4QP7A

Crystal structure of erk2 in complex with 2-(1h-pyrazol-4-yl)-5h-pyrrolo[2,3-b]pyrazine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
345
structure length
337
Chain Sequence
MVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title Fragment-based discovery of potent ERK2 pyrrolopyrazine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 337
sequence length 345
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qp7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qp7A01
3CEKA 3UZTA 3HA6A 4AFJA 1H1PA 3N4UA 3FQHA 4GG7A 4ZK5A 5M51A 5ICPA 4D1SA 4NM0A 5C4KA 4FL3A 4CGAA 4TXCA 1GZOA 2BIKB 4I0TA 3Q9XA 4OTWA 3TWJA 3DDPA 4DN5A 3VNTA 2GFCA 2ITQA 3MVMA 4XLIA 1P4FA 3OP5A 3OG7A 4NK9A 4AA4A 3DK3A 2Z8CA 4QMPA 1ERKA 2YAAA 2XNMA 4UB7A 5E91A 4AACA 3LFAA 5JT2A 3BEGA 2B9IA 3F3UA 2QD9A 2QNJA 3GCUA 5ANOA 2VO0A 2BROA 4U41A 4ANMA 2C3LA 4AW1A 3OHTA 4TRLA 1GZ8A 4CQGA 3VIDA 4IM3A 2HZNA 3NNWA 4FTOA 4CV9A 2OJ9A 2XK7A 2ITOA 4TWOA 4FK3A 3IONA 2FSOX 4TZRA 3A7HA 4C2VA 4KNBA 1PY5A 3DAEA 1YRPA 2CDZA 3G0EA 4IB0A 2CN5A 2QLUA 3NVKI 2W1ZA 4QMXA 3IW5A 2X7GA 5LJJA 3TJDA 4AT5A 2YIQA 1JSUA 4FSRA 2BZJA 4M0YA 3W2QA 3OCGA 3KY2A 4DTAA 3QGWA 4IFGA 2PUIA 1QPCA 2C6MA 4YUQA 5TF9A 4OBQA 1CMKE 4YJRA 5EI2A 4W4WA 4X3JA 3N4VA 3LQ3A 4KIOA 4RA4A 4DGOA 4GT4A 1KE8A 2WEIA 1PMEA 2XRUA 3F6XA 3H9RA 3PXKA 4BC6A 2E9NA 4BHZA 3FLNC 2XK8A 3PJ8A 2IZRA 1YW2A 1PHKA 2O65A 3AD6A 4PL4A 1UVRA 4DAWA 4C62A 5CEOA 3SHEA 1ZMUA 3EL8A 5AAEA 3IOPA 3GCQA 3I0QA 4KBAA 3LE6A 2Y8OA 5HLPA 2OBJA 1J91A 4DEDA 3DLSA 2UW6A 3OC1A 4YP8A 1F0QA 4EQMA 3R21A 3LXNA 3WYYA 2XKEA 3QRTA 4F6UA 3AMYA 2C1BA 4FV1A 4W8DA 1PMUA 2WQOA 4RIXB 4JIAA 5TO8A 3OOGA 3PLAE 4XOZA 3QD4A 3ZMMA 3DK7A 5E8TA 3ALNA 5ANKA 3VBYA 3D5UA 3OF0A 4TYHA 3LHJA 4EOIA 2P2IA 3LMGA 3EN6A 4LUDA 4R5SA 5IPJA 4HPTE 5I5ZA 4RMZA 5FEDA 5M08A 1A06A 3I0OA 3CJFA 2Z02A 5LVNA 2HW7A 4RQVA 5TE0A 3R1YA 4DEGA 2CGWA 4ACCA 3UVPA 2V62A 5E8YA 4KAOA 4PDOA 4JL9A 4C3FA 3T3UA 5KHWA 3K5UA 3MFUA 4O0UA 2O63A 4YTIA 2BAKA 4ANNA 1Q8UA 4I3ZA 3S3IA 5AUWA 2H34A 4DFLA 5L2IA 3A62A 3EQFA 4FEVA 3ZXTA 4LOOA 4FZFB 5HIBA 5FP5A 1YDTE 3BLQA 3PY1A 1TKIA 4X0MA 2GNGA 3NRMA 3ODZX 4W4VA 4GKIA 1WVWA 3I1AA 2CPKE 2O3PA 4O81A 2R2PA 2BRBA 3T9TA 4CV8A 4OTDA 1YHSA 1MRYA 3FMMA 4I94A 3NYOA 2UZTA 3PA4A 4AT3A 3DBFA 3IGOA 4K33A 3VF8A 2BHHA 2JKKA 3EKKA 3M2WA 3NUYA 5JFSA 4QMVA 4Q5EA 1RQQA 2J90A 3ULIA 3EYHA 3H0YA 5D7AA 5IISA 2OSCA 3E7OA 3C13A 5I3RA 4FYOA 1PKDA 3A8XA 3BV2A 5EYDA 5J1WA 2R3JA 4ZS0A 5DIAA 5CAQA 5DRBA 5KKRC 4DCEA 4JDHA 4I23A 4BGHA 5HBJA 1YXXA 3O8PA 2XUUA 2JFMA 5BVOA 4KKGA 4BCOA 2P0CA 4KB8A 4LYNA 3LMHA 3KGAA 4V01A 3GC9A 2BR1A 1R3CA 3JUHA 3DKFA 3OUKA 4D2TA 4FT5A 5EDRA 4EBWA 1R1WA 4HYIA 3NYNA 2YITA 3MIYA 1XQZA 5CU0A 4UMPA 5KO1A 4XG2A 3TZ8A 4LG4A 4M8TA 4FTRA 2WTCA 3HUBA 3R7GA 5EI6A 5I0BA 2QVSE 2ZDTA 4O7LA 1XH6A 2Z2WA 3PG3A 4I4FA 4RLKA 4TL0A 4WNMA 2RFEA 5GJGA 5GIPE 4FSQA 5EDPA 3L9NA 2JEDA 1I09A 5J9LA 2WTKB 2CLXA 1Y8GA 3R1QA 4JBPA 4P7EA 1DM2A 4U97A 3MTFA 3QA8A 3FZ1A 4FEUA 4FIJA 3UPXA 3BHTA 4KUJA 2VGPA 3OXZA 3FV8A 4M66A 5AAFA 2WIPA 1V0BA 1M2PA 1Q3WA 3UC4A 2WELA 3ZUUA 4BVUA 1Q99A 4RJ3A 3NMUF 4CSVA 3AD4A 5ETFA 3LXPA 2DUVA 5EH0A 4S34A 2ETKA 2V7AA 3HEGA 1H01A 3NCZA 3SAYA 3UG2A 2WQNA 4I4EA 5DPVA 3ALOA 4KBCA 3FDNA 2XJ0A 3MBLA 4RIYA 4FNWA 3LAUA 4BDKA 3RK7A 5ITAA 3ZLXA 4GFOA 1FVVA 3FY2A 5HTIA 1ZZ2A 3DB6A 4MBIA 3EL7A 4X2JA 4XX9A 4O0RA 3A8WA 3PJCA 5J87A 5D9HA 4ZSLA 5T6KA 4XYFA 3S95A 3KXZA 2H96A 3HL7A 5L6OA 3P08A 3QZFA 4NWMA 3KK9A 5AADA 4LOQA 3V01A 4NM7A 2WZJA 2J5EA 4HOKA 4O0SA 3KC3A 4BYIA 4EHEA 5IF1A 4NJDA 4A9SA 4ID7A 5EDQA 3HV6A 4QP6A 1ZOGA 3P7CA 1FINA 1MUOA 2QOQA 3H9FA 4FL2A 3JR1A 4XV1A 1XKKA 3QWJA 4O0TA 5F1ZA 3VUDA 1HOWA 4MX9A 2B7AA 5CF6A 4ITIA 4RVLA 3RJCA 4EC8A 4AS0A 4ASZA 3DZQA 4JX3A 2QOBA 3W2SA 2J0JA 1OL2A 4AX8A 2XIXA 2F7ZE 2VWWA 4L52A 5DT3A 4I24A 3ZSGA 3E87A 3OROA 2XP2A 5I9WA 3I7CA 3QFVA 4DLIA 4LMNA 5AP2A 1UU3A 4JRNA 4KRCA 2PMLX 2HY0A 4FV6A 3NEWA 4FUXA 3W33A 2W5AA 1DAWA 2CHLA 1QCFA 3WF7A 2I40A 1H07A 3G15A 4UX9A 2PK9A 3DB8A 3MB7A 3UZPA 3MVJA 3D0EA 4TYJA 3EQCA 3ZZWA 2ZAZA 4I6BA 5J9YA 1U54B 3C4ZA 4GK2A 5FG8A 4DG3E 2ZV8A 4FV5A 3TACA 5HCXA 3TKIA 4BCKA 1YQJA 2OJIA 4C4HA 4DCAA 1OL1A 5DH3A 5FP6A 3ZLWA 4RX5A 3BQCA 2Q0BA 1E9HA 3EQIA 3OS3A 4M97A 5JQ5A 2WMAA 3W10A 4EH2A 5EQYA 3BBWA 5LMKC 3PZEA 3C1XA 2W4OA 3QLGA 5AP6A 4G34A 5BYZA 4UZDA 4NFNA 4PPAA 4AW2A 2YJRA 4Y5HA 3KK8A 4CFVA 5JRQA 1G3NA 2UZEA 3U51A 4EOMA 4UWYA 5E8UA 5ANEA 4XV9A 5HI2A 3H30A 3WZKA 1GIIA 3EQHA 5HKMA 3PVUA 4J1RA 2JDSA 2OI4X 2JFLA 5D11A 3LCDA 3LFBA 3LOKA 5GJDA 4YSJA 4EORA 1G5SA 1KV2A 2FGIA 4DGNA 3DXPA 1MRUA 3VBTA 2CKOA 5AR2A 4FKRA 4J8NA 3LIJA 4FV8A 3MPAA 4O0YA 4EWHA 4CEGA 3Q4ZA 2PZPA 4EHZA 2W9FB 5HBHA 5F4NA 3C4CA 2EB3A 3R9HA 2FSMX 2VTNA 4OBOA 2CKPA 4MXXA 3P7AA 4G9RA 5AUZA 2GNIA 1ZYDA 3UOLA 1Q61A 1OI9A 3U4WA 3W32A 1BMKA 1B6CB 4HZRA 3EYGA 4ITHA 1M2RA 2BFYA 1YXTA 4ZTMA 3AC3A 4EUTA 5KMJA 2HZ0A 2PVJA 4L9IA 4WG5A 4D4YA 4F6WA 5K4IA 5IQAA 5CEPA 2VD5A 4O7RA 4AN9A 4IB5A 3FZPA 4AE9A 1RE8A 4BDIA 3A4PA 2XEZA 4NM3A 2ITXA 1P14A 1REJA 3CTHA 4O1PA 4CG8A 3PA5A 4PP7A 3GC0A 2BFXA 2PMNX 2QOCA 3UQGA 5E7RA 3NIEA 4FK6A 4BIBA 4KD1A 3WIKA 4JRVA 4CT1A 4GU9A 3PE2A 2R0IA 4MXZA 2BCJA 1VR2A 1PXKA 3NIZA 3QTXA 5AV0A 3VRYA 1UA2A 3NWWA 4KS8A 3AMBA 4HYSA 3C9WA 3VBWA 4EC9A 1H26A 4BYJA 4S2ZA 5A3XA 2B52A 3BGZA 5HEZA 1DI9A 2I0HA 2C6TA 2R3PA 3OD6X 4GUEA 2QC6A 3NGAA 4WRGA 3EN5A 3MW1A 2BTRA 3OWKA 3LCOA 2EWAA 2E9PA 3WARA 4QMSA 4BIDA 3UIBA 5BNJA 1YDRE 5AUTA 3FC1X 3OCBA 5A54A 2LAVA 4DTBA 3NLBA 4FV3A 3F5PA 3EFWA 1OECA 4Z55A 4WSYA 4JAIA 4LUEA 1OIYA 4ZLYA 3CLYA 2CCIA 2FO0A 2ZVAA 3PRIA 1H1SA 3EWHA 3JY9A 2CSNA 5AR3A 3WI6A 4WA9A 1ZXEA 3EQGA 3RPOA 4DG2E 5J9ZA 2JDOA 1X8BA 3PZHA 4RVMA 2FUMA 3TNQB 3W2RA 5BYLA 1WBPA 3WYXA 4GT5A 4IAIA 3TV4A 4DYMA 5C8MA 3B8QA 4AFEA 3SV0A 4AUAA 2F9GA 1Z5MA 5B7VA 3Q2MA 4E4LA 4J97A 2OG8A 4RA5A 1IA9A 2XK6A 5KHXA 4P2KA 4QO9A 3EHAA 4FI1A 1GNGA 1M2QA 5CANA 5AV4A 2OH4A 4FT7A 1PXMA 1PXNA 2PMIA 2UZWE 3MH1A 3S4QA 4V05A 2IZUA 3BLHA 3LXLA 4FKWA 5LWNA 2YZAA 3JYAA 1KOBA 4CLJA 3DJ6A 2Z7RA 4RRVA 3HV5A 3CC6A 3QX2A 2YIYA 2X4FA 5HVYA 4QP1A 5F94A 5FEEA 4FZ6A 3HLLA 1JVPP 2C6KA 3ORTA 2Y4IC 3MA3A 3HDMA 4E5AX 4CFMA 3QQHA 4YZDA 5LMAA 4H58A 4QMNA 4BDGA 4FX3A 3RM6A 3FMDA 5D10A 2GMXA 3TTJA 4BKJA 1H25A 3DBQA 2C69A 4FZ7A 5ETCA 3UVRA 2ITUA 4QP2A 4O7VA 3CQEA 3R7OA 4PQNA 4FOCA 3M11A 2OK1A 3SG9A 4NCTC 2YCSA 4D5KA 1T45A 2X6EA 4Q5HA 5EYKA 3L9MA 3W2CA 5CNOA 5IH6A 3GI3A 3WILA 2VNYA 3FYKX 5EYCA 3VS3A 2WU7A 5FQDC 3VUGA 3VUMA 4BZOA 2XNPA 3ACJA 4I0SA 3ROYA 3F3VA 4BKYA 3G6HA 3A60A 4LOPA 3TJCA 4IAFA 4Z7HA 4RX9A 3A61A 2QG7A 3MPTA 4QMWA 1H1QA 2W06A 4O1OA 2RFDA 4C8BA 3MDYA 2QU6A 3UG1A 3DOGA 2ITTA 4OAVB 3GU4A 1ZARA 2ACXA 2YM4A 4G1WA 2C5VA 4YJNA 4K6ZA 4Y83A 4A9RA 3DK6A 1E1VA 1QPEA 2IW6A 4QMMA 2Y6OA 4ANOA 4B4LA 4O83A 4JX7A 2ITWA 2UZOA 4PUZA 3V04A 4PMTA 4ZEGA 3QD0A 4ZTHA 5M4CA 2XNBA 3SW4A 4OTGA 2OFVA 3E93A 3W1FA 1O6LA 5LMKA 5AA9A 3IW8A 3PFQA 3AC5A 2JGZA 4MEDA 4Z3VA 4M69B 2OJGA 2XBAA 5IQHA 2X6DA 5HX6A 3ZCLA 5FXQA 4KABA 4NKAA 4J99A 5EQEA 4KSQA 4L53A 4B99A 4M15A 3QKKA 3KFAA 2ZV7A 3UO6A 4EH7A 4HVIA 3LJ0A 4WG3A 2XM9A 4XP2A 3NW5A 4K9YA 4NW5A 4D1ZA 4O7YA 4L46A 3KN6A 1RJBA 3ZDIA 4FSTA 4FMQA 1U5QA 3IW4A 2HYYA 2OICA 4L67A 1NVSA 3R8PA 4CRLA 5IH4A 3K54A 4DA5A 4Z9LA 3VBVA 3KCKA 4LRMA 1OB3A 2QR8A 4QYFA 5ANDA 3BYMA 2V5QA 4W4YA 5IDNA 5TKDA 1TQMA 3UDBA 4CQEA 4X7QA 3SGCA 1TVOA 4FTMA 1WBWA 5B2MA 4RJ5A 1G8AA 3KRXA 2VTAA 3OTUA 3UP7A 3VS7A 3GCSA 4H1JA 3R9DA 4FEWA 1GY3A 2AYPA 2REIA 2JLDA 4I41A 4FNXA 3VBXA 1PMNA 4M14A 4AZWA 3EQPA 3T3VA 2ZB1A 5M4IA 3Q2JA 1UKIA 3SRVA 2R9SA 3R71A 4YJSA 5A4QA 2FYSA 2EB2A 5IDPA 3UPZA 4ANQA 5LVLA 3SW7A 4QYHA 4JJRA 2NNWB 3Q32A 4U42A 1URCA 3AC8A 2JBOA 3CBLA 3QTIA 5IUHA 3NYVA 4ZLOA 3ZTXA 1FOTA 3C0GA 5CZIA 4ASDA 3PPZA 2YCFA 1H00A 4DFUA 5TR6A 3E62A 3VS5A 3D9VA 5K0KA 5AA8A 1XH9A 3MI9A 2R64A 2YJSA 4MF1A 5IUIA 5IQBA 3RVGA 4B8MA 3EFLA 1Q41A 3GU6A 3QAME 3OT3A 4CG9A 4BDBA 4DT8A 2C6OA 5CNNA 5CQWA 2XZSA 4ALVA 3TUDA 3R73A 1I44A 2RSVA 3VRZA 4C38A 5JZJA 3DV3A 4FKPA 2C6LA 3FMEA 3FKOA 1Z9XA 5E9EA 1H4LA 3JY0A 4BI1A 4FODA 3AC4A 1Q8ZA 3LQ8A 4DTKA 3SD0A 1VZOA 3UYTA 3HMPA 2W05A 4G6OA 1M17A 5KMKA 2WNTA 3F5UA 1J3HA 3KXHA 4G16A 4YJUA 1R0EA 4U6RA 5JN2A 1GZNA 2OF4A 2NO3A 5HG9A 4CCBA 3ULZA 3G33A 4A9YA 4CD0A 3UC3A 5GNKA 2GTMA 1U59A 4M84A 2WMSA 4KINA 2W0JA 4O0XA 4XBRA 2BDJA 5IQFA 3CTQA 5K5XA 1H1WA 3QCXA 5AV1A 3VW6A 4RBLA 3QQGA 3FMLA 3SVVA 3P7BA 2GS2A 5JGAA 2EU9A 3TTIA 4F7LA 3A4OX 2ZJWA 4G5PA 3P1AA 2HWPA 2QU5A 1Q62A 4O91A 3QALE 5KNJA 5AP0A 2JDRA 4FGBA 3DU8A 2KULA 5HE2A 3ODYX 1OL5A 2YDKA 5LQFA 4LRKA 3PE1A 2VO6A 5HG5A 3QLFA 3R1SA 2FSLX 2WMVA 1XR1A 3R6XA 4I1ZA 5EHYA 2XCKA 3B2WA 2PWLA 1JKSA 1ZYSA 3LMIA 3O7LD 4NCTA 3DDQA 5CYIA 4ZSJA 3UE4A 2OH0E 3KVXA 4FZAB 3FXWA 1JSVA 3I79A 4TWCA 4AAAA 2YZLA 2UZLA 2B9HA 2VTOA 3HV3A 2YACA 3A7FA 3I6WA 2UZDA 4G3GA 3ZO3A 1U46A 5IEXA 5DI1A 4GV1A 4MKCA 3O8UA 1J1CA 3L9LA 5M07A 4XG9A 4APPA 3D7TA 4MVFA 2B54A 2XNOA 4W9WA 4YTHA 2W4KA 5CENA 4E4MA 3Q5ZA 3C4EA 3ZEPA 4BIEA 1CM8A 4YNEA 3ZEWA 4IM0A 4RVKA 3ZM9A 3MFRA 4B9DA 4I6HA 4O0VA 4QQJA 1ZYCA 1AQ1A 4AOIA 3QX4A 4PDSA 3DAKA 2X8EA 1UU7A 2NRUA 4KIKA 1OITA 3UOJA 4X3FC 1JKTA 5HNIX 1K2PA 3LM5A 4ONAA 4QT1A 2XH5A 2A19B 4F7JA 4LM5A 2VWYA 5JMSA 3GQIA 3Q52A 4NEUA 3NUNA 2PVNA 2RIOA 4R7IA 4WG4A 4FKOA 1Q5KA 4FR4A 4H3PA 4A7CA 5L6WL 2Y4PA 5EI8A 2PZRA 3TUBA 2ITZA 5HVJA 2AUHA 1Q8WA 3R01A 4FYNA 5AUUA 3U6JA 2XIZA 4MCVA 2C0TA 2F57A 4JBQA 1U4DA 5EM7A 5KZIA 5CZHA 3NCGA 4GH2A 3ZUTA 4J98A 4XJ0A 1YHWA 4D55A 4QTCA 4F63A 3QQLA 2YISA 5K9IA 3WF9A 1XH5A 4LGGA 3LFCA 2VAGA 4QTAA 4RIOA 2R3MA 3QWKA 5HNGA 3FHRA 1FGIA 3ZFMA 4ERKA 2VU3A 1J1BA 3DAJA 3FLQA 3I7BA 4RPVA 4EZ3A 5M57A 5A14A 3U55A 4FSYA 2W1FA 4NUSA 1JPAA 2P4IA 4PNKA 5HO7A 3BRBA 3FPMA 3U9NA 3GFWA 4KWPA 5CASA 2RKUA 3TM0A 2XBJA 2VWUA 2PL0A 3RAKA 2BZHB 1W8CA 3F9NA 5AIKA 1JSTA 3PLSA 4GIHA 2Y0AA 3BE2A 4FSUA 4XG8A 5BYYA 5DGZA 5AP4A 3I60A 2QOOA 4QP9A 2Y6MA 2R3HA 4ZZOA 3WE4A 4CVAA 3S0OA 5GJFA 4LV8A 5CAPA 2J0LA 4YU2A 4G2FA 2IWIA 5FDXA 4K18A 3ZFXA 4MQ2A 5AX3A 4BCPA 4EK3A 3PY3A 5HE0A 5BVEA 2CMWA 2FB8A 3CGFA 5FTGA 4PTGA 4ZY5A 4NU1A 4LL5A 2QKWB 4EL9A 4O7WA 3GP0A 2VTHA 2XS0A 3OEZA 3PRFA 4O38A 4UEUA 1JLUE 5C03A 1BYGA 2NP8A 4QYGA 2X1NA 3KL8A 5ANIA 3R7YA 4R1YA 4Y72A 3ZSHA 4BN1A 4NYEA 2X81A 3U87A 3HZTA 5G1XA 4DT9A 5EKNA 2J0MB 3PG1A 2UVZA 3GT8A 2VWBA 4G17A 5F95A 5HIDA 3FI4A 2XIKA 3UIXA 4IB1A 4GYIA 2UVXA 2QOLA 5FBNC 5M09A 1FMOE 1BI8A 3WIGA 4J52A 3G0FA 3CTJA 4L7FA 3F5XA 1ZLTA 4BCIA 4C02A 3V8SA 1U5RA 4LFIA 4CFNA 5CSHA 2C47A 4G3DA 1FPUA 2PVRA 3M1SA 2CGUA 3WZUA 2BDWA 2HW6A 5IKWA 4D1XA 4BCJA 4BTJA 3LFEA 4IAKA 4O96A 2WMTA 3CPBA 2DWBA 4L8MA 4XEYA 3WBLA 4EZ7A 2IW8A 4ZMFA 4QMUA 3HMMA 4GYGA 4PMSA 4TNBA 4YLLA 3VVHA 3UQCA 2WGJA 1KE5A 5J8IA 2VX1A 3RAHA 4N6ZA 1CKIA 4WNKA 2ZYBA 4UYAA 3W8QA 2Y4IB 3HMNA 3CD3A 3E92A 4IIRA 4F08A 5BUIA 3VHKA 4XOYA 1CSNA 1WVYA 3VUKA 2V22A 4HGSA 4ALWA 4ARKA 4EOQA 4YO6A 4D4RA 3PIYA 3QD2B 2WD1A 4DFXE 1GOLA 1BI7A 1OGUA 5KE0A 3V5PA 5BVFA 4QNYA 4O6LA 5CT7A 2PULA 4A06A 2ITVA 4NKSA 3VUHA 4WIHA 4EEVA 5FEQA 3QCSA 4FTUA 3EB0A 3OXIA 5K4JA 3FI2A 3HX4A 5HCYA 4G9CA 2WTVA 2YWVA 3Q3BA 4H3BA 5LARA 5LCJA 4OGRA 3B2TA 3F2RA 2HXQA 2PU8A 4BF2A 3PIZA 4D2RA 4DFYA 4QD6A 3HAMA 3IO7A 2HZ4A 4FF8A 4TT7A 5DEWA 4IH8A 1JQHA 3QRJA 2PVFA 2C5YA 2YIWA 1O9UA 4Q2AA 4O84A 2C0IA 2C5NA 2PSQA 1M7NA 3OXTA 5EHLA 3VBQA 5HLWA 3D7TB 2OU7A 3BPRA 2IO6A 5FWKK 2OIQA 3FMKA 4OR5A 2EUFB 2ONLC 5CQUA 5GZAA 5J7BA 1XH4A 5KMOA 2VX0A 2GS7A 3NW7A 3PWYA 2PZIA 3DLZA 4QP7A 4CTBA 4X6QC 5FRIA 3RCJA 2BALA 4KIKB 2C5OA 2WPAA 3E5AA 2QLQA 4E93A 4EI4A 4OLIA 1PRYA 1ZRZA 2QG5A 3QCYA 4IZYA 4BDCA 3FEGA 2P3GX 5CTPA 3FZRA 4USEA 4FV0A 4FT9A 3A7JA 4AZSA 4CFXA 2C6DA 4X3FA 4MNEA 4S33A 1E1XA 3R8ZA 1IRKA 4R3CA 4AGUA 4RZVA 3V5QA 5FTQA 2A4LA 5D1JA 4IACA 5LXMA 2UW5A 3UIUA 5L2SA 3BHHA 3AQVA 3SQQA 4F1OA 4ZOGA 3DXNA 3IKAA 3GGFA 2J0KA 2BIYA 4QQ5A 4AWIA 5KX8A 5AP5A 3EH9A 3RWQA 4U3YA 2BKKA 4TN6A 1W0XC 2RG5A 2YABA 5DG5A 1OL7A 2H8HA 5DR6A 3OZ6A 5KBQA 5H8EA 4AF3A 3ZONA 3COKA 4RFYA 4AGDA 4U0IA 5CF5A 4YGAA 5BUJA 3L8VA 2R7BA 4JT3A 2UZBA 2C4GA 4IADA 4IWDA 1R78A 3PPJA 4YZCA 5JK3A 4IEBA 4HW7A 2BVAA 4QMLA 4QP8A 4N57A 5ETIA 5HX8A 4DGGA 4F70A 3PJ2A 4D4SA 3PXZA 3PDTA 1V0OA 1H1RA 2GHGA 2QR7A 3FJQE 5HNBA 3OWJA 3TCPA 3KF4A 3POZA 4QNAA 3TV6A 3IECA 1W7HA 4AG8A 3DKCA 2QONA 4F1TA 5BUEA 2W5BA 1W84A 4DFZE 2W1DA 5HORA 1V0PA 3P5KA 3W2PA 1YXUA 4FT0A 4EK6A 3KA0A 4EH8A 4MXAA 3MY5A 3Q04A 2V7OA 4DEBA 1EH4A 2YERA 3H10A 5AP1A 4O7TA 3C4WA 4R1VA 3C4FA 5F9EA 3QXPA 3ZM4A 4RC3A 3DJ5A 2JITA 3DNDA 3RNIA 3SG8A 3BQRA 4C7TA 4EHVA 1J7UA 2GNHA 5ANJA 5AR5A 3RM7A 5IG1A 2RFSA 4AXAA 3W18A 3AC1A 3D5VA 4D9UA 3KRJA 5EOBA 4E4XA 2X8DA 1T46A 3O23A 4LRJA 4QTBA 1YXSA 3NNXA 4FKVA 4BTKA 2GQGA 2R3OA 4PL3A 2Q0NA 4OT5A 4QYYA 3MB6A 3R04A 2VO7A 5CEQA 2XRWA 3RPRA 3UMXA 2X2MA 3DCVA 4EZ5A 3PIXA 4TYHB 1KWPA 4FKGA 4GK4A 4C34A 4LMUA 4WUNA 3GOPA 4IDTA 1ZOEA 1XJDA 3WZEA 2C6IA 3QTWA 1P4OA 2JIVA 2WKMA 4GFGA 4RFZA 2F7XE 4BGQA 4K8AA 4D0XA 3U8WA 4EHGA 2ETRA 1JNKA 4DBXA 4QPAA 1R0PA 2X9FA 3II5A 3O0GA 3QYZA 1TQIA 1VEBA 4R8QA 5CXHA 3COIA 3DNEA 1LP4A 3TIYA 3RAWA 4EUUA 4FKJA 4IX4A 4JG7A 2ITNA 3QC9A 4B7TA 3VF9A 4C2WA 2W4JA 4ZXTA 2JC6A 2JBPA 3QUPA 4FVQA 4IHPA 4S31A 5IUGA 5IQEA 3FBVA 3FUPA 3E7VA 4UV0A 1NVRA 5JKGA 5AJQA 2B1PA 2R3RA 2XA4A 4A4OA 5LCKA 4FT3A 2YLFA 3R8VA 3DT1A 4D2PA 2W9ZB 5HG8A 5H3QA 1YVJA 1FVRA 2R5TA 2X7FA 2IVVA 3PVBA 4L01A 5H9BA 3RMFA 5CVHA 3GBZA 4L3JA 3F7WA 3ELJA 2C3KA 4CLIA 4D28A 3AT3A 4WBOA 3S1HA 3OEFX 4V04A 1K9AA 2ERKA 2QHMA 1XH7A 3OWPA 4QMYA 3W8LA 3AG9A 5L8LA 2Q83A 4PY1A 2WXVA 3DFAA 3FQEA 5AM7A 2IPXA 5KCVA 1O6YA 4U9AA 4RVTA 4BHNA 4UYNA 4K11A 1G8SA 4RIWA 4BCMA 5J5TA 4RWKA 4AOTA 3CE3A 4K0YA 1SVHA 2J4ZA 3A99A 3PA3A 3QQUA 4FTLA 1NVQA 3NPCA 4P5QA 3K3IA 3UJGA 3TL8A 4KIPA 3V5LA 4F4PA 2G01A 4RJ4A 3QRUA 4G3CA 3V6RA 5K5NA 3OMVA 2ERZE 3UNJA 3HNGA 2VTPA 1L8TA 2HXLA 3C5UA 5AUXA 2HZIA 2ZM1A 3GNIB 3LM0A 3NDMA 3QUDA 5FBOA 3MVHA 3N9XA 3H4JA 4HYUA 2C1AA 5E90A 4AZVA 2CGXA 4GU6A 4X3FB 1WBSA 3EMGA 4MNEB 4MTAA 4EYJA 3Q4CA 3LCTA 4UN0C 3Q9WA 3QQFA 4XCUA 4B0GA 5IA0A 5DYJA 4EJNA 4CKRA 4GCJA 4NW6A 5G6VA 2BRGA 3CPCA 4D2WA 5AEPA 2ZMCA 3DS6A 3HECA 3MSSA 1YI4A 3DZOA 1NW1A 2W1CA 4EOKA 5A4CA 3G2FA 5CLPA 3MPMA 3N51A 3LXKA 4BGGA 3KMUA 4BZDA 1ATPE 1QPDA 1M52A 4I21A 1STCE 1OM1A 3R9OA 5E8VA 3A7GA 4I5PA 2XKDA 2NRYA 4IW0A 5M4UA 5L2QA 5FDPA 2J5FA 4A9TA 2GS6A 2VO3A 3R9RA 4EH6A 5I9YA 2XF0A 2HK5A 4D5HA 2WTWA 4TYIA 3ZFYA 1WBTA 5D7VA 2W96B 3NNVA 4DC2A 5DLSA 4CNHA 3FI3A 3PSBA 4RIYB 3MFTA 5ETAA 4ZJIA 5A4EA 5IA1A 3C7QA 4FGRA 2XNGA 4FBXA 4HNIA 4QMQA 4EK5A 2J51A 3G9LX 4MWIA 4PP9A 4C0TA 2B9FA 2BAQA 4Q9ZA 2HOGA 3NS9A 3ORNA 2YDIA 4BCQA 3SXSA 2IVSA 3BE9A 3E3PA 4ACDA 3MH0A 3SX9A 4BWXA 4IDVA 3C0HA 3VS4A 4FSZA 3ORKA 3E8DA 4AU8A 4EYMA 1BL7A 3HUCA 3SDJA 2QURA 3CIKA 4U8ZA 3HAVA 5CVGA 2V55A 2IVUA 4FTCA 4ZP5A 3ZOSA 4AN3A 3ANQA 4DH5A 4M0ZA 4UXQA 1O6KA 4USFA 4C3RA 4QP3A 3DPKA 4B8LA 4GJ3A 4NT4A 1PJKA 1WAKA 3UOKA 4F0IA 4GL9A 4BKZA 5IQIA 2RL5A 4L6QA 5FGKA 2CNUA 3I5NA 2H6DA 3TZMA 4UBAA 3HMOA 2AC3A 1W82A 4IE9A 4BCHA 4R7HA 2I0VA 2VTLA 3ANRA 2BMCA 5D12A 1YWNA 2XNNA 2KTYA 3QCQA 4PRJA 5DN3A 2HENA 1UU9A 3FKNA 4FIIA 3I4BA 3VJOA 3E8NA 3QTQA 2IW9A 4PMMA 3MWUA 3ATTA 2J2IB 4NIFA 2WTDA 5JZNA 1OKVA 3KXXA 4O7ZA 2XKFA 2UVYA 4LQMA 3DQWA 4K77A 3ORIA 4DH1A 3T8OA 4BTMA 2JKOA 3IK3A 4U81A 4ZZNA 3QHWA 4JR3A 3ET7A 1QPJA 4YMJA 4R3PA 4UMQA 3RZBA 2UW9A 5CI7A 4EOOA 5J5SA 4BCFA 3FMJA 4YTFA 3D83A 2OJJA 2EVAA 4M12A 4IJPA 5C9CA 1DI8A 4OTQA 4YO4A 2WO6A 4N0SA 2BZIB 5FD2A 1SYKA 2BRNA 3OCSA 4C58A 2OIBA 4I93A 2O2UA 4U44A 3T9IA 4B6LA 4CFFA 5C8NA 3NNUA 3AGMA 5A4LA 4HYHA 4A4LA 2JD5A 4EKLA 3VC4A 2ITPA 3UVQA 4BTFA 1UNLA 3QC4A 3WF6A 5I4NA 4AT4A 3F2NA 2Z60A 4DGLC 4DITA 4HVGA 3U6HA 3ZH8A 4FEXA 2X8IA 4ANLA 1Q4LA 4HNFA 3V8TA 2YEXA 4D2VA 3CD8A 1S9JA 4QYEA 4XS2A 5DBXA 3U54A 3R30A 3FYJX 2SRCA 3E88A 4JDIA 5IA4A 4GMYA 1UV5A 3RI1A 1IAJA 2WTJA 2WMWA 3R1NA 4MXCA 3MJ1A 4FOBA 1CKJA 2WIHA 3G6GA 4XP0A 5AR8A 2HELA 1P5EA 4UY9A 2QO9A 5JSMA 3E63A 4IZ5A 2H9VA 1H8FA 2CGVA 2XYNA 4MXYA 1IG1A 4ACMA 2W1EA 4AZEA 4IWPA 4CMTA 5CXZA 3KXNA 5L8JA 3JS2A 2PE2A 1MP8A 2XB7A 5HESA 3OTVA 5AUYA 4CMUA 4FNYA 5IMEA 4CTCA 5CSXA 4PTEA 3TUCA 4ZS4A 2BUJA 1LPUA 3FLZA 3OBGA 4KBKA 4X6RA 3UOHA 4CKJA 1GJOA 5KKRB 4NM5A 4ENXA 5HHWA 4E5BA 2UW7A 3TZ9A 2ITYA 3I6UA 2WQEA 5EHOA 4Y73A 3KVWA 4ACGA 2IZSA 4KRDA 5K0XA 3UZRA 3V51A 1OZ1A 4FG8A 3H0ZA 4OTPA 4F9BA 2WTKC 1YOMA 4CCUA 4J96A 4ENYA 4O86A 3DKOA 3KN5A 3LLAA 3Q53A 2C5XA 4CZTA 5T3QA 3ZZEA 1KE7A 2G2IA 2GNLA 1PXIA 3RZFA 1JKKA 3EQDA 4QMZA 1H08A 2BHEA 4KKHA 4FSNA 3F3TA 3AT2A 3QKLA 2FSTX 5C01A 1OKWA 3RCDA 5A4TA 4OT6A 2OKRA 3I5ZA 2PVHA 4I0RA 5AV2A 4DEAA 3S00A 4PPBA 1FBNA 4MBJA 3EN4A 4E1ZA 3F7ZA 2V0DA 3WZJA 3FSFA 3LKMA 3FZTA 5L6PA 2VTRA 2WHBA 4AGCA 3EKNA 4EWQA 1CKPA 4IQ6A 4XLVA 4HJOA 2VGOA 4X2GA 1YHVA 2QI8A 3ZBXA 1ZYJA 4FTQA 4EOJA 3OFMA 5CEKA 2JKQA 4L44A 4A9UA 4C4IA 5DMZA 5BMMA 3CKXA 1OUYA 2UW8A 2A27A 1IA8A 2WB8A 3P9JA 4IAAA 3D2IA 2C3IB 3V6SA 3MVLA 3OWLA 1DS5A 3P79A 4UWBA 4U7ZA 3S2PA 3PP0A 4IZAA 4BZNA 4FTTA 2WMRA 5DT0A 1FVTA 3PXYA 4YJQA 2GHMA 3FLYA 4XRJA 4I5CA 4UXLA 3SC1A 4E8AA 5AP3A 3VQHA 4BI0A 5M53A 1HCLA 5AWMA 4XUFA 5HCZA 5KMNA 3BLRA 4E3CA 4X2KA 3BYOA 4PMPA 2W17A 1UNGA 3PVGA 5IU2A 5JH6A 2WMUA 4JNWA 4KS7A 4AE6A 1PXOA 2E2BA 4WRSA 4J71A 5J7HA 4C57A 3AGLA 2OZAA 5A6OA 1GIJA 4U79A 4WNPA 5CU4A 4Y85A 5I9UA 4HPUE 2QOFA 2OLCA 1XBBA 3GENA 5DWRA 4NIFB 2WOTA 4UMTA 4BI2A 5E4HA 3R02A 2HY81 4GSBA 4JDJA 4EONA 5IEVA 3LCKA 5KMMA 3TV7A 3FL5A 4XHKB 3VULA 5IA3A 4TPTA 2BTSA 4I22A 2GNJA 3QYWA 1Q24A 1CDKA 4HCVA 2E9OA 3RBWA 4PV0A 4R5YA 3ZRMA 4QRCA 3D14A 5HD4A 5JFVA 2X7OA 3LJ1A 4GUBA 3REPA 2PPQA 3VW8A 1OMWA 3MJ2A 4G5JA 4FKTA 2PMOX 2BPMA 3MN3A 5T68A 3VHEA 5I9XA 4V0GA 4M7IA 1FQ1B 5LVPA 2QOIA 2VUWA 3CKWA 4GT3A 3W16A 4U3ZA 4NL0A 4TWPA 4DFNA 3C51A 3Q60A 4UMRA 2WTIA 5J79A 4F9WA 4OBPA 4F7NA 4X2FA 3CQUA 5DR2A 2X2LA 4XMOA 4JDKA 3UP2A 3ORZA 4Y5QA 2GPHA 4IC7A 3D15A 2W1HA 3C0IA 4QTDA 2YDJA 1Q3DA 5KZ0A 4YZBA 5LOHA 3TEIA 5M55A 5M4FA 3BZ3A 3GUBA 1VYZA 4QMTA 3ITZA 3CS9A 3FL4A 1Q8YA 3R00A 2ZOQA 3JVRA 1OPKA 5EM8A 3FHIA 3HV4A 2XK9A 4JAJA 5L4QA 3UMWA 3AT4A 2CKQA 1YOLA 2WOUA 4BCNA 3F66A 4IB3A 1B38A 1FMKA 4BDJA 3UO5A 5IA5A 4YPSA 1PKGA 1K3AA 1PMVA 4UWCA 4DG0E 1B39A 4JOAA 4YJTA 4HVDA 3NSZA 3KU2A 3V5TA 1OBGA 1GZKA 2YM3A 4C36A 3KMMA 4ZJVA 4UZHA 1WZYA 3R28A 3AC2A 3G51A 1ZY4A 4FA2A 4RGJA 4XV2A 3LFFA 3RINA 5C8KA 5HU3A 4RJ7A 4RWIA 3R83A 5GZ8A 3C5IA 5CEMA 4W9XA 3BBTB 3F61A 1ZOHA 3UODA 1VYWA 2XJ1A 4CZUA 1XBCA 3EJ1A 2VTIA 3BKBA 3QRIA 4D0WA 2GNFA 4ZSEA 4JBVA 1LUFA 3VS1A 2WQMA 4FL1A 4QTEA 2PUPA 3UIMA 4RQKA 3UBDA 3BX5A 3DTWA 4MH7A 4IX5A 2R0UA 2ZV2A 3U9CA 3Q4TA 2C6EA 3ZYAA 2UUEA 5CAUA 2VX3A 3L1SA 2IG7A 4S30A 2WEVA 3TT0A 3RALA 3UGCA 4U40A 1S9IA 4JQ8A 4D2SA 4U80A 1H24A 4FTIA 4DINA 3HGKA 3SRVB 3VUIA 4EBVA 3R8UA 3HKOA 3BYVA 3O17A 4R6VA 3ENMA 4RX8A 1NA7A 4RSSA 2HWOA 4FUYA 2JKMA 4MD7E 4CYJA 4DEHA 2A0CX 2I0EA 4FNZA 5AUVA 5CWZA 3IW7A 5ACBC 3H3CA 3RGFA 3E3BX 3A2CA 4II5A 3NVMB 5HG7A 3PVWA 4DGMA 2PE0A 1WCCA 4Y8DA 3DFCB 4ZJJA 3U6IA 2X2KA 3CP9A 4GEOA 4DHFA 5HQ0A 4YBKA 3OUNB 4MXOA 4PX6A 4AW0A 4YHJA 5C26A 4RWJA 4DEIA 1LR4A 4KSPA 2DQ7X 2VNWA 4I20A 4N4SA 4FG9A 3JXWA 2W5HA 3FMNA 3NAYA 1SZMA 3B8RA 5CSVA 4JI9A 5C1QB 1L3RE 3JPVA 3LFQA 4CT2A 3THBA 5EK7A 3MH2A 4BBMA 1Y57A 3LFDA 4HVSA 2GQRA 1XH8A 3PY0A 5FXSA 1W83A 4K2RA 4DEEA 4JQEA 4RFMA 3NUUA 4FIFA 1OIUA 2ESMA 4L43A 3UNZA 4WSQA 4O22A 1W98A 4HGLA 3ORPA 5EW8A 1OBDA 2XYUA 4EK4A 4EJ7A 2J50A 2JDTA 3GFEA 3TIZA 5J1VA 3W2OA 5CVFA 5C4LA 5E8SA 4E20A 3TDVA 3AD5A 3QXOA 5IQGA 4O27B 3L8XA 1ZMVA 4FVRA 4F9CA 3IS5A 2OZAB 4QQCA 1PXJA 4NZWB 2YHVA 3LFNA 5DFPA 3OY1A 4E5WA 3TNHA 4YZ9A 3QD3A 5CSWA 4ALUA 4A07A 2XIRA 3NZ0A 2X9EA 5CT0A 5L8KA 5HTBA 4FTJA 2F4JA 3QTZA 3R7VA 3GCPA 4FSWA 3QZHA 3KF7A 5IA2A 1GIHA 3TN8A 3QL8A 2VZ6A 3MV5A 2QO7A 4GIIA 5EOLA 4TW9A 4DH7A 4NFMA 3SOCA 4O7NA 2C3JA 4FE2A 4AQCA 2XEYA 4ZY6A 4WUAA 2G15A 1SNUA 3QQJA 5EYMA 5FM2A 2RFNA 2A1AB 3V3VA 4HCUA 2EXMA 3DBCA 4FG7A 4MD9E 3Q6WA 4V0GB 3HRBA 1U54A 3O2MA 5I3OA 4AN2A 4IWQA 3RPYA 2YCRA 4ZLZA 4PF4A 4GG5A 4FEQA 3WOWA 3DA6A 2R3GA 5DE2A 4F0FA 2BKZA 5HICA 3V5WA 4O2PA 4TTHB 3E64A 2B9JA 4S32A 5IEYA 4F99A 3ID6C 3KB7A 3GCVA 3PXRA 1OPLA 2PVMA 4FIHA 3PUPA 2XM8A 3ZS5A 3ZLSA 4L45A 4DH3A 3O51A 5GINE 4KKEA 1H27A 3DKGA 4M68A 1OIQA 3F5GA 4AA0A 2GU8A 1UNHA 1P2AA 1A9UA 4HCTA 4QPMA 4IC8A 1ND4A 4NTTA 3TI1A 2XJ2A 3ZC5A 3ENHA 4FKLA 2PZYA 3TG1A 4X21A 2UZUE 4C35A 3SLSA 1H0WA 4GVJA 4C59A 2OFUA 4Y95A 4OTHA 4BL1A 1OKYA 5LMBA 4IMYA 1IEPA 2F2UA 4Z16A 4J7BA 3BEAA 1SMHA 1M14A 2R3IA 2YIXA 1Q8TA 3I81A 4F7SA 3G90X 4H05A 4ANSA 2J6MA 2Y7JA 3FC2A 3FLWA 1J7IA 4YJOA 2RF9A 3EN7A 4E6AA 3CSVA 3MESA 1YOJA 2VWZA 4FSMA 2YFXA 4BCGA 4R77A 5DVRA 5AV3A 3NUXA 3QTUA 2PVYA 2UW4A 3DXQA 5EFQA 2YLEA 4FKQA 4QQTA 4O2ZA 2EXCX 2R3NA 2I0YA 3FQSA 3P23A 1JWHA 3QRKA 4PWNA 4RC4A 4XNEA 4ZTRA 2X0GA 4R7BA 4BDHA 5ANGA 3ZLYA 3LLTA 4IM2A 1Y91A 3F82A 5J95A 4E4NA 3F69A 3R0TA 3V8WA 4PL5A 3C50A 2OXDA 4ZSAA 5IZFA 2C68A 2DYLA 1QL6A 1OUKA 1YKRA 4OUCA 4YNOA 4NH1A 2IVTA 3AMAA 3Q5IA 4XBUA 2X4ZA 4RZWA 5EM6A 4J8MA 4DBNA 4BR3A 3BU6A 5B2LA 1DAYA 2QQ7A 4YC8A 4F64A 4JG6A 5CS6A 1ZMWA 3MY0A 3ZSIA 2GSFA 3FE3A 4BDDA 3HA8A 2JDVA 3EIDA 4YLJA 2WAJA 4MK0A 1ZYLA 5JGBA 4OTRA 3ZDUA 1OIRA 3BYUA 3CY3A 3GVUA 4C4FA 4CFUA 4F6SA 3EZVA 1OL6A 3AXWA 4RWLA 5H2UA 4C4EA 3KRWA 4FZDB 4W8EA 3KREA 4EQUA 2VTJA 3EFKA 5I9VA 3IQ7A 2ZMDA 4C4GA 3UO4A 4RJ8A 4UALA 1YI3A 4MD8E 4W4XA 3MGYA 2OWBA 4EKKA 3R7EA 3NW6A 2VN9A 4G3FA 5TOZA 5CX9A 4WT6A 4E6QA 2CLQA 2G9XA 1MRVA 2OGVA 2G2FA 2PHKA 3DBDA 4YC3A 5AX9A 4E6CA 2GFSA 3SKCA 3ROCA 3BELA 5HIEA 3D5XA 3LZBA 4O0WA 4MAOA 4ZIMA 5M56A 2QHNA 1BUHA 4L7SA 5HOAA 5ACKA 2VTMA 3R7UA 2YM6A 4YHTA 2W7XA 2CKEA 4IFCA 5HD7A 2XCHA 4TNDA 5A6NA 3P0MA 2CNVA 5BX0A 1OVEA 3O50A 2F2CB 3ATSA 3D2KA 1F5QA 2PY3A 5HO6A 5TT7A 5AP7A 4KIQA 3TDWA 1OKZA 3BGPA 4ZTNA 1AD5A 1H28A 4DF3A 3L8PA 4IWOA 1SVGA 2ZM3A 3WF5A 4IXPA 4MWHA 3ZXZA 4WD5A 2OXXA 2F49A 1XO2B 2OIDA 5FM3A 1Y8YA 3QTRA 4U43A 4DLJA 3BV3A 4P4CA 3ORLA 4RX7A 4QMOA 4RC2A 1IAHA 4PNIA 2ZB0A 4YLKA 4GVAA 4ERWA 4Z7GA 3FAAA 2XK4A 2XMYA 3BI6A 1YI6A 2B53A 4GJ2A 3GU5A 1REKA 4JR7A 4AZTA 4BY9E 2E9UA 4LGHA 4BWPA 5JRSA 5CALA 2O8YA 3F2AA 3U4UA 4AOJA 2GDOA 1J7LA 1XBAA 2B4SB 5BVKA 4JLCA 2JAMA 4TY1A 2R3KA 3NAXA 4EOLA 1PXLA 4YR8A 3GU8A 3QQKA 1BX6A 3D5WA 4FIEA 3FWQA 4AP7A 3ACKA 5LVMA 1WFCA 2CN8A 3QZGA 3GXLA 3GQLA 3R7IA 1OPJA 2JIIA 3KEXA 1M7QA 4JXFA 5JEBA 4I5MA 4I6FA 4I6QA 4IBMA 5IQCA 5HE1A 2ZM4A 1ZAOA 2CJMA 3KCFA 4C4JA 5GIOE 2Z7QA 2P2HA 5FUTA 1RDQE 3L9PA 5JFWA 1AGWA 1JKLA 4G3EA 4M13A 3DGKA 3UTOA 3ZO1A 3EZRA 2R4BA 2I1MA 4BFMA 1SM2A 2HIWA 2YWPA 1KE9A 5BQ0A 2BILB 3HMIA 2IN6A 1KOAA 5CF8A 2ONLA 3PTGA 4XG4A 4E26A 5EQPA 4G6LA 2QOKA 4CRSA 5JQ8A 2GQSA 2GCDA 4LV5A 4WBBB 5DT4A 4TYGA 3PSDA 3TKHA 3NX8A 2ETMA 5E92A 2OO8X 4MYGA 4M69A 2BRHA 4O82A 4BBFA 5K3YA 2W1GA 4FC0A 4H1MA 2W99B 5HLNA 1XHAA 3CJGA 4J95A 3TNPC 5L2TA 3CCNA 3JVSA 1XWSA 3PXFA 3BWFA 3OY3A 1UU8A 4XV3A 3TNWA 3DBEA 4C33A 1ZY5A 4XRLA 1A48A 4R78A 3PJ3A 3BCEA 3KXGA 4ZZMA 2XVDA 5CAVA 3RNYA 5JGDA 4IX3A 1PYEA 2WQBA 2Z7SA 3BYSA 4C61A 4PPCA 4YZNA 4RJ6A 4YPDA 5BVDA 4IVBA 3OVVA 3RK9A 2QOHA 4ASEA 3K5VA 3NR9A 1F3MC 2C0OA 3OBJA 4GW8A 5DOSA 4JG8A 3F88A 4YTCA 2W1IA 3QGYA 1LEWA 2PVKA 5DRDA 4HGTA 3POOA 4R3RA 4J53A 3BHUA 1KE6A 4ZTQA 5CU6A 4ZAUA 5IMXA 2XNEA 2QO2A 3LJ2A 5DR9A 1WBNA 4PDYA 5CSPA 3HP2A 2BRMA 1LEZA 3BHYA 4X2NA 4GK3A 1PXPA 1UWHA 3RK5A 3VWAA 4JVGA 3RTPA 5HZNA 2WFYA 4LL0A 5EKOA 3UNKA 3ZC6A 1UKHA 1PW2A 2FH9A 3KXMA 3KRRA 4XP3A 4MNFA 4WNOA 1RW8A 4DH8A 4EH9A 5H8BA 4ASXA 1FGKA 4FV2A 4NSTA 3K3JA 3MIAA 1WBOA 2O0UA 2DS1A 4CXAA 3FMHA 2PTKA 3E8CA 5HBEA 3LPBA 2UZNA 4O7SA 5L3AA 3NUAA 4WOVA 4HGEA 3GEQA 3VJNA 1URWA 2BAJA 4EOSA 3LW0A 3SOAA 3VQUA 5CU2A 5B0XA 2YAKA 4RG0A 3RWPA 3QKMA 3RHKA 4TWNA 3TKUA 4U45A 1V1KA 3QUEA 4ITJA 4UMUA 2B0QA 1PF8A 2R3QA 3FLSA 2Z7LA 3CQWA 3PJ1A 3TXOA 5LWMA 3FZSA 2VWVA 2AC5A 5CF4A 3RAIA 3MYGA 1H0VA 3PYYA 4JBOA 3L8SA 5E1EA 3KULA 5CU3A 3P4KA 3DQXA 3BHVA 3F3WA 2QKRA 3GC8A 3MY1A 5CAOA 4E73A 3ORXA 4FV9A 4AA5A 3EOCA 1CTPE 3QA0A 4U5JA 2XKCA 3COHA 4EOPA 1VJYA 3VS2A 1WVXA 4YHFA 5E8ZA 3ZHPC 2P55A 2IJMA 2UW0A 2WMQA 3Q9ZA 4F0GA 5L2WA 5LVOA 3ERKA 3FXXA 3KQ7A 4CKIA 4E7WA 1APME 2Y9QA 3K2LA 3P78A 2GHLA 4JS8A 4LGDA 2G2HA 5AR7A 1UWJA 4FKUA 1MQBA 4FIGA 2JIUA 4D9TA 4TKSA 4M67A 5A46A 2YM8A 4NJ3A 1Y6BA 4FTNA 5DA3A 5AAGA 2J7TA 5F20A 3ZRLA 1NXKA 4DFBA 3OOMA 3HYHA 5DNRA 5KMIA 4ANBA 5M44A 3V5JA 3FY0A 1SNXA 3Q96A 4IANA 4M3QA 4ZSGA 4KA3A 2YCQA 3FXZA 2VRXA 4I92A 4MBLA 3ZO4A 4YURA 3R9NA 1IR3A 1GAGA 4EH5A 3FPQA 4QPSA 4JIKA 3BU3A 3CY2A 3GU7A 4L68A 4BBEA 5AFVA 5E1SA 2ZV9A 4QP4A 2YIRA 4ZTSA 4GRBA 5DHJA 3M42A 3SXFA 3ZU7A 3WE8A 1KSWA 4RIWB 2BDFA 2OF2A 2HAKA 3A7IA 2A2AA 3EFJA 3D7ZA 3G5DA 5FTOA 3HP5A 3IW6A 4FTAA 4AGWA 5CEIA 3BU5A 2XIYA 1YDSE 2VWXA 4OTIA 3LQ5A 5EM5A 1Z57A 3TZ7A 4BICA 4TYEA 4QOXA 2VTQA 5C27A 1BKXA 4APCA 3MS9A 5BVNA 1KUTA 3KMWA 5CY3A 2LGCA 2CNQA 4N70A 4XG6A 4GKHA 3G9NA 3PPKA 5B2KA 3RHXA 4IVAA 4JQ7A 3ORMA 4YZMA 2XK3A 2CCHA 2X39A 2RGPA 2VTTA 2GTNA 5I9ZA 5DEYA 5FXRA 3VUTA 4FKSA 3AOXA 2WMBA 3BGQA 2O64A 3IDCA 3BIZA 4HVHA 2YA9A 4CFWA 2I7QA 4F09A 4O21A 5EW3A 3EQRA 5BVWA 2FVDA 3O7LB 3Q4UA 4EK8A 3MFSA 3QTSA 4HZSA 4O6EA 3LFSA 3QZIA 2HCKA 3CR0A 2UV2A 1PYXA 5BMSA 5HO8A 1ZWSA 2I6LA 2QCSA 2VTSA 2WU6A 4FV7A 3W55A 4BWKA 1MQ4A 3HVCA 2BZKB 2O5KA 4FKIA 4OTFA 4WO5A 1WMKA 3PSCA 4EQCA 2NPQA 4D4VA 4PDPA 4OW8A 1HCKA 3HDNA 2QODA 4GS6A 2R3FA 4H36A 3ZBFA 5IQDA 3O71A 1YWVA 3GB2A 2RG6A 3QU0A 4AW5A 3VS0A 2PUUA 4BDFA 4WHZA 2R3LA 3CXWA 4H39A 5KBRA 4ORKA 1R39A 1SVEA 4H3QA 3VAPA 4XG3A 4BRXA 3FSKA 4FTKA 1KV1A 4YC6A 5AR4A 5KMLA 5KUPA 3FI8A 4IJ9A 4I5HA 4GFMA 3ZRKA 3TNIA 5HU9A 4USDA 5EW9A 4IAZA 3SXRA 3WZDA 4IZ7A 4F65A 2F7EE 2EXEA 4RLLA 4EH3A 3KRLA 3OW3A 3GOKA 4LI5A 3R63A 4MQ1A 3H9OA 2YM5A 3Q6UA 3E8EA 3NUSA 2VWIA 4N6YA 2PE1A 3HRFA 4CMOA 3IOKA 4IAYA 3VN9A 3PP1A 2R7IA 1JOWB 4XH6A 2IZTA 5AMNA 3HRCA 3CGOA 3QF9A 1JBPE 3ZUVA 4C37A 2P33A 3KULB 1NT2A 1Q97A 5AM6A 2PVLA 2B55A 3R22A 3FKLA 4ACHA 4DE4A 4L00A 4P90A 3QHRA 4OAUC 3P86A 5GZ9A 3D94A 2PUNA 3LVPA 2C30A 3DJ7A 3FZOA 3BWJA 4XG7A 4BDAA 3DTCA 4RIXA 3LCSA 3QBNA 4IVCA 4ZMEA 4A4XA 3R2BA 4FICA 2PYWA 3OCTA 3Q9YA 3C4XA 3MH3A 5BPYA 1JAMA 5HE3A 3N4TA 3COMA 3F3ZA 2OZOA 4G6NA 4L3LA 3NYXA 5HVKA 5IH5A 2UZVA 4MHAA 5D41A 2PZ5A 3RP9A 3RPVA 3D4QA 5E8WA 3ZO2A 3NUPA 3SA0A 2J0IA 4ZTLA 4C3PA 4FVPA 1YWRA 4FV4A 3WF8A 4P5ZA 3IG7A 2ZDUA 4F1MA 4L42A 2YN8A 3GC7A 3O8TA 3EN9A 4F9AA 3UQFA 4F9YA 3KKVA 4L3PA 2J9MA 3MA6A 4Y46A 4CYIA 2YM7A 4D58A 5A9UA 3O96A 3ETAA 3MTLA 5AIRA 4RT7A 3DY7A 4EH4A 4YSMA 5M06A 3HV7A 1QMZA 1ZZLA 4NTSA 3R8MA 5JFXA 1BLXA 4AZFA 3PWDA 4MF0A 4ZY4A 4E6DA 4K1BA 4PTCA 1YXVA 1WBVA 4YJVA 3IDPA 4YJPA 5E8XA 4IVDA 2VV9A 3RKBA 5GHVA 3IGGA 3UYSA 3VO3A 4YBJA 3OW4A 4IX6A 2JAVA 1TQPA 1Y6AA 1BL6A 4WKQA 3OT8A 3R2YA 4BDEA 3VS6A 2OJFE 2G1TA 3PXQA 5CI6A 5HGIA 2OW3A 2UW3A 4BB4A 2FA2A 2OXYA 3IDBA 3IPHA 5FLFA 1NY3A 5EG3A 4CZYB 3EQBA 3R8LA 2WMXA 5HTCA 2E9VA 3RPSA 5H8GA 4G31A 4Q9SA 1IASA
chains in the Genus database with same CATH superfamily
3CEKA 3UZTA 3HA6A 4AFJA 1H1PA 3N4UA 3FQHA 4GG7A 4ZK5A 5M51A 5ICPA 4D1SA 4NM0A 5C4KA 4FL3A 4CGAA 4TXCA 1GZOA 2BIKB 4I0TA 3Q9XA 4OTWA 3TWJA 3DDPA 4DN5A 3VNTA 2GFCA 2ITQA 3MVMA 4XLIA 2X0QA 1P4FA 3OP5A 3OG7A 4NK9A 4AA4A 3DK3A 2Z8CA 4FRFA 4QMPA 1ERKA 2YAAA 2XNMA 4UB7A 5E91A 4AACA 3LFAA 5JT2A 3BEGA 2B9IA 3F3UA 2QD9A 2QNJA 3GCUA 4JMQA 5ANOA 2VO0A 5BV3A 2BROA 4U41A 4ANMA 2C3LA 4AW1A 3OHTA 4TRLA 1GZ8A 4CQGA 3VIDA 4IM3A 2HZNA 3NNWA 4FTOA 4CV9A 2OJ9A 2XK7A 2ITOA 4TWOA 4FK3A 3IONA 2FSOX 4TZRA 3A7HA 4C2VA 4KNBA 1PY5A 3DAEA 1YRPA 2CDZA 3G0EA 4IB0A 2CN5A 2QLUA 3NVKI 2W1ZA 4QMXA 3IW5A 2X7GA 5LJJA 3TJDA 4AT5A 2YIQA 1JSUA 4FSRA 2BZJA 4M0YA 3W2QA 3OCGA 3KY2A 4DTAA 3QGWA 4IFGA 2PUIA 1QPCA 2C6MA 4YUQA 5TF9A 4OBQA 1CMKE 4YJRA 5EI2A 4W4WA 4X3JA 3N4VA 3LQ3A 4KIOA 4RA4A 4DGOA 4GT4A 1KE8A 2WEIA 1PMEA 2XRUA 3F6XA 1W2DA 3H9RA 3PXKA 2E9NA 4BHZA 3FLNC 2XK8A 3PJ8A 2IZRA 1YW2A 1PHKA 2O65A 3AD6A 4PL4A 1UVRA 4DAWA 4C62A 5CEOA 3SHEA 1ZMUA 3EL8A 5AAEA 3IOPA 3GCQA 3I0QA 4KBAA 3LE6A 2Y8OA 5HLPA 2OBJA 4LDTA 1J91A 4DEDA 3DLSA 2UW6A 3OC1A 4YP8A 1F0QA 4EQMA 3R21A 3LXNA 3WYYA 2XKEA 3QRTA 4F6UA 1XMLA 3AMYA 2C1BA 4FV1A 4W8DA 1PMUA 2WQOA 4RIXB 4JIAA 5TO8A 3OOGA 3PLAE 4XOZA 3QD4A 3ZMMA 3DK7A 5E8TA 3ALNA 5ANKA 3VBYA 3D5UA 3OF0A 4TYHA 3LHJA 4EOIA 2P2IA 3LMGA 3EN6A 4LUDA 4R5SA 5IPJA 4HPTE 5I5ZA 4RMZA 5FEDA 5M08A 1A06A 3I0OA 3CJFA 2Z02A 5LVNA 2HW7A 4RQVA 5TE0A 3R1YA 4DEGA 2CGWA 4ACCA 3UVPA 2V62A 5E8YA 4KAOA 4PDOA 4JL9A 4BJJA 4C3FA 3T3UA 5KHWA 3K5UA 3MFUA 4O0UA 2O63A 4YTIA 2BAKA 4ANNA 1Q8UA 4I3ZA 3S3IA 5AUWA 2H34A 4DFLA 5L2IA 3A62A 3EQFA 4FEVA 3ZXTA 4LOOA 4FZFB 5HIBA 5FP5A 1YDTE 3BLQA 3PY1A 1TKIA 4X0MA 2GNGA 3NRMA 3ODZX 4W4VA 4GKIA 1WVWA 3I1AA 2CPKE 2O3PA 4O81A 2R2PA 2BRBA 3T9TA 4CV8A 4OTDA 1YHSA 1MRYA 3FMMA 4I94A 3NYOA 2UZTA 3PUFC 3PA4A 4AT3A 3DBFA 3IGOA 4K33A 3VF8A 2BHHA 2JKKA 3EKKA 3M2WA 3NUYA 5JFSA 4QMVA 4AAYA 4Q5EA 1RQQA 2J90A 3ULIA 3EYHA 3H0YA 5D7AA 5IISA 2OSCA 3E7OA 3C13A 5I3RA 4FYOA 1PKDA 3A8XA 3BV2A 5EYDA 5J1WA 2R3JA 4ZS0A 5DIAA 5CAQA 5DRBA 5KKRC 4DCEA 4JDHA 4I23A 4BGHA 5HBJA 1YXXA 3O8PA 2XUUA 2JFMA 5BVOA 4KKGA 4BCOA 2P0CA 4KB8A 4LYNA 3LMHA 3KGAA 4V01A 3GC9A 2BR1A 1R3CA 3JUHA 3DKFA 3OUKA 4D2TA 4FT5A 5EDRA 4EBWA 1R1WA 4HYIA 3NYNA 2YITA 3MIYA 1XQZA 5CU0A 4UMPA 5KO1A 4XG2A 3TZ8A 4LG4A 4M8TA 4FTRA 2WTCA 3HUBA 3R7GA 5EI6A 5I0BA 2QVSE 2ZDTA 4O7LA 1XH6A 2Z2WA 3PG3A 4I4FA 4RLKA 4TL0A 4WNMA 2RFEA 5GJGA 5GIPE 4FSQA 5EDPA 3L9NA 2JEDA 1I09A 5J9LA 2WTKB 2CLXA 1Y8GA 3R1QA 4JBPA 4P7EA 1DM2A 4U97A 3MTFA 3QA8A 3FZ1A 4FEUA 4FIJA 3UPXA 3BHTA 4KUJA 2VGPA 3OXZA 3FV8A 4M66A 5AAFA 2WIPA 1V0BA 1M2PA 1Q3WA 3UC4A 4BC6A 2WELA 3ZUUA 4BVUA 1Q99A 4RJ3A 3NMUF 4CSVA 3AD4A 5ETFA 3LXPA 2DUVA 5EH0A 4S34A 2ETKA 2V7AA 3HEGA 1H01A 3NCZA 3SAYA 3UG2A 2WQNA 4I4EA 5DPVA 3ALOA 4KBCA 3FDNA 2XJ0A 3MBLA 4RIYA 4FNWA 3LAUA 4BDKA 3RK7A 5ITAA 3ZLXA 4GFOA 1FVVA 3FY2A 5HTIA 1ZZ2A 3DB6A 4MBIA 3EL7A 4X2JA 4XX9A 4O0RA 3A8WA 3PJCA 5J87A 5D9HA 4ZSLA 5T6KA 4XYFA 3S95A 3KXZA 2H96A 3HL7A 5L6OA 2XAOA 3P08A 3QZFA 4NWMA 3KK9A 5AADA 4AXDA 4LOQA 3V01A 4NM7A 2WZJA 2J5EA 4HOKA 4O0SA 3KC3A 4BYIA 4EHEA 5IF1A 4NJDA 4A9SA 4ID7A 5EDQA 3HV6A 4QP6A 1ZOGA 3P7CA 1FINA 1MUOA 2QOQA 3H9FA 4FL2A 3JR1A 4XV1A 1XKKA 3QWJA 4O0TA 5F1ZA 3VUDA 1HOWA 4MX9A 2B7AA 5CF6A 4ITIA 4RVLA 3RJCA 4EC8A 4AS0A 4ASZA 3DZQA 4JX3A 2QOBA 3W2SA 2J0JA 1OL2A 4AX8A 2XIXA 2F7ZE 2VWWA 4L52A 5DT3A 4I24A 3ZSGA 3E87A 3OROA 2XP2A 5I9WA 3I7CA 3QFVA 4DLIA 4LMNA 5AP2A 1XMMA 1UU3A 4JRNA 4KRCA 2PMLX 2HY0A 4FV6A 3NEWA 4FUXA 3W33A 2W5AA 1DAWA 2CHLA 1QCFA 3WF7A 2I40A 1H07A 3G15A 4UX9A 2PK9A 3DB8A 3MB7A 3UZPA 3MVJA 3D0EA 4TYJA 3EQCA 3ZZWA 2ZAZA 4I6BA 5J9YA 1U54B 3C4ZA 4GK2A 5FG8A 4DG3E 2ZV8A 4FV5A 3TACA 5HCXA 3TKIA 4BCKA 1YQJA 2OJIA 4C4HA 4DCAA 1OL1A 5DH3A 5FP6A 3ZLWA 4RX5A 3BQCA 2Q0BA 1E9HA 3EQIA 3OS3A 4M97A 5JQ5A 4BJJB 2WMAA 3W10A 4EH2A 5EQYA 3BBWA 5LMKC 3PZEA 3C1XA 2W4OA 3QLGA 5AP6A 4G34A 5BYZA 4UZDA 4NFNA 4PPAA 4AW2A 2YJRA 4Y5HA 3KK8A 4CFVA 5JRQA 1G3NA 2UZEA 3U51A 4EOMA 4UWYA 5E8UA 5ANEA 4XV9A 5HI2A 3H30A 3WZKA 1GIIA 3EQHA 5HKMA 3PVUA 4J1RA 2X0OA 2JDSA 4DHZA 2OI4X 2JFLA 5D11A 3LCDA 3LFBA 3LOKA 5GJDA 4YSJA 4EORA 1G5SA 1KV2A 2FGIA 4DGNA 3DXPA 1MRUA 3VBTA 2CKOA 5AR2A 4FKRA 4J8NA 3LIJA 4FV8A 3MPAA 4O0YA 4EWHA 4CEGA 3Q4ZA 2PZPA 4EHZA 2W9FB 5HBHA 5F4NA 3C4CA 2EB3A 3R9HA 2FSMX 2VTNA 4OBOA 2CKPA 4MXXA 3P7AA 4G9RA 5AUZA 2GNIA 1ZYDA 3UOLA 1Q61A 1OI9A 3U4WA 3W32A 1BMKA 1B6CB 4HZRA 3EYGA 4ITHA 1M2RA 2BFYA 1YXTA 4ZTMA 3AC3A 4EUTA 5KMJA 2HZ0A 2PVJA 4L9IA 4WG5A 4D4YA 4F6WA 5K4IA 5IQAA 5CEPA 2VD5A 4O7RA 4AN9A 4IB5A 3FZPA 4AE9A 1RE8A 4BDIA 3A4PA 2XEZA 4NM3A 2ITXA 1P14A 1REJA 3CTHA 4O1PA 4CG8A 3PA5A 4PP7A 3GC0A 2BFXA 2PMNX 2QOCA 3UQGA 5E7RA 3NIEA 4FK6A 4BIBA 4KD1A 3WIKA 4JRVA 4CT1A 4GU9A 3PE2A 2R0IA 4MXZA 2BCJA 1VR2A 1PXKA 3NIZA 3QTXA 5AV0A 3VRYA 1UA2A 3NWWA 4KS8A 3AMBA 4HYSA 3C9WA 3VBWA 4EC9A 2XALA 1H26A 4BYJA 4S2ZA 5A3XA 2B52A 3BGZA 5HEZA 1DI9A 2I0HA 2C6TA 2R3PA 3OD6X 4GUEA 2QC6A 3NGAA 4WRGA 3EN5A 3MW1A 2BTRA 3OWKA 3W0RA 3LCOA 2EWAA 2E9PA 3WARA 4QMSA 4BIDA 3UIBA 5BNJA 1YDRE 5AUTA 3FC1X 3OCBA 5A54A 2LAVA 4DTBA 3NLBA 4FV3A 3F5PA 3EFWA 1OECA 4Z55A 4WSYA 4JAIA 4LUEA 1OIYA 4ZLYA 3CLYA 2CCIA 2FO0A 2ZVAA 3PRIA 1H1SA 3EWHA 3JY9A 2CSNA 5AR3A 3WI6A 4WA9A 1ZXEA 3EQGA 3RPOA 4DG2E 5J9ZA 2JDOA 1X8BA 3PZHA 4RVMA 2FUMA 3TNQB 3W2RA 5BYLA 1WBPA 3WYXA 4GT5A 4IAIA 3TV4A 4DYMA 3TMOA 5C8MA 3B8QA 4AFEA 3SV0A 4AUAA 2F9GA 1Z5MA 5B7VA 3Q2MA 4E4LA 4J97A 2OG8A 4RA5A 1IA9A 2XK6A 5KHXA 4P2KA 4QO9A 3EHAA 4FI1A 1GNGA 1M2QA 5CANA 5AV4A 2OH4A 4FT7A 1PXMA 1PXNA 2PMIA 2UZWE 3MH1A 3S4QA 4V05A 2IZUA 3BLHA 3LXLA 4FKWA 5LWNA 2YZAA 3JYAA 1KOBA 4CLJA 3DJ6A 2Z7RA 4RRVA 3HV5A 3CC6A 3QX2A 2YIYA 2X4FA 5HVYA 4QP1A 5F94A 5FEEA 4FZ6A 3HLLA 1JVPP 2C6KA 3ORTA 2Y4IC 3MA3A 2XANA 3HDMA 4E5AX 4CFMA 3QQHA 4YZDA 5LMAA 4H58A 4QMNA 4BDGA 4FX3A 3RM6A 3FMDA 5D10A 2GMXA 3TTJA 4BKJA 1H25A 3DBQA 2C69A 4FZ7A 5ETCA 3UVRA 2ITUA 4QP2A 4O7VA 3CQEA 3R7OA 4PQNA 4FOCA 3M11A 2OK1A 3SG9A 4NCTC 2YCSA 4D5KA 1T45A 2X6EA 4Q5HA 5EYKA 3L9MA 3W2CA 5CNOA 5IH6A 3GI3A 3WILA 2VNYA 3FYKX 5EYCA 3VS3A 2WU7A 5FQDC 3VUGA 3VUMA 4BZOA 2XNPA 3ACJA 4I0SA 3ROYA 3F3VA 4BKYA 3G6HA 3A60A 4LOPA 3TJCA 4IAFA 4Z7HA 4RX9A 3A61A 2QG7A 3MPTA 4QMWA 1H1QA 2W06A 4O1OA 2RFDA 4C8BA 3MDYA 2QU6A 3UG1A 3DOGA 2ITTA 4OAVB 3GU4A 1ZARA 2ACXA 4F78A 2YM4A 4G1WA 2C5VA 4YJNA 4K6ZA 4Y83A 4A9RA 3DK6A 1E1VA 1QPEA 2IW6A 4QMMA 2Y6OA 4ANOA 4B4LA 4O83A 4JX7A 2ITWA 2UZOA 4PUZA 3V04A 4PMTA 4ZEGA 3QD0A 4ZTHA 5M4CA 2XNBA 3SW4A 4OTGA 2OFVA 3E93A 3W1FA 1O6LA 5LMKA 5AA9A 3IW8A 3PFQA 3AC5A 2JGZA 4MEDA 4Z3VA 4M69B 2OJGA 2XBAA 5IQHA 2X6DA 5HX6A 3ZCLA 5FXQA 4KABA 4NKAA 4J99A 5EQEA 4KSQA 4L53A 4B99A 4M15A 3QKKA 3KFAA 2ZV7A 3UO6A 4EH7A 4HVIA 3LJ0A 4WG3A 2XM9A 4XP2A 3NW5A 4K9YA 4NW5A 4D1ZA 4O7YA 4L46A 3KN6A 1RJBA 3ZDIA 4FSTA 4FMQA 1U5QA 3IW4A 2HYYA 2OICA 4L67A 1NVSA 3R8PA 4CRLA 5IH4A 3K54A 4DA5A 4Z9LA 3VBVA 3KCKA 4LRMA 1OB3A 2QR8A 3AKKA 4QYFA 5ANDA 3BYMA 2V5QA 4W4YA 5IDNA 5TKDA 1TQMA 3UDBA 4CQEA 4X7QA 3SGCA 1TVOA 4FTMA 1WBWA 5B2MA 4RJ5A 1TZDA 1G8AA 3KRXA 2VTAA 3OTUA 3UP7A 3VS7A 3GCSA 4H1JA 3R9DA 4FEWA 1GY3A 2AYPA 2REIA 2JLDA 4I41A 4FNXA 3VBXA 1PMNA 4M14A 4AZWA 3EQPA 4O4CA 2ZB1A 3T3VA 5M4IA 3Q2JA 1UKIA 3SRVA 2R9SA 3R71A 4YJSA 5A4QA 2FYSA 2EB2A 5IDPA 3UPZA 4ANQA 5LVLA 3SW7A 4QYHA 4DDIA 4JJRA 2NNWB 3Q32A 4U42A 1URCA 3AC8A 2JBOA 3CBLA 3QTIA 5IUHA 3NYVA 4ZLOA 3ZTXA 1FOTA 3C0GA 5CZIA 4ASDA 3PPZA 2YCFA 1H00A 4DFUA 5TR6A 3E62A 3VS5A 3D9VA 5K0KA 5AA8A 1XH9A 3MI9A 2R64A 2YJSA 4MF1A 5IUIA 5IQBA 3RVGA 4B8MA 3EFLA 1Q41A 3GU6A 3QAME 3OT3A 4CG9A 4BDBA 4DT8A 2C6OA 5CNNA 5CQWA 2XZSA 4ALVA 3TUDA 3R73A 1I44A 2RSVA 3VRZA 4C38A 5JZJA 3DV3A 4FKPA 2C6LA 3FMEA 3FKOA 1Z9XA 5E9EA 1H4LA 3JY0A 4BI1A 4FODA 3AC4A 1Q8ZA 3LQ8A 4DTKA 3SD0A 1VZOA 3UYTA 3HMPA 2W05A 4G6OA 1M17A 5KMKA 2WNTA 3F5UA 1J3HA 3KXHA 4G16A 4YJUA 1R0EA 4U6RA 5JN2A 1GZNA 2OF4A 2NO3A 5HG9A 4CCBA 3ULZA 3G33A 4A9YA 4CD0A 3UC3A 3UDZA 5GNKA 2GTMA 1U59A 4M84A 2WMSA 4KINA 2W0JA 4O0XA 4XBRA 2BDJA 5IQFA 2A98A 3CTQA 5K5XA 1H1WA 3QCXA 5AV1A 3VW6A 4RBLA 3QQGA 3FMLA 3SVVA 3P7BA 2GS2A 5JGAA 2EU9A 3TTIA 4F7LA 3A4OX 2ZJWA 4G5PA 3P1AA 2HWPA 2QU5A 1Q62A 4O91A 3QALE 5KNJA 5AP0A 2JDRA 4FGBA 3DU8A 2KULA 5HE2A 3ODYX 1OL5A 3BL9A 2YDKA 5LQFA 4LRKA 3PE1A 2VO6A 5HG5A 3QLFA 3R1SA 2FSLX 2WMVA 1XR1A 3R6XA 4I1ZA 5EHYA 2XCKA 3B2WA 2PWLA 1JKSA 1ZYSA 3LMIA 3O7LD 4NCTA 3DDQA 5CYIA 4ZSJA 3UE4A 2OH0E 3KVXA 4FZAB 3FXWA 1JSVA 3I79A 4TWCA 4AAAA 2YZLA 2UZLA 2B9HA 2VTOA 3HV3A 2YACA 3A7FA 3I6WA 2UZDA 4G3GA 3ZO3A 1U46A 5IEXA 5DI1A 4GV1A 4MKCA 3O8UA 1J1CA 3L9LA 5M07A 4XG9A 4APPA 3D7TA 4MVFA 2B54A 2XNOA 4W9WA 4YTHA 2W4KA 5CENA 4E4MA 3Q5ZA 3C4EA 3ZEPA 3BLAA 4BIEA 1CM8A 4YNEA 3ZEWA 4IM0A 4RVKA 3NFFB 3ZM9A 3MFRA 4B9DA 4I6HA 4O0VA 4QQJA 1ZYCA 1AQ1A 4AOIA 3QX4A 4PDSA 3DAKA 2X8EA 1UU7A 2NRUA 4KIKA 1OITA 3UOJA 4X3FC 1JKTA 5HNIX 1K2PA 3LM5A 4ONAA 4QT1A 2XH5A 2A19B 4F7JA 4LM5A 2VWYA 5JMSA 3GQIA 3Q52A 4NEUA 3NUNA 2PVNA 2RIOA 4R7IA 4WG4A 4FKOA 1Q5KA 4FR4A 4H3PA 4A7CA 5L6WL 2Y4PA 5EI8A 2PZRA 3TUBA 2ITZA 5HVJA 2AUHA 1Q8WA 3R01A 4FYNA 5AUUA 3U6JA 2XIZA 4MCVA 2C0TA 2F57A 4JBQA 1U4DA 5EM7A 5KZIA 5CZHA 3NCGA 4GH2A 3ZUTA 4J98A 4XJ0A 1YHWA 4D55A 4QTCA 4F63A 3QQLA 2YISA 5K9IA 3WF9A 1XH5A 4LGGA 3LFCA 2VAGA 4QTAA 4RIOA 2R3MA 3QWKA 2IEWA 3FHRA 5HNGA 1FGIA 3ZFMA 4ERKA 2VU3A 1J1BA 3DAJA 3FLQA 3I7BA 4RPVA 4EZ3A 5M57A 5A14A 3U55A 4FSYA 2W1FA 4NUSA 1JPAA 2P4IA 4PNKA 5HO7A 3BRBA 3FPMA 3U9NA 3GFWA 4KWPA 5CASA 2RKUA 3TM0A 2XBJA 2VWUA 2PL0A 3RAKA 2BZHB 1W8CA 3F9NA 5AIKA 1JSTA 3PLSA 4GIHA 2Y0AA 3BE2A 4FSUA 4XG8A 5BYYA 5DGZA 5AP4A 3I60A 2QOOA 4QP9A 2Y6MA 2R3HA 4ZZOA 3WE4A 4CVAA 3S0OA 5GJFA 4LV8A 5CAPA 2J0LA 4YU2A 4G2FA 2IWIA 5FDXA 4K18A 3ZFXA 4MQ2A 5AX3A 4BCPA 4EK3A 3PY3A 5HE0A 5BVEA 2CMWA 2FB8A 3CGFA 5FTGA 4PTGA 4ZY5A 4NU1A 4LL5A 2QKWB 4EL9A 4O7WA 3GP0A 2VTHA 2XS0A 3OEZA 3PRFA 4O38A 4UEUA 1JLUE 5C03A 1BYGA 2NP8A 4QYGA 2X1NA 3KL8A 5ANIA 3R7YA 4R1YA 4Y72A 3ZSHA 4BN1A 4NYEA 2X81A 3U87A 3HZTA 5G1XA 4DT9A 3BL7A 5EKNA 2J0MB 3PG1A 4O4BB 2UVZA 3GT8A 2VWBA 4G17A 5F95A 5HIDA 3FI4A 2XIKA 3UIXA 4IB1A 4GYIA 2UVXA 2QOLA 5FBNC 5M09A 1FMOE 1BI8A 3WIGA 4DDGA 4J52A 3G0FA 3CTJA 3W0PA 4L7FA 3F5XA 1ZLTA 4BCIA 4C02A 3V8SA 1U5RA 4LFIA 4CFNA 5CSHA 2C47A 4G3DA 1FPUA 2PVRA 3M1SA 2CGUA 3WZUA 2BDWA 2HW6A 5IKWA 4D1XA 4BCJA 4BTJA 3LFEA 4IAKA 4O96A 2WMTA 3CPBA 2DWBA 4L8MA 4XEYA 3WBLA 4EZ7A 2IW8A 4ZMFA 4QMUA 3HMMA 4GYGA 4PMSA 4TNBA 4YLLA 3VVHA 3UQCA 4DHIB 2WGJA 1KE5A 5J8IA 2VX1A 3RAHA 4N6ZA 1CKIA 4WNKA 2ZYBA 4UYAA 3W8QA 2Y4IB 3HMNA 3CD3A 3E92A 4IIRA 4F08A 5BUIA 3VHKA 4XOYA 1CSNA 1WVYA 3VUKA 2V22A 4HGSA 4ALWA 4ARKA 4EOQA 4YO6A 4D4RA 3PIYA 3QD2B 2WD1A 4DFXE 1GOLA 1BI7A 1OGUA 5KE0A 3V5PA 5BVFA 4QNYA 4O6LA 5CT7A 2PULA 4A06A 2ITVA 4NKSA 3VUHA 4WIHA 4EEVA 5FEQA 3QCSA 4FTUA 3EB0A 3OXIA 5K4JA 3FI2A 3HX4A 5HCYA 4G9CA 2WTVA 2YWVA 3Q3BA 4H3BA 5LARA 5LCJA 4OGRA 3B2TA 3F2RA 2HXQA 2PU8A 4BF2A 3PIZA 4D2RA 4DFYA 4QD6A 3HAMA 3IO7A 2HZ4A 4FF8A 4TT7A 5DEWA 4O4EA 4IH8A 3UDTA 1JQHA 3QRJA 2PVFA 2C5YA 2YIWA 1O9UA 4Q2AA 4O84A 2C0IA 2C5NA 2PSQA 1M7NA 3OXTA 5EHLA 3VBQA 5HLWA 3D7TB 2OU7A 3BPRA 2IO6A 5FWKK 2OIQA 3FMKA 4OR5A 2EUFB 2ONLC 5CQUA 5GZAA 5J7BA 1XH4A 5KMOA 2VX0A 2GS7A 3NW7A 3PWYA 2PZIA 3DLZA 4QP7A 4CTBA 4X6QC 5FRIA 3RCJA 2BALA 4KIKB 2XARA 2C5OA 2WPAA 3E5AA 2QLQA 4E93A 4EI4A 4OLIA 1PRYA 1ZRZA 2QG5A 3QCYA 4IZYA 4BDCA 3FEGA 2P3GX 5CTPA 3FZRA 4USEA 4FV0A 4FT9A 3A7JA 4AZSA 4CFXA 2C6DA 4X3FA 4MNEA 4S33A 1E1XA 3R8ZA 2ZFYA 1IRKA 4R3CA 4AGUA 3TYKA 4RZVA 3V5QA 5FTQA 2A4LA 5D1JA 4IACA 5LXMA 2UW5A 3UIUA 5L2SA 3BHHA 3AQVA 3SQQA 4F1OA 4ZOGA 1ST0A 3DXNA 3IKAA 3GGFA 2J0KA 2BIYA 4QQ5A 4AWIA 5KX8A 5AP5A 3EH9A 3RWQA 4U3YA 2BKKA 4TN6A 1W0XC 2RG5A 2YABA 5DG5A 1OL7A 2H8HA 5DR6A 3OZ6A 5KBQA 5H8EA 4AF3A 3ZONA 3COKA 4RFYA 4AGDA 4U0IA 5CF5A 4YGAA 5BUJA 3L8VA 2R7BA 4JT3A 2UZBA 2C4GA 4IADA 4IWDA 1R78A 3PPJA 4YZCA 5JK3A 4IEBA 4HW7A 2BVAA 4QMLA 4QP8A 4N57A 5ETIA 5HX8A 4DGGA 4F70A 3PJ2A 4D4SA 3PXZA 3PDTA 1V0OA 1H1RA 2GHGA 2QR7A 3FJQE 5HNBA 3OWJA 3TCPA 3KF4A 3POZA 4QNAA 3TV6A 3IECA 1W7HA 4AG8A 3DKCA 2QONA 4F1TA 5BUEA 2W5BA 1W84A 4DFZE 2W1DA 5HORA 1V0PA 3P5KA 3W2PA 1YXUA 4FT0A 4EK6A 3KA0A 4EH8A 4MXAA 3MY5A 3Q04A 2V7OA 4DEBA 3NFGB 1EH4A 2YERA 3H10A 5AP1A 4O7TA 3C4WA 4R1VA 3C4FA 5F9EA 3QXPA 3ZM4A 4RC3A 3DJ5A 2JITA 3DNDA 3RNIA 3SG8A 3BQRA 4C7TA 4EHVA 1J7UA 2GNHA 5ANJA 5AR5A 3RM7A 5IG1A 2RFSA 4AXAA 3W18A 3AC1A 3D5VA 4D9UA 3KRJA 5EOBA 4E4XA 2X8DA 1T46A 3O23A 4LRJA 4QTBA 1YXSA 3NNXA 4FKVA 4BTKA 2GQGA 2R3OA 4PL3A 2Q0NA 4OT5A 4QYYA 3MB6A 3R04A 2VO7A 5CEQA 2XRWA 3RPRA 3UMXA 2X2MA 3DCVA 4EZ5A 3PIXA 4TYHB 1KWPA 1W2CA 4FKGA 4GK4A 4C34A 4LMUA 4WUNA 3GOPA 4IDTA 1ZOEA 1XJDA 3WZEA 2C6IA 3QTWA 1P4OA 2JIVA 2WKMA 4GFGA 4RFZA 2F7XE 4BGQA 4K8AA 4D0XA 3U8WA 4EHGA 2ETRA 1JNKA 4DBXA 4QPAA 1R0PA 2X9FA 3II5A 3O0GA 3QYZA 1TQIA 1VEBA 4R8QA 5CXHA 3COIA 3DNEA 1LP4A 3TIYA 3RAWA 4EUUA 4FKJA 4IX4A 4JG7A 2ITNA 3QC9A 4B7TA 3VF9A 4C2WA 2W4JA 4ZXTA 2JC6A 2JBPA 3QUPA 4FVQA 4IHPA 4S31A 5IUGA 5IQEA 3FBVA 3FUPA 3E7VA 4UV0A 1NVRA 5JKGA 5AJQA 2B1PA 2R3RA 2XA4A 4A4OA 5LCKA 4FT3A 2YLFA 3R8VA 3DT1A 4D2PA 2W9ZB 5HG8A 5H3QA 3O5AA 1YVJA 1FVRA 2R5TA 4MUQA 3PFYA 2X7FA 2IVVA 3PVBA 4L01A 5H9BA 3RMFA 5CVHA 3GBZA 4L3JA 3F7WA 3ELJA 2C3KA 4CLIA 4D28A 3AT3A 4WBOA 3S1HA 3OEFX 4V04A 1K9AA 2ERKA 2QHMA 1XH7A 3OWPA 4QMYA 3W8LA 3AG9A 5L8LA 2Q83A 4PY1A 2WXVA 3DFAA 3FQEA 5AM7A 2IPXA 5KCVA 4QEBA 1O6YA 4U9AA 4RVTA 4BHNA 4UYNA 4K11A 1G8SA 4RIWA 4BCMA 5J5TA 4RWKA 4AOTA 3CE3A 4K0YA 1SVHA 2J4ZA 3A99A 3PA3A 3QQUA 4FTLA 1NVQA 3NPCA 4P5QA 3K3IA 3UJGA 3TL8A 4KIPA 3V5LA 4F4PA 2G01A 4RJ4A 3QRUA 4G3CA 3V6RA 5K5NA 3OMVA 2ERZE 3UNJA 3HNGA 2VTPA 1L8TA 2HXLA 3C5UA 5AUXA 2HZIA 2ZM1A 3GNIB 3LM0A 3NDMA 3QUDA