2BRHA 1OECA 4EUTA 4XJ0A 5IPJA 4NCTA 5JH6A 3PG3A 3E3BX 4NL0A 5ANJA 2J0IA 2R9SA 1UWJA 3CCNA 2PUNA 2UW3A 3VBQA 4BCIA 4GRBA 5IQIA 2XP2A 5BNJA 1ZRZA 2VTOA 3BLRA 4LV5A 4OTPA 2YISA 3RPSA 4GMYA 3ZCLA 3VS0A 2X1NA 1JNKA 4YBKA 1R0PA 3DB6A 4C37A 2GNJA 2OIDA 3F66A 5AP6A 4ANBA 1VZOA 2CCHA 5BUIA 2WMRA 3EB0A 4XOYA 3ZOSA 2XK4A 4I23A 1KSWA 3FL4A 4MF1A 4TYIA 4F9WA 1VR2A 4CFXA 5I9ZA 3OCTA 3L1SA 3ID6C 3KVXA 5IA2A 2WMAA 3HV7A 4H39A 3MW1A 2YN8A 2R0UA 3A99A 3R04A 4IAFA 5DR9A 3SC1A 4A4OA 1R78A 2ZJWA 3ORMA 3VF9A 2J0MB 4JR3A 4BDAA 5K4JA 2YCRA 3RM7A 3VNTA 2C5VA 4G5PA 4M67A 2JDSA 2X2KA 4G5JA 4J71A 4QPMA 5HG8A 1ZMWA 4R78A 1ZYJA 2A19B 4ZSAA 3KXGA 2A1AB 3CQWA 3VBYA 3H0YA 1P14A 5IEVA 5IQHA 4AWIA 3EKNA 3OW3A 3OMVA 3PXFA 5IQGA 2C3KA 2JIUA 4FSWA 4NU1A 1R1WA 1S9JA 4JIKA 4BBMA 5A4LA 5IH6A 5HQ0A 4NW5A 3R9NA 3R8UA 4U97A 5J9LA 4IANA 2PUPA 3VUGA 3T3UA 2ONLC 2QO7A 3MBLA 3MFRA 5CQWA 3UO4A 5CAUA 4O38A 3OS3A 4YLLA 3QQGA 5CNNA 4F0GA 4E4MA 4FK6A 4F7LA 2QOKA 1IAJA 4D1XA 2QOOA 3MFUA 2C5YA 2E9VA 3NAYA 3TV6A 2FSMX 3HP5A 4M8TA 3RHXA 2XRUA 5CWZA 3VN9A 1SMHA 5KMJA 2P3GX 2XNNA 3R2BA 3R28A 3TNIA 2ETMA 2OJGA 4RQKA 4F63A 3LMGA 3F2NA 1OB3A 2QOLA 4XMOA 2B9FA 2HXQA 3CR0A 4ZTLA 1WVYA 2P0CA 4TYHB 2VTAA 5DOSA 4D2RA 4WNPA 4BDDA 5IG1A 5IQFA 1FBNA 1W7HA 2YDKA 5DT4A 5JRQA 1V1KA 3LCTA 5FTOA 1JQHA 4XRLA 4QYFA 4UV0A 3COHA 4BGHA 3Q4UA 2JKMA 2F2UA 1NVRA 2W9ZB 4U42A 3BYMA 3ZO3A 1TKIA 3HECA 4YPSA 3Q5IA 1H0WA 2OXXA 2ITNA 5HG7A 2ITZA 4YC8A 2EUFB 4KINA 4OLIA 3DB8A 5FLFA 2G2FA 5J1WA 2XYNA 1ZMUA 4N57A 4YZNA 4FSMA 3FSFA 2QKWB 3QCYA 3DZOA 3W2OA 5JGAA 3DK7A 3SX9A 2J0KA 3NWWA 3BX5A 4BIEA 5GZ8A 3R73A 3QC4A 2NNWB 4L6QA 3KXNA 3HV4A 2R5TA 4L42A 4AW5A 2VNWA 2CGXA 3BHUA 2YABA 3FUPA 2BIKB 5B0XA 2WMSA 2UUEA 4ZTNA 4BKZA 4DFZE 4CTBA 3OY3A 4CRSA 5AX9A 3F3WA 5M4CA 5HESA 3LFAA 3PXZA 4L3PA 2QU6A 4USDA 4AGUA 2HW6A 4H1MA 3PLAE 3WYXA 4CSVA 4NM5A 4YGAA 4YO4A 2PE2A 3QQLA 2C69A 1P5EA 3ZH8A 4IAIA 4FV6A 3G15A 1ZMVA 3POZA 4D4VA 4TWPA 4ZSEA 4OUCA 4AFEA 2XYUA 3OTUA 5C8MA 4J7BA 3ZRKA 3TIZA 3KK8A 3F2RA 3O0GA 4JG8A 1BI7A 3SXSA 4I3ZA 2Z8CA 4IDTA 4L45A 4IIRA 3EQDA 4U7ZA 1B38A 4G9CA 1CDKA 3GCVA 4ZK5A 5TKDA 1WBNA 5CSXA 3UYSA 4ENXA 5C8KA 4QMOA 4IX3A 4E5WA 5HTBA 3NUXA 4OT5A 5FTQA 5G1XA 3C51A 3KY2A 3RPOA 3QTWA 1WMKA 3VJNA 5KO1A 4FTNA 3DJ6A 3GOPA 5DT0A 4FKVA 2Y8OA 1Z57A 4DG0E 4X2NA 4AUAA 3SW7A 5EOBA 4PRJA 4IQ6A 4CFWA 3SDJA 3ET7A 3LFBA 4BDEA 1KE8A 2EVAA 2WTWA 4KSQA 3FMJA 3F6XA 4L44A 4ZZMA 2DYLA 2OH0E 4FTRA 2VWZA 5I9WA 5LOHA 2CNQA 1OZ1A 2YLEA 3VUHA 5EI8A 3R9RA 4FG8A 4XP0A 4DGOA 2C5XA 4K9YA 4BTKA 1W98A 3C4XA 3G0EA 5I3RA 3DTWA 4WSYA 4DBXA 5C01A 3QXPA 3EQIA 4DH8A 3ZM4A 4A9RA 2GHLA 4DINA 4HVHA 2Y4IC 3IDBA 3EN9A 1URCA 3MB6A 3P86A 4H3PA 5DR6A 2PPQA 4EOKA 4YJOA 4FEVA 4FT5A 4FYNA 4CYIA 3PDTA 1GOLA 2VGPA 3AGLA 4ZTRA 3JPVA 4EJ7A 3F3TA 3TNPC 3MYGA 3UO6A 2CLXA 4AW2A 4QMWA 5DG5A 4RA5A 3SOAA 4OR5A 3Q9YA 4A4XA 2QHMA 3KA0A 3MSSA 2XRWA 1YXSA 2WMTA 2IW6A 4LMUA 3VVHA 3NEWA 4E1ZA 2BKZA 5M4UA 2AC5A 2QG5A 4O27B 1O6KA 2IN6A 2XCHA 2E9UA 1OL6A 4DFUA 5J5SA 5IH4A 4TY1A 3FKOA 4GFOA 3CBLA 5E8WA 4NZWB 3NUNA 4DT8A 4EZ3A 2BROA 3MPTA 3ATTA 3BU3A 4P5QA 5EK7A 4K11A 3OBJA 4M69B 5KUPA 3L8VA 4DH5A 5KZ0A 1CKIA 4GK4A 5HVKA 2RSVA 4B6LA 1MUOA 3NW6A 3ZO4A 2CMWA 1LUFA 5HLNA 2VWBA 1KWPA 2YDJA 4I5HA 3G0FA 4ASDA 2OO8X 3VWAA 2JFLA 2C5NA 5KMOA 3D15A 3FXWA 4BDBA 3DT1A 3OT3A 2IPXA 4DEHA 4FV9A 3Q4ZA 4CT1A 3FZSA 1PMVA 3QFVA 4MBJA 3R8ZA 3S4QA 1URWA 3U4WA 5EM8A 4CGAA 3OP5A 1AD5A 2WO6A 5CF8A 2BAQA 5KBRA 3IW4A 3QRUA 2QNJA 1ZOHA 5A54A 5EM7A 3LMHA 2VU3A 3HP2A 3DKGA 4MNEB 4O7VA 1MRVA 4FTMA 4ZP5A 3PP1A 2OIQA 4C8BA 2WOTA 3MJ2A 4DEBA 1KOBA 4WNMA 5GIPE 3W32A 1LR4A 5E91A 3OWPA 1SYKA 3B8QA 2EWAA 1PXPA 2YIYA 1KE9A 2NPQA 4BCJA 4DFBA 3F69A 3QRIA 5IQCA 4ANOA 1UKIA 2W1ZA 4QYYA 4D1ZA 4XLIA 3Q96A 1Q8YA 4I6FA 5L2WA 4DG3E 3KU2A 5AR5A 5E8UA 3RZBA 2C3IB 5AA8A 5LVPA 2ZYBA 2AC3A 3HEGA 4K8AA 4JLCA 5C4LA 4F7JA 4EYMA 1CSNA 1S9IA 5AP4A 3DCVA 5EYKA 4FKQA 5L2IA 2XK9A 5IUHA 4KNBA 3RPRA 3BYUA 5DHJA 4YC3A 4JQ8A 2QC6A 3BHTA 3ORIA 4C36A 2XNBA 3HV6A 3GXLA 4DEDA 4U3ZA 4NFNA 3UNKA 4O0XA 5HNIX 3CTQA 3KRWA 5ETAA 3RBWA 3V5TA 2HK5A 3AD6A 2Z2WA 2R7BA 2VTSA 3W2CA 4IZAA 1J1CA 2R2PA 4RRVA 3P7BA 4HYUA 3GC8A 5LWMA 4LRKA 1YDTE 4UBAA 3FI3A 4WG3A 1GIJA 4KBCA 1KV2A 4K18A 2VNYA 5JEBA 5D9HA 4C3PA 1BKXA 3A7JA 4DHFA 5BYLA 3Q9WA 5DE2A 5L2TA 2OZAA 3AC1A 4FNWA 5AP7A 3ZMMA 2UW0A 3WIGA 4MXAA 2XKDA 3BQRA 4NM3A 3T9IA 4RJ3A 3ELJA 1QCFA 4O86A 3BLHA 3VUDA 2P33A 3NYOA 3H0ZA 3PTGA 3I5NA 4FNYA 4N4SA 3K3JA 4Z3VA 4E6CA 2EU9A 2WQOA 4KKEA 4GFGA 3QBNA 4FTJA 2UZDA 3W10A 3ZXZA 4IMYA 3HDNA 3PRIA 4TRLA 5EFQA 3TXOA 1QMZA 3O7LD 3FMHA 4PL3A 3R1YA 3TNWA 5KX8A 3E63A 3WZKA 4Z55A 2R4BA 4ZY4A 3EQCA 4BYIA 5A9UA 5BVOA 1PKGA 3LFCA 3DLZA 1R39A 3WZUA 3RPVA 5BYYA 2JDRA 3BYVA 5L6WL 2ZM3A 3BGQA 5FXRA 3A60A 3DXQA 3FY0A 3PXKA 1FGIA 3BBTB 4O0RA 2VN9A 4QPAA 3GQIA 4KB8A 3R0TA 1IA9A 4BGQA 4I92A 1H1WA 2DUVA 3PIYA 3QAME 1XR1A 3O71A 4RPVA 5LMAA 3P9JA 4EBVA 3NPCA 4AT4A 5HX8A 5KMKA 4GKHA 2ZM4A 4AZSA 1YXVA 2VWIA 3V8WA 4QMUA 3NX8A 2P4IA 4R7HA 4FF8A 5TT7A 4RFZA 1UKHA 2Z7RA 2PK9A 3E8EA 2IW9A 4I20A 4L01A 2JEDA 5J9ZA 5M51A 1GIHA 3NCZA 3OWLA 4FSNA 4IEBA 2ITXA 4JAJA 4O0VA 2YHVA 3PY0A 1L8TA 4JQ7A 4HPUE 5D41A 5LQFA 3JY9A 3OZ6A 5KBQA 4J53A 3ITZA 4K2RA 4HGLA 4CCBA 2W4OA 2XBAA 4KKHA 2LGCA 1GY3A 1Q62A 2HELA 2W5HA 3Q9XA 5DI1A 2XIYA 4CZYB 4LOOA 4CFMA 4OT6A 5LXMA 2E9OA 5FD2A 4L43A 4HYSA 5DRBA 2VWWA 2XJ1A 3OUNB 5EYCA 2C6TA 4G3EA 1OKWA 2WTCA 3FLNC 3R9HA 5CU3A 5AEPA 4ZS4A 4YNEA 2ZMDA 4NTTA 3HX4A 5DN3A 5E8TA 4NK9A 4HGTA 4YTIA 3WBLA 5L3AA 1YOMA 3F61A 4IX6A 3QWKA 3QZFA 4I6BA 3RAWA 4XOZA 3UYTA 4L8MA 2R3MA 4TN6A 4DEAA 3VRZA 2BPMA 2JKOA 5B2MA 5FEEA 5BQ0A 3H10A 3TCPA 2YWVA 1REKA 2RFDA 5CSHA 2WTJA 3EHAA 4ANQA 2G1TA 3IW7A 1H25A 1YXTA 3KXZA 4IX4A 3CEKA 4FZDB 4NYEA 3MTFA 3Q6WA 4EH4A 1JSTA 3MI9A 4CZTA 4GKIA 4PDOA 1FOTA 3GENA 3Q60A 3PSDA 2XEYA 4EH9A 3TT0A 1YHWA 5EM5A 5BPYA 4DH1A 2WXVA 2GS7A 3QALE 3L8PA 4QMMA 4YZCA 2AUHA 4I21A 2LAVA 5HEZA 2PUUA 3RGFA 3TZ7A 4F1TA 2F49A 2FH9A 3QU0A 4CXAA 1YXUA 3DPKA 2C3LA 3MH0A 4D4RA 2P55A 3UE4A 2QQ7A 3DOGA 4MYGA 3EL7A 4APPA 2GHMA 4Y46A 5BUEA 2GQRA 5HIBA 2PYWA 4QMSA 2W96B 4YSJA 4KIQA 4DLIA 1F3MC 2J0JA 4F9AA 3L9NA 3FLYA 3GC9A 2PVHA 3CQEA 3P23A 3PWDA 3UZRA 2ZM1A 1YOJA 3MY1A 1OKVA 1H07A 2X39A 4LMNA 2C6EA 4MF0A 3HUBA 4FIFA 1MQBA 4FKOA 4V05A 5CEQA 3TZ8A 3WOWA 2YM4A 3PIXA 4W9WA 3E87A 3ZUUA 2GPHA 3QL8A 2C6MA 3R71A 4XX9A 4AS0A 4W4XA 2OZAB 3U9CA 3ZLXA 2RF9A 1U5QA 4GIHA 1LPUA 4E3CA 4HVSA 4K0YA 5CY3A 2ITOA 4FV5A 4UWYA 4MXZA 3O51A 4FEQA 1Q8TA 2J0LA 3CPBA 4BDKA 3RKBA 4EOSA 1PRYA 3AGMA 3GI3A 5E4HA 3E5AA 3KFAA 2XK7A 4TL0A 4RX5A 2OSCA 2X9FA 2CKQA 4GG5A 5DFPA 1Q41A 3L9LA 1H1SA 4QMPA 1H01A 4JDJA 4D1SA 4EYJA 3KRRA 3HRCA 4RJ8A 3ZTXA 3HRBA 4EHZA 2WMVA 1W8CA 4FL3A 4ZMEA 2GS6A 5J7HA 4O0UA 2QODA 3C5IA 1OL1A 2SRCA 5D1JA 1PXOA 4BCGA 5C9CA 4BDJA 4RLKA 3RWQA 4FKPA 2RG5A 2W9FB 5JFSA 2J51A 3NW5A 2OJFE 4L00A 3VS4A 4CTCA 3ACJA 2YIWA 4FR4A 3CQUA 5IA3A 4EBWA 4CLJA 5EQPA 4AGDA 5FXQA 3JY0A 3CS9A 3W16A 1H1QA 4IAZA 1MQ4A 3EYGA 4IC7A 1TQMA 2C6KA 4AZWA 2E9NA 4ACMA 4ARKA 3HMOA 3MTLA 3IQ7A 4FKJA 1ZY5A 3GGFA 3FQSA 3L9MA 5EOLA 5CXHA 3RK5A 3R1QA 4IX5A 4NKAA 4I5CA 4E4LA 3MJ1A 4RVTA 4D2SA 5CF5A 4C62A 5HKMA 4A9SA 3UIXA 1JOWB 2YDIA 1BL6A 4U43A 4YPDA 2Q0BA 1YWNA 4K33A 3TUBA 2WIPA 3LXNA 5EI6A 3PA4A 3QX2A 3EJ1A 3EQGA 4FKSA 4YJSA 1FGKA 2YM6A 2W0JA 3HMMA 3KVWA 2VTLA 3QTSA 4M12A 4E6DA 3JXWA 3KMMA 2OF2A 2QU5A 4O7RA 4BI1A 1XHAA 4X2JA 4FA2A 5M4IA 4FL1A 2Q83A 2WTIA 3M1SA 4ITHA 4G6OA 5HCYA 3PIZA 3FMLA 4APCA 1NT2A 3VBVA 3MDYA 1CKJA 4P7EA 4IBMA 1BI8A 3C0GA 5I9YA 3KN5A 2OICA 3EH9A 1VYWA 1JSVA 1UNGA 3IOPA 4NKSA 5GIOE 1FPUA 4D0WA 5IISA 4W4YA 4XG9A 4EKKA 4KRCA 4EH7A 4G6NA 5HU3A 4F6UA 5H9BA 5HOAA 4FTCA 4M68A 3D9VA 1YI4A 3JVSA 1Q24A 4W4VA 5I0BA 1B6CB 2FB8A 2V7OA 2B7AA 3LCDA 4DEEA 2GQGA 4E4XA 3O8PA 4ITIA 3KKVA 3R9DA 5A6NA 4ERWA 2GMXA 2PVKA 3K2LA 4R77A 3T8OA 5LJJA 5E7RA 4RT7A 3FDNA 3Q4TA 4DTBA 5A3XA 3R63A 4PF4A 4YMJA 1F0QA 3DBFA 3COKA 4FBXA 4FT9A 4K77A 4YJPA 2W4JA 4GUBA 4I94A 5CT7A 5M08A 3G51A 3C50A 4EK5A 2VGOA 5E8VA 4JBOA 3D4QA 4TNBA 4WRGA 3UVRA 5LVMA 1JKSA 1STCE 1A06A 2H6DA 3I60A 3ZDUA 2PMIA 4EWHA 1M2RA 1MRYA 4FIEA 3QZGA 4GV1A 3IONA 2F7XE 4IM2A 5T3QA 3UP2A 1KV1A 3C5UA 2A4LA 3OOMA 4FODA 4KS8A 3UG1A 4XG6A 4BTJA 3DKFA 3BV3A 3QA0A 4O96A 3UNJA 1GZ8A 4MNEA 3THBA 1ZOEA 4EZ7A 3GU4A 2EB3A 3FKLA 3GEQA 2Y7JA 3ZFXA 2OI4X 3FPQA 3A7GA 1ZYLA 3D7TA 3OVVA 3AMBA 2C6IA 4M13A 4E20A 3LXLA 2O5KA 2VUWA 2FSTX 2ITUA 2H8HA 2XH5A 3UPXA 5JSMA 4AU8A 4FIIA 3QUPA 2R0IA 2QG7A 3GC0A 3CC6A 4CCUA 3CP9A 4J99A 3FKNA 2BZIB 4UEUA 3D2IA 1M52A 2JC6A 2O63A 3FLQA 4FV7A 3VQUA 3P1AA 4Y5HA 1IASA 4IWOA 5FRIA 2V7AA 3MVHA 1UU7A 4FEWA 1ATPE 2A2AA 1GZNA 2QOBA 3N9XA 5C8NA 4AZEA 3PLSA 4FG7A 4HOKA 4TNDA 3F88A 1WBVA 4FKIA 3FMEA 3CXWA 2HY81 4ENYA 4DFLA 4XEYA 5KMIA 2QD9A 2CCIA 3FLWA 3JYAA 4IB3A 4RWIA 4WUAA 4R8QA 3PXYA 1OM1A 5F4NA 3MY0A 5AAFA 3IOKA 5EYDA 5JZNA 4RBLA 2BCJA 3AOXA 5FM3A 5AADA 2YIXA 3HKOA 2XVDA 3NIZA 4NWMA 3PXRA 2IVUA 3HYHA 5CANA 4ZLOA 3LM0A 3DZQA 4AP7A 2ZV8A 5CASA 4JDHA 1U59A 4QP1A 4YSMA 1MRUA 1Z5MA 1FINA 2XZSA 4FSQA 1HOWA 3LCSA 4Y85A 4C38A 2HIWA 2HWPA 2JDOA 5HE3A 1G8AA 4FGRA 3ORZA 4DT9A 2YM3A 2O0UA 2V5QA 3M11A 5HLPA 3MWUA 3SXFA 4DCEA 3QZIA 5L2SA 2XIZA 4J1RA 3ETAA 2BVAA 5ANIA 5CU0A 4Y83A 5JGBA 5CEMA 5CSPA 3KF7A 2X2LA 5E92A 3W18A 1Y57A 4AXAA 1DAWA 3OG7A 5HD4A 4LM5A 2JAMA 5KHXA 4CQEA 4C33A 2ZOQA 3TJCA 1Q61A 4F0IA 4EJNA 3O7LB 5DVRA 3QZHA 4A9TA 3ORKA 4HGEA 2UW5A 4UXQA 2CNUA 2WKMA 4I6HA 3OT8A 5HO6A 2VRXA 5HICA 3U9NA 3OCGA 1J91A 4BDIA 4KA3A 3EKKA 4FOBA 3UG2A 5IU2A 3UOJA 3R7OA 5T68A 2QURA 3R8PA 3RK7A 5HE1A 3LM5A 4D4YA 5JKGA 4CYJA 4IWDA 2HCKA 3FL5A 3QRKA 3RPYA 2J5EA 3UDBA 3F2AA 2QLQA 4AT3A 2PZYA 4E5AX 5JQ5A 5CQUA 4C3FA 5KCVA 2EXEA 1ZZLA 3EQBA 4BZOA 4L3LA 4AZVA 4EH3A 1J1BA 3GC7A 4BHZA 3R1SA 3RWPA 2ZVAA 3G6GA 2GS2A 4M66A 2PVFA 4II5A 4KAOA 4O1OA 2VV9A 5HE0A 4CLIA 5ITAA 3BCEA 4F64A 4TXCA 4RVKA 3NGAA 5CVGA 4UB7A 4RJ6A 1H08A 4NTSA 2R3HA 1TVOA 3BHHA 2PSQA 3ENMA 1I09A 5M57A 3I0QA 2GFCA 3HZTA 4MKCA 3PSCA 3NUSA 3KRJA 3QUDA 5DPVA 3R7UA 4AN9A 2BZKB 3WARA 2ETRA 2PE1A 3ANRA 2OJIA 4JQEA 4PDPA 2WB8A 3UQGA 4X0MA 2IJMA 3BEGA 3M2WA 3FYJX 3ROYA 3VUKA 1ND4A 4IVBA 3R7VA 5HBHA 3N4UA 3BE9A 3IGOA 5CZHA 4FK3A 3ZZEA 3AC8A 2V22A 4EH5A 4KWPA 3D5WA 2PVYA 3E8NA 3DAKA 2WELA 2UW6A 3F5XA 4CKRA 3G6HA 4JT3A 2VZ6A 1QPJA 4O0SA 3CJGA 1O6LA 3GFWA 4QMVA 3SKCA 4BCFA 5IMXA 4MQ1A 2V0DA 3U55A 4LGGA 2V62A 5ACBC 2ERZE 3PA5A 5AUZA 1HCKA 5L6OA 1OMWA 4E6QA 3FZ1A 3DNDA 1OPLA 4J98A 4U41A 4TYHA 3ULIA 4HCVA 3FZRA 4RVLA 4GUEA 4W9XA 5AP1A 4EQCA 5BMSA 2RFNA 3TUDA 4D2TA 4YTFA 3WF5A 2IW8A 4RJ5A 5CU4A 4I93A 4Z7GA 2I40A 3K54A 3NYNA 5DT3A 4FG9A 4CV9A 3SVVA 3DGKA 2JBPA 4C2VA 4EHGA 3UQFA 2ESMA 2UVZA 4QP2A 3L8SA 4ALUA 4HVIA 4YHJA 2CPKE 4U45A 1B39A 4CKJA 2XF0A 5E1SA 4IDVA 3GCUA 5DH3A 1P2AA 5IUIA 1WBPA 5IKWA 4AGWA 3HMNA 3CLYA 1VYZA 4R6VA 3ZONA 4QQTA 4UZHA 4GCJA 3PWYA 4I0SA 2IO6A 1JKKA 4FX3A 2C6LA 3VQHA 3IDCA 5HBJA 2PL0A 3FC1X 2OH4A 1YHSA 3C13A 5FP6A 5M53A 5J5TA 4KRDA 5AP5A 2ZDTA 3FXXA 4UXLA 5CI6A 3LFQA 1G3NA 2B9JA 2CLQA 4FT7A 3G9LX 4RSSA 4IVAA 3HAMA 3PSBA 3HMIA 2R3GA 2WQMA 4BWPA 2BILB 4B0GA 1QPEA 1RW8A 5IDNA 3FE3A 2PMNX 2F7EE 2PWLA 3VS1A 5EW8A 3EFJA 5IEXA 3OUKA 2B9IA 2ITYA 3P4KA 5GJFA 4EK8A 5C1QB 1KE5A 3L9PA 4ALVA 2BRNA 2OJ9A 2VAGA 3FMMA 4IAAA 4RX7A 4NEUA 2KULA 4BVUA 5CXZA 4PPAA 4M15A 5CAQA 2QKRA 2YAAA 5ETFA 4ZTSA 3CY3A 2ZAZA 5D7VA 4K6ZA 2XIXA 4TWOA 3ODYX 2JAVA 3PPZA 2X4FA 3KB7A 4F9CA 3DAJA 3OCSA 1W0XC 4FIHA 3PRFA 2W1HA 3I1AA 4YUQA 4FTOA 2PHKA 4AAAA 3IS5A 2CDZA 5IH5A 3QTXA 3BKBA 4I4EA 4ACDA 3F9NA 4X21A 3UVPA 3F5GA 3ZEPA 3HAVA 4D2PA 4HPTE 4L46A 4FV0A 4XP3A 2ETKA 3V3VA 4C35A 4I0RA 4YHTA 4I0TA 4TYGA 1BMKA 3G2FA 4IXPA 2I0HA 3ZFYA 4F7NA 3Q6UA 3RMFA 3SRVB 4HVDA 3PXQA 4NJDA 3DQXA 4J96A 2VTQA 5AR2A 5GINE 2XMYA 3WE8A 2DQ7X 4JOAA 3DAEA 4AZTA 3LFFA 3PP0A 4G34A 3ZEWA 3NNUA 4KIPA 3MIAA 1J7UA 4E26A 4RZWA 4C34A 5K4IA 3Q2JA 4N70A 2IZSA 4PV0A 2WQBA 4BF2A 1YWRA 2VWXA 3DU8A 4BCQA 4RZVA 3UIMA 3TIYA 5FUTA 4BDFA 4CMUA 1LEWA 4E73A 4O7YA 3BU6A 5CEOA 4NM0A 3DS6A 5DWRA 3Q2MA 1YVJA 2VTJA 3TKHA 2BZHB 3VBTA 3QTRA 1DM2A 3UGCA 4C4HA 4L52A 5EDQA 4A06A 3RI1A 5B2LA 3LJ0A 2PMOX 2W5AA 4FI1A 2YA9A 3FLZA 4YO6A 5HIDA 3U6IA 1J7IA 3AT4A 3IW8A 3C0HA 4GYGA 5FWKK 2ZV9A 4CT2A 2J4ZA 3ZBXA 4CMOA 2YCSA 2BKKA 2Y4PA 4V0GB 4U9AA 3RJCA 3COMA 1O9UA 5KHWA 5AV2A 4L3JA 5CEPA 2WTDA 1OI9A 3DY7A 4GK3A 3SW4A 2GHGA 4I5MA 1NVQA 4RGJA 4BI0A 4E93A 3IPHA 5CSWA 2J90A 5D7AA 4QTCA 2WMQA 1K2PA 1BLXA 3SHEA 3QUEA 5GHVA 4G3DA 2OW3A 2UZTA 3K5UA 3EQFA 5AM6A 4PDSA 5A4QA 1V0BA 1T45A 2C0TA 3BLQA 4LUDA 1VEBA 4O21A 3UODA 2GNHA 2XJ2A 4YJNA 4EQUA 4X3FC 4O7SA 3NS9A 2R3NA 4M14A 2WTKC 3Q5ZA 3PJ1A 4FT0A 1P4FA 3HVCA 3QLGA 3F3UA 3ORPA 5LVLA 2J50A 4MAOA 3QGYA 4U81A 3F5UA 4UZDA 3BZ3A 2B53A 3UVQA 3NUUA 3WI6A 5HO7A 4DLJA 5AMNA 4G6LA 5FEDA 3AT2A 3R8LA 4QQCA 4DFYA 3FI8A 3FZOA 4IVCA 3EQPA 4RC2A 4CG9A 4S32A 3A61A 3UIUA 3EFWA 2BZJA 2C0OA 2R3IA 3LFSA 4DC2A 4XLVA 4F6WA 5IQBA 4FNZA 3TV7A 5IQAA 2JITA 3D94A 3G5DA 4FUXA 3Q3BA 3VIDA 3BQCA 3E8DA 3OEZA 2UVXA 2A27A 4FMQA 1XWSA 1H27A 4O0YA 3II5A 4X2KA 5A46A 4ORKA 4RX8A 5FG8A 2E2BA 3V04A 1A9UA 5HG5A 3UOHA 4ALWA 3LCOA 1PW2A 4IM0A 4YZBA 2X8EA 3HL7A 4UALA 4X2GA 3LXPA 4J97A 3AG9A 1PXMA 2WMXA 3QA8A 2JDVA 5DGZA 4EORA 3SOCA 2OU7A 2PUIA 4PMMA 5CEIA 3D5XA 4D9UA 1FMOE 4JBPA 2XA4A 3BWFA 3R83A 4WA9A 5HX6A 4IZ5A 5EKOA 3ZRMA 4Z7HA 5LMBA 3PJ2A 3D7ZA 3KCFA 3QHRA 4PY1A 4MXCA 4FKGA 4DFNA 3C1XA 4HNFA 4IE9A 3IW5A 2VTMA 3BPRA 3NAXA 2QHNA 3KULA 4FEXA 4BHNA 4WT6A 1YI6A 3B8RA 3ZSHA 2GDOA 2P2IA 2RKUA 4YJVA 4DE4A 4B4LA 4PX6A 3SG9A 4OW8A 3KEXA 2AYPA 4F0FA 3QTQA 3DDQA 3DK3A 4F08A 3MH3A 4YZDA 4AOJA 5J7BA 4GYIA 4C4FA 4PMTA 4AZFA 2VX0A 5AWMA 3OHTA 3BE2A 4BR3A 4GVAA 4WG4A 4H36A 5L4QA 2QOIA 3DFCB 1OUYA 3TZMA 2YACA 3G90X 5ANEA 4OAVB 3I7CA 4ANSA 4H58A 2HZIA 4WKQA 2VO0A 3R30A 2WZJA 3TWJA 4CFFA 4CQGA 4U5JA 4QNYA 3P7CA 1REJA 2OIBA 4C3RA 4PL4A 1NVSA 1DS5A 1K3AA 4IAYA 4NM7A 2XIRA 3PVGA 4BWKA 3VS5A 2O2UA 3E8CA 3FV8A 4AT5A 3ORXA 1PMUA 4R1VA 5F94A 2C1BA 1IG1A 4RLLA 4JR7A 5LMKA 2W1CA 4I41A 4P4CA 4QP8A 4NUSA 3UPZA 2OLCA 3CY2A 3NNWA 4PUZA 4TZRA 4JDIA 3V5QA 1E1XA 1SVHA 3W55A 2R3LA 1Y8GA 4XS2A 4QMTA 3JS2A 3REPA 2VTHA 2VO3A 1UA2A 2OFVA 3RK9A 5CS6A 4EKLA 4FEUA 2YAKA 5AV0A 3EN4A 3U51A 3UOKA 5LCKA 2FGIA 5DIAA 4UY9A 3ZC5A 4GSBA 4G2FA 3E93A 1XH8A 2JKQA 2VO6A 4BZDA 4FTUA 3MN3A 3HA8A 4BCHA 4H3BA 5AUTA 4XG7A 2UZLA 4EOOA 4A07A 3K5VA 4NCTC 2R3JA 5H3QA 1T46A 4AG8A 1G5SA 5C26A 2HZ0A 3QX4A 5CX9A 2XIKA 5DMZA 3OXZA 4MBLA 2CGVA 4FSRA 5CLPA 3VW8A 2BAJA 4C02A 3H3CA 4H3QA 3E62A 5GZ9A 4CG8A 5AAEA 2ZDUA 4YHFA 5ANKA 3TL8A 3DFAA 4AA4A 4XG4A 4I6QA 3ERKA 1XBAA 4GEOA 4FV8A 5EYMA 3PFQA 3CD3A 4R7IA 5M55A 2XM9A 3W2PA 2I7QA 3ZLSA 4BDGA 4XG8A 3C4WA 2VTIA 1GZOA 3QF9A 4ZIMA 2PE0A 5E8ZA 4XUFA 4MEDA 4F6SA 2R3KA 4FZ6A 4FGBA 3Q9ZA 2A0CX 1H8FA 2W06A 3O50A 3AD5A 1YQJA 5DEWA 3POOA 4USEA 1Q4LA 3C4FA 5BVKA 2ACXA 3LCKA 4D9TA 4MBIA 4U44A 2NO3A 1OPKA 2X8DA 3H9FA 1PHKA 3OOGA 4IAKA 4LV8A 3AC2A 4QYGA 4R3CA 3V8TA 4B7TA 3S95A 4B99A 3IK3A 3NVKI 5HCZA 3EQRA 1RE8A 3EFKA 4F1OA 1WVWA 2XNGA 4QTBA 1CKPA 2Z7LA 5AR4A 5AX3A 4TWNA 4AA0A 4JBVA 3KMWA 5AV4A 3VC4A 3LLAA 4U0IA 4RIYA 4E8AA 4D2VA 1UV5A 2PTKA 4RFMA 5D12A 1OPJA 5IA4A 3U6JA 3C4EA 4I4FA 4WUNA 4L53A 4AW1A 1XH5A 4BL1A 5KKRC 5F9EA 4M69A 4E5BA 5IQEA 5CEKA 4CKIA 5CVHA 2UZOA 3TACA 2BFXA 3F3ZA 3DQWA 3IDPA 3OXIA 1YRPA 5CENA 3RINA 4Y73A 4IW0A 2NRUA 1PMEA 4LQMA 4L68A 2VX3A 4LUEA 5L8LA 1FVVA 5AA9A 3CTHA 3FY2A 3CGOA 1ZYSA 3V5PA 5F95A 5HNGA 1QL6A 4X3FB 2J6MA 4FSZA 4L7FA 3BV2A 2I6LA 2ZV7A 2WTKB 3M42A 1R3CA 1SNUA 3MS9A 2WFYA 3NRMA 4O2PA 1Y8YA 3H9OA 3Q32A 4S30A 3C0IA 4V01A 4O7TA 4LOQA 4O6LA 1IR3A 1LP4A 4ONAA 4UYAA 3SAYA 5EQYA 4C59A 3LFDA 3NCGA 4BZNA 3TEIA 3OWKA 1WFCA 2JBOA 2Y6MA 3PVBA 4QYEA 4HNIA 4WNOA 3RP9A 4DFXE 1GAGA 2VWYA 2O8YA 4E6AA 4XG3A 5LCJA 3BEAA 4ASXA 3PA3A 4RIOA 2Z7QA 4BYJA 5JZJA 2UZNA 4QP6A 2H9VA 4ITJA 4WSQA 5HLWA 3BGPA 1ZYDA 5JMSA 3SGCA 5M07A 4HZSA 3HGKA 4MX9A 4O7NA 4PDYA 4NFMA 1OIQA 4YNOA 5E8XA 2VO7A 3B2TA 3P7AA 4C4JA 1X8BA 1Y91A 3NNVA 4NW6A 5HVJA 4M97A 4MD9E 3O2MA 3UP7A 3VUMA 5IMEA 2OZOA 3NSZA 4G17A 4P5ZA 1WBSA 4YZMA 4KUJA 4V04A 5AUYA 5I9XA 2IWIA 4JBQA 3ZUTA 2IVSA 2HAKA 4Q9SA 4U79A 4DTAA 5KMLA 5DEYA 5I3OA 2WU6A 1R0EA 4M7IA 5CI7A 3GT8A 5IUGA 4DG2E 1UWHA 4LL0A 3FZPA 2ONLA 5ANGA 4HZRA 2HYYA 3HUCA 3ZS5A 3CPCA 3R01A 4XBRA 3GU7A 5EDRA 4KSPA 4AQCA 3UOLA 2CN5A 4A7CA 5EH0A 5K0KA 4PP7A 5GJGA 4Q9ZA 1K9AA 1MP8A 3BBWA 5AR7A 2EXCX 3QYZA 4RJ4A 3ZO2A 4RC3A 4KIKA 3HNGA 4O1PA 4PMSA 4EHEA 3KCKA 5LMKC 5AP2A 3MH1A 4RWKA 3VW6A 2CGWA 3V5JA 3EYHA 2V55A 5AUXA 5B2KA 4O7WA 3OBGA 3EL8A 3FQEA 4O0WA 2PVRA 1F5QA 3DV3A 4ZJJA 4RWJA 3AT3A 5FP5A 4DGMA 4EZ5A 1KOAA 2CN8A 3I7BA 4JDKA 1PXKA 2PVMA 3A8WA 4FV1A 2FYSA 3MA6A 2GFSA 3VS2A 1WBTA 4L9IA 5A14A 3ACKA 3KXMA 2VTRA 5FDPA 2Z60A 5KMNA 2WNTA 3RNIA 5T6KA 1JLUE 1JAMA 3PJ8A 4MCVA 3UO5A 2ITVA 4UMQA 4X2FA 1TQPA 2GCDA 2XK6A 3GCSA 4MXOA 3MPAA 3QQHA 2BHEA 3F5PA 4Q5EA 5EI2A 3TI1A 2GU8A 5HTCA 4UX9A 5EHLA 2Q0NA 2BUJA 3QQUA 3LJ1A 3AC3A 4Z16A 3PJCA 3MB7A 4X3JA 3QRJA 4IJ9A 1OITA 2UW4A 4J8MA 2OK1A 2B55A 3D0EA 2WMWA 3VHKA 4PTEA 3R22A 4ZY5A 5CF4A 2O3PA 3DA6A 3BHVA 4AA5A 3C7QA 3LLTA 5F1ZA 2QCSA 3WILA 2BTSA 4AE6A 2NP8A 3KXXA 3P0MA 3LAUA 2UZWE 3I4BA 4IM3A 3D14A 4DF3A 3V6RA 1TQIA 3BI6A 4FKUA 4GU6A 3QTIA 3S0OA 1H26A 2J5FA 4B9DA 1M14A 4OTFA 4HW7A 4C57A 1H1RA 4IB0A 4LL5A 5HIEA 3R8MA 3NMUF 2BFYA 2B0QA 5H8BA 4LG4A 1YI3A 4QTEA 5JFXA 2PY3A 3FMDA 4OBQA 3JUHA 3LJ2A 2VX1A 3TV4A 3UMXA 4I1ZA 4IACA 4ZY6A 4BN1A 2IVVA 4JRVA 4QQJA 3A7IA 4F09A 2Z7SA 3TTJA 4BB4A 4ACCA 4QP7A 4ZLZA 3H9RA 4PP9A 3QD3A 2BHHA 4XH6A 4GVJA 4FTIA 3FZTA 5EW3A 5ETCA 3MA3A 4MD8E 3QD4A 3K3IA 4A9UA 5CALA 5J8IA 2I0VA 3QWJA 4D0XA 1QPDA 3AMYA 4KBAA 2QR7A 3S00A 3S1HA 2CKPA 2J7TA 4ACHA 4ZZNA 2JGZA 2ZMCA 3FYKX 3I5ZA 4FTLA 3RVGA 2PZRA 3ULZA 1CTPE 3COIA 1BL7A 2WEIA 3H4JA 4PNKA 3Q53A 3MGYA 3QLFA 4QMXA 4DH3A 4F65A 3G33A 3TDVA 3LXKA 1ERKA 3IO7A 3NNXA 3TTIA 4ANNA 1XBCA 3A2CA 4FC0A 3R9OA 4DGLC 3W33A 2QVSE 2BDWA 3QD0A 4XV2A 4JG6A 5CU2A 3OEFX 2YZLA 2ITWA 2WEVA 3D83A 3F3VA 5AJQA 3QCSA 5BVFA 2JKKA 4DBNA 4EK3A 5C03A 4F4PA 2G2IA 5AUUA 3RALA 2VTTA 4ZTHA 3UNZA 4GL9A 4NT4A 1SNXA 2UW9A 1ZAOA 3FI4A 4WOVA 4DYMA 4BIBA 1PXIA 4ANLA 1ZY4A 1WZYA 2QLUA 2QOFA 4YZ9A 3V51A 3AC5A 3R7GA 5AIKA 4MWHA 2OBJA 5IEYA 2JD5A 3MVMA 3ZLWA 3MV5A 4DEIA 3KXHA 5KMMA 3QKKA 2Z02A 3DBEA 4OBPA 3ENHA 3CTJA 1ZOGA 4ASEA 3HA6A 4BTMA 2OJJA 4FIGA 2HWOA 2YITA 3SQQA 5C27A 3V5WA 3ZM9A 3BYSA 4LGHA 2OXYA 5K9IA 5TF9A 4QMQA 4FV3A 4MK0A 5M4FA 3N4TA 1I44A 2EB2A 4R3PA 3U87A 4JRNA 2BAKA 1U54A 4EWQA 4FKLA 4WHZA 4TT7A 4GFMA 1G8SA 4O0TA 4YURA 4RX9A 4G3GA 1OKZA 2W4KA 4HYIA 4TKSA 1AGWA 2C68A 3LIJA 5M44A 1ZZ2A 4OTDA 4FE2A 4OTIA 2UZEA 4D5KA 3E92A 3T9TA 4M84A 2UZBA 2X2MA 3FWQA 3ZBFA 4QYHA 4R7BA 3ANQA 4ZJIA 2HY0A 2PU8A 4PWNA 5EG3A 1YDSE 4EH8A 3UZPA 4BY9E 3KRLA 1EH4A 5CT0A 5CU6A 5CSVA 3LZBA 3VUTA 1BX6A 5EDPA 3PPKA 2CSNA 4QT1A 2GNIA 5G6VA 1UVRA 5HU9A 2Y4IB 1W84A 3ALOA 3DJ7A 4EOMA 1U54B 2RGPA 3FQHA 5I9VA 3GU8A 2I0EA 3W8LA 2WHBA 2F57A 3EMGA 1CM8A 2KTYA 3NUPA 4YU2A 2B52A 3FBVA 1FMKA 3FLSA 3W2QA 1E9HA 3R00A 4ZSGA 3W2SA 1XBBA 3A4OX 4OBOA 1JSUA 4AOTA 5LVOA 3D2KA 1NXKA 3NUAA 3A7HA 4UMPA 4CFVA 4O84A 3FMKA 2BMCA 2YCQA 3UC3A 2ZB1A 3E7VA 2X7FA 5FGKA 4USFA 3DK6A 3HV3A 2XEZA 5BMMA 4XRJA 3P08A 4D5HA 2NRYA 5CF6A 1YDRE 3GUBA 3P79A 3ORTA 4IJPA 1YWVA 2C47A 2FSLX 4KIOA 1M17A 2W05A 2R7IA 3HRFA 3ZFMA 3ZHPC 3LFEA 3PUPA 3KK9A 4S31A 3RAKA 4EOJA 5ICPA 1XH6A 2BTRA 4WIHA 1GZKA 3HLLA 5H8GA 4DGNA 5CVFA 3O96A 3OTVA 4QQ5A 5I5ZA 4U8ZA 4X3FA 3ZUVA 4WG5A 3MFTA 4RFYA 2BR1A 2CJMA 4YJUA 4OTRA 3GP0A 2X0GA 4EONA 4TYJA 5AV3A 4C61A 3T3VA 5I9UA 1H00A 5AV1A 5TR6A 4IWPA 3S2PA 4BDCA 5GZAA 3F82A 3DKOA 5HO8A 2YCFA 5JGDA 1RDQE 4ZOGA 4FTQA 3LOKA 3OC1A 3TJDA 5B7VA 4LYNA 5FDXA 3BGZA 3DBDA 4W8DA 1KUTA 3NR9A 4OTWA 3V8SA 1YW2A 4NSTA 4IH8A 5AAGA 5JRSA 4QO9A 4YBJA 5F20A 3R7IA 4D2WA 5DYJA 4ANMA 4S33A 2Y9QA 4BCMA 5HD7A 4AX8A 4FKRA 4FTKA 3OCBA 5IQDA 4FSYA 4ASZA 4XV3A 5KE0A 1Q8ZA 4KD1A 2YFXA 4O91A 4RQVA 4JIAA 2XB7A 5M06A 1Q5KA 4JAIA 1OL5A 2X9EA 4JX7A 5C4KA 4F7SA 3WZEA 1OUKA 1UU3A 2C3JA 4FVQA 4ZLYA 3LW0A 3WF7A 4YP8A 1WAKA 2PMLX 4DN5A 3BRBA 3OD6X 5M56A 2C6DA 1J7LA 1OBDA 5J9YA 4JG7A 5H8EA 4EOLA 2YM8A 3NYVA 4JVGA 1IEPA 2H96A 1XO2B 5ACKA 4ZTQA 4X6QC 4AW0A 4R5YA 3ATSA 3DBQA 5LVNA 1JKLA 1Q99A 1WBWA 3LPBA 2H34A 2PVJA 4XNEA 3EOCA 3I79A 3GB2A 2QOHA 4RIWA 5GNKA 4BICA 4EI4A 3VRYA 3CGFA 1LEZA 2YEXA 3OY1A 4EK4A 3VF8A 2VWUA 5EW9A 1V0PA 3QGWA 3G9NA 4WBBB 4R1YA 3R7YA 3WZJA 5JFWA 2X7GA 5BYZA 4YJQA 5IA0A 1Q8UA 2R3RA 4PTCA 4YLKA 5K5NA 3ZRLA 1H28A 5DR2A 3MVJA 5JFVA 4BKJA 3EWHA 4H05A 5J79A 2C30A 3LVPA 4UYNA 3UBDA 4RVMA 2YZAA 4E7WA 3GNIB 2C6OA 3RM6A 2X4ZA 3MPMA 4NJ3A 3SV0A 3RHKA 1U4DA 4NIFA 4BCOA 4S2ZA 4JXFA 4BCKA 4FL2A 2YJSA 3DXPA 4QOXA 1A48A 1H4LA 2J9MA 2YERA 5EHYA 4RJ7A 5L2QA 4GW8A 3FXZA 3E64A 3A8XA 2W17A 2ITPA 4J95A 4XP2A 4F1MA 5A6OA 3MIYA 3PPJA 3O8TA 4DITA 3ODZX 4FV4A 4IVDA 4J8NA 5CZIA 3FMNA 2DS1A 1U46A 2PZIA 3LQ3A 1FQ1B 4ZXTA 3SD0A 3KGAA 3NUYA 3MFSA 4QTAA 4RIWB 4IFGA 2UW7A 5LWNA 3Q52A 1QPCA 3EZVA 2W99B 2WIHA 4W4WA 4GS6A 1GIIA 3V5LA 3QKMA 2F9GA 4GJ3A 1XJDA 1W82A 3WZDA 3TUCA 4F9YA 1YOLA 4Y95A 5HHWA 4WBOA 3U8WA 4YLJA 2QI8A 1M7QA 1CMKE 3OROA 4QP3A 3GU6A 5CNOA 5J95A 2VTNA 4GT3A 5JK3A 4GT5A 2R3FA 4QP9A 4A9YA 2VWVA 5GJDA 2E9PA 3VS3A 2RG6A 2J2IB 3QCQA 4G16A 4PTGA 5HGIA 1PY5A 4XCUA 2WMUA 3NLBA 4ERKA 2YWPA 3EN5A 5FM2A 3C9WA 5IZFA 5A4TA 3FHIA 5K0XA 4RIXA 5IA5A 5AP3A 2OF4A 5A4CA 1VJYA 3AC4A 4FSUA 2IZTA 2YIQA 1PYEA 3P78A 2BDJA 4IB1A 4O2ZA 2W7XA 2IZUA 4BIDA 4LRMA 5JT2A 2QO2A 3QC9A 4MWIA 4N6YA 1BUHA 4AOIA 1OVEA 4ID7A 1H24A 4G3CA 5CTPA 3WE4A 2IZRA 3EN6A 3HMPA 3DDPA 4FVRA 3SRVA 1DAYA 2VTPA 3ZU7A 4AN3A 2B9HA 5K5XA 4E4NA 3BYOA 1UNHA 5FEQA 4B8MA 4A4LA 3LHJA 2HXLA 5AR3A 3MH2A 5KZIA 3UMWA 4PL5A 2BDFA 2X6EA 1ZWSA 3QXOA 4KBKA 3CD8A 2UV2A 1RQQA 1SM2A 1AQ1A 4Y5QA 3R7EA 5KNJA 3FPMA 1WCCA 4MXYA 3E7OA 2GSFA 5AUWA 3SA0A 4JNWA 2RL5A 1XH4A 3WF9A 2CKEA 2QOQA 1IRKA 2W1IA 4DTKA 4UN0C 3Q04A 1XQZA 3ZSIA 2W1DA 4XYFA 1UNLA 4G1WA 2WOUA 1Q3WA 5I4NA 4EC8A 4QD6A 4Q2AA 4FNXA 3TZ9A 2PULA 4AGCA 3C4ZA 2P2HA 5L8KA 4TWCA 5ANOA 3B2WA 2PZPA 1JWHA 4FTAA 4UMUA 4EL9A 3LFNA 4U80A 4FYOA 2XK3A 4Z9LA 4MQ2A 3W1FA 4EUUA 2R3PA 3FI2A 4BCPA 3OF0A 4QMLA 5LARA 4HVGA 3IGGA 5HBEA 3PY1A 2YM7A 3VHEA 4C0TA 2BRGA 1M7NA 3C4CA 2JIIA 1OIUA 4OAUC 4C58A 4UMTA 3ALNA 4RMZA 4CV8A 1H0VA 4BI2A 2QOCA 4DH7A 3RAIA 3KL8A 4EH6A 4TTHB 3HDMA 4AE9A 4YC6A 1PJKA 2ZV2A 2XNOA 3SXRA 5BVWA 2UZVA 3OFMA 1YHVA 4EK6A 2REIA 2WPAA 1Z9XA 5AM7A 5EKNA 4UWCA 2GTMA 3WYYA 3O8UA 5CYIA 3A62A 4V0GA 5HG9A 2XM8A 3NYXA 3ORLA 4HYHA 4KABA 3UZTA 2X81A 2XKFA 3TM0A 4EOPA 5TOZA 4PPCA 1HCLA 5E90A 3OW4A 5DA3A 1OBGA 5D10A 3N51A 4FUYA 1E1VA 3KRXA 1PF8A 3H30A 3QQFA 5CAVA 5FBNC 2CKOA 3FJQE 3BIZA 2IG7A 4R3RA 2HOGA 4RC4A 1OL7A 4FSTA 4C4GA 5IA1A 3RCJA 1OL2A 1NA7A 4IB5A 3EZRA 3O23A 3WF6A 4MXXA 4UMRA 2HZNA 3MVLA 4ZSLA 4QNAA 3KMUA 4FZ7A 3GFEA 1SVEA 5AUVA 4EH2A 3MY5A 4GK2A 3VS7A 4LOPA 4OTGA 3LQ8A 3KREA 1ZLTA 2XUUA 5JQ8A 3OXTA 3QTZA 3KN6A 4JJRA 2FSOX 2OFUA 2W1GA 1JPAA 2WAJA 5HI2A 3JVRA 3QRTA 1DI8A 5HNBA 1APME 4FOCA 3R8VA 3RZFA 4M0YA 5HCXA 2JIVA 4QMNA 1Q8WA 1JVPP 1XKKA 3BWJA 2R3OA 4HCTA 2VD5A 3E3PA 4YTHA 2IVTA 4QP4A 4CNHA 3UIBA 5E8YA 3PJ3A 2YJRA 4AN2A 2WMBA 3HV5A 4U3YA 4P90A 2UW8A 4X7QA 3PY3A 4RIYB 2CHLA
chains in the Genus database with same CATH superfamily
4IWQA 2C1AA 5FXSA 5DNRA 2G2HA 3V6SA 1XH9A 5IDPA 3GCPA 3IW6A 3QKLA 4RA4A 4L7SA 2R3QA 2FVDA 4Q5HA 2XNMA 2QO9A 2DWBA 3W0OA 3GOKA 4CEGA 4UWBA 4OGRA 3PFYA 3CIKA 3LE6A 4I24A 2WGJA 4U6RA 2B54A 2O65A 3FC2A 3GU5A 3F7ZA 3L8XA 5TO8A 4DGGA 2PVNA 4ZS0A 4ZSJA 1YXXA 3O17A 1JKTA 4CFUA 3QCXA 4CMTA 4RIXB 3ZZWA 1ZARA 4BGGA 5HVYA 1KE7A 3PYYA 4WD5A 2OG8A 4QMYA 4FV2A 1XH7A 3DJ5A 3ZSGA 1WBOA 3WIKA 5M09A 3I0OA 4FTTA 3VS6A 2C0IA 4PMPA 3UQCA 2R64A 3KULB 4O6EA 3GBZA 3UTOA 1NW1A 4GIIA 4D55A 4NH1A 2ZB0A 4GT4A 5E1EA 4JL9A 3AMAA 1KE6A 3D5VA 3R6XA 4FT3A 2WU7A 4F70A 3GCQA 3NZ0A 3ZYAA 4BBFA 4OTHA 3O5AA 4AACA 4JMQA 3BU5A 2XBJA 1ZYCA 4MNFA 2ITQA 2BRMA 4N0SA 2X6DA 4WRSA 5IF1A 5DRDA 3IECA 3QHWA 4IC8A 2GQSA 4JS8A 2PVLA 3NIEA 2ITTA 4GG7A 4O22A 3D5UA 5CAPA 5BVEA 4IZYA 3BHYA 4AF3A 2PZ5A 4D28A 2GTNA 4U40A 4M3QA 1SZMA 3ZO1A 1FVRA 2QONA 3SLSA 5TE0A 4PQNA 2GNFA 3VBXA 4GU9A 2GNGA 4J52A 4XV9A 5ETIA 3A7FA 3IG7A 2XK8A 3E88A 2C5OA 3IKAA 2WD1A 2W5BA 4YTCA 4DCAA 4O7LA 4ZEGA 4C4IA 5DBXA 2HENA 2I0YA 2W1EA 3QTUA 3ZLYA 3A4PA 4FKWA 1O6YA 1UU8A 1DI9A 2QR8A 4FVPA 4I22A 3TKIA 4NIFB 4YR8A 3FEGA 1M2PA 4KIKB 2GNLA 3CE3A 4DAWA 4CFNA 4MHAA 3VJOA 2OKRA 3W8QA 4EOIA 1P4OA 3DXNA 4FIJA 4HJOA 3DKCA 4O83A 4EHVA 1YKRA 3I81A 1SVGA 3PG1A 4MVFA 5HE2A 4ZTMA 5JN2A 5J87A 2JFMA 1IA8A 3U54A 3TNHA 1U5RA 5L6PA 4O81A 2XS0A 4P2KA 4YJRA 3WF8A 5AP0A 2UVYA 4G9RA 5HZNA 5BUJA 2WQNA 3TNQB 3FAAA 2BIYA 4F99A 1PXNA 4H1JA 2XKCA 4BWXA 2Y6OA 3VULA 3R02A 3TKUA 2RIOA 4BKYA 2CNVA 1PXLA 4CVAA 3QYWA 1PXJA 1IAHA 2YM5A 4MH7A 4K1BA 3NVMB 1NY3A 3VAPA 4O82A 3I6UA 4D4SA 2X0PA 3QD2B 1PKDA 2OWBA 5L8JA 3R1NA 2FUMA 3DBCA 3TDWA 5E8SA 3VUIA 4ZMFA 4QTDA 2WTVA 4EEVA 3QQJA 4QMZA 3ROCA 1TFFA 4FZFB 4HGSA 2XCKA 4LGDA 4ZAUA 1FVTA 4FZAB 4CD0A 3RTPA 1L3RE 4EC9A 4XBUA 3EFLA 3R2YA 2XNPA 2XJ0A 3PE1A 3ORNA 4GJ2A 2YIRA 4PNIA 2I1MA 3DNEA 2HW7A 1JBPE 4MTAA 4M0ZA 5D11A 3JR1A 2HZ4A 2X8IA 1OIYA 4BTFA 4EQMA 1Y6AA 3FSKA 4FKTA 3GQLA 5A4EA 3QQKA 2JDTA 3TN8A 1GNGA 4DA5A 2O64A 4G3FA 4GH2A 5AIRA 3W2RA 3EQHA 3PVWA 3KF4A 4BRXA 3EIDA 4LFIA 4RG0A 2B1PA 2BRBA 2WQEA 5FQDC 3U4UA 2FO0A 5AR8A 4F9BA 5HTIA 4RWLA 5J1VA 4C4EA 4LRJA 4CZUA 3EN7A 2OGVA 4XG2A 3UJGA 3CKWA 1W83A 3GVUA 3ZXTA 3KC3A 3LKMA 2BALA 3I6WA 4JI9A 1Q97A 3CJFA 4ZJVA 2XNEA 3ZC6A 4WO5A 3UC4A 5KKRB 1H1PA 1Q3DA 1V0OA 1ZXEA 3R21A 2EXMA 3NDMA 3PZHA 2XKEA 4Y8DA 5BX0A 4AXCA 3VBWA 3ZDIA 5EHOA 2G15A 5AFVA 4CRLA 2UZUE 3DLSA 3AD4A 2ERKA 4D58A 3P5KA 4O7ZA 3BELA 5DLSA 3AKJA 1PYXA 3PVUA 4TW9A 4L67A 4AFJA 5EM6A 5K3YA 4HCUA 3OWJA 4Y72A 3AKKA 2X7OA 2Y0AA 4X6RA 4DEGA 4BC6A 2G9XA 4JX3A 2RFEA 4W8EA 4OTQA 4IHPA 4XV1A 4N6ZA 4YJTA 4BBEA 4BDHA 5FTGA 2CGUA 4BFMA 2F7ZE 4G31A 3AQVA 4QEBA 4ZZOA 2F4JA 2F2CB 5ANDA 4C7TA 5E9EA 4FICA 3F7WA 4QRCA 3AXWA 4IZ7A 5H2UA 3RAHA 1PMNA 1OKYA 4TPTA 4LI5A 5CAOA 4MD7E 5HORA 3SG8A 1RJBA 4QPSA 4PPBA 3DTCA 3PE2A 1Y6BA 1M2QA 4I5PA 2OXDA 4EOQA 2RFSA 1GJOA 2FA2A 5BVDA 4WNKA 3RCDA 4AAYA 4IFCA 2JLDA 3Q4CA 5BVNA 2B4SB 3RNYA 2YLFA 3CSVA 1W2CA 4IADA 1OIRA 5FBOA 3U6HA 4XHKB 5EQEA 3LQ5A 2W1FA 4R5SA 3TG1A 3CKXA 3VO3A 4KS7A 1OGUA 3V01A 3D7TB 3KQ7A 4TYEA 2G01A 4S34A 1BYGA 3MESA 1UU9A 4C2WA 4KKGA 4ACGA 1J3HA 3FHRA 2C4GA 4B8LA 3LMIA 1WVXA 3S3IA 3PZEA 3N4VA 3NW7A 4BCNA 2BRHA 1OECA 4EUTA 4XJ0A 5IPJA 4NCTA 5JH6A 3PG3A 3E3BX 4NL0A 5ANJA 2J0IA 2R9SA 1UWJA 3CCNA 2PUNA 2UW3A 3VBQA 4BCIA 4GRBA 5IQIA 2XP2A 5BNJA 1ZRZA 2VTOA 3BLRA 4LV5A 4OTPA 2YISA 3RPSA 4GMYA 3ZCLA 3VS0A 2X1NA 1JNKA 4YBKA 1R0PA 3DB6A 4C37A 2GNJA 2OIDA 3F66A 5AP6A 4ANBA 1VZOA 2CCHA 5BUIA 2WMRA 3EB0A 4XOYA 3ZOSA 2XK4A 4I23A 1KSWA 3FL4A 4MF1A 4TYIA 4F9WA 1VR2A 4CFXA 5I9ZA 3OCTA 3L1SA 3ID6C 3KVXA 5IA2A 2WMAA 3HV7A 4H39A 3MW1A 2YN8A 2R0UA 3A99A 3R04A 4IAFA 5DR9A 3SC1A 4A4OA 2XAOA 1R78A 2ZJWA 3ORMA 3VF9A 2J0MB 4JR3A 4BDAA 5K4JA 2YCRA 3RM7A 3VNTA 2C5VA 4G5PA 4M67A 2JDSA 2X2KA 4G5JA 4J71A 4QPMA 5HG8A 1ZMWA 4R78A 1ZYJA 2A19B 4ZSAA 3KXGA 2A1AB 3CQWA 3VBYA 3H0YA 1P14A 5IEVA 5IQHA 4AWIA 3EKNA 3OW3A 3OMVA 3PXFA 5IQGA 2C3KA 2JIUA 4FSWA 4NU1A 1R1WA 1S9JA 4JIKA 4BBMA 5A4LA 5IH6A 5HQ0A 4NW5A 3R9NA 3R8UA 4U97A 5J9LA 4IANA 2PUPA 3VUGA 3T3UA 2ONLC 2QO7A 3MBLA 3MFRA 5CQWA 3UO4A 5CAUA 4O38A 3OS3A 4YLLA 3QQGA 5CNNA 4F0GA 4LDTA 4E4MA 4FK6A 4F7LA 2QOKA 1IAJA 4D1XA 2QOOA 3MFUA 2C5YA 2E9VA 3NAYA 3TV6A 2FSMX 3HP5A 4M8TA 3RHXA 2XRUA 5CWZA 3VN9A 1SMHA 5KMJA 2P3GX 2XNNA 3R2BA 3R28A 3TNIA 2ETMA 2OJGA 4RQKA 4F63A 3LMGA 3W0RA 3F2NA 1OB3A 2QOLA 4XMOA 2B9FA 2HXQA 3CR0A 4ZTLA 1WVYA 2P0CA 4TYHB 2VTAA 5DOSA 4D2RA 4WNPA 4BDDA 5IG1A 5IQFA 1FBNA 1W7HA 2YDKA 5DT4A 5JRQA 1V1KA 3LCTA 5FTOA 1JQHA 4XRLA 4QYFA 4UV0A 3COHA 4BGHA 3Q4UA 2JKMA 2F2UA 1NVRA 2W9ZB 4U42A 3BYMA 3ZO3A 1TKIA 3HECA 4YPSA 3Q5IA 1H0WA 2OXXA 2ITNA 5HG7A 2ITZA 4YC8A 2EUFB 4KINA 4OLIA 3DB8A 5FLFA 2G2FA 5J1WA 2XYNA 1ZMUA 4N57A 4YZNA 4FSMA 3FSFA 2QKWB 3QCYA 3DZOA 3W2OA 5JGAA 3DK7A 3SX9A 2J0KA 3NWWA 3BX5A 4BIEA 5GZ8A 3R73A 3QC4A 2NNWB 4L6QA 3KXNA 3HV4A 2R5TA 4L42A 4AW5A 2VNWA 2CGXA 3BHUA 2YABA 3FUPA 2BIKB 5B0XA 2WMSA 2UUEA 4ZTNA 4BKZA 4DFZE 4CTBA 3OY3A 4CRSA 5AX9A 3F3WA 5M4CA 5HESA 3LFAA 3PXZA 4L3PA 2QU6A 4USDA 4AGUA 2HW6A 4H1MA 3PLAE 3WYXA 4CSVA 4NM5A 4YGAA 4YO4A 2PE2A 3QQLA 2C69A 1P5EA 3ZH8A 4IAIA 4FV6A 3G15A 1ZMVA 3POZA 4D4VA 4TWPA 4ZSEA 4OUCA 4AFEA 2XYUA 3OTUA 5C8MA 4J7BA 3ZRKA 3TIZA 3KK8A 3F2RA 3O0GA 3UDZA 4JG8A 1BI7A 3SXSA 4I3ZA 2Z8CA 4IDTA 4L45A 4IIRA 3EQDA 4U7ZA 1B38A 4G9CA 1CDKA 3GCVA 4ZK5A 5TKDA 1WBNA 5CSXA 3UYSA 4ENXA 5C8KA 4QMOA 4IX3A 4E5WA 5HTBA 3NUXA 4OT5A 5FTQA 5G1XA 3C51A 3KY2A 3RPOA 4DHZA 3QTWA 1WMKA 3VJNA 5KO1A 4FTNA 3DJ6A 3GOPA 5DT0A 4FKVA 2Y8OA 1Z57A 4DG0E 4X2NA 4AUAA 3SW7A 5EOBA 4PRJA 3NFGB 3PUFC 4IQ6A 4CFWA 3SDJA 3ET7A 3LFBA 4BDEA 1KE8A 2EVAA 2WTWA 4KSQA 3FMJA 3F6XA 4L44A 4ZZMA 2DYLA 2OH0E 4FTRA 2VWZA 5I9WA 5LOHA 3ML1A 2CNQA 1OZ1A 2YLEA 3VUHA 5EI8A 3R9RA 4FG8A 4XP0A 4DGOA 2C5XA 4K9YA 4BTKA 1W98A 3C4XA 3G0EA 5I3RA 3DTWA 4WSYA 4DBXA 5C01A 3QXPA 3EQIA 4DH8A 3ZM4A 4A9RA 2GHLA 4DINA 4HVHA 2Y4IC 3IDBA 3EN9A 1URCA 3MB6A 3P86A 4H3PA 5DR6A 2PPQA 4EOKA 4YJOA 4FEVA 4FT5A 4FYNA 4CYIA 3PDTA 1GOLA 2VGPA 3AGLA 4ZTRA 3JPVA 4EJ7A 3F3TA 3TNPC 3MYGA 3UO6A 2CLXA 4AW2A 4QMWA 5DG5A 4RA5A 3SOAA 4OR5A 3Q9YA 4A4XA 2QHMA 3KA0A 3MSSA 2XRWA 1YXSA 2WMTA 2IW6A 4LMUA 3VVHA 3NEWA 4E1ZA 2BKZA 5M4UA 2AC5A 2QG5A 4O27B 1O6KA 2IN6A 2XCHA 2E9UA 1OL6A 4DFUA 5J5SA 5IH4A 4TY1A 3FKOA 4GFOA 3CBLA 5E8WA 4NZWB 3NUNA 4DT8A 4EZ3A 2BROA 3MPTA 3ATTA 3BU3A 4P5QA 5EK7A 4K11A 3OBJA 4M69B 5KUPA 3L8VA 4DH5A 5KZ0A 1CKIA 4GK4A 5HVKA 2RSVA 4B6LA 1MUOA 3NW6A 3ZO4A 2CMWA 1LUFA 5HLNA 2VWBA 1KWPA 2YDJA 4I5HA 3G0FA 4ASDA 4O4FA 2OO8X 3VWAA 2JFLA 2C5NA 5KMOA 3D15A 3FXWA 4BDBA 3DT1A 3OT3A 2IPXA 4DEHA 4FV9A 3Q4ZA 4CT1A 3FZSA 1PMVA 3QFVA 4MBJA 3R8ZA 3S4QA 1URWA 3U4WA 5EM8A 4CGAA 3OP5A 1AD5A 2WO6A 5CF8A 2BAQA 5KBRA 3IW4A 3QRUA 2QNJA 1ZOHA 5A54A 5EM7A 3LMHA 2VU3A 3HP2A 3DKGA 4MNEB 4O7VA 1MRVA 3W0QA 4FTMA 4ZP5A 3PP1A 2OIQA 4C8BA 2WOTA 3MJ2A 4DEBA 1KOBA 4WNMA 5GIPE 3W32A 1LR4A 5E91A 1VLRA 3OWPA 1SYKA 3B8QA 2EWAA 1PXPA 2YIYA 1KE9A 2NPQA 4BCJA 4DFBA 3F69A 3QRIA 5IQCA 4ANOA 2XALA 1UKIA 2W1ZA 4QYYA 4D1ZA 4XLIA 3Q96A 1Q8YA 1G8KA 4I6FA 5L2WA 4DG3E 3KU2A 5AR5A 5E8UA 3RZBA 2C3IB 5AA8A 5LVPA 2ZYBA 2AC3A 3HEGA 4K8AA 4JLCA 5C4LA 4F7JA 4EYMA 1CSNA 1S9IA 5AP4A 3DCVA 5EYKA 4FKQA 5L2IA 2XK9A 5IUHA 4KNBA 3RPRA 3BYUA 5DHJA 4YC3A 4JQ8A 2QC6A 3BHTA 3ORIA 4C36A 2XNBA 3HV6A 3GXLA 4DEDA 4U3ZA 4NFNA 3UNKA 4O0XA 5HNIX 3CTQA 3KRWA 5ETAA 3RBWA 3V5TA 2HK5A 3AD6A 2Z2WA 2R7BA 2VTSA 3W2CA 4IZAA 1J1CA 2R2PA 4RRVA 3P7BA 4HYUA 3GC8A 5LWMA 4LRKA 1YDTE 4UBAA 3FI3A 4WG3A 1GIJA 4KBCA 1KV2A 4K18A 2VNYA 5JEBA 5D9HA 4C3PA 1BKXA 3A7JA 4DHFA 5BYLA 3Q9WA 5DE2A 5L2TA 2OZAA 3AC1A 4FNWA 5AP7A 3ZMMA 2UW0A 3WIGA 4MXAA 2XKDA 3BQRA 4NM3A 3T9IA 4RJ3A 3ELJA 1QCFA 4O86A 3BLHA 3VUDA 2P33A 3NYOA 3H0ZA 3PTGA 3I5NA 4FNYA 4N4SA 3K3JA 4Z3VA 4E6CA 2EU9A 2WQOA 4KKEA 4GFGA 3QBNA 4FTJA 2UZDA 3W10A 3ZXZA 4IMYA 3HDNA 3PRIA 4TRLA 5EFQA 3TXOA 1QMZA 3O7LD 3FMHA 4PL3A 3R1YA 3TNWA 5KX8A 2XANA 3E63A 3WZKA 4Z55A 2R4BA 4ZY4A 4DHJA 3EQCA 4BYIA 5A9UA 5BVOA 1PKGA 3LFCA 3DLZA 1R39A 3WZUA 3RPVA 5BYYA 2JDRA 3BYVA 5L6WL 2ZM3A 3BGQA 5FXRA 3A60A 3DXQA 3FY0A 3PXKA 1FGIA 3BBTB 4O0RA 2VN9A 4QPAA 3GQIA 4KB8A 3R0TA 1IA9A 4BGQA 4I92A 1H1WA 2DUVA 3PIYA 3QAME 1XR1A 3O71A 4RPVA 5LMAA 3P9JA 4EBVA 3NPCA 4AT4A 5HX8A 5KMKA 4GKHA 2ZM4A 4AZSA 1YXVA 2VWIA 3V8WA 4QMUA 3NX8A 2P4IA 4R7HA 4FF8A 5TT7A 4RFZA 1UKHA 2Z7RA 2PK9A 3E8EA 2IW9A 4I20A 4L01A 2JEDA 5J9ZA 5M51A 1GIHA 3NCZA 3OWLA 4FSNA 4IEBA 2ITXA 4JAJA 4O0VA 2YHVA 3PY0A 1ST0A 1L8TA 4JQ7A 4HPUE 5D41A 4O4EA 3JY9A 3OZ6A 5KBQA 4J53A 3ITZA 4K2RA 5LQFA 2X0QA 4HGLA 4CCBA 2W4OA 2XBAA 4KKHA 2LGCA 1GY3A 1Q62A 2HELA 2W5HA 3Q9XA 5DI1A 2XIYA 4CZYB 4LOOA 4CFMA 4OT6A 5LXMA 2E9OA 5FD2A 4L43A 4HYSA 5DRBA 2VWWA 2XJ1A 3OUNB 5EYCA 2C6TA 4G3EA 1OKWA 2WTCA 3FLNC 3R9HA 5CU3A 5AEPA 4ZS4A 4YNEA 2ZMDA 4NTTA 3HX4A 5DN3A 5E8TA 4NK9A 4HGTA 4YTIA 3WBLA 5L3AA 4F78A 1YOMA 3F61A 4IX6A 3QWKA 3QZFA 4I6BA 3RAWA 4XOZA 3UYTA 4L8MA 2R3MA 4TN6A 4DEAA 3VRZA 2BPMA 2JKOA 5B2MA 5FEEA 5BQ0A 3H10A 3TCPA 2YWVA 1REKA 2RFDA 5CSHA 2WTJA 3EHAA 4ANQA 2G1TA 3IW7A 1H25A 1YXTA 3KXZA 4IX4A 3CEKA 4FZDB 4NYEA 3MTFA 3Q6WA 4EH4A 1JSTA 3MI9A 4CZTA 4GKIA 4PDOA 1FOTA 3GENA 3Q60A 3PSDA 2XEYA 4EH9A 3TT0A 1YHWA 5EM5A 5BPYA 4DH1A 2WXVA 2GS7A 3QALE 3L8PA 4QMMA 4YZCA 2AUHA 4I21A 2LAVA 5HEZA 2PUUA 3RGFA 3TZ7A 4F1TA 2F49A 2FH9A 3QU0A 4CXAA 1YXUA 3DPKA 2C3LA 3MH0A 4D4RA 2P55A 3UE4A 2QQ7A 3DOGA 4MYGA 3EL7A 4APPA 2GHMA 4Y46A 5BUEA 2GQRA 5HIBA 2PYWA 4QMSA 2W96B 4YSJA 4KIQA 4DLIA 1F3MC 2J0JA 4F9AA 3L9NA 3FLYA 3GC9A 2PVHA 3CQEA 3P23A 3PWDA 3UZRA 2ZM1A 1YOJA 2NYAA 3MY1A 1OKVA 1H07A 2X39A 4LMNA 2C6EA 4MF0A 3HUBA 4FIFA 1MQBA 4FKOA 4V05A 5CEQA 3TZ8A 3WOWA 2YM4A 3PIXA 4W9WA 3E87A 3ZUUA 2GPHA 3QL8A 2C6MA 3R71A 4XX9A 4AS0A 4W4XA 2OZAB 3U9CA 3ZLXA 2RF9A 1U5QA 4GIHA 1LPUA 4E3CA 4HVSA 4K0YA 5CY3A 2ITOA 4FV5A 4UWYA 4MXZA 3O51A 4FEQA 1Q8TA 2J0LA 3CPBA 4O4BB 3RKBA 4BDKA 4EOSA 3TMOA 1PRYA 3AGMA 3GI3A 5E4HA 3E5AA 3KFAA 2XK7A 4TL0A 4RX5A 2OSCA 2X9FA 2CKQA 4GG5A 5DFPA 1Q41A 3L9LA 1H1SA 4QMPA 1H01A 4JDJA 4D1SA 4EYJA 3KRRA 3HRCA 4RJ8A 3ZTXA 3HRBA 4EHZA 2WMVA 1W8CA 4FL3A 4ZMEA 2GS6A 5J7HA 4O0UA 2QODA 3C5IA 1OL1A 2SRCA 5D1JA 1PXOA 4BCGA 5C9CA 4BDJA 4RLKA 3RWQA 4FKPA 2RG5A 2W9FB 5JFSA 2J51A 3NW5A 2OJFE 4L00A 3VS4A 4CTCA 3ACJA 2YIWA 4FR4A 3CQUA 5IA3A 4EBWA 4CLJA 5EQPA 4AGDA 4BJJB 5FXQA 3JY0A 3CS9A 3W16A 1H1QA 4IAZA 1MQ4A 3EYGA 4IC7A 1TQMA 2C6KA 4AZWA 2E9NA 4ACMA 4ARKA 3HMOA 3MTLA 3IQ7A 4FKJA 1ZY5A 3GGFA 3FQSA 3L9MA 5EOLA 5CXHA 3RK5A 3R1QA 4IX5A 4NKAA 4I5CA 4E4LA 3MJ1A 4RVTA 4D2SA 5CF5A 4C62A 5HKMA 4A9SA 3UIXA 1JOWB 2YDIA 1BL6A 4U43A 4YPDA 2Q0BA 1YWNA 4K33A 3TUBA 2WIPA 3LXNA 5EI6A 3PA4A 3QX2A 3EJ1A 3EQGA 4FKSA 4YJSA 1FGKA 2YM6A 2W0JA 3HMMA 3KVWA 2VTLA 3QTSA 4M12A 4E6DA 3JXWA 3KMMA 2OF2A 2QU5A 4O7RA 4BI1A 1XHAA 4X2JA 4FA2A 5M4IA 4FL1A 2Q83A 2WTIA 3M1SA 4ITHA 4G6OA 5HCYA 3PIZA 3FMLA 4APCA 1NT2A 3VBVA 3MDYA 1CKJA 4P7EA 4IBMA 1BI8A 3C0GA 5I9YA 3KN5A 2OICA 3EH9A 1VYWA 1JSVA 1UNGA 3IOPA 4NKSA 5GIOE 3UDTA 1FPUA 4D0WA 5IISA 4W4YA 4XG9A 4EKKA 4KRCA 4EH7A 4G6NA 5HU3A 4F6UA 5H9BA 5HOAA 4FTCA 4M68A 3D9VA 1YI4A 3JVSA 1Q24A 4W4VA 5I0BA 1B6CB 2FB8A 2V7OA 2B7AA 3LCDA 4DEEA 2GQGA 4E4XA 3O8PA 4ITIA 3KKVA 3R9DA 5A6NA 4ERWA 2GMXA 2PVKA 3K2LA 4R77A 3T8OA 5LJJA 5E7RA 4RT7A 3FDNA 3Q4TA 4DTBA 4DDIA 5A3XA 3R63A 4PF4A 4YMJA 1F0QA 3DBFA 3COKA 4FBXA 4FT9A 4K77A 4YJPA 2W4JA 4GUBA 4I94A 5CT7A 5M08A 3G51A 3C50A 4EK5A 2VGOA 5E8VA 4JBOA 3D4QA 4TNBA 4WRGA 3UVRA 5LVMA 1JKSA 1STCE 1A06A 2H6DA 3I60A 3ZDUA 2PMIA 4EWHA 1M2RA 1MRYA 4FIEA 3QZGA 4GV1A 3IONA 2F7XE 4IM2A 5T3QA 3UP2A 1KV1A 3C5UA 2A4LA 3OOMA 4FODA 4KS8A 3UG1A 4XG6A 4BTJA 3DKFA 3BV3A 3QA0A 4O96A 3UNJA 1GZ8A 4MNEA 3THBA 1ZOEA 4EZ7A 3GU4A 2EB3A 3FKLA 3GEQA 2Y7JA 3ZFXA 2OI4X 3FPQA 3A7GA 1ZYLA 3D7TA 3OVVA 3AMBA 2C6IA 4M13A 4O4DA 4E20A 3LXLA 2O5KA 2VUWA 2FSTX 2ITUA 2H8HA 2XH5A 3UPXA 5JSMA 4AU8A 4FIIA 3QUPA 2R0IA 2QG7A 3GC0A 3CC6A 4CCUA 3CP9A 4J99A 3FKNA 2BZIB 4UEUA 3D2IA 1M52A 2JC6A 2O63A 3FLQA 4FV7A 3VQUA 3P1AA 4Y5HA 1IASA 4IWOA 5FRIA 2V7AA 3MVHA 1UU7A 4FEWA 1ATPE 2A2AA 1GZNA 2QOBA 3N9XA 5C8NA 4AZEA 3PLSA 4FG7A 4HOKA 4TNDA 3F88A 1WBVA 4FKIA 3FMEA 3CXWA 2HY81 4ENYA 4DFLA 4XEYA 5KMIA 2QD9A 2CCIA 3FLWA 3JYAA 4IB3A 4RWIA 4WUAA 4R8QA 2ZFYA 3PXYA 1OM1A 5F4NA 3MY0A 5AAFA 3IOKA 5EYDA 5JZNA 4RBLA 2BCJA 3AOXA 5FM3A 5AADA 2YIXA 3HKOA 2XVDA 3NIZA 4NWMA 3PXRA 2IVUA 3HYHA 5CANA 4ZLOA 3LM0A 3DZQA 4AP7A 2ZV8A 5CASA 4JDHA 1U59A 4QP1A 4YSMA 1MRUA 1Z5MA 1FINA 4DHIB 2XZSA 4FSQA 1HOWA 3LCSA 4Y85A 4C38A 2HIWA 2HWPA 2JDOA 5HE3A 1G8AA 4FGRA 3ORZA 4DT9A 2YM3A 2O0UA 2V5QA 3M11A 5HLPA 3MWUA 3SXFA 4DCEA 3QZIA 5L2SA 2XIZA 4J1RA 3ETAA 2BVAA 5ANIA 5CU0A 4Y83A 5JGBA 5CEMA 5CSPA 3KF7A 2X2LA 5E92A 3W18A 1Y57A 4AXAA 1DAWA 3OG7A 5HD4A 4LM5A 2JAMA 5KHXA 4CQEA 4C33A 2ZOQA 3TJCA 1Q61A 4F0IA 4EJNA 3O7LB 5DVRA 3QZHA 4A9TA 3ORKA 4HGEA 2UW5A 4UXQA 2CNUA 2WKMA 4I6HA 3OT8A 5HO6A 2VRXA 5HICA 3U9NA 3OCGA 2AEGA 1J91A 4BDIA 4KA3A 3EKKA 4FOBA 3UG2A 5IU2A 3UOJA 3R7OA 5T68A 2QURA 3R8PA 1W2DA 5HE1A 3RK7A 3LM5A 4D4YA 5JKGA 4CYJA 4IWDA 2HCKA 3FL5A 3QRKA 3RPYA 2J5EA 3UDBA 3F2AA 2QLQA 4AT3A 2PZYA 4E5AX 5JQ5A 5CQUA 4C3FA 5KCVA 2EXEA 1ZZLA 3EQBA 4BZOA 4L3LA 4AZVA 4EH3A 1J1BA 3GC7A 4BHZA 3R1SA 3RWPA 2ZVAA 3G6GA 2GS2A 4M66A 2PVFA 4II5A 4KAOA 4O1OA 2VV9A 5HE0A 4CLIA 5ITAA 3BCEA 4F64A 4TXCA 4RVKA 3NGAA 5CVGA 4UB7A 4RJ6A 1H08A 4NTSA 2R3HA 1TVOA 3BHHA 2PSQA 3ENMA 1I09A 5M57A 3I0QA 2GFCA 3HZTA 4MKCA 3PSCA 3NUSA 3KRJA 3QUDA 5DPVA 3R7UA 4AN9A 2BZKB 3WARA 2ETRA 2PE1A 3ANRA 2OJIA 4JQEA 4PDPA 2WB8A 3UQGA 4X0MA 2IJMA 3BEGA 3M2WA 3FYJX 3ROYA 3VUKA 1ND4A 4IVBA 3R7VA 5HBHA 3N4UA 3BE9A 3IGOA 5CZHA 4FK3A 3ZZEA 3AC8A 2V22A 4EH5A 4KWPA 1XMLA 3D5WA 2PVYA 3E8NA 3DAKA 2WEL