4QP7A

Crystal structure of erk2 in complex with 2-(1h-pyrazol-4-yl)-5h-pyrrolo[2,3-b]pyrazine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
345
structure length
337
Chain Sequence
MVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Fragment-based discovery of potent ERK2 pyrrolopyrazine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 107
structure length 337
sequence length 345
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qp7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qp7A01
4NT4A 5F9EA 4YO4A 2YERA 3FKNA 3SLSA 2FA2A 3CTHA 3OEFX 3D5UA 4E4LA 3C50A 2XNBA 2J4ZA 3QCYA 3FYJX 3PPKA 4AS0A 3AMYA 4AZTA 3JPVA 4TY1A 5HKMA 4QNAA 5H9BA 3U55A 3FMEA 2C5NA 2YM6A 4QYFA 3TCPA 4BBFA 1IAHA 4U43A 3TG1A 3I7CA 4AFJA 2XM8A 4FSTA 3CTQA 3KRRA 5F95A 2XJ0A 4BDGA 3O23A 2DQ7X 4JDIA 1KSWA 3Q9YA 3V8TA 5E90A 3W8QA 3MH2A 4U79A 3BE2A 4CMTA 3VW8A 3R00A 1RW8A 3PA4A 1DS5A 4FKOA 4JAJA 5I3OA 4ACCA 5CAOA 2YFXA 4ZY4A 4FT7A 3ZM4A 4F9WA 4W4XA 4PMMA 3PJCA 3ULZA 5KBQA 3TUCA 4G9CA 4GV1A 5F20A 4EZ3A 5L2QA 4BCPA 3O51A 5ACBC 3PXYA 3UNJA 2X7OA 3F6XA 2X81A 3PJ3A 3E88A 3LXPA 4JDHA 4OW8A 4ANOA 4PUZA 4RVTA 4RQVA 3B2TA 3QD4A 4GT3A 1ZY4A 2PVLA 2W17A 4QQJA 3QKLA 5E8ZA 4C3PA 2QOFA 3R9DA 4GYGA 2R3RA 3UDBA 2PMNX 3LFAA 3Q60A 1W83A 2ETMA 2WMBA 3Q32A 4TTHB 4U44A 4E4XA 1JKKA 3TDVA 4IAAA 4QP6A 3UG1A 3FYKX 4F7NA 1Y91A 4AACA 4LUDA 3N4TA 3EQHA 4QTBA 2R3QA 3IW8A 4EQMA 4CFWA 4E6CA 4NCTC 4F6SA 4XG7A 5L2TA 1ZAOA 3WF6A 4I94A 2W06A 3H0YA 2PK9A 4NW6A 3LFSA 4FVPA 4E93A 3VIDA 3POOA 3ORZA 3NGAA 3MPTA 2BILB 3OW4A 4DBNA 4LV8A 4DT9A 2XJ2A 2X0GA 2R4BA 1GZ8A 4FNYA 4LV5A 4GKIA 3MVMA 2C4GA 2UV2A 2ZV7A 4B0GA 5CSHA 2PE2A 4DG2E 2IW8A 3D0EA 3QZIA 3KXNA 5IU2A 5CF6A 2G01A 3A99A 4BDEA 5DR6A 4BDFA 3E7OA 3K5UA 4Y83A 4YNOA 4CXAA 3LHJA 3AC1A 3UZTA 5IG1A 5IQAA 3LJ1A 2QO9A 4AGDA 1Q8ZA 4EH5A 2VWZA 3HL7A 4JBPA 2VGOA 4LUEA 4XH6A 4BDAA 3IONA 3QUPA 2HW7A 3DY7A 5BMMA 3P7BA 2CNQA 2UUEA 3WZEA 3MB6A 3TT0A 4N4SA 3TXOA 3ZO3A 3GB2A 4KBAA 5DBXA 3LCKA 4J95A 4F64A 3ET7A 4AE9A 5AP3A 5BYLA 2WTKB 2WEVA 4U9AA 5DPVA 3C4ZA 5DRBA 4QMLA 5EI6A 4FTKA 3SRVB 4BDCA 3UQCA 4DH7A 1OL2A 4XNEA 3WBLA 2E9UA 5DIAA 4PRJA 3NNXA 4GVJA 3SQQA 5DGZA 3DBDA 5AUXA 1RQQA 2X39A 3HDNA 3AT3A 4HGLA 5ANJA 3FC1X 2XYUA 3COKA 2CKPA 4LI5A 3RAWA 3MH1A 4PX6A 3KKVA 4DHFA 5D41A 3W2CA 4O84A 4BIBA 4Z9LA 2ITZA 4UALA 3BELA 3AD5A 4LGGA 4QTDA 5J79A 5CS6A 1WCCA 3SD0A 2GSFA 2VWUA 3MGYA 3RM7A 3A2CA 4IAZA 3ZLSA 1OB3A 3HNGA 2HXQA 3ITZA 3G15A 2B9FA 4RC3A 5H8GA 3GC9A 4YBJA 5HCYA 5M4UA 1Q8YA 3NX8A 4ZSLA 3FQSA 4OBQA 5DH3A 3WI6A 4QTEA 3LMIA 4F7LA 3VHKA 5A14A 5JEBA 1V0PA 1CSNA 4S30A 4TKSA 2PSQA 4NM3A 1E1XA 3O50A 4FNWA 4IX6A 2I6LA 3CLYA 3V8WA 1PXIA 4I21A 3PRIA 3EN9A 4GRBA 4YTIA 2IW9A 4YJSA 4I6QA 4WRSA 5BNJA 5EG3A 4RQKA 2A1AB 3CKWA 4W4YA 3FSFA 3KN5A 4FTCA 5A6NA 2VV9A 5IQHA 2ITQA 3F2RA 4CZUA 3LM5A 3QC9A 4USFA 3GU5A 3R1SA 5FQDC 4AZWA 2B1PA 3HRCA 4BKYA 3HP5A 5IQCA 3FSKA 1ZMVA 2BAJA 1H0WA 3O7LB 3OTVA 2YZLA 2JDRA 4L43A 4FIFA 2C5YA 4LL5A 2GNIA 5CI6A 3EQFA 4DFZE 2QHMA 5HG9A 2VU3A 4RRVA 1F3MC 4EOPA 4DYMA 3P08A 2FSOX 4CT1A 2HY0A 2R3IA 4M68A 1E9HA 2EXMA 1KOBA 1JBPE 3R04A 5CNNA 4YNEA 3UZPA 3VS5A 3W2RA 4C62A 1XH4A 3JUHA 3NUYA 3SG9A 2A2AA 2W1IA 2GDOA 3CQEA 2H9VA 1YWRA 3EYGA 3P23A 3DK7A 4PY1A 5DNRA 2O63A 3VBYA 4DC2A 2FSLX 3GCUA 1YDRE 3KCFA 3NWWA 4U7ZA 4PDYA 3EFWA 3HYHA 1DM2A 1UKIA 4C8BA 1BL6A 5CNOA 5LVLA 5F94A 2PMOX 4A07A 2R64A 4KKGA 2FB8A 3ORMA 3FMJA 4FTAA 4L00A 1HCKA 5HVJA 4P90A 4N57A 4PP7A 4BZOA 2J90A 3PXRA 1JAMA 4BTJA 4UWBA 4EUTA 1ZRZA 2QVSE 4RIWB 4ZTQA 2X2LA 2XNGA 3CKXA 4BBEA 4NM0A 5HGIA 4DA5A 2GNLA 4NU1A 1JSTA 5FM2A 4IX4A 1AGWA 3I0QA 4UMPA 1B38A 3FDNA 2AUHA 5AR7A 3U4UA 4NM7A 4LGHA 4QMZA 4WNMA 3G33A 3KRWA 5AA8A 2WU6A 3C4XA 4I5PA 3MY0A 5ICPA 4FE2A 5M56A 4KIQA 5DT4A 3QYZA 3OXTA 3AT4A 3QTZA 4Y8DA 2PYWA 4EBWA 3MY5A 1PY5A 5IDNA 5LXMA 1QPDA 4CV8A 5CSVA 2IZRA 3R0TA 4B8LA 2BTRA 1OL6A 4ANLA 5ITAA 4UN0C 5AA9A 4XP0A 4IWQA 3UIBA 5A46A 3PSCA 5GZ8A 3WE8A 4IDVA 4GU9A 4CTBA 4TRLA 3EQCA 3R71A 1J7UA 2C69A 4KB8A 4PMSA 1WBWA 1NVRA 4FYNA 4BI0A 2WMXA 3ZRMA 4FG9A 4NW5A 4C0TA 5CEIA 4D55A 4IW0A 3DXQA 3CP9A 3W1FA 4CNHA 5J5SA 4UB7A 3AC4A 3QL8A 3RM6A 2VTJA 3DAKA 4B99A 2OFUA 1J91A 2VO6A 1OIRA 4UWCA 3TTIA 3LQ5A 5KCVA 4YUQA 4XOYA 3FLZA 2J7TA 5BVWA 2R0IA 2GNHA 3F2NA 3RVGA 4Y95A 4O2ZA 3MTFA 5HEZA 4HW7A 3R8LA 4YHJA 1YHSA 4DTAA 2EUFB 1Y8GA 4WSQA 4LRMA 3UODA 4D4VA 4CMUA 3EL8A 4J7BA 3S2PA 1FPUA 4ZZMA 5L8LA 5KBRA 3R8VA 3BBTB 5IA1A 1OBGA 2W1CA 4O22A 4RZVA 1P2AA 4YP8A 4ZIMA 3VBTA 3NIZA 4EONA 2W05A 4RJ3A 3U8WA 4U3ZA 5BUIA 5IZFA 4RX5A 4ERKA 2DWBA 3LZBA 3FLQA 3LIJA 3Q2JA 2WXVA 3FBVA 4XUFA 4BI1A 4FTRA 3EYHA 2OXYA 5KHXA 4XX9A 2I7QA 4XS2A 1Q41A 3KN6A 4TYIA 4NFNA 3K3IA 3MIYA 3PVGA 5BVFA 2F7XE 5E8YA 1IR3A 2Y8OA 4JRNA 4H3PA 4HGTA 4R1YA 2GS6A 3NR9A 4NKSA 3MA3A 2W1DA 2YA9A 1W84A 1H00A 2GNGA 4FV1A 4YJNA 2PVMA 3PZEA 1Q3WA 2VWIA 5CSXA 3D15A 2OH4A 2QCSA 3KF7A 2FSTX 2WMRA 3I79A 4LQMA 2F2UA 3LQ8A 4GT5A 2VTNA 4LL0A 4ZK5A 4KRDA 5EQYA 4EOSA 5LWNA 2OZAB 5E91A 2ITYA 3R9HA 2AYPA 4E5BA 4EL9A 2WMAA 3VUHA 3TDWA 2VTIA 2XVDA 3PP0A 3QGWA 5B0XA 4KBCA 3I60A 3RK9A 3OUNB 4XV3A 3U6IA 5AP4A 4L7SA 3A8WA 2UZOA 3GP0A 2JLDA 3HMPA 4PV0A 5ANEA 4HVDA 3M42A 1YXVA 5E92A 1XH5A 5C01A 1L3RE 4AW1A 3Q9WA 4AW2A 3DT1A 3LM0A 4L67A 4FA2A 4FTUA 3F5PA 1K2PA 2Y4IB 4RT7A 2XCKA 5KMJA 3VS3A 2VWWA 2ZMDA 5IA5A 4A7CA 5FRIA 4AT4A 1IA9A 3V6RA 3UNKA 4JG7A 4I6BA 3ZO1A 3AOXA 1VYZA 3M2WA 4UMTA 3V5TA 3Q04A 4NH1A 1VYWA 2XNNA 4QMPA 3S0OA 4CGAA 2PUUA 3L9PA 2WMQA 2YCRA 3VUIA 4F6WA 2B53A 3OCGA 4TPTA 4BN1A 4J1RA 4BYJA 3E3PA 2J0IA 3MVLA 4FV2A 4C3RA 1PMUA 3NUXA 4Q5HA 2G2FA 5H2UA 2WPAA 3FPMA 2PVNA 4DGMA 4CD0A 3KRXA 4WG3A 2PVHA 4FOCA 1H1WA 3EN5A 3GU7A 2HZNA 4S2ZA 3LFNA 3OT8A 5AR4A 1V1KA 2UZNA 3RNYA 4APPA 3QA0A 4DH1A 3SG8A 1CTPE 1KV2A 5EM6A 4QMWA 2YIXA 4MHAA 3U4WA 2YAAA 3VJOA 2VNWA 3F3TA 3Q4UA 4FL1A 4O0YA 5I3RA 4FV7A 4H58A 3COHA 5HU3A 3PDTA 4ACMA 3FLWA 5KNJA 5IUGA 5J95A 4KSPA 1WFCA 2JKOA 2WTKC 3P78A 4RWKA 4C4JA 3DCVA 2OG8A 4JQEA 2Y6OA 2GNJA 2YLEA 3QXPA 2VD5A 2XNPA 3GCQA 4BDHA 1KUTA 3TACA 4ZTRA 4O1OA 3KVWA 2OIDA 3VS1A 4NCTA 3MBLA 5EOBA 5KMNA 4PPAA 2BDFA 3C0HA 4FKGA 1OKVA 3MY1A 4K77A 4AWIA 4ZAUA 3KMMA 4O6EA 3NUAA 2CDZA 4G6NA 1OMWA 4R3RA 4BCOA 2W9ZB 3EWHA 3MVHA 3QRJA 5M06A 2X4FA 3FQHA 4D1ZA 3L8SA 4MXZA 3FLNC 5CALA 5I9WA 2XZSA 4II5A 3RALA 3BZ3A 3QUEA 4A4XA 3O8UA 5IISA 5LMKC 4D2PA 3DJ7A 3E3BX 3MIAA 4U6RA 4D4YA 5HIDA 5AAEA 1XO2B 4X3JA 2BZIB 5GZ9A 2R7IA 3V6SA 4HVIA 2C68A 5EDQA 4EHGA 3HV4A 5IQFA 2JBPA 4Y73A 3WF8A 1Y57A 3JR1A 4R7BA 1PMEA 2UVYA 3VS6A 3KMUA 2RG5A 1H27A 3E8NA 2W1EA 2O65A 4CZTA 2RG6A 1ZMWA 2I0YA 4DEHA 1XKKA 3KXMA 4EC8A 5JMSA 4XJ0A 3FC2A 1YXUA 3UIXA 2QODA 1WBVA 2I0EA 5ETIA 1JKLA 4EKKA 3NVMB 5AR3A 3F5XA 3HGKA 3EIDA 4XG4A 4YSJA 3HMNA 4K18A 2OW3A 4O96A 3M1SA 4PF4A 5LMBA 4U45A 3UBDA 1QPEA 4BTMA 4DGLC 3ID6C 3C4CA 2QO2A 2Y0AA 1H1RA 4G5JA 3UO4A 3UVRA 5L2WA 4XHKB 2R5TA 4EK6A 2BROA 4O0VA 4EK4A 4RFMA 3VUTA 3BU5A 1SVHA 2QOBA 1RJBA 1ZYCA 4AF3A 4DH8A 1WBNA 3BE9A 5H3QA 3CPBA 5BMSA 3UP2A 3ENHA 2O0UA 5AJQA 3BPRA 3GOKA 4L01A 3RBWA 2DYLA 4YJPA 2WMSA 3BWJA 4OTRA 2XB7A 3AQVA 4KIKB 2OJFE 3WZDA 5IA3A 1JKTA 5E9EA 3ORXA 1ERKA 3NPCA 3ZONA 5D12A 2ONLA 4AA5A 5CWZA 2PMIA 1H1QA 2Y9QA 5JQ5A 2FH9A 5CXZA 2WKMA 1H1SA 1YHVA 4W8DA 5EM5A 2W4OA 2BZJA 4FSMA 4C38A 2QURA 3NNWA 4JI9A 4MBJA 1ZYSA 3ZM9A 2V5QA 3T3VA 4R5YA 5E8UA 4FKRA 2OKRA 1QL6A 3QTXA 3NUPA 3ODYX 3F5GA 3W32A 5B7VA 1BMKA 2W1ZA 2YDJA 3NW6A 4M0ZA 3FI4A 4QMVA 5M55A 5DA3A 3DDPA 4OT6A 5DI1A 4HVSA 2J0KA 1BKXA 2UZBA 3BLHA 3MWUA 1GIHA 5HG8A 3UE4A 5E8WA 5FDPA 1P4OA 4NTTA 1R1WA 2X1NA 3MFUA 4ONAA 4QP2A 3MA6A 3KK8A 4WUAA 2UZDA 4DLJA 4FZ7A 3ERKA 4PDSA 5D1JA 2A19B 1P4FA 2NRYA 4EZ5A 3ZBXA 3K54A 3ZYAA 4F65A 2PZRA 1CDKA 2ZM4A 3L8PA 4YJOA 3AT2A 3RWQA 2OH0E 3OOGA 4GJ3A 4BC6A 1PYXA 2ESMA 4CSVA 1NT2A 1OI9A 2Z60A 2G15A 4L45A 5TO8A 1GZKA 2XIXA 5L6OA 5A9UA 3OCBA 3HA6A 2XKCA 3A8XA 1UVRA 3QHWA 4FT3A 2OJGA 4IB1A 3E87A 2UZLA 1PXLA 3FMKA 3LFDA 5CY3A 2BDJA 5KO1A 1IASA 4HNIA 4EH9A 3DKFA 4L68A 3I0OA 1SNUA 1OPKA 4JXFA 3A7FA 3NLBA 4TYEA 3MESA 4CT2A 2QD9A 3TUBA 2IVUA 5JH6A 3DZOA 5JGBA 3FXXA 4BCGA 4LRKA 4FL3A 3PRFA 5CEQA 2CKEA 4FIIA 4F9BA 3NEWA 4EK8A 4FGRA 2B4SB 4MX9A 4DFBA 4EOIA 4ERWA 1OBDA 4XP2A 2CSNA 3PIXA 4O21A 4C2WA 3GT8A 4JQ8A 3VS0A 5HLPA 1KV1A 4O7RA 1XH9A 5KMKA 4M14A 1LEZA 4TZRA 1U54A 4FZAB 4QP7A 3FAAA 4H36A 5M4IA 3RPVA 3AMBA 1V0OA 4OTDA 3DOGA 4EKLA 1PMVA 4RIYB 4IM0A 4NK9A 4YHTA 1I09A 3R83A 4YR8A 4EOMA 2BZHB 4ZP5A 5KKRB 5AV3A 2QHNA 2BRBA 3GFWA 3UVQA 2BR1A 3A60A 4C37A 1SNXA 4O7YA 2RSVA 2UW4A 3GQLA 3ZU7A 1NXKA 4P4CA 3O71A 3F69A 3DPKA 4G3EA 1YKRA 4MBLA 5GZAA 1YVJA 4X7QA 3A7JA 4UMUA 4FV5A 4OUCA 2UW7A 4AZFA 2ITVA 1WBOA 1W0XC 2B9IA 1B39A 4AN2A 1TVOA 4L53A 4DGNA 2CKOA 3PXZA 5L8JA 3RTPA 3GOPA 5HNGA 3UC4A 3EN7A 5IQGA 3C4WA 1OPJA 2XK8A 2V55A 4BWXA 4AZEA 4FSWA 4JRVA 4DFLA 1OPLA 1U59A 4GEOA 4A9RA 1G5SA 2W4JA 3TV7A 3ZXZA 4MWIA 2HXLA 3PY1A 4JT3A 4CV9A 3CY3A 2YN8A 3QC4A 4QRCA 4WG4A 2YHVA 4AXAA 2JDOA 3KGAA 1DI8A 3CGFA 4DE4A 2IWIA 2BRHA 4IZ5A 4AAAA 5FTQA 4FV3A 3PA3A 5T68A 3R8PA 4TXCA 3QRIA 2OSCA 3BQCA 2YM8A 5B2LA 4IWOA 3HZTA 3WYYA 5JFSA 2F49A 5HG7A 4C4IA 3MTLA 3EFKA 1XJDA 4ZZOA 5A4EA 2W5HA 4HYHA 1PXJA 5IKWA 4I0SA 4EQCA 2F9GA 4G5PA 4MF0A 3RCJA 2BIKB 5CVHA 4BGQA 4QYHA 4F08A 5HTIA 3TNIA 1CKJA 3SXRA 4WNKA 3L8VA 3F9NA 5CASA 3LLTA 4BWPA 3S00A 4Q9ZA 3VC4A 3F82A 2NNWB 4I3ZA 4BI2A 5DWRA 4HGEA 3FY2A 5KUPA 1MQBA 3MI9A 3AMAA 3VS2A 1PF8A 2O64A 1ZY5A 2QC6A 3PXQA 4GFOA 3I7BA 3ZZWA 2C1AA 4ACDA 2JAVA 3QBNA 1M17A 4FKUA 2JBOA 4BZNA 4DFYA 2FUMA 3AC3A 2CJMA 4E3CA 3IG7A 5T3QA 1W7HA 4U0IA 4AA4A 5A4CA 4TNBA 2XM9A 3TWJA 3MJ2A 3ZLYA 3OCTA 5DLSA 5HBHA 5AV2A 3COIA 3CY2A 4GSBA 4S32A 2Q0NA 4RMZA 3UYSA 4FZDB 5BYYA 4DBXA 3QTUA 4FSRA 3WZKA 2OFVA 3CBLA 4NJ3A 4ZSJA 3AGMA 4F0IA 2AC3A 3BV2A 5J8IA 5CF4A 4HVHA 3FQEA 4QP4A 4U5JA 4LOPA 4B4LA 4CKJA 3HP2A 4I20A 3LQ3A 2J0MB 4QMUA 4O0RA 1XH6A 4MD8E 2RGPA 4QP8A 4C02A 4QQCA 5I9YA 3PLAE 1H1PA 3ZOSA 3D5XA 1HCLA 4QYGA 3SX9A 2Q83A 1MUOA 4X3FB 3QTWA 5HG5A 2PE1A 5AEPA 4ZMEA 2Z7RA 2C6IA 5CLPA 4IFGA 4J98A 3NRMA 3U51A 4F1MA 2UVZA 4RJ6A 4EWHA 2UW6A 1W8CA 3LMGA 3VJNA 5HVYA 4FIHA 2UW3A 4CVAA 4L3LA 4YZDA 3OWKA 4B7TA 3IKAA 2ZAZA 5T6KA 5CTPA 3EH9A 3NAXA 3DFAA 3E92A 1LPUA 3PJ2A 5HX8A 3BLRA 4O7ZA 3V5PA 3Q3BA 3Q5ZA 4K11A 1Y8YA 4JDJA 4LFIA 3R63A 2O3PA 5FXQA 3LFEA 1J3HA 1WVWA 2P4IA 3EKKA 4EHEA 3VF8A 3PXFA 3CJFA 3K3JA 3BHVA 3HMMA 1U46A 2YIQA 4IVDA 4MEDA 4UXLA 3ZEWA 3ZLXA 1LR4A 4WHZA 4CFUA 4DT8A 1GIIA 2PVKA 2CGUA 3FKOA 2NRUA 2VAGA 3KEXA 3UQGA 4GK2A 4FKVA 3G6GA 4CFNA 3UPZA 2Z7SA 3H9FA 2VTTA 3EZVA 4ENYA 2VGPA 4F09A 3PA5A 2LAVA 1K3AA 1UA2A 2YZAA 2QOQA 5GHVA 2GU8A 3ZUTA 5M4FA 4RC2A 5KE0A 5GNKA 5HNIX 2UZUE 5HESA 4PMPA 3Q53A 3PSBA 2Z2WA 4M7IA 4EUUA 2QOHA 3Q6UA 2H6DA 3E5AA 4Y72A 5FTOA 4GH2A 5JZNA 4HZRA 1F0QA 3QA8A 4ZZNA 4D5KA 2E9NA 3A7IA 4GG7A 1VJYA 1XH8A 4GIHA 4KWPA 4FTTA 5BPYA 3D14A 1XBBA 2VTMA 4PWNA 4RA5A 5EYKA 4M3QA 4IEBA 4BCHA 4QMNA 3QZHA 4F0GA 2PPQA 4WNOA 3FI8A 1H07A 3FUPA 2ZDTA 3R30A 3UQFA 4M67A 3QTRA 4TYJA 5D7VA 3PTGA 4FTJA 3GC7A 4CFXA 5HICA 4FIJA 4QMQA 3Q2MA 4BTKA 4GMYA 5M07A 3RHXA 3FEGA 3I6WA 2UZWE 3R2BA 5IA0A 5C4KA 5J7BA 3T9IA 4ANMA 4F7SA 2JD5A 3ZC6A 3VRYA 3ZO4A 4D0XA 2CGWA 2JDSA 4AZSA 5IF1A 4PDPA 4UZDA 4J53A 3EQPA 5AFVA 5GJGA 4BCIA 4V04A 3QQJA 1UNLA 2RFNA 2CKQA 3R7GA 4M66A 4YC8A 2RKUA 4JBQA 2OIBA 2Q0BA 4BYIA 1S9IA 3DA6A 3T8OA 3QQUA 2RFEA 1Q4LA 1W82A 1PXOA 2YM3A 1S9JA 4JX7A 4W4WA 4XG6A 4AGUA 5J1VA 4MNEA 2WQEA 4OTGA 2WQOA 3ZXTA 2G1TA 3DGKA 3QCXA 1URWA 3WYXA 4WNPA 5LARA 3ZFXA 1TQPA 4OTFA 5EYDA 3QRUA 4XP3A 2PUIA 4O7TA 4D2RA 2HYYA 4R7IA 4O0TA 2BZKB 2JDVA 2C5VA 4IX3A 1SYKA 3FL4A 5IQDA 2W96B 4BIEA 4E5AX 1BYGA 5CYIA 3UMXA 4FTLA 3T3UA 2XNMA 4KAOA 2JFLA 1PXMA 4F1TA 4EEVA 5IH4A 4BGHA 4U8ZA 2YJSA 4CFVA 5I9UA 1OL5A 3DK6A 5EKOA 3HV6A 2OO8X 4X6QC 3DBFA 4EJ7A 2QOOA 4G6OA 4ZMFA 2XK9A 2VWXA 2Z7LA 4QMYA 4F70A 3ZUVA 3PPZA 4YPSA 5BVOA 3QZFA 1ZZLA 1PYEA 2OJJA 4AA0A 3G6HA 3KXGA 3R7IA 3E7VA 5M08A 3QU0A 3QLGA 3KU2A 4O0XA 3GVUA 3NSZA 5AP6A 3DQXA 4IB0A 3ORNA 5E8TA 3B8RA 4O0SA 5K4JA 2W7XA 2XH5A 4KD1A 3BRBA 5IDPA 2QLUA 3QCQA 4Y85A 5C03A 2WTDA 2PZYA 5HLWA 3Q9XA 3OMVA 4EBVA 4A9YA 5ACKA 1BX6A 2UZVA 4ASXA 4G3DA 4QPAA 2ITXA 4O82A 1X8BA 2YDIA 3QKKA 4O7SA 2ZJWA 4AOJA 4EH3A 4DF3A 3TNQB 5KKRC 5HE0A 4NL0A 3MB7A 3DQWA 3OEZA 3TKIA 2C0TA 4C59A 2YM4A 3MS9A 4C4EA 4CQEA 2XA4A 3BHUA 3CQWA 2JC6A 2P0CA 5CEOA 3P0MA 4G2FA 2ACXA 3OTUA 4Q5EA 5EM7A 3ACKA 4C57A 1YRPA 3ZSHA 2IJMA 1VZOA 3HV5A 4DTKA 5JFXA 3R1QA 5GINE 2JKQA 5AUUA 2QQ7A 3GCPA 2C6OA 3D2IA 1H4LA 2IZTA 3HRFA 1ZZ2A 2ITNA 3MYGA 4JIAA 1OECA 3QD2B 1YI6A 3U9CA 2PL0A 3LE6A 3R7VA 1LUFA 4R77A 4OTIA 3KREA 4QYYA 3W18A 4A06A 5BUJA 4OGRA 3ALNA 1FQ1B 3OOMA 1GOLA 2XK7A 3ZS5A 5G6VA 4CLIA 2BTSA 1V0BA 4Y5QA 4P5QA 4ZY6A 4H1JA 3SW4A 3IOKA 3RPYA 3NCZA 5HVKA 3LKMA 5AV1A 2CN8A 3BBWA 4JG8A 2G2HA 1QCFA 3FZRA 3GCVA 3H9RA 5EDPA 2PULA 2OWBA 4CKIA 4B8MA 3DAJA 1NVSA 4NSTA 4BDKA 5C4LA 2W4KA 4WRGA 1CMKE 1J1BA 3IECA 3DLZA 2XKEA 3FI3A 3ZZEA 4CYIA 5A54A 3P9JA 2YLFA 3U87A 4RWJA 5AUZA 4GIIA 4L46A 3R28A 4BZDA 3FV8A 3BYUA 4C3FA 2OLCA 2C3KA 4MD9E 3ZSIA 4UBAA 4MXOA 2UZTA 4BCJA 3GXLA 5AUWA 3VAPA 3SC1A 4C58A 3P4KA 3PJ1A 2WFYA 2OJIA 2R0UA 3WILA 3EMGA 3KFAA 4AGCA 5JKGA 5DT0A 2EXEA 4X2FA 5EH0A 4FX3A 1G8SA 4FMQA 4E4MA 1JOWB 1U5QA 4PP9A 3PE1A 3S3IA 3ZBFA 2GHMA 2VTQA 3UNZA 4TYHA 1UU7A 1DI9A 2VTRA 3QD0A 2ITTA 5DT3A 3GENA 4MXXA 4MVFA 3I6UA 5DRDA 3RMFA 1ZARA 4BIDA 4MNFA 4ZTSA 4IB3A 5FEDA 5CANA 4NEUA 3MH0A 4IB5A 3JVSA 5DMZA 4XV2A 3RK5A 1J7IA 5AM7A 4BF2A 5IEYA 4G16A 1FGKA 4RVLA 3NCGA 4KIOA 2BALA 1Q24A 4TNDA 4ALUA 5FLFA 1JKSA 4ASEA 5GIPE 2WTVA 2XNOA 5DE2A 2R3KA 4K33A 5L6PA 3V51A 1FOTA 1H01A 2YEXA 3V3VA 1GZNA 4I5CA 4X3FC 4HYIA 5I9ZA 2UW9A 4K8AA 5A4LA 2XK3A 1A9UA 3PSDA 3WARA 4CQGA 3OY3A 2J51A 4R3CA 3R73A 3NNVA 3DNEA 4DG0E 2XIYA 4XEYA 3G9LX 3NUUA 5K5XA 5IMEA 2I0HA 4I6HA 5AUVA 2CN5A 3EQBA 3S1HA 2XRUA 4NIFB 3R8UA 4PL5A 4O6LA 3ZTXA 2WAJA 3LCSA 4R8QA 3BX5A 4P7EA 4RIXA 3SA0A 4YLLA 1U5RA 4QQ5A 3RAHA 2BVAA 2YWVA 4TL0A 4ZS0A 5L2SA 3IDCA 3BYOA 2HZIA 5FDXA 4HCUA 4KIPA 5L3AA 3NNUA 2E9PA 2P33A 4G34A 1OGUA 4FTOA 3QF9A 4PMTA 3ENMA 4L52A 4MXCA 3OG7A 2EB3A 3DB6A 3LXLA 4LMUA 4O0UA 2YCQA 4FICA 4DEAA 1OKYA 2RL5A 3IGOA 3QTSA 4KABA 4EOOA 4J8MA 5JGDA 3UPXA 3DXPA 4O81A 5TKDA 4F9CA 5D9HA 2WTJA 1GY3A 2B0QA 4S34A 3DJ5A 4U3YA 4BCNA 3D7TA 5J7HA 3PXKA 4RSSA 3DKOA 2CHLA 5CI7A 3UG2A 2UZEA 3IQ7A 3W2QA 4JVGA 5DYJA 1WZYA 2C0OA 5LVMA 3FZ1A 1KOAA 5FG8A 3FMNA 3RPRA 4G17A 5EK7A 2VZ6A 3W2OA 4V0GA 3OW3A 4F1OA 3UO6A 2V7OA 1WBTA 1FVVA 1WBSA 3LAUA 4XRJA 1YI3A 1JLUE 2UW0A 4TWOA 3OUKA 4QNYA 3KULB 5CVFA 4BHNA 5IH6A 3V8SA 4I0TA 4CG9A 2GTNA 3E8EA 5CT7A 4YZ9A 5BVEA 3ZRKA 2P2HA 1Q8UA 2RFDA 3FKLA 4IAKA 2VX1A 1SM2A 3JS2A 4G9RA 2QOIA 3PP1A 4O91A 2ZOQA 4PDOA 1Q8TA 3R01A 4OTQA 3VUGA 3FZTA 5B2KA 3D94A 5GJFA 1UWJA 2C3LA 4AW0A 3QQFA 4J96A 4MCVA 3R9OA 3UTOA 4BHZA 4EYMA 2ZDUA 3C9WA 3O7LD 4BR3A 4JAIA 4DEIA 1YQJA 3EN6A 5FM3A 4EWQA 5HO8A 3UZRA 4BDBA 2CCHA 2IVSA 1KE5A 3A62A 4HGSA 4FTIA 4NZWB 3LOKA 4OBOA 4RJ5A 1M2PA 2XK4A 3CD8A 2VO7A 1NVQA 2WTCA 3PPJA 1WVXA 4L8MA 3TTJA 3QTQA 5EW9A 5HE3A 5M57A 5LMAA 3VUKA 3ACJA 3GC0A 1H08A 3OBJA 4K9YA 3RCDA 3AD4A 4C4FA 4C34A 2HOGA 1OUYA 2I40A 3HX4A 4E26A 5HBJA 4O7VA 4FC0A 2PWLA 1WBPA 3ZDUA 3PVUA 3V5WA 1AD5A 5K0KA 4DCAA 3ORIA 4I22A 2VNYA 4CFMA 4N0SA 4YJQA 4FF8A 3FHRA 5HO6A 3UMWA 5IA4A 2ZV2A 3EKNA 4KBKA 4BCKA 3DB8A 3TEIA 5CXHA 1GAGA 3MDYA 4E73A 1P5EA 1BL7A 2QG7A 4MXYA 4KSQA 1SVGA 2ZM3A 2FO0A 3PG3A 4O38A 4PNKA 3KK9A 1A48A 2WMWA 5D7AA 3NUNA 4CMOA 3V04A 4ZTMA 5CF8A 2R3PA 2IZSA 5JQ8A 3RPOA 3KXXA 3PFQA 5CQWA 3AG9A 3KA0A 2QR7A 4ITIA 2WTWA 2W1HA 3PG1A 1PXKA 2JKKA 5CU0A 2WTIA 2GS7A 4LGDA 3ETAA 3ROCA 2QOKA 4FEXA 3HVCA 3HMIA 3KMWA 5TOZA 4QP3A 4ZLZA 2Y4PA 2VTPA 4GFGA 4XBUA 2QO7A 4IAIA 4WO5A 1B6CB 3TI1A 1FGIA 3VBQA 1M7NA 1OZ1A 1Q97A 4IVCA 2ZV8A 4X0MA 2YIWA 5HI2A 5C8KA 5JRQA 1Q3DA 4KS7A 2QNJA 2X6EA 3BU6A 4OLIA 1K9AA 3D7ZA 4HYSA 4IDTA 3UIUA 4CRLA 2OBJA 4XG8A 4UX9A 2R3FA 3JXWA 4FSYA 5E8SA 3PIZA 2OK1A 4YTCA 4USEA 3C4FA 5EHLA 5J9YA 3W8LA 3NYNA 3TZ9A 3R6XA 2WNTA 4QMMA 4NFMA 3F7WA 3O2MA 4WUNA 4YU2A 3U54A 5CU2A 3TZMA 2VWYA 2PU8A 4C2VA 2R2PA 5HX6A 3P79A 5AIRA 2QOLA 3WE4A 1Q62A 1E1VA 1OKZA 2C30A 3ODZX 3SVVA 1P14A 4AZVA 2DUVA 4BRXA 3P1AA 4I92A 4AT5A 4FSZA 3TJCA 5CAUA 3VRZA 3GI3A 2WELA 4DH5A 3QD3A 4QMOA 3Q5IA 4FK6A 5HD4A 3FXWA 1YXSA 3PUPA 5HD7A 3PYYA 3L8XA 4U42A 4YZCA 3VQHA 4X2KA 4PPBA 4L9IA 4FODA 1M52A 4ORKA 4D1XA 5AR2A 4XLIA 4B6LA 2Z8CA 3BHYA 3ZLWA 2CCIA 4E5WA 2X8DA 2VTLA 2OIQA 5EI2A 3DKGA 3E64A 3R21A 1YI4A 4IJ9A 5AX3A 2ZMCA 3R2YA 2QKWB 2J5EA 3V5LA 3E93A 5J87A 3MV5A 1H0VA 2HY81 1R78A 3KY2A 4TWPA 5CQUA 4GKHA 3VS4A 2WOTA 3MJ1A 4IADA 3RINA 3NYOA 4LM5A 2IZUA 2QI8A 4EOLA 3P7AA 4LMNA 5EW3A 4AU8A 4E20A 3DLSA 1UU9A 3C7QA 4D2VA 3QRKA 4JQ7A 3GU4A 3F7ZA 3OS3A 4IHPA 5ANGA 3FXZA 3KCKA 2WZJA 3OXZA 3I1AA 3QLFA 4L42A 4JOAA 3DTCA 4Z7HA 5EFQA 3ZHPC 5E8VA 2ZB0A 5HE2A 3QXOA 4DITA 4YTHA 4OR5A 4M8TA 3ZMMA 2F57A 2VN9A 2YJRA 4RX7A 5AM6A 3S4QA 5EYMA 3N4UA 1FVRA 2J0LA 3HECA 3MVJA 2X2KA 4TN6A 4L7FA 5LCJA 1ZOHA 1NY3A 2XIZA 5DG5A 4EOQA 4EI4A 4GUEA 3CIKA 2W1FA 3NMUF 4ID7A 3OT3A 3OFMA 2BMCA 3RWPA 5HTCA 2XCHA 4M12A 4DFNA 4ZY5A 2JDTA 4JIKA 4ZLYA 4YGAA 5C8NA 3JY0A 2W5BA 3F88A 2Y7JA 1XWSA 4IM3A 2F4JA 5HBEA 4E6AA 4YTFA 2BFYA 3VW6A 2OXXA 3NW7A 4FTQA 2BRMA 2C6TA 2C6MA 3NAYA 4I41A 5DHJA 5E7RA 4AG8A 2C3IB 3GU8A 3RZBA 1T46A 5ETAA 5EDRA 2E9VA 4ZSEA 1GNGA 4U81A 3G90X 2REIA 5BUEA 4PNIA 3QQKA 3LFFA 3D83A 2B7AA 2WMVA 3EL7A 3TV4A 4BDDA 1ZLTA 3FMLA 5KX8A 4PL4A 4RX8A 1KE7A 1ZMUA 3ALOA 4FV0A 4IJPA 3R7OA 3WF7A 2HWPA 4FR4A 2XS0A 5CENA 4BCFA 5CAQA 5LOHA 4A9TA 1U54B 5HU9A 5CAPA 5EYCA 4D0WA 2ERKA 3E8DA 3IW4A 2BIYA 3HAVA 1WVYA 1PMNA 3C5UA 3RPSA 3TN8A 4DEEA 3TZ7A 5I9VA 1O6LA 3T9TA 3TV6A 3AGLA 3VNTA 5EHYA 4ZSGA 2IG7A 2X7GA 1Q61A 1YOMA 3ORTA 3EJ1A 3CS9A 3FZPA 3O8TA 4IIRA 4FG7A 4JLCA 2GMXA 3MW1A 4FIGA 4XYFA 3OD6X 5LVOA 4YMJA 3L9NA 3BV3A 4FV8A 4M69A 5LJJA 2HIWA 5EM8A 3ZUUA 4F63A 4YSMA 5BYZA 2OI4X 2YM5A 4LYNA 4NKAA 5AADA 4DFXE 1NA7A 4BBMA 4IACA 2IN6A 3IW6A 3NYXA 2YDKA 3DS6A 2Y4IC 1RDQE 2WQBA 5AP2A 2Z02A 2OF2A 4CEGA 2I1MA 5ETFA 3CQUA 1OL7A 4CFFA 2V22A 4FTNA 3HAMA 1OKWA 2GTMA 1U4DA 2UW5A 1IEPA 2YACA 1BI7A 3BGQA 3PLSA 3LCOA 5H8BA 4GUBA 3OHTA 4U97A 5DR2A 3O8PA 4DLIA 1KE8A 3TJDA 4W4VA 3REPA 4ACGA 1SZMA 1Z57A 4QMXA 5CF5A 2JITA 2JIVA 2VX3A 3EQIA 4F9AA 2IW6A 2PVRA 3SXSA 2C3JA 4FTMA 5IEXA 4NJDA 2BCJA 3GGFA 2BUJA 3A7HA 4ZTHA 4JX3A 4ZLOA 4N6YA 2BKKA 3BCEA 2BAKA 4H05A 4Z7GA 4F6UA 5IEVA 4Q2AA 4BWKA 2GHGA 2X9EA 3I4BA 4E6QA 3KRJA 3A4PA 3DDQA 3ZFMA 4IH8A 4GT4A 2GFCA 1M14A 4FZFB 3COMA 3CTJA 3P7CA 4HZSA 2WIPA 2OGVA 4QYEA 5FBOA 1UU8A 3F2AA 4KA3A 5FP5A 4APCA 3AC8A 4FKWA 5KMLA 3SOCA 2V0DA 4EH7A 3SOAA 4FOBA 2CGXA 3SW7A 2E9OA 4X3FA 3KC3A 3RGFA 3BU3A 3OROA 4KRCA 2FVDA 4D28A 3CEKA 3DFCB 4DEBA 3OC1A 4ANBA 1PRYA 5I0BA 1R0PA 4WA9A 3R9NA 2EXCX 3MN3A 4IZYA 4UWYA 2H34A 2HK5A 3G51A 5LCKA 3RKBA 4YLKA 5FXSA 4FKSA 3CSVA 4HCVA 4ZS4A 1MP8A 3E8CA 3RP9A 4HOKA 4O2PA 3KL8A 5JGAA 1G8AA 3V01A 2XKFA 3LFCA 5E8XA 2HAKA 5FD2A 2ZB1A 2B9HA 4F99A 3IPHA 4RVKA 4AN3A 1XR1A 1F5QA 2B9JA 4ANNA 1OIUA 1QPJA 2ETKA 5JFWA 3EHAA 3ATTA 2JIUA 2R3HA 2XF0A 1H28A 5IQBA 2E2BA 3EN4A 4I5HA 4LOQA 5TF9A 4J71A 4DEGA 4GCJA 2J0JA 2JIIA 2BRNA 5HQ0A 4RIOA 5JN2A 4NYEA 3QYWA 4QMSA 4GJ2A 3NVKI 4YLJA 2ETRA 3D4QA 4DINA 2HZ0A 2BPMA 2C0IA 2HCKA 4H3BA 5F4NA 5ANIA 5E1EA 1M7QA 4KKEA 4FKPA 3HV3A 3D9VA 4RFZA 5HIBA 4YC6A 4CTCA 5DR9A 1APME 4UMRA 4ZJVA 5AV0A 4YZBA 3TNPC 3PVWA 2EB2A 3ANRA 4YJTA 4R78A 5F1ZA 4O27B 2XYNA 3SRVA 3VVHA 4UV0A 5JSMA 2PUPA 4XOZA 2H8HA 3EQDA 4O7NA 3UVPA 4D1SA 5KZ0A 3N9XA 3KQ7A 3VUMA 1JPAA 4M84A 3R22A 4HYUA 3BYSA 4TW9A 2IPXA 5L6WL 1WAKA 4FEVA 4WIHA 2QONA 5IUIA 4WT6A 3LMHA 2BHHA 3FY0A 4IZ7A 4EC9A 5BVNA 4G3FA 2VTHA 3BKBA 1CKPA 3POZA 5LVPA 3NIEA 3II5A 2GQSA 1ZXEA 1FINA 3D2KA 3RAKA 1UU3A 3BGPA 3AC2A 4RVMA 5LMKA 1MRVA 2XNEA 2VX0A 3CJGA 3D5WA 2W5AA 3UC3A 3FWQA 4MTAA 3U6HA 4R3PA 4MH7A 3HLLA 5FXRA 2X2MA 2VTAA 3HEGA 2OU7A 2QKRA 3HUCA 3MFTA 3OVVA 4U80A 4NM5A 3I81A 5AAFA 3THBA 4M15A 4RGJA 4G1WA 4I6FA 2B54A 4UMQA 4FVRA 1UWHA 1SMHA 5IQEA 3QWJA 4HPTE 3ZCLA 4FSQA 4CKRA 4OBPA 4EOJA 3CC6A 3N51A 4BKJA 2YIRA 3BHTA 2OZOA 3LJ0A 3MPMA 3ORPA 4FYOA 3M11A 3EOCA 4O0WA 4DH3A 5A4QA 2CLQA 1O6KA 3VQUA 2JGZA 4MK0A 4BL1A 5KMIA 4WBBB 4JS8A 4XG3A 3TZ8A 3OBGA 3R1YA 3MFRA 4L6QA 4E7WA 2ONLC 2P3GX 4RX9A 5CZIA 2YITA 3GUBA 4KUJA 3QKMA 3NDMA 2WOUA 1YOJA 2CPKE 5JZJA 3CR0A 3KXHA 3R7UA 2UVXA 3HKOA 4W9WA 5IA2A 4TYGA 2YIYA 3SGCA 4ZEGA 3HRBA 4X2NA 5AR8A 4D9UA 3C0IA 3I5NA 5EQEA 4P2KA 4EYJA 4I4FA 3W16A 4MKCA 4YZNA 3KB7A 3R7YA 1BUHA 4ZJIA 2WD1A 2WMUA 3H10A 4ANSA 1FVTA 4DN5A 5FUTA 4PPCA 3CE3A 3WIKA 4GS6A 3F61A 3QCSA 4MNEB 2O8YA 4FV9A 3W33A 5IPJA 3V5QA 2F7EE 2ZM1A 4RBLA 3SV0A 3W55A 2X7FA 4XLVA 1YXXA 5HCZA 2C1BA 3BYVA 3RAIA 1H8FA 4AFEA 4AP7A 4D9TA 4E1ZA 5EKNA 1J1CA 4RIWA 2B55A 4ASDA 1MRUA 4CZYB 1OIQA 1OM1A 3A7GA 1L8TA 2PHKA 3DNDA 1IA8A 4GYIA 4UY9A 4ZTNA 3TKHA 4BGGA 4DGGA 3NUSA 4MQ2A 5DOSA 4F0FA 4JBOA 2XK6A 4Y46A 1H24A 2QLQA 2W9FB 4GFMA 4YZMA 5HOAA 4EOKA 4I24A 4IWPA 1JSUA 4XMOA 1KE6A 4I5MA 1KWPA 1UKHA 1OVEA 4IE9A 3R9RA 5HNBA 2C5OA 2KULA 5TE0A 3WOWA 3ZSGA 4ANQA 5M44A 3BIZA 1FMOE 5FWKK 3C4EA 3HUBA 4NUSA 4TT7A 3G0FA 3VBWA 5AAGA 2R3MA 5FEQA 3UGCA 4WSYA 5B2MA 4ZTLA 2FYSA 2OF4A 5K3YA 4JG6A 5C27A 3TUDA 4D4RA 5LVNA 2ITOA 1VR2A 3LFBA 4ZJJA 3E62A 1PXPA 4FL2A 4QPMA 1MRYA 4RG0A 5CX9A 2YWPA 4E4NA 4C7TA 3B2WA 4EJNA 3NS9A 3QHRA 3PIYA 3PWYA 4FNXA 4I4EA 4EHZA 2X8IA 2IVTA 5DEWA 2LGCA 3BLQA 4MF1A 2NPQA 3BQRA 4K6ZA 3UYTA 4AE6A 4AUAA 4Y5HA 1Q99A 2PUNA 4QPSA 4RC4A 2O2UA 2BFXA 2J5FA 2OICA 4QD6A 3SDJA 4AGWA 4O83A 1YWNA 3C13A 4FK3A 3LPBA 1YHWA 4D2TA 3GEQA 5FTGA 4FEWA 4KS8A 4QMTA 5KMOA 2P2IA 3DBQA 5ANOA 5HCXA 1QPCA 4BDIA 1Z5MA 1W98A 1URCA 2W1GA 5L2IA 2J9MA 5CSPA 4IANA 4BICA 2FSMX 4IAYA 2CNUA 3TIYA 3QX4A 4J99A 4GK3A 2XMYA 3ZO2A 5I4NA 4IVBA 1TKIA 1Q5KA 4FKJA 4ZSAA 3LFQA 3AD6A 2J2IB 2X4ZA 4WBOA 3R8ZA 4L3PA 2GQRA 3KXZA 2C47A 4OTWA 1XQZA 5AV4A 5AWMA 2QOCA 4NWMA 2YM7A 3JY9A 4Z16A 1XHAA 2NO3A 3Q4TA 1UNGA 4RJ4A 3O17A 1PJKA 2X6DA 1ZYJA 3TL8A 5HIEA 3DTWA 3ELJA 4FV6A 1IAJA 3IDBA 5JFVA 2PY3A 2FGIA 2C6KA 4FUYA 1HOWA 4G6LA 3VF9A 4BCMA 3UOJA 4RLKA 2VWVA 4FNZA 3EFLA 3FLSA 2OZAA 2I0VA 2R3GA 3AC5A 3NZ0A 4AQCA 4EORA 3UOKA 3HV7A 1PW2A 1REKA 4GU6A 2WHBA 4LOOA 3DBCA 3L9LA 4QTAA 3PWDA 5BVDA 3R7EA 2ZVAA 3K5VA 4IFCA 4C4HA 4FBXA 5EOLA 4JR7A 1RE8A 2C6LA 5L8KA 5HLNA 2W99B 4FZ6A 2ZV9A 5C9CA 4JBVA 5HO7A 3IO7A 5C1QB 2X8EA 4P5ZA 4HVGA 3O96A 4FGBA 2ZYBA 3DV3A 3U9NA 5AUTA 4X6RA 1REJA 3Q9ZA 4HCTA 3RJCA 3LJ2A 3NW5A 4HJOA 4F4PA 4AOIA 2QR8A 3QGYA 2XKDA 3UJGA 4UYAA 5A3XA 4NIFA 4TYHB 4FUXA 3BI6A 1GIJA 2EWAA 4H3QA 4MD7E 5K5NA 3F3VA 4UXQA 5HZNA 5A6OA 2ITUA 4S31A 1OITA 5AP5A 3WZUA 3ZRLA 2HWOA 4OTPA 5M53A 5M51A 3OZ6A 5CEPA 3A61A 4K0YA 3F5UA 4QP1A 1LEWA 3Q4CA 5E4HA 1XBCA 4YURA 4W8EA 5AP7A 1CKIA 2XRWA 2NP8A 2A0CX 3QWKA 4XRLA 4IXPA 2WB8A 2WIHA 3CGOA 4ACHA 1ZWSA 4C61A 5D11A 4S33A 1QMZA 4WKQA 3B8QA 5BQ0A 4OTHA 4YC3A 3OP5A 4R1VA 3QZGA 2G9XA 3AXWA 3PY3A 4FT0A 4Z55A 1UV5A 5ANKA 1YW2A 5J1WA 5CT0A 3GFEA 4IMYA 3NYVA 4RPVA 3WF5A 3TNHA 3H0ZA 3F3UA 1G3NA 2PZPA 3VHEA 4I23A 1O6YA 5I5ZA 4CYJA 2EU9A 4MAOA 3FZOA 4OAVB 1Y6AA 1ZOGA 4RIXB 4X2GA 3IOPA 4O86A 3H30A 3FL5A 4X21A 2BRGA 3GBZA 4K2RA 4UEUA 5AMNA 1ZYDA 1YOLA 2VO0A 1J7LA 2GHLA 4FT9A 2JEDA 2CNVA 3UO5A 4ITHA 2AC5A 3KULA 3H3CA 4L3JA 4V05A 3W2PA 2QG5A 3DU8A 2CGVA 2R3NA 4H1MA 2JFMA 4CCUA 2EVAA 5FEEA 1O9UA 2VRXA 2VWBA 4WG5A 4Q9SA 2XUUA 4DTBA 4O7WA 1DAYA 5CZHA 2R3LA 4AX8A 3VS7A 4O1PA 3FI2A 4DGOA 4I93A 2BDWA 2XP2A 3IS5A 4V01A 4RJ7A 1GJOA 1PKDA 4K1BA 4A4LA 5IUHA 3C5IA 3TM0A 1JWHA 3JVRA 4XV9A 5CU6A 3D7TB 3PJ8A 4BCQA 4LG4A 3HMOA 2WQMA 4EH6A 2PE0A 3ZFYA 4LRJA 4RFYA 4RA4A 1FMKA 3DZQA 4FEQA 3LXNA 5DVRA 4V0GB 5BVKA 5BX0A 2OJ9A 3EQGA 2JAMA 4FI1A 4M97A 4MQ1A 2KTYA 4FKLA 4XCUA 1MQ4A 4ARKA 5IQIA 1H26A 3ORLA 5AX9A 5K0XA 5EW8A 5L4QA 1BLXA 2R9SA 4JDKA 5KMMA 2R7BA 2YAKA 3QALE 4UYNA 4X2JA 4FKIA 4BDJA 4BFMA 4QTCA 2R3JA 4L44A 5LWMA 4WOVA 4EK5A 2PMLX 4DFUA 3JYAA 4MYGA 4G3GA 3BGZA 3W2SA 2BHEA 3DBEA 5GJDA 4R5SA 4E6DA 4HPUE 4MXAA 5HE1A 4FV4A 2P55A 4I0RA 4EQUA 3BEAA 3BEGA 4YO6A 2RIOA 2HENA 4BKZA 4JL9A 4I1ZA 5HHWA 5CU3A 4G31A 3PZHA 2RF9A 4FSNA 4QP9A 3EZRA 4PL3A 3TIZA 3H4JA 3UIMA 3IW5A 1OL1A 2XEYA 4ZOGA 1OIYA 4IVAA 4MWHA 2VTSA 3RI1A 1AQ1A 2CMWA 3MH3A 3MSSA 4UZHA 3L1SA 2GQGA 5I9XA 3VWAA 2G2IA 3LLAA 3FMDA 4D2WA 1R0EA 4FG8A 5C26A 1DAWA 5JK3A 5M4CA 3OY1A 4FIEA 5H8EA 2BAQA 4IM2A 4R7HA 4YJRA 4KIKA 2WQNA 5ANDA 3S95A 3G2FA 3GU6A 2GS2A 4JR3A 3KVXA 4CG8A 1JQHA 3FLYA 4GK4A 2BKZA 3C0GA 5JRSA 1T45A 3Q6WA 1LP4A 4U41A 1ZOEA 3OWLA 3VBXA 3QQHA 3PVBA 4WD5A 5DEYA 3CXWA 3WIGA 3LXKA 4EH2A 1R3CA 2QU5A 3MFSA 5AUYA 4XBRA 5EHOA 5FBNC 5AR5A 2R3OA 2PVJA 1PHKA 3N4VA 3F3WA 3CD3A 4B9DA 4OT5A 2PVFA 3ZEPA 3ULIA 3LCDA 3O0GA 1XBAA 3OF0A 3G5DA 3TNWA 3ZC5A 2HELA 2XIKA 3IW7A 4CCBA 4PTEA 1CM8A 4PQNA 3VN9A 3OXIA 3GC8A 5K9IA 4IC8A 5CSWA 4EK3A 1VEBA 4AW5A 3OWPA 4FKTA 1H25A 2WGJA 2YISA 4EZ7A 4RLLA 4CLJA 1Y6BA 4USDA 3QRTA 4DG3E 4C36A 3FMHA 3RNIA 4TWNA 4BVUA 5J9LA 1IRKA 4FSUA 3ATSA 2F2CB 2XIRA 2GFSA 5FP6A 4JNWA 3RK7A 5IMXA 2PTKA 3FE3A 3DKCA 4HNFA 5M09A 3QUDA 3RHKA 5DN3A 3Q4ZA 5CEKA 4R6VA 4IX5A 1I44A 2W0JA 3DK3A 4J97A 3K2LA 2X9FA 2RFSA 3WF9A 5J5TA 3LW0A 1TQIA 4D2SA 2WMTA 4NTSA 3OCSA 2WEIA 3EFJA 3EQRA 3OWJA 4FKQA 4IC7A 4J8NA 3EB0A 1GZOA 5G1XA 4IAFA 5C8MA 5K4IA 3PY0A 3QTIA 4BTFA 3MPAA 3I5ZA 1KE9A 2IO6A 2SRCA 1JSVA 3GCSA 2VUWA 4D4SA 2JKMA 1PKGA 2XBAA 4XV1A 4YJVA 1IG1A 3ANQA 2C6DA 3DJ6A 3QQLA 2OXDA 3WZJA 3A4OX 4H39A 2UW8A 5E1SA 2VTOA 4BB4A 2PZ5A 4AT3A 1JNKA 3UOHA 5KHWA 4RIYA 4D58A 4C35A 3ROYA 2V7AA 3G0EA 3L9MA 4M13A 3VULA 4C4GA 4PTGA 4AOTA 2HW6A 3E63A 4EHVA 4N70A 5CVGA 2WU7A 3SKCA 1SVEA 1EH4A 1YDSE 4EH4A 3UP7A 1PXNA 3FJQE 3KF4A 3QAME 4QO9A 3VO3A 4A4OA 4YPDA 2V62A 5LQFA 3W10A 1XH7A 2C6EA 4FEUA 2PZIA 2Z7QA 3Q52A 3SXFA 3VUDA 4OAUC 4IWDA 4GW8A 2YABA 4A9UA 4BY9E 4RWLA 3C51A 1M2QA 2QU6A 4ALWA 4KKHA 4A9SA 5A4TA 4N6ZA 3SHEA 5FGKA 2IVVA 1A06A 3FHIA 3LVPA 5AIKA 4C33A 1Q8WA 2J6MA 3P5KA 3FZSA 1YXTA 3F3ZA 4YJUA 1R39A 2B52A 1UNHA 2ERZE 3Q96A 1ATPE 4E8AA 4GVAA 2O5KA 4PTCA 1JVPP 4M0YA 3F66A 3QX2A 5AP0A 4XG9A 3CCNA 5TR6A 1ND4A 3U6JA 3BWFA 4CRSA 2YCFA 3C1XA 1TQMA 3FMMA 3P86A 5EQPA 5D10A 4F9YA 4TWCA 3R1NA 3G9NA 4AN9A 4Z3VA 5CEMA 2GPHA 3PE2A 4U40A 4FT5A 3TKUA 3R8MA 1M2RA 4YHFA 4ALVA 4ITJA 5EI8A 4O7LA 2A27A 3BHHA 4KNBA 3QFVA 4DAWA 4RZWA 4QOXA 2ITPA 4J52A 2C5XA 3ZDIA 2GCDA 2HZ4A 3IK3A 4ASZA 4IBMA 3R02A 2WO6A 5CU4A 4XG2A 3H9OA 5GIOE 2H96A 1BI8A 3IGGA 2YCSA 1FBNA 3SAYA 4JJRA 1STCE 2DS1A 1YWVA 4MBIA 3UOLA 4KINA 2VO3A 3DXNA 4G3CA 4YBKA 1ZYLA 2ITWA 5DFPA 5AP1A 4QQTA 2XJ1A 4RJ8A 4F7JA 4W9XA 4DCEA 3FPQA 4IQ6A 1NW1A 5TT7A 2F7ZE 5KZIA 2A4LA 2GNFA 3KRLA 4RWIA 3GNIB 2CLXA 4ENXA 5JT2A 3HDMA 2XEZA 5HORA 3VBVA 2XBJA 3LCTA 4ZXTA 3D5VA 5CAVA 4M69B 3GQIA 2J50A 5IH5A 3DAEA 4QT1A 1WMKA 4D5HA 5J9ZA 3ORKA 3BYMA 4GG5A 1YDTE 4GL9A 3IDPA 3HA8A 2PVYA 3QQGA 3CPCA 5HTBA 3RZFA 2Y6MA 3V5JA 4IZAA 1OUKA 4FVQA 3ZH8A 4EH8A 1Z9XA 5ETCA 4DEDA
chains in the Genus database with same CATH superfamily
4NT4A 5F9EA 4YO4A 2YERA 3FKNA 3SLSA 2FA2A 3CTHA 3OEFX 3D5UA 4E4LA 3C50A 2XNBA 2J4ZA 3QCYA 3FYJX 3PPKA 4AS0A 3AMYA 4AZTA 3JPVA 4TY1A 4BJJA 5HKMA 4QNAA 5H9BA 3U55A 3FMEA 2C5NA 2YM6A 4QYFA 3TCPA 4BBFA 1IAHA 4U43A 3TG1A 3I7CA 4AFJA 2XM8A 4FSTA 3CTQA 3KRRA 5F95A 2XJ0A 4BDGA 3O23A 2DQ7X 4JDIA 1KSWA 3Q9YA 3V8TA 5E90A 3W8QA 3MH2A 4U79A 3BE2A 4CMTA 3VW8A 3R00A 1RW8A 3PA4A 1DS5A 4FKOA 4JAJA 5I3OA 4ACCA 5CAOA 2YFXA 4ZY4A 4FT7A 3ZM4A 4F9WA 4W4XA 4PMMA 3PJCA 3ULZA 5KBQA 3TUCA 4G9CA 4GV1A 5F20A 4EZ3A 5L2QA 4BCPA 3O51A 5ACBC 3PXYA 3UNJA 2X7OA 3F6XA 2X81A 3PJ3A 3E88A 3LXPA 4JDHA 4OW8A 4ANOA 4PUZA 4RVTA 4RQVA 3B2TA 3QD4A 4GT3A 1ZY4A 2PVLA 2W17A 4QQJA 3QKLA 5E8ZA 4C3PA 2QOFA 3R9DA 4GYGA 2R3RA 3UDBA 2PMNX 3LFAA 3Q60A 1W83A 2ETMA 2WMBA 3Q32A 4TTHB 4U44A 4E4XA 1JKKA 3TDVA 4IAAA 4QP6A 3UG1A 3FYKX 4F7NA 1Y91A 4AACA 4LUDA 3N4TA 3EQHA 4QTBA 2R3QA 3IW8A 4EQMA 4CFWA 4E6CA 4NCTC 4F6SA 4XG7A 5L2TA 1ZAOA 3WF6A 4I94A 2W06A 3H0YA 2PK9A 4NW6A 3LFSA 4FVPA 4E93A 3VIDA 3W0PA 3POOA 3ORZA 3NGAA 3MPTA 2BILB 3OW4A 4DBNA 4LV8A 4DT9A 2XJ2A 2X0GA 2R4BA 1GZ8A 4FNYA 3BL7A 4LV5A 4GKIA 3MVMA 2C4GA 2UV2A 2ZV7A 4B0GA 5CSHA 2PE2A 4DG2E 2IW8A 3D0EA 3QZIA 3KXNA 5IU2A 5CF6A 2G01A 3A99A 4BDEA 5DR6A 4BDFA 3E7OA 3K5UA 4Y83A 4YNOA 4CXAA 3LHJA 3AC1A 3UZTA 5IG1A 5IQAA 3LJ1A 2QO9A 4AGDA 1Q8ZA 4EH5A 2VWZA 3HL7A 4JBPA 2VGOA 4LUEA 4XH6A 4BDAA 3IONA 3QUPA 2HW7A 3DY7A 5BMMA 3P7BA 2CNQA 2UUEA 3WZEA 3MB6A 3TT0A 4N4SA 3TXOA 3ZO3A 3GB2A 4KBAA 5DBXA 3LCKA 4J95A 4F64A 3ET7A 4AE9A 5AP3A 5BYLA 2WTKB 2WEVA 4U9AA 5DPVA 3C4ZA 5DRBA 4QMLA 5EI6A 4FTKA 3SRVB 4BDCA 3UQCA 4DH7A 1OL2A 4XNEA 3WBLA 2E9UA 5DIAA 4PRJA 3NNXA 4GVJA 3SQQA 5DGZA 3DBDA 5AUXA 1RQQA 2X39A 3HDNA 3AT3A 4HGLA 5ANJA 3FC1X 2XYUA 3COKA 2CKPA 4LI5A 3RAWA 3MH1A 4PX6A 3KKVA 4DHFA 5D41A 3W2CA 4O84A 4BIBA 4Z9LA 2ITZA 4UALA 3BELA 3AD5A 4LGGA 4QTDA 5J79A 5CS6A 1WCCA 3SD0A 2GSFA 2VWUA 3MGYA 3RM7A 3A2CA 4IAZA 3ZLSA 1OB3A 3NFFB 3HNGA 2HXQA 3ITZA 3G15A 2B9FA 4RC3A 5H8GA 3GC9A 4YBJA 5HCYA 5M4UA 1Q8YA 3NX8A 4ZSLA 3FQSA 4OBQA 5DH3A 3WI6A 4QTEA 3LMIA 4F7LA 3VHKA 5A14A 5JEBA 1V0PA 1CSNA 4S30A 4TKSA 2PSQA 4NM3A 1E1XA 3O50A 4FNWA 4IX6A 2I6LA 3CLYA 3V8WA 1PXIA 4I21A 3PRIA 3EN9A 4GRBA 4YTIA 2IW9A 3AKJA 4YJSA 4I6QA 4WRSA 5BNJA 5EG3A 4RQKA 2A1AB 3UDTA 3CKWA 4W4YA 3FSFA 3KN5A 4FTCA 5A6NA 2VV9A 5IQHA 2ITQA 3F2RA 4CZUA 3LM5A 3QC9A 4USFA 3GU5A 3R1SA 5FQDC 4AZWA 2B1PA 3HRCA 4BKYA 3HP5A 5IQCA 3FSKA 1ZMVA 2BAJA 1H0WA 3O7LB 3OTVA 2YZLA 2JDRA 4L43A 4FIFA 2C5YA 4LL5A 2GNIA 5CI6A 3EQFA 4DFZE 2QHMA 5HG9A 2VU3A 4RRVA 1F3MC 4EOPA 4DYMA 3P08A 2FSOX 4CT1A 2HY0A 2R3IA 4M68A 1E9HA 2EXMA 1KOBA 1JBPE 3R04A 5CNNA 4YNEA 3UZPA 3VS5A 3W2RA 4C62A 1XH4A 3JUHA 3NUYA 3SG9A 2A2AA 2W1IA 2GDOA 3CQEA 2H9VA 1YWRA 3EYGA 3P23A 3DK7A 4PY1A 5DNRA 2O63A 3VBYA 4DC2A 2FSLX 3GCUA 1YDRE 3KCFA 3NWWA 4U7ZA 4PDYA 3EFWA 3HYHA 1DM2A 1UKIA 4C8BA 1BL6A 5CNOA 5LVLA 5F94A 2PMOX 3PUFC 4A07A 2R64A 4KKGA 2FB8A 3ORMA 3FMJA 4FTAA 4L00A 1HCKA 5HVJA 4P90A 4N57A 4PP7A 4BZOA 2J90A 3PXRA 1JAMA 4BTJA 4UWBA 4EUTA 1ZRZA 2QVSE 4RIWB 4ZTQA 4AQKA 2X2LA 2XNGA 3CKXA 4BBEA 4NM0A 5HGIA 4DA5A 2GNLA 4NU1A 1JSTA 5FM2A 4IX4A 1AGWA 3I0QA 4UMPA 1B38A 3FDNA 2AUHA 5AR7A 3U4UA 4NM7A 4LGHA 4QMZA 4WNMA 3G33A 3KRWA 5AA8A 2WU6A 3C4XA 4I5PA 3MY0A 5ICPA 4FE2A 5M56A 4KIQA 5DT4A 3QYZA 3OXTA 3AT4A 3QTZA 4Y8DA 2PYWA 4EBWA 3MY5A 1PY5A 5IDNA 5LXMA 1QPDA 4CV8A 5CSVA 1TZDA 2IZRA 3R0TA 4B8LA 2BTRA 1OL6A 4ANLA 5ITAA 4UN0C 5AA9A 4XP0A 4IWQA 3UIBA 5A46A 3PSCA 5GZ8A 3WE8A 4IDVA 4GU9A 4CTBA 4TRLA 3EQCA 3R71A 1J7UA 2C69A 4KB8A 4PMSA 1WBWA 1NVRA 4FYNA 4BI0A 2WMXA 3ZRMA 4FG9A 4NW5A 4C0TA 5CEIA 4D55A 4IW0A 3DXQA 3CP9A 3W1FA 4CNHA 5J5SA 2X0QA 3AC4A 3QL8A 4UB7A 3RM6A 2VTJA 3DAKA 4B99A 2OFUA 1J91A 2VO6A 1OIRA 4UWCA 3TTIA 3LQ5A 5KCVA 4YUQA 4XOYA 3FLZA 2J7TA 5BVWA 2R0IA 2GNHA 3F2NA 3RVGA 4Y95A 4O2ZA 3MTFA 5HEZA 4HW7A 3R8LA 4YHJA 1YHSA 4DTAA 2EUFB 1Y8GA 4WSQA 4LRMA 3UODA 4D4VA 4CMUA 3EL8A 4J7BA 3S2PA 1FPUA 4ZZMA 5L8LA 5KBRA 3R8VA 3BBTB 5IA1A 1OBGA 2W1CA 4O22A 4RZVA 1P2AA 4YP8A 4ZIMA 3VBTA 3NIZA 4EONA 2W05A 4RJ3A 3U8WA 4U3ZA 5BUIA 4QEBA 5IZFA 4RX5A 4ERKA 2DWBA 3LZBA 3FLQA 3LIJA 3Q2JA 2WXVA 3FBVA 4XUFA 4BI1A 4FTRA 3EYHA 2OXYA 5KHXA 4XX9A 2I7QA 4XS2A 1Q41A 3KN6A 4TYIA 4NFNA 3K3IA 3MIYA 2X0OA 3PVGA 5BVFA 2F7XE 5E8YA 1IR3A 2Y8OA 4JRNA 4H3PA 4HGTA 4R1YA 2GS6A 3NR9A 4NKSA 3MA3A 2W1DA 2YA9A 1W84A 1H00A 2GNGA 4FV1A 4YJNA 2PVMA 3PZEA 1Q3WA 2VWIA 5CSXA 3D15A 2OH4A 2QCSA 3KF7A 2FSTX 2WMRA 3I79A 4LQMA 2F2UA 3LQ8A 4GT5A 2VTNA 4LL0A 4ZK5A 4KRDA 5EQYA 4EOSA 5LWNA 2OZAB 5E91A 2ITYA 3R9HA 2AYPA 4E5BA 4EL9A 2WMAA 3VUHA 3TDWA 2VTIA 2XVDA 3PP0A 3QGWA 5B0XA 4KBCA 3I60A 3RK9A 3OUNB 4XV3A 3U6IA 5AP4A 4L7SA 3A8WA 2UZOA 3GP0A 2JLDA 3HMPA 4PV0A 5ANEA 4HVDA 3M42A 1YXVA 5E92A 1XH5A 5C01A 1L3RE 4AW1A 3Q9WA 4AW2A 3DT1A 3LM0A 2XARA 4L67A 4FA2A 4FTUA 3F5PA 1K2PA 2Y4IB 4RT7A 2XCKA 5KMJA 3VS3A 2VWWA 2ZMDA 5IA5A 4A7CA 5FRIA 4AT4A 1IA9A 3V6RA 3UNKA 4JG7A 4I6BA 3ZO1A 3AOXA 1VYZA 3M2WA 4UMTA 3V5TA 4AAYA 3Q04A 4NH1A 2A98A 1VYWA 2XNNA 4QMPA 3S0OA 4CGAA 2PUUA 3L9PA 2WMQA 2YCRA 3VUIA 4F6WA 2B53A 3OCGA 4TPTA 4BN1A 4J1RA 4BYJA 3E3PA 2J0IA 3MVLA 4FV2A 4C3RA 1PMUA 3NUXA 4Q5HA 2G2FA 5H2UA 2WPAA 3FPMA 2PVNA 4DGMA 4CD0A 3KRXA 4WG3A 2PVHA 4FOCA 1H1WA 3EN5A 3GU7A 2HZNA 4AXCA 4S2ZA 3LFNA 3OT8A 5AR4A 1V1KA 2UZNA 3RNYA 4APPA 3QA0A 4DH1A 3SG8A 1CTPE 1KV2A 5EM6A 4QMWA 2YIXA 4MHAA 3U4WA 2YAAA 3VJOA 2VNWA 3F3TA 3Q4UA 4FL1A 4O0YA 5I3RA 4FV7A 4H58A 3COHA 5HU3A 3PDTA 4ACMA 3FLWA 5KNJA 5IUGA 5J95A 4KSPA 1WFCA 2JKOA 2WTKC 3P78A 4RWKA 4C4JA 3DCVA 2OG8A 4JQEA 2Y6OA 2GNJA 2YLEA 3QXPA 2VD5A 2XNPA 3GCQA 4BDHA 1KUTA 3TACA 4ZTRA 4O1OA 3KVWA 2OIDA 3VS1A 4NCTA 3MBLA 5EOBA 5KMNA 4PPAA 2BDFA 3C0HA 4FKGA 1OKVA 3MY1A 4K77A 4AWIA 4ZAUA 3KMMA 4O6EA 3NUAA 2CDZA 4G6NA 1OMWA 4R3RA 4BCOA 2W9ZB 3EWHA 3MVHA 3QRJA 5M06A 2X4FA 3FQHA 4D1ZA 3L8SA 4MXZA 3FLNC 5CALA 5I9WA 2XZSA 4II5A 3RALA 3BZ3A 3QUEA 4A4XA 3O8UA 5IISA 5LMKC 4D2PA 3DJ7A 3E3BX 3MIAA 4U6RA 4D4YA 5HIDA 5AAEA 1XO2B 4X3JA 2BZIB 5GZ9A 2R7IA 3V6SA 4HVIA 2C68A 5EDQA 4EHGA 3HV4A 5IQFA 2JBPA 4Y73A 3WF8A 1Y57A 3JR1A 4R7BA 1PMEA 2UVYA 3VS6A 3KMUA 2RG5A 1H27A 3E8NA 2W1EA 2O65A 4CZTA 2RG6A 1ZMWA 2I0YA 4DEHA 1XKKA 3KXMA 4EC8A 5JMSA 4XJ0A 3FC2A 1YXUA 3UIXA 2QODA 1WBVA 2I0EA 5ETIA 1JKLA 4EKKA 3NVMB 5AR3A 3F5XA 3HGKA 3EIDA 4XG4A 4YSJA 3HMNA 4K18A 2OW3A 4O96A 3M1SA 4PF4A 5LMBA 4U45A 3UBDA 1QPEA 4BTMA 4DGLC 4QDEA 3ID6C 3C4CA 2QO2A 2Y0AA 1H1RA 2X0PA 4G5JA 3UO4A 3UVRA 5L2WA 4XHKB 2R5TA 4EK6A 2BROA 4O0VA 4EK4A 4RFMA 3VUTA 3BU5A 1SVHA 2QOBA 1RJBA 1ZYCA 4AF3A 4DH8A 1WBNA 3BE9A 5H3QA 3CPBA 5BMSA 3UP2A 3ENHA 2O0UA 5AJQA 3BPRA 3GOKA 4L01A 3RBWA 2DYLA 4YJPA 2WMSA 3BWJA 4OTRA 2XB7A 3AQVA 4KIKB 2OJFE 3WZDA 5IA3A 1JKTA 5E9EA 3ORXA 1ERKA 3NPCA 3ZONA 5D12A 2ONLA 4AA5A 5CWZA 2PMIA 1H1QA 2Y9QA 5JQ5A 2FH9A 5CXZA 2WKMA 1H1SA 1YHVA 4W8DA 5EM5A 2W4OA 2BZJA 4FSMA 4C38A 2QURA 3NNWA 4JI9A 4MBJA 1ZYSA 3ZM9A 2V5QA 3T3VA 4R5YA 5E8UA 4FKRA 2OKRA 1QL6A 3QTXA 3NUPA 3ODYX 3F5GA 3W32A 5B7VA 1BMKA 2W1ZA 2YDJA 3NW6A 4M0ZA 3FI4A 4QMVA 5M55A 5DA3A 3DDPA 4OT6A 5DI1A 4HVSA 2J0KA 1BKXA 2UZBA 3BLHA 3MWUA 1GIHA 5HG8A 3UE4A 5E8WA 5FDPA 1P4OA 4NTTA 1R1WA 2X1NA 3MFUA 4ONAA 4QP2A 3MA6A 3KK8A 4WUAA 2UZDA 4DLJA 4FZ7A 3ERKA 4PDSA 5D1JA 2A19B 1P4FA 2NRYA 4EZ5A 3ZBXA 3K54A 3ZYAA 4F65A 2PZRA 1CDKA 2ZM4A 3L8PA 4YJOA 3AT2A 3RWQA 2OH0E 3OOGA 4GJ3A 4BC6A 1PYXA 2ESMA 4CSVA 1NT2A 1OI9A 2Z60A 2G15A 4L45A 5TO8A 1GZKA 2XIXA 5L6OA 5A9UA 3OCBA 3HA6A 2XKCA 3A8XA 1UVRA 3QHWA 4FT3A 2OJGA 4IB1A 3E87A 2UZLA 1PXLA 3FMKA 3LFDA 5CY3A 2BDJA 5KO1A 1IASA 4HNIA 4EH9A 3DKFA 4L68A 3I0OA 1SNUA 1OPKA 4JXFA 3A7FA 3NLBA 4TYEA 3MESA 4CT2A 4MUQA 2QD9A 3TUBA 2IVUA 4DDGA 5JH6A 3DZOA 5JGBA 3FXXA 4BCGA 4LRKA 4FL3A 3PRFA 5CEQA 2CKEA 4FIIA 4F9BA 3NEWA 4EK8A 4FGRA 2B4SB 4MX9A 4DFBA 4EOIA 4ERWA 1OBDA 4XP2A 2CSNA 3PIXA 4O21A 4C2WA 3GT8A 4JQ8A 3VS0A 5HLPA 1KV1A 4O7RA 1XH9A 5KMKA 4M14A 1LEZA 4TZRA 1U54A 4FZAB 4QP7A 3FAAA 4H36A 5M4IA 3RPVA 3AMBA 1V0OA 4OTDA 3DOGA 4EKLA 1PMVA 4RIYB 4IM0A 4NK9A 4YHTA 1I09A 3R83A 4YR8A 4EOMA 2BZHB 4ZP5A 5KKRB 5AV3A 2QHNA 2BRBA 3GFWA 3UVQA 2BR1A 3A60A 4C37A 1SNXA 4O7YA 2RSVA 2UW4A 3GQLA 3ZU7A 1NXKA 4P4CA 3O71A 3F69A 3DPKA 4G3EA 1YKRA 4MBLA 5GZAA 1YVJA 4X7QA 3A7JA 4UMUA 4QDVA 4FV5A 4OUCA 2UW7A 4AZFA 2ITVA 1WBOA 1W0XC 2B9IA 1B39A 4AN2A 1TVOA 4L53A 4DGNA 2CKOA 3W0RA 3PXZA 2XAOA 5L8JA 3RTPA 3GOPA 5HNGA 3UC4A 3EN7A 5IQGA 3C4WA 1OPJA 2XK8A 2V55A 4BWXA 4AZEA 4FSWA 4JRVA 4DFLA 1OPLA 1U59A 4GEOA 4A9RA 1G5SA 2W4JA 3TV7A 3ZXZA 4MWIA 2HXLA 3PY1A 4JT3A 4CV9A 3CY3A 2YN8A 3QC4A 4QRCA 4WG4A 2YHVA 4AXAA 2JDOA 3KGAA 1DI8A 3CGFA 4DE4A 2IWIA 2BRHA 4IZ5A 4AAAA 5FTQA 1XMLA 4FV3A 3PA3A 5T68A 3R8PA 4TXCA 3QRIA 2OSCA 3BQCA 2YM8A 5B2LA 4IWOA 3HZTA 3WYYA 5JFSA 2F49A 5HG7A 4C4IA 3MTLA 3EFKA 1XJDA 4ZZOA 5A4EA 2W5HA 4HYHA 1PXJA 5IKWA 4I0SA 4EQCA 2F9GA 4G5PA 4MF0A 3RCJA 2BIKB 5CVHA 4BGQA 4QYHA 4F08A 5HTIA 3TNIA 1CKJA 3SXRA 4WNKA 3L8VA 3F9NA 5CASA 3LLTA 4BWPA 3S00A 4Q9ZA 3VC4A 3F82A 2NNWB 4I3ZA 4BI2A 5DWRA 4HGEA 3FY2A 5KUPA 1MQBA 3MI9A 3AMAA 3VS2A 1PF8A 2O64A 1ZY5A 2QC6A 3PXQA 4GFOA 3I7BA 3ZZWA 2C1AA 4ACDA 2JAVA 3QBNA 1M17A 4FKUA 2JBOA 4BZNA 4DFYA 2FUMA 3AC3A 2CJMA 4E3CA 3IG7A 5T3QA 1W7HA 4U0IA 4AA4A 5A4CA 4TNBA 2XM9A 3TWJA 3MJ2A 3ZLYA 3OCTA 5DLSA 5HBHA 5AV2A 3COIA 3CY2A 4GSBA 4S32A 2Q0NA 4RMZA 3UYSA 4FZDB 5BYYA 4DBXA 3QTUA 4FSRA 3WZKA 2OFVA 3CBLA 4NJ3A 4ZSJA 3AGMA 4F0IA 2AC3A 3BV2A 5J8IA 5CF4A 4HVHA 3FQEA 4QP4A 4U5JA 4LOPA 4B4LA 4CKJA 3HP2A 4I20A 3LQ3A 2J0MB 4QMUA 4O0RA 1XH6A 4MD8E 2RGPA 4QP8A 4C02A 4QQCA 5I9YA 3PLAE 1H1PA 3ZOSA 3D5XA 1HCLA 4QYGA 3SX9A 2Q83A 1MUOA 4X3FB 3QTWA 5HG5A 2PE1A 5AEPA 4ZMEA 2Z7RA 2C6IA 5CLPA 4IFGA 4J98A 3NRMA 3U51A 4F1MA 2UVZA 4RJ6A 4EWHA 2UW6A 1W8CA 3LMGA 3VJNA 5HVYA 4FIHA 2UW3A 4CVAA 4L3LA 4YZDA 3OWKA 4B7TA 3IKAA 2ZAZA 5T6KA 5CTPA 3EH9A 3NAXA 2NYAA 3DFAA 3E92A 1LPUA 3PJ2A 5HX8A 3BLRA 4O7ZA 3TMOA 3V5PA 3Q3BA 3Q5ZA 4K11A 1Y8YA 4JDJA 4LFIA 3R63A 2O3PA 5FXQA 3LFEA 1J3HA 1WVWA 2P4IA 3EKKA 4EHEA 3VF8A 3PXFA 3CJFA 3K3JA 3BHVA 3HMMA 1U46A 2YIQA 4IVDA 4MEDA 4UXLA 3ZEWA 3ZLXA 1LR4A 4WHZA 4CFUA 4DT8A 1GIIA 2PVKA 2CGUA 3FKOA 2NRUA 2VAGA 3KEXA 3UQGA 4GK2A 4FKVA 3G6GA 4CFNA 3UPZA 2Z7SA 3H9FA 2VTTA 3EZVA 4ENYA 2VGPA 4F09A 3PA5A 2LAVA 2IEWA 1K3AA 1UA2A 2YZAA 2QOQA 5GHVA 2GU8A 3ZUTA 5M4FA 4RC2A 5KE0A 5GNKA 5HNIX 2UZUE 5HESA 4PMPA 3Q53A 3PSBA 2Z2WA 4M7IA 4EUUA 2QOHA 3Q6UA 2H6DA 3E5AA 4Y72A 3TYKA 5FTOA 4GH2A 5JZNA 4HZRA 1F0QA 3QA8A 4ZZNA 4D5KA 2E9NA 3A7IA 4GG7A 1VJYA 1XH8A 4GIHA 4KWPA 4FTTA 5BPYA 3D14A 1XBBA 2VTMA 4PWNA 4RA5A 5EYKA 4M3QA 4IEBA 4BCHA 4QMNA 3QZHA 4F0GA 2PPQA 4WNOA 3AKKA 3FI8A 4AXDA 1H07A 3FUPA 2ZDTA 3R30A 3UQFA 4M67A 3QTRA 4TYJA 5D7VA 3PTGA 4FTJA 3GC7A 4CFXA 5HICA 4FIJA 4QMQA 3Q2MA 4BTKA 4GMYA 5M07A 3RHXA 3FEGA 3I6WA 2UZWE 2XANA 3R2BA 2ZFYA 1XMMA 5IA0A 5C4KA 5J7BA 3T9IA 4ANMA 4F7SA 2JD5A 3ZC6A 3VRYA 3ZO4A 4D0XA 2CGWA 2JDSA 4AZSA 5IF1A 4PDPA 4UZDA 4J53A 3EQPA 5AFVA 5GJGA 4BCIA 4V04A 3QQJA 1UNLA 2RFNA 2CKQA 3R7GA 4M66A 4YC8A 2RKUA 4JBQA 2OIBA 2Q0BA 4BYIA 1S9IA 3DA6A 3T8OA 3QQUA 2RFEA 1Q4LA 1W82A 1PXOA 2YM3A 1S9JA 4JX7A 4W4WA 4XG6A 4AGUA 5J1VA 4MNEA 2WQEA 4OTGA 2WQOA 3ZXTA 2G1TA 3DGKA 3QCXA 1URWA 3WYXA 4WNPA 5LARA 3ZFXA 1TQPA 4OTFA 5EYDA 3QRUA 4XP3A 2PUIA 4O7TA 4D2RA 2HYYA 4R7IA 4O0TA 2BZKB 2JDVA 2C5VA 4IX3A 1SYKA 3FL4A 5IQDA 2W96B 4BIEA 4E5AX 1BYGA 5CYIA 3UMXA 4FTLA 3T3UA 2XNMA 4KAOA 2JFLA 1PXMA 4F1TA 4EEVA 5IH4A 4BGHA 4U8ZA 2YJSA 4CFVA 5I9UA 1OL5A 3DK6A 5EKOA 3HV6A 2OO8X 4X6QC 3DBFA 4EJ7A 2QOOA 4G6OA 4ZMFA 2XK9A 2VWXA 2Z7LA 4QMYA 4F70A 3ZUVA 3PPZA 4YPSA 5BVOA 3QZFA 1ZZLA 1PYEA 2OJJA 4AA0A 3G6HA 3KXGA 3R7IA 3E7VA 5M08A 3QU0A 3QLGA 3KU2A 4O0XA 3GVUA 3NSZA 5AP6A 3DQXA 4IB0A 3ORNA 5E8TA 3B8RA 4O0SA 5K4JA 2W7XA 2XH5A 4KD1A 3BRBA 5IDPA 2QLUA 3QCQA 4Y85A 5C03A 2WTDA 2PZYA 5HLWA 3Q9XA 3OMVA 4EBVA 4A9YA 5ACKA 1BX6A 2UZVA 4ASXA 4G3DA 4QPAA 2ITXA 4O82A 1X8BA 2YDIA 3QKKA 4O7SA 2ZJWA 4AOJA 4EH3A 4DF3A 3TNQB 5KKRC 5HE0A 1G8JA 4NL0A 3MB7A 3DQWA 3OEZA 3TKIA 2C0TA 4C59A 2YM4A 3MS9A 4C4EA 4CQEA 2XA4A 3BHUA 3CQWA 2JC6A 2P0CA 5CEOA 3P0MA 4G2FA 2ACXA 3OTUA 4Q5EA 5EM7A 3ACKA 4C57A 1YRPA 3ZSHA 2IJMA 1VZOA 3HV5A 4DTKA 5JFXA 3R1QA 5GINE 2JKQA 5AUUA 3ML1A 2QQ7A 3GCPA 2C6OA 3D2IA 1H4LA 2IZTA 3HRFA 1ZZ2A 2ITNA 3MYGA 3W0QA 4JIAA 1OECA 3QD2B 1YI6A 3U9CA 2PL0A 3LE6A 3R7VA 1LUFA 4R77A 4OTIA 3KREA 4QYYA 3W18A 4A06A 5BUJA 4OGRA 3ALNA 1FQ1B 3OOMA 1GOLA 2XK7A 4O4BB 5G6VA 3ZS5A 4CLIA 2BTSA 1V0BA 4Y5QA 4P5QA 4ZY6A 4H1JA 3SW4A 3IOKA 3RPYA 3NCZA 5HVKA 3LKMA 5AV1A 2CN8A 3BBWA 4JG8A 2G2HA 1QCFA 3FZRA 3GCVA 3H9RA 5EDPA 2PULA 2OWBA 4CKIA 4B8MA 3DAJA 1NVSA 4NSTA 4BDKA 5C4LA 2W4KA 4WRGA 1CMKE 1J1BA 3IECA 3DLZA 2XKEA 3FI3A 3ZZEA 4CYIA 5A54A 3P9JA 2YLFA 3U87A 4RWJA 5AUZA 4GIIA 3W0NA 4L46A 3R28A 4BZDA 3FV8A 3BYUA 4C3FA 2OLCA 2C3KA 4MD9E 3ZSIA 4UBAA 4MXOA 2UZTA 4BCJA 3GXLA 5AUWA 3VAPA 3SC1A 4C58A 3P4KA 3PJ1A 4DHZA 2WFYA 2OJIA 2R0UA 3WILA 3EMGA 3KFAA 4AGCA 5JKGA 5DT0A 2EXEA 4X2FA 5EH0A 4FX3A 1G8SA 4FMQA 4E4MA 1JOWB 1U5QA 3W0OA 4PP9A 3PE1A 3S3IA 3ZBFA 2GHMA 2VTQA 3UNZA 4TYHA 1UU7A 1DI9A 2VTRA 3QD0A 2ITTA 5DT3A 3GENA 4MXXA 4MVFA 3I6UA 5DRDA 3RMFA 1ZARA 4BIDA 4MNFA 4ZTSA 4IB3A 5FEDA 5CANA 4NEUA 3MH0A 4IB5A 3JVSA 5DMZA 4XV2A 3RK5A 1J7IA 5AM7A 4BF2A 5IEYA 4G16A 1FGKA 4RVLA 3NCGA 4KIOA 2BALA 1Q24A 4TNDA 4ALUA 4O4EA 1JKSA 5FLFA 4ASEA 5GIPE 2WTVA 2XNOA 5DE2A 2R3KA 4K33A 5L6PA 3V51A 1FOTA 1H01A 2YEXA 3V3VA 1GZNA 4I5CA 4X3FC 4HYIA 5I9ZA 2UW9A 4K8AA 5A4LA 2XK3A 1A9UA 3PSDA 3WARA 4CQGA 2XAMA 3OY3A 2J51A 4R3CA 3R73A 3NNVA 3DNEA 4DG0E 2XIYA 4XEYA 3G9LX 3NUUA 4O4FA 5K5XA 5IMEA 2I0HA 4I6HA 5AUVA 2CN5A 3EQBA 3S1HA 2XRUA 4NIFB 3R8UA 4PL5A 4O6LA 3ZTXA 2WAJA 3LCSA 4R8QA 3BX5A 4P7EA 4RIXA 3SA0A 4YLLA 1U5RA 4QQ5A