2OU7A

Structure of the catalytic domain of human polo-like kinase 1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
292
structure length
292
Chain Sequence
AKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKVLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PLK1
publication title Structure of the catalytic domain of human polo-like kinase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 292
sequence length 292
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ou7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ou7A01
2ITXA 4FSNA 4FTLA 4J71A 4LL0A 4D1ZA 1WBNA 5C1QB 3ZLXA 4LGGA 3CR0A 1YDSE 3BGQA 5L8KA 3EQCA 5EDQA 3BPRA 2VD5A 4PRJA 3FDNA 4YTIA 4TYEA 4CYJA 2OZAB 3DY7A 3IW7A 3L8PA 5B2KA 4O82A 2X8IA 2HZNA 4ZTLA 2YM5A 3UVRA 4J1RA 5L2SA 4I5CA 2A27A 5AP3A 4BTJA 4IZ5A 2VWUA 2PMOX 3V5PA 3EN5A 3P9JA 2GNGA 3P23A 4FZ6A 4ACHA 2HWPA 4X3JA 4UX9A 3DXQA 4C35A 4BGHA 1IG1A 5G6VA 4AX8A 3PJ3A 2HCKA 2B52A 4ZJVA 2BRMA 4CKIA 5LMKA 3OTUA 2W1HA 3P7CA 3QHWA 4H1MA 2WEIA 3KXMA 4L44A 3IDBA 4YO6A 3FKNA 5DGZA 3PA5A 5J79A 1Q8UA 4FSUA 4K2RA 2OI4X 3HMPA 1ZOHA 1DM2A 5CALA 2ETMA 2UV2A 3N4UA 4YJTA 3BYUA 3A7FA 3GXLA 4GEOA 4F99A 3D5VA 3HAVA 3VBXA 5JZJA 4LL5A 4AGWA 4UZDA 3B8RA 4D5HA 3DNDA 1H4LA 4QP4A 4ZMEA 2RFEA 3DB6A 4OW8A 2HY81 5KNJA 3UIXA 5F95A 4BF2A 3ZONA 1IAHA 3THBA 5EQYA 4I0SA 3DA6A 2GCDA 3FPMA 3RM7A 4C61A 3PXYA 4HVDA 3LXKA 4R78A 5KO1A 5CNOA 2BROA 3KULA 1OUKA 4EBVA 2V22A 3ZTXA 3W2PA 5ITAA 1SZMA 2WIHA 3TIZA 2XCKA 3NUUA 3RHXA 1KE7A 3G9LX 3R30A 4DE4A 5LVLA 3HP2A 3QLGA 5AAEA 2P4IA 3NYNA 1OUYA 4GCJA 4JNWA 5CNNA 3D0EA 3W16A 4PWNA 3BWFA 4NU1A 4NSTA 1PJKA 3SOCA 2PVKA 3H10A 1J91A 3PWDA 4LV5A 4XMOA 4ZOGA 2B53A 4DFXE 3LQ5A 3S3IA 5CAOA 1E1XA 5A14A 3ALNA 3FLQA 3GU5A 4AFEA 3EN7A 4YJOA 5C01A 4K0YA 2F2UA 4MXZA 3GCPA 3Q9YA 4IZ7A 5HIEA 3QGYA 2PVYA 4IZYA 2X9EA 2UVXA 2UZOA 3QYWA 3SRVB 4BBEA 2R3IA 3D7TA 5I3OA 2EB3A 3RGFA 5CEPA 2W1DA 2R3KA 3TTJA 3QKMA 3UP2A 3D9VA 2JDOA 5AP1A 2CGWA 4DGGA 4JX3A 2BFYA 3VRYA 1WVXA 2BZIB 2WFYA 4FV4A 3TZ9A 4F1MA 3F9NA 1O6KA 4NJDA 4RPVA 2E9OA 3GI3A 2B9IA 3R1NA 4M66A 3OHTA 4M67A 4YTCA 5BVDA 4MXYA 4EJNA 2PVJA 3EQRA 4GK4A 4OBPA 2HENA 3U9CA 3EOCA 3BIZA 5BMSA 4RJ5A 1CM8A 4ALUA 5AR3A 3PLAE 4V04A 3OY3A 1B38A 4Q9ZA 4CZTA 3FY2A 2XKFA 3W32A 2ZB1A 2J7TA 5LMBA 3IOKA 1XH7A 3MPTA 2A1AB 5HTCA 1RQQA 3HECA 4A7CA 4YHTA 4ZMFA 1XH9A 4I93A 4F9CA 3IK3A 3FI3A 2BCJA 2VWIA 3KXGA 4JX7A 4MBJA 5DOSA 3FL5A 4ACCA 3QCXA 3UGCA 2XM8A 5M4UA 4OTDA 2XRUA 5IPJA 4FKGA 4CMTA 3BQCA 4USFA 4RBLA 3KFAA 3RMFA 3R7OA 4BKYA 3Q4ZA 4W4WA 4FKIA 5HGIA 3CEKA 4A06A 4R3PA 3D7ZA 4IM2A 4F6WA 4HGEA 2FB8A 4MNEA 5IQBA 1S9IA 2VNYA 2WU7A 1ZY4A 1GZ8A 2C5YA 3DFAA 4BDGA 4R8QA 4DFLA 3HV7A 1M7NA 3RI1A 1GZOA 1L3RE 3FI4A 3IKAA 3LLTA 2J90A 4F0GA 1NXKA 4ZZNA 1VYWA 2DQ7X 1MP8A 5FBNC 4RWJA 3JVRA 3ZEWA 3F2RA 4DLIA 4F09A 4J98A 3OCSA 1A48A 4QP3A 4UYNA 4HNIA 3CQWA 4FGBA 4ANLA 3POOA 4FKOA 2VTSA 3O7LD 2ZDUA 4HCVA 4C34A 2C3LA 1OL2A 3ORPA 3MESA 4YZMA 3KULB 4GYGA 3ZS5A 1PXOA 3CY2A 2JDRA 4O7VA 2V5QA 2V7AA 1IASA 3PVGA 3R1QA 3R0TA 3DNEA 5CEOA 4LMUA 3BZ3A 4BDKA 4WNKA 3U4UA 4PL4A 3FMMA 3LOKA 4ONAA 2YJSA 5ETIA 2DWBA 1Q97A 4HZRA 4BI2A 2ZAZA 3QWJA 1QMZA 1QPJA 1UNLA 3EN4A 2VAGA 4DN5A 1ZMWA 4M97A 3BHUA 2QODA 4BWPA 3ROCA 5JZNA 3K54A 2GFSA 3IW5A 3MFSA 3S4QA 3ATTA 3RZBA 4FE2A 2X7GA 3HUBA 4DCEA 3Q2MA 1Q3WA 5FXQA 3F69A 3PXQA 4U97A 3BU3A 5M4CA 1H0VA 4TT7A 5E8WA 5BVEA 4J52A 4BDHA 4IWPA 4F9WA 3O96A 3CTQA 4TZRA 1KOAA 1YDTE 2E9UA 4KABA 4WSYA 4B8MA 2QOFA 5DR6A 3KRLA 4EQUA 4AOIA 3ENHA 4JI9A 4AN3A 2ZMDA 5K9IA 4A9RA 2WGJA 4CG8A 4BGGA 4L6QA 3P78A 1GIHA 3R7GA 1YXXA 2G01A 3O8UA 3CPBA 3E8DA 4RIYA 2XS0A 3KN6A 4UMTA 4BVUA 2EXEA 1ZZLA 2J2IB 3QBNA 3WILA 5EDPA 1U5QA 3EFWA 2ITTA 5JFXA 5CSVA 3CTJA 4S30A 4WG3A 3WZDA 4YSMA 3VS5A 3WF7A 3C5IA 4NTSA 5HLPA 2VRXA 3CCNA 2OGVA 4O38A 5E92A 3Q4CA 4EI4A 5D9HA 3BE9A 5FTOA 2VO0A 2I6LA 3AGLA 3O8TA 2BUJA 2J9MA 3COHA 3AXWA 3OZ6A 4FV5A 4GUBA 4U80A 4WA9A 4CKRA 4O7ZA 3PTGA 4EH6A 4FKSA 1R1WA 2CSNA 4IDVA 4H39A 5F4NA 3ZSGA 3MVJA 2Z7QA 5CXHA 3BHHA 1Y8GA 4NL0A 3TT0A 4YC6A 5CT0A 4OUCA 3ZRKA 1YI3A 5FTGA 3MS9A 3PP1A 5DG5A 1OVEA 3CJFA 4O27B 4QYEA 4V0GA 4C57A 1ATPE 3LQ3A 5IQDA 5M08A 2OXDA 2J5FA 4PNIA 4E6DA 2ZV2A 3QYZA 2XNEA 3ULZA 2OKRA 4KSQA 3CGOA 4FF8A 4W8EA 5M07A 2UVZA 4G9CA 4WG4A 3OC1A 5HLNA 1AD5A 2PHKA 5B0XA 1IA8A 4U7ZA 4RC2A 4HVHA 4CTCA 4HVSA 3TTIA 3KK9A 5M4FA 2PWLA 4GMYA 1W8CA 3CE3A 3TNQB 4JBQA 4O0WA 3OMVA 2W5AA 2W1ZA 3IQ7A 3NIEA 2QONA 2YM4A 4EONA 3TN8A 4KINA 5HG5A 3UQCA 2IW6A 4U9AA 4ZXTA 4FEUA 2XIZA 5CF5A 2Y7JA 4IMYA 5IMEA 3D5XA 4W9XA 4NM0A 1R3CA 4MD7E 4OTQA 4FKTA 3F7ZA 2PMIA 2P2HA 4ZIMA 5LMAA 2EWAA 2JDTA 4CGAA 2DUVA 4AGDA 1APME 2EXMA 3PZHA 3UO5A 1LP4A 4ITIA 4I4EA 4EHGA 1DI9A 1FINA 4QMZA 3GC7A 1OB3A 2VO6A 4JDIA 4BDFA 1MQ4A 2OU7A 2QKWB 1CDKA 3EN6A 4V01A 4DGNA 2W05A 3L9LA 4O86A 2WMVA 4FICA 4O6EA 3Q9XA 4C36A 5IDNA 5EM6A 1FOTA 5A6OA 4IX6A 4X21A 3ORLA 4L67A 3SD0A 2J4ZA 5IEXA 4YTHA 2PL0A 4I23A 4PP9A 4EWHA 2YDIA 4K18A 2X7FA 4QOXA 1P14A 2UZUE 2RF9A 2XNMA 3C51A 5E1SA 4ANQA 5AP2A 2GS7A 2LGCA 4RIYB 2YZAA 4BCMA 3F6XA 4HVGA 4FNWA 2FH9A 4D2WA 3OWKA 1SVEA 3PSDA 2XJ2A 1WBTA 3WF8A 3A7HA 3O51A 4FIFA 4MF1A 4XG2A 4ZSGA 1OMWA 1OPLA 3FMHA 3MIYA 2O63A 3P1AA 1BLXA 3QRUA 4D2SA 5DFPA 5KMLA 3DKCA 2OBJA 2YITA 3BYOA 5CQWA 5IMXA 4RX5A 5JKGA 2QCSA 4QPSA 2WMAA 3I6WA 4CG9A 1JBPE 4IX3A 3OEZA 2VO7A 1G8AA 1UVRA 3CGFA 4GT5A 4KIOA 3OOGA 4MD8E 3U6HA 2NPQA 3KCFA 3OWJA 2OIQA 3V01A 4DGLC 2QHMA 5HO6A 5EHLA 4AAAA 5F1ZA 4I1ZA 1XH6A 4BBFA 2VGPA 4FV0A 5JGBA 3G9NA 2EXCX 3FLWA 4IDTA 1AQ1A 3A7IA 4PMPA 3HKOA 2C4GA 3RCDA 4V05A 2C5OA 4V0GB 5FEEA 4C4HA 2YABA 4BYIA 3SHEA 3ZSIA 5CVHA 3WI6A 5CANA 2CGUA 3QF9A 3O8PA 3VF9A 4H58A 3FUPA 4K9YA 3REPA 1BUHA 3L9PA 1CSNA 3M1SA 4R7IA 1W7HA 5CXZA 2QOQA 3CY3A 3LFFA 5E91A 4MXAA 4EBWA 2HZIA 4HPTE 4CCBA 5H8BA 1OKVA 5EQPA 4AXAA 3E93A 2VTOA 4FKPA 4FSQA 4GRBA 1JSTA 5H2UA 4EK8A 4BY9E 2QD9A 4O7RA 3DOGA 3CXWA 5IH6A 4OTIA 3PY1A 4L43A 4R7HA 3SXRA 1W83A 2Z7SA 4IX5A 5A4LA 4FIEA 4Y85A 1HCKA 2BALA 1ZWSA 2QHNA 3OXZA 3LFSA 3R2BA 4FOCA 4CSVA 5HTIA 3N4VA 2VX0A 3UIUA 4IXPA 3D2IA 3WF9A 5L2TA 2LAVA 4E20A 3CQUA 1J7UA 4HYUA 2YACA 2QURA 4GK2A 4F70A 4ZJJA 3O50A 5IA0A 3KREA 5EM5A 5BYZA 1Q61A 3I7BA 3Q4UA 2W9FB 4O96A 3QKLA 5HVJA 3GEQA 3DJ6A 4ALVA 3QD3A 5A54A 4O2ZA 4DG0E 3QA8A 4F7NA 3LXNA 3QALE 5AP4A 4QMWA 2C47A 3DK6A 2AUHA 3R1SA 4JLCA 2GDOA 4K1BA 3NMUF 2P55A 3RAHA 3LMIA 1KE6A 4L68A 5FDXA 4QMMA 3M11A 1PXNA 2I0EA 2VWWA 4R7BA 1ZLTA 2JEDA 3R9HA 2QC6A 3PJ2A 2W1IA 3QD0A 4LQMA 4ZZOA 4HYHA 4S31A 4CV9A 5E8VA 3MB7A 3P86A 3UDBA 4TL0A 4YO4A 5HE2A 3WZKA 4U3ZA 2JKMA 4ZZMA 2JIUA 2UZDA 1OM1A 3KMMA 5M09A 3NX8A 2X81A 3LCDA 2OF4A 2QR7A 4GVJA 1NVQA 2IZTA 3HDMA 3E8EA 3SVVA 3Q4TA 2W1FA 5I5ZA 2BAJA 5IA1A 4P4CA 3EIDA 4XP3A 5K5NA 4GU9A 4JDJA 4HGSA 4XP2A 5J8IA 4OAUC 4UN0C 3UVPA 2CNUA 4FC0A 1JNKA 4QQJA 3UIMA 4DFBA 3AD6A 3NUAA 4YNEA 3UOKA 5BVKA 4R3RA 2P0CA 4BCOA 5L8LA 5TR6A 3R73A 3AC8A 4RVTA 3ALOA 5F20A 4XRLA 4O1PA 4ACGA 4D2TA 3AD4A 3QQKA 1TVOA 1XH8A 4JBPA 3SG8A 3OEFX 5HD4A 4APCA 2ONLA 3C4CA 3E64A 3LCSA 1PW2A 2WQBA 4TWNA 4ZAUA 4XG4A 2E9PA 2JFMA 5AP5A 3BEGA 2BDJA 4NTTA 5HCYA 4ACMA 2E9VA 2RFSA 3R9OA 1OITA 2ZV8A 1RDQE 3FZSA 3QZIA 5DT3A 3SC1A 2WMSA 2I0YA 4AOJA 3FQEA 2XK6A 4Y46A 4GIHA 4Y73A 2BKKA 5GZ8A 2VWBA 4U81A 2VGOA 4QMOA 4YBKA 2QG5A 3OG7A 3VHKA 3BGPA 4TXCA 4D9UA 2B1PA 3FMKA 2PVFA 4WNPA 1FMKA 3WARA 4C2VA 1PYXA 3G6GA 2FSTX 3G6HA 3OFMA 3OWLA 4FOBA 2WTKB 5CAUA 4EH9A 2FO0A 4BCNA 3PPJA 3UNJA 3F3WA 4IEBA 5GIOE 4TY1A 1SVGA 2P3GX 3UOLA 4BDJA 3R8ZA 4BCFA 4RC4A 3NZ0A 3CSVA 4H3PA 5DMZA 2GNHA 1H08A 1JWHA 2BDWA 3JPVA 4GT3A 4ERWA 2UW5A 3RAKA 4YJPA 5CX9A 5K4JA 1Y57A 4IM0A 3ZU7A 2CKOA 4FTRA 4X6RA 3VUKA 3H0YA 1WBSA 3I79A 3KF4A 4BTMA 4BICA 2Y8OA 3L8XA 2O65A 1PHKA 4JIAA 4F64A 4Z7GA 3UQFA 2ZM4A 4K8AA 4PL5A 4LOQA 4IQ6A 2PUNA 4G3DA 5IQCA 4J8MA 4ENYA 1XBBA 2X4ZA 3R04A 5AV1A 1UV5A 4ANNA 1H25A 3MV5A 4FVPA 5D12A 3F66A 5B2LA 5HBJA 1LPUA 2FSLX 4P90A 5FGKA 4X0MA 3KVXA 5J9LA 4FKVA 2WTKC 3V8WA 5DI1A 4D0WA 2ESMA 3GQIA 1ZXEA 4QT1A 4TYHA 5CU6A 3WIGA 2GS6A 5AUZA 1LEWA 3NYVA 3VIDA 4G9RA 3VVHA 5GIPE 4IB0A 5J5SA 4QMLA 4KKEA 4MWIA 1M2RA 4JT3A 4ARKA 2CNQA 4ASXA 1UWJA 2IVUA 3PXZA 4IAKA 4EL9A 3TNIA 2W5BA 3EQPA 5T6KA 3VHEA 4BHZA 3UJGA 3Q2JA 1JKSA 1ZOEA 1R39A 5A4CA 3R28A 2IZRA 1O6YA 2HIWA 2YERA 4CZYB 4NCTA 3PVWA 4E6QA 5L6PA 1FGIA 2XIYA 3WZJA 2REIA 3P5KA 1XBAA 4HNFA 1UWHA 5EH0A 1UU9A 1BL6A 3BV2A 5KHWA 5CQUA 3D15A 3AC3A 4F6SA 3PG3A 4UMQA 4LI5A 3HMOA 4NT4A 5DH3A 3II5A 5DT0A 5KZ0A 4UWBA 3UNKA 2DS1A 2X8EA 3U54A 3DU8A 4EHEA 4LRKA 2VTAA 1GNGA 3VBWA 2XVDA 4CFXA 2XK7A 5CI6A 5HHWA 4IE9A 4A4XA 4AG8A 3U8WA 3M42A 3OXTA 2XKDA 4GG5A 2C6EA 3TKUA 5K3YA 3VUDA 5J9ZA 1Q8TA 5JEBA 2E2BA 2WNTA 5AV2A 3TG1A 4CLJA 3PWYA 2Z8CA 4C4FA 3EB0A 3AMBA 4FL2A 4FZAB 3ZH8A 4XV3A 4FIHA 3IO7A 2OH4A 4RWIA 3NW6A 5C03A 3GP0A 4D4YA 4JR7A 4GT4A 3W55A 4L3LA 3EZVA 3HLLA 3NW7A 2PE1A 4C0TA 2W4OA 2O0UA 4FKLA 3R02A 4MXOA 2CGXA 3PJ1A 3SXSA 3HZTA 5HO8A 2ITOA 3BLRA 4TYJA 2PSQA 2JKQA 5CT7A 3ZRMA 4OT6A 3FXXA 3N9XA 4FYNA 1OIQA 2G15A 4FNXA 4FIIA 4UB7A 4C59A 1UA2A 3DBCA 3EL7A 2C6IA 1TQPA 2JIVA 3RWQA 4QMSA 4ZLYA 4PL3A 5ETCA 4R6VA 2VTRA 5IKWA 2PUIA 3BQRA 3C13A 3A2CA 4B8LA 3DAJA 2ZYBA 4E73A 1OPJA 4N6ZA 2OIDA 4F7JA 4G17A 3GU7A 5AMNA 3VW8A 2WELA 4EOLA 5ANOA 5KMNA 3T8OA 3UQGA 4D1XA 3PE1A 3I4BA 3A4OX 2F57A 4M0YA 1JSVA 4BCHA 2C6MA 3JUHA 2B54A 5BVOA 2X2KA 2R2PA 5HNIX 2UZEA 4KUJA 3FV8A 4KS7A 4U40A 5HKMA 4WOVA 1Q3DA 1FVRA 4RX8A 2P2IA 3RK7A 1XWSA 3QQUA 3WBLA 4RVKA 4PDYA 2WMQA 3Q5IA 3C5UA 1A9UA 4E26A 1BYGA 1LEZA 2J0IA 2QLQA 4IANA 3QFVA 3PXRA 3OBGA 4JR3A 4Z55A 3ACKA 3FHIA 3HA8A 4F7LA 2IO6A 2AC3A 4PUZA 3MFTA 3OTVA 5K0XA 3ZMMA 5E7RA 4QMXA 5KUPA 5AR8A 3ORZA 5BNJA 5HX8A 2GHMA 4O1OA 1HCLA 3DJ5A 5T68A 3IW4A 4WIHA 4Y5QA 5M06A 4EORA 4F63A 2CCHA 4CTBA 5FEDA 3V8SA 4GG7A 3WF6A 3TJCA 4EH7A 3TV6A 2UZNA 4AZFA 3MN3A 4PPAA 1JAMA 3E7OA 3ZSHA 3Q9ZA 4IFCA 1H1WA 4HJOA 2X9FA 4IX4A 3E3PA 3A4PA 5H9BA 4UMUA 3NDMA 5JK3A 3AD5A 3LE6A 4EUUA 1NW1A 5BVWA 2WMUA 2W9ZB 3R7VA 2FSMX 3GFEA 2XP2A 1ZYSA 4TYIA 5IA4A 1H07A 2ZDTA 3MFUA 5E8XA 4ZJIA 2I40A 3ANRA 4X2JA 4YZBA 1F5QA 2RG5A 4AGUA 3O23A 3GT8A 3LJ0A 5HEZA 3K3JA 3NUXA 3GCVA 2BHHA 5IA5A 2C5NA 1YWRA 2WTIA 3D4QA 4JBVA 3RTPA 2GQGA 2Q0NA 4DC2A 4FV9A 3A8XA 4I4FA 4C3FA 1G3NA 5DRBA 5ANDA 4L8MA 2RIOA 3V5WA 4D0XA 5I9UA 4A9SA 5EM7A 5HG8A 4AN9A 3FYKX 3S0OA 4ANOA 4FG7A 2G2HA 4A9TA 3TWJA 3VF8A 3UZPA 3MY1A 3VW6A 2I0HA 4RGJA 3OW3A 4TWOA 4X2FA 3OVVA 1AGWA 2R3PA 3UG2A 5KMMA 3ZCLA 2C5XA 4MAOA 5AR5A 3VBVA 4BB4A 4QO9A 3SAYA 5KHXA 2XKCA 3D94A 3DGKA 4IAZA 2Y6MA 3VBYA 5KCVA 1GZNA 3GOKA 2O3PA 4BR3A 5HESA 2BRBA 2X0GA 1WZYA 4OTGA 3DQXA 5JSMA 2XK9A 4XBRA 3NSZA 2G1TA 3O71A 2GFCA 1DAWA 4G5JA 3MPAA 3L1SA 1YHSA 2A2AA 3SXFA 4XV1A 1MRYA 4NYEA 1PF8A 2XEYA 5CF4A 3BRBA 5I4NA 5E8SA 2VTMA 2OJJA 4RG0A 3C9WA 4RQVA 2R64A 4C38A 2BIYA 2PYWA 4G3EA 3TNWA 4KIKA 2YLFA 1H00A 3LFAA 3S00A 4EOIA 4R3CA 4EKKA 3ZM9A 4L3JA 4DLJA 3PIZA 3P0MA 3PIYA 4FA2A 5J7BA 5FWKK 3GNIB 2QQ7A 4FTOA 1PY5A 3TV7A 3ENMA 4YR8A 3E8CA 2O2UA 3G90X 1YWNA 3SKCA 3CPCA 4UMRA 4NK9A 3MY5A 4WO5A 2PY3A 5L3AA 2ZM1A 3K5VA 4QNAA 4HCTA 4E4LA 5CU2A 3HX4A 4YMJA 5FP5A 2WIPA 5DPVA 4WNMA 4EOOA 4FEWA 4J7BA 5C9CA 4MX9A 4C33A 2PE0A 3AT3A 2VTNA 4TWPA 5HTBA 2QOOA 4UBAA 2R3OA 3IDPA 4EKLA 4O22A 1XBCA 2QR8A 2A19B 4O0XA 3EQGA 5HU3A 2CN8A 2ERZE 4UV0A 1KE9A 4NIFA 3R9NA 2NNWB 4RZWA 4DFYA 2WAJA 1V1KA 1FPUA 5EQEA 1OPKA 2R3MA 3MW1A 4FV7A 3NS9A 4PTCA 3GBZA 5B7VA 3FMLA 2JITA 4QMQA 3MWUA 2HXLA 2HW6A 4JRVA 5J7HA 3QRIA 5E8UA 4CD0A 4UYAA 2O8YA 3PZEA 3OP5A 2QOCA 4IADA 4IHPA 1K9AA 4LG4A 3DZQA 3CTHA 4D28A 3ZM4A 5J9YA 4L3PA 4WUAA 4C58A 2OICA 2BVAA 2WTWA 2JGZA 3DCVA 4C3PA 5LMKC 3KRRA 2G2IA 3AOXA 4HGLA 5KBQA 4U5JA 4L00A 2DYLA 3RWPA 3TNPC 5C4KA 3FE3A 3QL8A 4KRCA 5IQFA 4IZAA 3E5AA 5JT2A 1J1BA 4XH6A 1WAKA 4GU6A 2V7OA 3QZFA 5HE1A 5M56A 2CJMA 1BI7A 3IDCA 3F5UA 4JAJA 4QP8A 5DIAA 3RPYA 3UMWA 1UNGA 3NEWA 3OUNB 4BDBA 5HX6A 1EH4A 3R9RA 1H27A 2XZSA 3D7TB 4PDSA 2UW4A 4ZY6A 2ITQA 4HGTA 5ICPA 4GH2A 4Q2AA 5GJDA 2OJIA 1QPDA 2GSFA 4ZSJA 4BDEA 3JXWA 3MI9A 5DHJA 4ANBA 5KBRA 2UZWE 4X2NA 2HW7A 1B39A 2YCSA 3L8SA 4CKJA 3MSSA 5CVFA 2BIKB 5JQ5A 3LJ2A 4GSBA 2BPMA 5C8MA 3JVSA 3WYXA 4CT1A 3KY2A 4X3FA 4HW7A 4Q5HA 3RAWA 3CQEA 3UG1A 3RZFA 4UZHA 4B99A 4TN6A 4XV2A 3VJOA 3FMNA 5CWZA 3SOAA 5IQHA 2ZOQA 5HG7A 4QP9A 3R8MA 3ZDIA 5E8YA 1JPAA 2OFVA 4IWDA 2ETRA 5BUEA 5ACKA 5IQAA 1DAYA 3BLQA 3EL8A 3QZGA 4IM3A 4KBKA 5CENA 5J1VA 5E4HA 2XB7A 4RA4A 3FPQA 4AACA 3ET7A 2W1CA 1XQZA 1ZY5A 1BX6A 2W4KA 1F0QA 3IGOA 4M13A 4YNOA 4O7YA 1IAJA 5JQ8A 2JBOA 2PVMA 2RFNA 2XIXA 3DBDA 3EH9A 1Y8YA 4QYYA 3VS4A 4YZCA 3PA4A 3WYYA 4F7SA 1PXJA 3KA0A 4RA5A 5FBOA 3AMAA 3E8NA 4D1SA 1FVVA 4I6FA 3ZDUA 5AAGA 4ASEA 4RT7A 2VWVA 5FM3A 3ID6C 4FT0A 1URCA 3RPRA 4J8NA 4DCAA 3OCGA 3DLZA 3EQBA 4J53A 3CD8A 1PMUA 4MNEB 5ANKA 2VTPA 3FZPA 3QC4A 4FT3A 5AUXA 3TNHA 5JMSA 4C7TA 3LAUA 3LM0A 2OG8A 4KBAA 3S1HA 1CKPA 4TNDA 3Q53A 3U55A 3IONA 4FSTA 4PMTA 5ANGA 3ZO1A 5AA9A 1Y6BA 4KIQA 3MVHA 2BZJA 2QU6A 4NIFB 3WE4A 4DTKA 1BKXA 3W2SA 4E4XA 4F6UA 5BVNA 3RCJA 2C69A 4FGRA 2GU8A 4YJRA 4ZTNA 2BR1A 4XP0A 1DI8A 5EOLA 2Y4IB 1NA7A 3BWJA 4OLIA 1T45A 1RW8A 3D5UA 3MBLA 3WOWA 5E9EA 5EOBA 3DTWA 4ZP5A 3NCZA 4QTBA 3FQHA 3KK8A 3FXZA 4CFMA 4O0TA 2OXYA 3GU4A 4MNFA 3QRTA 3DS6A 3NVKI 3AT2A 2C1AA 5DVRA 3LCTA 3COIA 1GJOA 3U6IA 3TL8A 5CASA 5D11A 3MPMA 3QUEA 2F9GA 4O2PA 5AX3A 1R0EA 3EKNA 3F5GA 2XYNA 4DFZE 3L8VA 2HZ4A 1O6LA 3UOJA 3R6XA 5AP6A 2NP8A 5JN2A 3AG9A 4H3QA 2CGVA 2WQOA 3F2AA 3HRCA 3TKHA 3HNGA 4C4GA 4I6HA 3UPZA 3FI8A 1VR2A 3KU2A 3QUPA 4JS8A 4CFWA 2ACXA 2QO9A 3M2WA 5TF9A 4FIGA 4ZY4A 2IVTA 3TUCA 2PVNA 3OCBA 1QPCA 2WQNA 4AT5A 2VNWA 3RM6A 2YA9A 3MH2A 1J1CA 3E3BX 2P33A 4AE6A 2XM9A 4BDCA 3ULIA 2Y4IC 1TKIA 1UU7A 5DT4A 4IBMA 4BDDA 3LFDA 4DH7A 2X4FA 3SW4A 4QYHA 4MVFA 3UP7A 2C6LA 3R8VA 3UE4A 5GZAA 1OL7A 4FV1A 4JG7A 3T9TA 3ZO4A 4DEHA 1M2QA 3PSBA 4KWPA 2NRUA 5IDPA 2YIQA 3ZUTA 1UKIA 3FHRA 3W8LA 3ZUUA 4ZSEA 3LLAA 3DXNA 3QTUA 4YLLA 2F49A 4QMTA 4X3FB 1PYEA 3IPHA 4QYGA 4UWCA 3FEGA 3A62A 3MH0A 4DITA 2C3IB 3F88A 3BE2A 4EH3A 3ZEPA 3DLSA 3NNWA 4RFZA 4B7TA 1YOMA 3FL4A 4DEIA 4PTGA 5DBXA 4AZWA 4BIDA 1J7IA 3KMUA 4EHZA 3R1YA 5K4IA 5A46A 4DH1A 4I0TA 2I7QA 1PKGA 3KF7A 2V55A 5HE3A 1G8SA 2VWYA 1H24A 2PMLX 5M51A 1UU3A 4M69A 4RQKA 3SX9A 2C30A 3VUGA 4FIJA 4IVAA 5EK7A 1WVWA 3UBDA 3NAXA 4CMUA 2BAKA 2EVAA 3H9OA 4P5QA 3GB2A 4G1WA 5EI8A 4YUQA 3VQHA 3BBWA 4FG8A 3HEGA 1E9HA 4DTBA 3DKOA 2IG7A 2SRCA 4G3FA 4OAVB 2Z60A 3R00A 3FMDA 4DBNA 2GNIA 2UZLA 4JOAA 4X3FC 3HGKA 3H4JA 5I9YA 1U5RA 1WBVA 5HVYA 3U87A 4PY1A 3QTWA 3BU5A 4C37A 4UMPA 1REKA 1WBPA 3PY0A 3QTIA 2OJ9A 1UKHA 4QMPA 3NR9A 4WBBB 4FV2A 3NAYA 2VO3A 5HG9A 5EHYA 1ZYJA 3HV4A 4ZK5A 2UZVA 4QMNA 3MJ1A 3MB6A 3EN9A 1JSUA 2JKKA 3PE2A 3C4WA 3N51A 5ANEA 3TM0A 4GV1A 3MA6A 5I9ZA 5D10A 4TPTA 4AZVA 3EFLA 5FD2A 4IB5A 4G5PA 5DE2A 1PXPA 3COKA 2PMNX 2JDSA 4EOQA 2C68A 5LVNA 2YEXA 4AZTA 3BYVA 4LOPA 5EKNA 4GJ2A 4AW1A 5CEQA 2OLCA 3ORNA 4EZ3A 2VX1A 1OIRA 2BHEA 2RSVA 3KXXA 4FNYA 5C26A 5I9XA 3KEXA 3UTOA 2X1NA 4DT8A 3G2FA 2ITVA 3QHRA 3U4WA 4ZTHA 4YGAA 2IJMA 4GUEA 4JG8A 3LPBA 3HMIA 4RZVA 4LRMA 1R0PA 2RGPA 1M2PA 3DBFA 2EUFB 2AC5A 2FUMA 2Y0AA 5BMMA 4D4RA 3DXPA 4AZSA 4E4MA 1WMKA 5M55A 1OGUA 2Q83A 5TT7A 3OCTA 3CJGA 4D4SA 5FQDC 4RIXA 3EQIA 3V5LA 5EDRA 2PE2A 3ACJA 4WD5A 1OL1A 4M14A 3VQUA 4EQCA 1XR1A 1QL6A 4BTFA 5KX8A 4EC8A 1KE5A 4NW5A 3FZOA 2XBAA 5J95A 5GHVA 4XNEA 5HBHA 3CC6A 3I60A 4UWYA 3Q5ZA 3DPKA 4O91A 4RVMA 1Q4LA 2GHGA 4U41A 2BRHA 3TXOA 3VS1A 5AADA 1YRPA 4E3CA 3QXPA 4MTAA 1M14A 2W0JA 4N4SA 4WSQA 5EYCA 2WTCA 3T3UA 1OL6A 2XRWA 4S2ZA 5A4EA 3MFRA 4FL1A 3PDTA 1JLUE 2R3GA 5IUGA 4EH5A 3QLFA 5BPYA 5HVKA 5FTQA 1WFCA 3HV3A 4R1VA 2CLXA 3MTFA 4AA5A 5HQ0A 3SW7A 5CU4A 3VBTA 3WZEA 3ORTA 4NZWB 3Q60A 3TUBA 3LXLA 5AP0A 3PXKA 4YHFA 4AWIA 3HV5A 3I1AA 4CLIA 2FYSA 3DZOA 4QP7A 4IWQA 4L46A 4OTPA 1OIYA 4LMNA 4NFMA 2BTSA 5FXSA 3UO6A 3VUTA 2OWBA 4YJVA 5E90A 1MUOA 4KBCA 5J1WA 4B0GA 4PPCA 1OL5A 2WO6A 4CNHA 3MYGA 4EOMA 2IVVA 2XJ0A 4AW5A 2WMTA 4HOKA 2X6DA 3LJ1A 1H1RA 1WVYA 3W8QA 4H1JA 3DKFA 3QTXA 4JDKA 3PXFA 4QRCA 3ZFMA 5DEWA 4AT3A 1A06A 1YI6A 3OOMA 1FQ1B 5EI2A 2YM6A 2J0JA 4RRVA 3OW4A 4IJPA 4KB8A 5CI7A 4PF4A 4L53A 4JBOA 4G16A 1MRVA 1O9UA 2UW3A 4YU2A 1Q8YA 3TZ7A 5HNBA 3F3UA 4BDIA 3OS3A 2OIBA 3GFWA 3QAME 1JQHA 3ETAA 4F0IA 2GQSA 4ZEGA 3B2TA 4UALA 4YSJA 2A4LA 3E7VA 3HMMA 5AEPA 4IAYA 4W4VA 5HZNA 2H8HA 1RE8A 5T3QA 3F5PA 3GCUA 3EQDA 4ZTMA 2JAMA 4WRSA 5LXMA 1PMVA 5AIRA 5TOZA 5HE0A 2H9VA 3Q96A 2HK5A 1YKRA 3FWQA 4U6RA 5F94A 4DEAA 4PPBA 3HDNA 4NH1A 1Q24A 2GNJA 4NUSA 3DV3A 3ZC6A 2BTRA 4ZTQA 4YHJA 5G1XA 4DEGA 2FGIA 4UXLA 2GS2A 1P4OA 4FV6A 5I0BA 3GUBA 2C6DA 3F3ZA 4OTHA 3VWAA 4O7LA 3NPCA 2RG6A 2VU3A 4R5YA 4ASDA 4A4OA 4Y95A 2UUEA 2XEZA 3KKVA 5M53A 2PULA 3RPSA 4U79A 2BRGA 4ZTRA 4EH8A 4BIBA 2R3HA 4FUYA 4RFMA 4LFIA 1H0WA 4FSWA 4RIXB 3V5TA 3KMWA 1CTPE 5DR9A 3AT4A 4E4NA 4UXQA 3W2CA 3C7QA 4QMVA 5I9WA 4Y72A 1I44A 2C6OA 4IAAA 4JQ8A 5AR4A 2GMXA 5D1JA 3NUYA 3GVUA 4F65A 4LUDA 1NT2A 3ODYX 2B7AA 4AN2A 3FZTA 2XUUA 3WE8A 4IC7A 4MF0A 3ELJA 4X7QA 5JFSA 2WOUA 3FMJA 4XLIA 3I5NA 3FY0A 5GNKA 5LCKA 4E7WA 2E9NA 5ACBC 4IH8A 4PTEA 5ANJA 4XHKB 5C4LA 3QGWA 3LCKA 4XS2A 1IEPA 5C27A 5L8JA 2R3QA 3CLYA 4MKCA 3GC9A 3H3CA 3UIBA 1U4DA 3TCPA 4P5ZA 4CV8A 4JVGA 4FVQA 4ACDA 5IEYA 5JFWA 3QCSA 4BCKA 3R2YA 4Y5HA 5FG8A 3TDWA 3Q6WA 4KD1A 4IACA 2XNOA 1JVPP 2PZ5A 3HYHA 4FNZA 4G3CA 3NNUA 4Z7HA 2BAQA 2HELA 2CKEA 4EHVA 3MJ2A 3QQGA 1PXIA 3EKKA 4FR4A 4GIIA 4QQCA 4S32A 4UEUA 4USDA 2YM3A 5AV3A 3SDJA 3RJCA 2YZLA 2Z02A 3BEAA 4MQ2A 2R3JA 3OUKA 2QO7A 3BELA 4E5BA 4ZLOA 1YW2A 4FKUA 5DEYA 4QP2A 2YWPA 3FSKA 3NGAA 1VJYA 1QPEA 4KKGA 5J87A 4DGOA 3FLZA 5CY3A 4FSZA 3GU6A 3R7IA 4AF3A 2J0KA 1LR4A 1KSWA 4M12A 3A7GA 3PFQA 3ZFXA 4RWLA 3QTRA 3VUIA 4BKZA 3CP9A 4I21A 4KSPA 4IJ9A 4RFYA 4M15A 3RPVA 4GJ3A 5HNGA 2WQEA 5L2WA 3NVMB 4EYMA 4L9IA 4DG2E 4FL3A 3ZBXA 2VTJA 4F4PA 5EFQA 4F1OA 4MXCA 3PRIA 1URWA 3DBQA 4KAOA 3BLHA 2XYUA 3QTQA 4FEVA 4E6AA 5HICA 5CAQA 4JJRA 5AFVA 4EYJA 1NVRA 3K3IA 2RL5A 3MA3A 4FG9A 4QTAA 2ONLC 3LHJA 3EZRA 3SG9A 3ZZWA 1PXLA 1V0OA 1YHWA 2R3RA 3G5DA 3KXNA 3H9RA 5EKOA 5IH4A 2J6MA 3QQJA 3QXOA 4BTKA 4DEDA 2ZVAA 3GU8A 2B9FA 3KRWA 3QX2A 4FTQA 4HCUA 4WNOA 5TO8A 5DRDA 3R63A 3S2PA 3FYJX 4S33A 3I7CA 4IW0A 5LVMA 4W4YA 1TQMA 1XJDA 3EFKA 1SM2A 2OH0E 3O17A 4C8BA 5IISA 1OKZA 3LMGA 5K0KA 3V5QA 4O0YA 4BCGA 3UOHA 4TYHB 3V6SA 2Y9QA 4FEQA 4EK6A 2B0QA 2ETKA 3C4XA 3OF0A 2V0DA 3LZBA 4MXXA 3VS3A 5BUIA 3GCSA 5CTPA 2W5HA 5AV0A 4Z16A 2YAAA 3E88A 2ITPA 4EQMA 4AQCA 2XMYA 3IGGA 3ORKA 5AUWA 4JL9A 5A9UA 3I81A 3IW6A 2VTLA 4FK6A 4FKJA 4U43A 3RK9A 3PA3A 3ZXTA 4R77A 4MK0A 5L2QA 4I20A 4AUAA 2B9HA 3I5ZA 1U59A 1W0XC 3NYXA 3OT3A 3P7BA 3EQHA 2IW9A 4E1ZA 3TDVA 2R0IA 3VS6A 4RLLA 1WBOA 2CPKE 3Q32A 4WUNA 5KMKA 4ANSA 4ZY5A 4OBOA 3HRFA 2EB2A 1H1QA 2GHLA 4GFGA 4CMOA 2V62A 4Z3VA 1HOWA 3LXPA 4BN1A 2Y6OA 3NYOA 1CMKE 2IVSA 3EFJA 1Q5KA 1PMEA 1NY3A 2OXXA 2XA4A 4O0UA 3OY1A 4II5A 4BCQA 3MH1A 3BYMA 3ZRLA 1U46A 4PV0A 3V6RA 1Q99A 1SMHA 2YIYA 3H9FA 2YCRA 5M44A 1YVJA 2VWZA 2BDFA 4KS8A 4TNBA 4L52A 3ROYA 3MGYA 3G0FA 5LVPA 4I41A 1H01A 4HZSA 5IU2A 3GQLA 4YTFA 4NCTC 4FT5A 3VS2A 4F08A 4O84A 5JFVA 4QMUA 3LFEA 5CSPA 3Q9WA 3F82A 4M8TA 2YCFA 4JRNA 4OTRA 4XJ0A 4LRJA 5AJQA 3R7YA 3RKBA 3TJDA 3PY3A 4JQ7A 1YQJA 4XUFA 3RNYA 2J0LA 2WZJA 1SYKA 1XHAA 2YFXA 4CCUA 4E6CA 4O81A 3ORMA 2QVSE 4C62A 4FTMA 4EOSA 2RKUA 4A9YA 3AC4A 5AWMA 3LKMA 4M0ZA 4RLKA 2RFDA 3O7LB 4I5MA 3ERKA 4KRDA 4MCVA 2VX3A 4I24A 4FTJA 4D5KA 4DH5A 3SLSA 2A0CX 4DTAA 5A4TA 3DJ7A 3FSFA 2ITUA 4NKAA 4NM3A 4O6LA 3UC4A 3B2WA 4R5SA 4CEGA 4E93A 5KMJA 4JXFA 3DDPA 2CKQA 3C0IA 4DEEA 5JRQA 2UW0A 4QPMA 3LFNA 2ZV9A 3OWPA 5AV4A 2C3JA 3ZC5A 3QA0A 4EH2A 2PUPA 3CIKA 3ZOSA 1KE8A 4N6YA 1SNXA 2VN9A 4P2KA 2OW3A 5DN3A 1I09A 4EZ7A 1BI8A 5IA3A 4I6BA 4S34A 3QRKA 4J99A 4TWCA 3UO4A 2G2FA 4ANMA 3KB7A 1FMOE 2PZYA 1Z5MA 3PJ8A 4EJ7A 4XRJA 4HVIA 4BIEA 5GZ9A 3WZUA 4G6LA 1V0PA 2PPQA 3VAPA 3OD6X 2WPAA 5AM7A 3VNTA 3VS7A 3BX5A 2PZIA 3DBEA 2YHVA 3FZRA 2WMRA 4Q9SA 3KVWA 4KNBA 3DAKA 5ETAA 4PNKA 5CSXA 2OO8X 2XH5A 4MH7A 5IZFA 2PVLA 3R7EA 4FTTA 1ERKA 4OBQA 3PYYA 2JIIA 2XBJA 2W1GA 3O0GA 4G2FA 5D41A 3W2QA 3F2NA 3QQLA 3LFBA 4U8ZA 3D2KA 2XF0A 3LCOA 3W2OA 4YJNA 1IR3A 1BMKA 3KN5A 3VBQA 5JH6A 4FZDB 4DA5A 5ANIA 1YOJA 4AS0A 3DK7A 4IWOA 1YWVA 5HD7A 5CSHA 1W98A 4BFMA 3AQVA 4BCIA 2YWVA 3NUSA 3QZHA 2VWXA 3DKGA 3PG1A 5CAPA 4PDPA 3UODA 2WMBA 5I3RA 4FBXA 4H05A 4MEDA 2WTDA 4BWXA 3TZMA 4QNYA 2IN6A 2BRNA 4LM5A 5FEQA 1KUTA 2GNFA 2XNGA 3F3VA 3QQFA 4F0FA 2QG7A 4OR5A 4ERKA 4BWKA 5C8NA 1OECA 4GW8A 4K6ZA 3SV0A 2CNVA 2JBPA 3NUPA 4WBOA 4DGMA 4QTEA 3VS0A 3HMNA 3RHKA 1KWPA 3FC1X 4O0VA 1H1SA 5EYMA 3ZO3A 4BI1A 5GINE 4I6QA 5IF1A 3V8TA 3ZLYA 4BZDA 4U42A 3QTSA 4G6OA 2WMWA 1WCCA 4EK4A 2PZRA 5HIBA 5FP6A 4E5AX 3DDQA 5HLWA 3C50A 5D7VA 4CFUA 2WQMA 2XIRA 5E8ZA 3HV6A 3LM5A 1M17A 4AW0A 4CRSA 3JY9A 2JAVA 5CZHA 2Y4PA 4IVDA 4B9DA 4CT2A 1GAGA 3BHTA 3RAIA 2HXQA 2XNPA 4AGCA 2NO3A 1J3HA 3PUPA 4YC3A 4FZFB 4RIWA 5LWMA 2ITNA 2WTJA 3QRJA 3PPZA 2WU6A 4G3GA 4N0SA 3VUHA 1G5SA 1ZARA 4N70A 3IS5A 4M84A 2AYPA 4FT9A 4U44A 5CEMA 4C4IA 1L8TA 2YM7A 3D83A 4LGHA 2R4BA 2UW7A 2KULA 4KIKB 3FAAA 4FX3A 1YI4A 3QUDA 1XO2B 4BL1A 5HCZA 2JLDA 1B6CB 4XCUA 4QYFA 2CKPA 2VV9A 5BUJA 5AR7A 4QD6A 3FQSA 2ZM3A 1LUFA 3C4EA 5CVGA 3FKOA 5AUUA 1OBGA 1QCFA 4CQEA 1V0BA 4RJ4A 4K11A 4U45A 4FTNA 1XH4A 3SGCA 1YXUA 4RJ3A 2W1EA 4DT9A 2QOBA 4FTKA 4IB3A 2XNNA 4C02A 3GCQA 4FODA 2YCQA 2GTMA 1H1PA 2OZOA 3NW5A 4FTAA 3R8LA 3O2MA 3U9NA 5KMIA 2IWIA 3L9NA 4ENXA 5H8EA 3NNXA 1FBNA 4O7NA 3C0GA 3I6UA 5DR2A 2VZ6A 4YLKA 4OTFA 1VYZA 5BVFA 4RX7A 2OF2A 4FT7A 4XLVA 4M7IA 3FLSA 1P5EA 3LW0A 1ND4A 1Q8ZA 4HYIA 4CRLA 5AUVA 3G0EA 1YOLA 4JIKA 2X2LA 4CXAA 4AE9A 1PXKA 4GFOA 4XG3A 4YP8A 3QKKA 4FKWA 4BCJA 2QOLA 3EQFA 2UW6A 4ID7A 3UZTA 2X8DA 4U3YA 4BDAA 2R5TA 4DG3E 3DTCA 4B4LA 1SVHA 4NKSA 4CFNA 1M7QA 1Y91A 4ZS0A 3V51A 4EC9A 5J5TA 4O7TA 4I94A 3TZ8A 1MRUA 3UYTA 4BI0A 3BBTB 4GYIA 5H8GA 3FLYA 5HCXA 2HYYA 5LARA 4A9UA 1M52A 2F4JA 3JS2A 3PLSA 4AU8A 4QP6A 4FSYA 4Q5EA 2OK1A 3C0HA 4LV8A 3RVGA 3FBVA 4C2WA 5LJJA 5HORA 1K3AA 4I0RA 2UW9A 4HPUE 4L42A 2XIKA 3ZUVA 3TI1A 5CU0A 2GQRA 4EK3A 3E62A 2QO2A 4PP7A 2F2CB 2CN5A 5KMOA 1STCE 4YZNA 3MIAA 3B8QA 4XEYA 4A4LA 5EYKA 5M4IA 1J7LA 3QQHA 4FSMA 5LWNA 3NNVA 3QC9A 3V5JA 3VC4A 1SNUA 2IZUA 3ZLWA 2IPXA 4QPAA 3FC2A 4XG6A 2PU8A 3VN9A 2HZ0A 4TYGA 4G31A 3LFCA 3KRXA 3A60A 3BI6A 4KA3A 3KC3A 2QOHA 5EHOA 2WHBA 4O21A 3K2LA 4ZS4A 4ITHA 2XKEA 5AM6A 5EI6A 3N4TA 1ZYCA 2WXVA 3AC1A 4EOJA 4RIWB 2YIRA 2JC6A 2O64A 3V04A 4YC8A 4AW2A 3HVCA 3TEIA 1GOLA 5AA8A 1IA9A 3HP5A 2PUUA 2G9XA 3NCGA 3OBJA 5DLSA 4GL9A 3ZFYA 2HY0A 3Q04A 2XK4A 4QTDA 4FZ7A 1FGKA 2ITZA 2C6KA 4J95A 5B2MA 2X7OA 4FV3A 3VULA 4H3BA 4EZ5A 3LVPA 3TIYA 3BCEA 4RIOA 4M3QA 4BYJA 4QQTA 1H8FA 4N57A 4AT4A 4D58A 2FVDA 2O5KA 2WD1A 1W84A 4GFMA 4F1TA 4WHZA 4TTHB 3U6JA 4RX9A 3P79A 2FSOX 3QWKA 4I92A 3NRMA 2BILB 3CBLA 4O83A 4O0RA 4DF3A 4APPA 4F9AA 4FVRA 3C1XA 4YPDA 2C0IA 4MWHA 3KL8A 4PMSA 5FXRA 5HO7A 4RMZA 4BC6A 3BYSA 3ZLSA 3R21A 3VRZA 3ZO2A 4EUTA 5IH5A 3H0ZA 5M57A 3I0QA 3HA6A 3CKXA 3QX4A 4DAWA 4NEUA 2Z2WA 2C3KA 1OKYA 5FLFA 4W8DA 1K2PA 2HOGA 1UU8A 4RJ8A 1P2AA 3UZRA 3JR1A 5IA2A 4JAIA 3IW8A 5E1EA 2C1BA 5EYDA 3KXHA 5FRIA 5AR2A 4QTCA 5HI2A 5A3XA 3GC8A 3EJ1A 4DEBA 5TKDA 2R9SA 2W4JA 2VTHA 4YZ9A 4MQ1A 2YISA 4I22A 1REJA 1KV2A 4FKQA 4GS6A 2B4SB 2I0VA 1U54A 2QOIA 4D2PA 3VJNA 2YDKA 3FJQE 2BZHB 5IUIA 5IQGA 2PZPA 1DS5A 3GGFA 2UW8A 2WEVA 3U51A 2IZSA 4BRXA 4D2VA 4FMQA 4ZLZA 2QKRA 2J5EA 4AFJA 5CS6A 5EM8A 3PRFA 3PP0A 4RC3A 4PQNA 5AP7A 4YBJA 3SQQA 1JKKA 2BZKB 2PVRA 2ZV7A 4PMMA 3P4KA 1PMNA 5HBEA 1TQIA 3AC2A 1GZKA 2CDZA 4R1YA 4NJ3A 3A7JA 3MTLA 1OI9A 4IVCA 4BZOA 5LVOA 2X2MA 3KCKA 1YDRE 5CYIA 3D14A 5IG1A 5AX9A 3H30A 5GJFA 2ZB0A 2JKOA 4TKSA 2CHLA 3QU0A 4CVAA 3C4ZA 2C5VA 4BKJA 3ZXZA 2F7XE 4F9BA 3AMYA 3OXIA 2VTIA 3IOPA 4CFFA 3ORXA 3W2RA 4ALWA 4MHAA 4BZNA 3F7WA 1W82A 3WIKA 5JGAA 3TKIA 4EEVA 5IUHA 2EU9A 1ZYLA 4RSSA 5EW3A 4E5WA 4IAFA 3HL7A 4WKQA 3PJCA 1MQBA 2OFUA 5DNRA 3R83A 2R3LA 3D5WA 4D2RA 4K77A 4A07A 1Q62A 3K5UA 5CZIA 2ITYA 4E8AA 1R78A 2QNJA 4DH8A 3V3VA 3F61A 5AIKA 3RPOA 3T3VA 5CAVA 4EH4A 2R0UA 2W17A 3S95A 3IECA 4C4EA 3EYGA 2WMXA 4RVLA 3FKLA 4GVAA 1KOBA 5L2IA 4D55A 3F5XA 4IB1A 2IW8A 2HAKA 3EHAA 2HWOA 3BV3A 4NWMA 4M69B 5EW9A 4U0IA 4I3ZA 5IEVA 5A6NA 2J50A 3CKWA 4TW9A 3TUDA 3UPXA 4YZDA 4USEA 5EG3A 2BMCA 3HUCA 3Q6UA 5CF8A 4GKIA 2R7IA 3QTZA 3MH3A 3QD2B 4FSRA 1PKDA 4L7SA 3UYSA 4BHNA 4QP1A 2WOTA 4LUEA 5JGDA 5IQIA 3RNIA 4JQEA 2C0TA 1CKJA 3DT1A 3LFQA 4IAIA 4MYGA 3TACA 4BBMA 4FEXA 1UNHA 4B6LA 4TRLA 3COMA 1OBDA 5CLPA 3BHYA 4W9WA 4GKHA 2FA2A 5TE0A 1E1VA 3ITZA 1OZ1A 3Q3BA 1ZRZA 1Q41A 3E92A 2QU5A 2WTVA 3NUNA 4KIPA 2CLQA 3FZ1A 4L7FA 2OJFE 4G34A 2R3FA 5EW8A 3G15A 1ZMVA 2I1MA 1U54B 4Y8DA 4FI1A 1Q8WA 5GJGA 3NIZA 1ZMUA 3DFCB 5FM2A 3FXWA 3KRJA 1IRKA 3G51A 4FTCA 5BX0A 2J0MB 4K33A 3C4FA 3BGZA 4EOKA 5KKRB 5L4QA 5AAFA 4KKHA 2CCIA 4AZEA 2QI8A 4D4VA 4YJUA 3QCYA 4YPSA 2ITWA 4FTUA 5AUTA 5KE0A 3KGAA 3DAEA 3UC3A 4WG5A 2W7XA 1YXVA 3CD3A 3FMEA 2W06A 4FYOA 2QLUA 3JY0A 2XK3A 5HIDA 2YDJA 2OSCA 3OROA 5BYLA 4DYMA 1PXMA 3IG7A 2YJRA 4RWKA 4PDOA 3R71A 1VZOA 2NRYA 3HAMA 4C3RA 3QD4A 3EYHA 3MVMA 1JKTA 3ORIA 4QMYA 3ZZEA 2GTNA 4OT5A 1OIUA 2R3NA 4FV8A 4CFVA 2PK9A 4ASZA 4LYNA 2F7ZE 4DH3A 3PIXA 2JDVA 2UZBA 4XG7A 5CEIA 5CF6A 2CMWA 4XBUA 1Y6AA 4O7SA 3EMGA 3HRBA 4M68A 3LIJA 4G6NA 1YHVA 4FUXA 4Z9LA 2YLEA 4DFNA 4XV9A 3LQ8A 5A4QA 1T46A 3RBWA 2KTYA 2F7EE 1ZAOA 5KKRC 4RJ7A 5FDPA 1XKKA 4MD9E 4WT6A 4ORKA 3TV4A 2H34A 4J96A 3ZBFA 4FK3A 1YXSA 1GIIA 2XNBA 5JRSA 3QCQA 5D7AA 4ZSLA 1BL7A 2B55A 3RALA 4WRGA 4W4XA 4J97A 3DQWA 4IVBA 4L45A 4X6QC 2ZMCA 3GOPA 4FTIA 5AUYA 4F9YA 1GY3A 1PRYA 4AP7A 3PSCA 1X8BA 2C0OA 1S9JA 5F9EA 2OZAA 5FUTA 4NM7A 2QOKA 4GK3A 1RJBA 3R9DA 4C4JA 3LMHA 2UZTA 5HU9A 3P7AA 3R8UA 4NM5A 4OTWA 4CZUA 3ZHPC 3RINA 5LCJA 1NVSA 4L01A 4O0SA 3R22A 4YJSA 4JG6A 3CS9A 3MDYA 5E8TA 2BKZA 5CEKA 2X6EA 3L9MA 4DHFA 3KQ7A 1GIJA 2XK8A 4DBXA 5HOAA 5LQFA 2J51A 4AA4A 4AA0A 2BFXA 2YN8A 3DB8A 2C6TA 2ZJWA 3FLNC 4XOYA 5H3QA 3ANQA 4CYIA 3I0OA 4XOZA 3A61A 1F3MC 2VTTA 5DA3A 3UVQA 4ZSAA 4HYSA 5BQ0A 4H36A 3T9IA 3ZYAA 4AOTA 5LOHA 3POZA 3BHVA 1YXTA 4DINA 3A99A 1FVTA 4X2GA 4FKRA 3KXZA 2X39A 4OGRA 4YURA 3FI2A 1OKWA 4RJ6A 3Q52A 2PVHA 2GPHA 4NFNA 3SA0A 3AC5A 4P7EA 3W10A 2YIWA 2Z7LA 3MVLA 3RP9A 1ZOGA 5C8KA 5I9VA 3R7UA 4UY9A 1JOWB 5DWRA 3WF5A 2JD5A 4D9TA 3OT8A 4LOOA 4Y83A 5KZIA 4BCPA 3ATSA 2H6DA 3PVUA 1JKLA 2YM8A 4XYFA 2GNLA 3NLBA 4EK5A 3P08A 2VUWA 3DK3A 4I5PA 3PPKA 3E63A 4LGDA 4MBIA 1H26A 1ZYDA 3BKBA 2Q0BA 3E87A 4MBLA 1WBWA 3RK5A 4CQGA 5DYJA 2B9JA 3AGMA 2YAKA 5IQEA 2PTKA 5CSWA 3UNZA 1P4FA 4JDHA 3ODZX 3VO3A 4BGQA 5K5XA 5L6WL 4XG9A 4NW6A 3EWHA 2XCHA 1ZZ2A 4ITJA 4ZTSA 5ETFA 3R01A 4EWQA 4YLJA 1VEBA 4X2KA 1XH5A 3SRVA 5BYYA 2JFLA 3PVBA 3G33A 4IIRA 4O7WA 4XG8A 3F3TA 1KV1A 3NWWA 4XX9A 4DFUA 2UVYA 3VUMA 2YIXA 4EOPA 3JYAA 2W99B 3GENA 4QQ5A 1CKIA 2OJGA 1Z9XA 2H96A 3BU6A 4IFGA 3A8WA 2Z7RA 2WKMA 3W1FA 3MY0A 2XJ1A 4YJQA 1H28A 2W96B 4PX6A 2VTQA 3UMXA 3W18A 3R8PA 4I5HA 5L6OA 2WB8A 3GC0A 2ERKA 1Z57A 3W33A 5CU3A 4IC8A 2R7BA
chains in the Genus database with same CATH superfamily
2AEGA 2ITXA 4FSNA 4FTLA 4J71A 4LL0A 4D1ZA 1WBNA 5C1QB 3ZLXA 4LGGA 3CR0A 1YDSE 3BGQA 5L8KA 3EQCA 5EDQA 3BPRA 2VD5A 4PRJA 3FDNA 4YTIA 4TYEA 4CYJA 2OZAB 3DY7A 3IW7A 3L8PA 5B2KA 4O82A 2X8IA 2HZNA 4ZTLA 2YM5A 3UVRA 4J1RA 5L2SA 4I5CA 2A27A 5AP3A 4BTJA 4IZ5A 2VWUA 2PMOX 3V5PA 3EN5A 3P9JA 2GNGA 3P23A 4FZ6A 4ACHA 2HWPA 4X3JA 4UX9A 3DXQA 4C35A 4BGHA 1IG1A 5G6VA 4AX8A 3PJ3A 2HCKA 2B52A 4ZJVA 2BRMA 4CKIA 5LMKA 3OTUA 2W1HA 3P7CA 3QHWA 4H1MA 2WEIA 3KXMA 4L44A 3IDBA 4YO6A 3FKNA 5DGZA 3PA5A 5J79A 1Q8UA 4FSUA 4K2RA 2OI4X 3HMPA 1ZOHA 1DM2A 2XALA 5CALA 2ETMA 2UV2A 3N4UA 4YJTA 3BYUA 2AQXA 3A7FA 3GXLA 4GEOA 4F99A 3D5VA 3HAVA 3VBXA 5JZJA 4LL5A 4AGWA 4UZDA 3B8RA 4D5HA 3DNDA 1H4LA 4QP4A 4ZMEA 2RFEA 3DB6A 4OW8A 2HY81 5KNJA 3UIXA 5F95A 4BF2A 3ZONA 1IAHA 3THBA 5EQYA 4I0SA 3DA6A 2GCDA 3FPMA 3RM7A 4C61A 3PXYA 4HVDA 3LXKA 4R78A 5KO1A 5CNOA 2BROA 3KULA 1OUKA 4EBVA 2V22A 3ZTXA 4AXCA 3W2PA 5ITAA 1SZMA 2WIHA 3TIZA 2XCKA 3NUUA 3RHXA 1KE7A 3G9LX 3R30A 4DE4A 5LVLA 3HP2A 3QLGA 5AAEA 2P4IA 3NYNA 1OUYA 4GCJA 4JNWA 5CNNA 3D0EA 3W16A 4PWNA 3BWFA 4NU1A 4NSTA 1PJKA 3SOCA 2PVKA 3H10A 1J91A 3PWDA 4LV5A 4XMOA 4ZOGA 2B53A 4DFXE 3LQ5A 4DHIB 3S3IA 5CAOA 1E1XA 5A14A 3ALNA 3FLQA 3GU5A 4AFEA 3EN7A 4YJOA 5C01A 4K0YA 2F2UA 4MXZA 3GCPA 3Q9YA 4IZ7A 5HIEA 3QGYA 2PVYA 4IZYA 2X9EA 2UVXA 2UZOA 3QYWA 3SRVB 4BBEA 2R3IA 3D7TA 5I3OA 2EB3A 3RGFA 5CEPA 2W1DA 2R3KA 3TTJA 3QKMA 3UP2A 3D9VA 2JDOA 5AP1A 2CGWA 4DGGA 4JX3A 2BFYA 3VRYA 1WVXA 2BZIB 2WFYA 4FV4A 3TZ9A 4F1MA 3F9NA 1O6KA 4NJDA 4RPVA 2E9OA 3GI3A 2B9IA 3R1NA 4M66A 3OHTA 4M67A 4YTCA 5BVDA 4MXYA 4EJNA 2PVJA 3EQRA 4GK4A 4OBPA 2HENA 3U9CA 3EOCA 3BIZA 5BMSA 4RJ5A 1CM8A 4ALUA 5AR3A 3PLAE 4V04A 3OY3A 1B38A 4Q9ZA 4CZTA 3FY2A 2XKFA 3W32A 2ZB1A 2J7TA 5LMBA 3IOKA 3W0OA 1XH7A 3MPTA 2A1AB 5HTCA 1RQQA 3HECA 4A7CA 4YHTA 4ZMFA 1XH9A 4I93A 4F9CA 3IK3A 3FI3A 2BCJA 2VWIA 3KXGA 4JX7A 4MBJA 5DOSA 3FL5A 4ACCA 3QCXA 3UGCA 2XM8A 5M4UA 4OTDA 4LV7A 2XRUA 5IPJA 4FKGA 4CMTA 3BQCA 4USFA 4RBLA 3KFAA 3RMFA 3R7OA 4BKYA 3Q4ZA 4W4WA 4FKIA 5HGIA 3CEKA 4A06A 4R3PA 3D7ZA 4IM2A 4F6WA 4HGEA 2FB8A 4MNEA 5IQBA 1S9IA 2VNYA 2WU7A 1ZY4A 1GZ8A 2C5YA 3DFAA 4BDGA 4R8QA 4DFLA 3HV7A 1M7NA 3RI1A 1GZOA 1L3RE 3FI4A 3IKAA 3LLTA 2J90A 4O4FA 1NXKA 4F0GA 4ZZNA 1VYWA 2DQ7X 1MP8A 5FBNC 4RWJA 3JVRA 3ZEWA 3F2RA 4DLIA 4F09A 4J98A 3OCSA 1A48A 4QP3A 4UYNA 4HNIA 3CQWA 4FGBA 4ANLA 3POOA 4FKOA 2VTSA 3O7LD 2ZDUA 4HCVA 4QDVA 4C34A 2C3LA 1OL2A 3ORPA 3MESA 4YZMA 3KULB 4GYGA 3ZS5A 1PXOA 3CY2A 2JDRA 4O7VA 2V5QA 2V7AA 1IASA 3PVGA 3R1QA 3R0TA 3DNEA 5CEOA 4LMUA 3BZ3A 4BDKA 4WNKA 3U4UA 4PL4A 3FMMA 3LOKA 4ONAA 2YJSA 5ETIA 2DWBA 1Q97A 4HZRA 4BI2A 2ZAZA 3QWJA 1QMZA 1QPJA 1UNLA 3EN4A 2VAGA 4DN5A 1ZMWA 4M97A 3BHUA 2QODA 4BWPA 3ROCA 5JZNA 3K54A 2GFSA 3IW5A 3MFSA 3S4QA 3ATTA 3RZBA 4FE2A 2X7GA 3HUBA 4DCEA 3Q2MA 1Q3WA 5FXQA 3F69A 3PXQA 4U97A 3BU3A 5M4CA 1H0VA 4TT7A 3KIOC 5E8WA 5BVEA 4J52A 4BDHA 4IWPA 4F9WA 3O96A 3CTQA 4TZRA 1KOAA 1YDTE 2E9UA 4KABA 4WSYA 4B8MA 2QOFA 5DR6A 3KRLA 4EQUA 4AOIA 3ENHA 4JI9A 4AN3A 2ZMDA 5K9IA 4A9RA 2WGJA 4CG8A 4BGGA 4L6QA 3P78A 1GIHA 3R7GA 1YXXA 2G01A 3O8UA 3CPBA 3E8DA 4RIYA 2XS0A 3KN6A 4UMTA 4BVUA 2EXEA 2XANA 1ZZLA 2J2IB 3QBNA 3WILA 5EDPA 1U5QA 3EFWA 2ITTA 5JFXA 5CSVA 3CTJA 4S30A 4WG3A 3WZDA 4YSMA 3VS5A 3WF7A 3C5IA 4NTSA 5HLPA 2VRXA 3CCNA 2OGVA 4O38A 5E92A 3Q4CA 4EI4A 5D9HA 3BE9A 5FTOA 2VO0A 2I6LA 3AGLA 3O8TA 2BUJA 2J9MA 3COHA 3AXWA 3OZ6A 4FV5A 4GUBA 4U80A 4WA9A 4CKRA 4O7ZA 3PTGA 4EH6A 4FKSA 1R1WA 2CSNA 4IDVA 4H39A 5F4NA 3ZSGA 3MVJA 2Z7QA 5CXHA 3BHHA 1Y8GA 4NL0A 3TT0A 4YC6A 5CT0A 4OUCA 3ZRKA 1YI3A 5FTGA 3MS9A 3PP1A 5DG5A 1OVEA 3CJFA 4O27B 4QYEA 4V0GA 4C57A 1ATPE 3LQ3A 5IQDA 5M08A 2OXDA 2J5FA 4PNIA 4E6DA 2ZV2A 3QYZA 2XNEA 3ULZA 2OKRA 4KSQA 3CGOA 4FF8A 4W8EA 5M07A 2UVZA 4G9CA 4WG4A 3OC1A 5HLNA 1AD5A 2PHKA 5B0XA 1IA8A 4U7ZA 4RC2A 4HVHA 4CTCA 4HVSA 3TTIA 3KK9A 5M4FA 2PWLA 4GMYA 1W8CA 2XAOA 3CE3A 3TNQB 4JBQA 4O0WA 3OMVA 2W5AA 2W1ZA 3IQ7A 3NIEA 2QONA 2YM4A 4EONA 3TN8A 4KINA 5HG5A 3UQCA 2IW6A 4U9AA 4ZXTA 4FEUA 2XIZA 5CF5A 2Y7JA 4IMYA 5IMEA 3D5XA 4W9XA 4NM0A 1R3CA 4MD7E 4OTQA 4FKTA 3F7ZA 2PMIA 2P2HA 4ZIMA 5LMAA 2EWAA 2JDTA 4CGAA 2DUVA 4AGDA 1APME 2EXMA 3PZHA 3UO5A 1LP4A 4ITIA 4I4EA 4EHGA 1DI9A 1FINA 4QMZA 3GC7A 1OB3A 2VO6A 4JDIA 4BDFA 1MQ4A 2OU7A 2QKWB 1CDKA 3EN6A 4V01A 4DGNA 2W05A 3L9LA 4O86A 2WMVA 4FICA 4O6EA 3Q9XA 4C36A 5IDNA 1G8JA 5EM6A 1FOTA 5A6OA 4IX6A 4X21A 3ORLA 4L67A 3SD0A 2J4ZA 5IEXA 4YTHA 4FRFA 2PL0A 4I23A 4PP9A 4EWHA 2YDIA 4K18A 2X7FA 4QOXA 1P14A 2UZUE 2RF9A 2XNMA 3C51A 5E1SA 4ANQA 5AP2A 2GS7A 2IF8A 2LGCA 4RIYB 2YZAA 4BCMA 3F6XA 3ML1A 4HVGA 4FNWA 2FH9A 4D2WA 3OWKA 1SVEA 3PSDA 2XJ2A 1WBTA 3WF8A 3A7HA 3O51A 4FIFA 4MF1A 4XG2A 4ZSGA 1OMWA 1OPLA 3FMHA 3MIYA 2O63A 3P1AA 1BLXA 3QRUA 4D2SA 5DFPA 5KMLA 3DKCA 2OBJA 2YITA 3BYOA 5CQWA 5IMXA 4RX5A 5JKGA 2QCSA 4QPSA 2WMAA 3I6WA 4CG9A 1JBPE 4IX3A 3OEZA 2VO7A 1G8AA 1UVRA 3CGFA 4GT5A 4KIOA 3OOGA 4MD8E 3U6HA 2NPQA 3KCFA 3OWJA 2OIQA 3V01A 4DGLC 3AKJA 2QHMA 5HO6A 5EHLA 4AAAA 5F1ZA 4I1ZA 1XH6A 4BBFA 2VGPA 4FV0A 5JGBA 3G9NA 2EXCX 3FLWA 4IDTA 1AQ1A 3A7IA 4PMPA 3HKOA 2C4GA 3RCDA 4V05A 2C5OA 4V0GB 5FEEA 4C4HA 2YABA 4BYIA 3SHEA 3ZSIA 5CVHA 3WI6A 5CANA 2CGUA 3QF9A 3O8PA 3VF9A 4H58A 3FUPA 4K9YA 3REPA 1BUHA 3L9PA 1CSNA 3M1SA 4AAYA 4R7IA 1W7HA 5CXZA 2QOQA 3CY3A 3LFFA 5E91A 4MXAA 4EBWA 2HZIA 4HPTE 4CCBA 4AXFA 5H8BA 1OKVA 5EQPA 4AXAA 3E93A 2VTOA 4FKPA 4FSQA 4GRBA 1JSTA 5H2UA 4EK8A 4BY9E 2QD9A 4O7RA 3DOGA 3CXWA 5IH6A 4OTIA 3PY1A 4L43A 4R7HA 3SXRA 1W83A 2Z7SA 4IX5A 2NYAA 5A4LA 4FIEA 4Y85A 1HCKA 2BALA 1ZWSA 2QHNA 3OXZA 3LFSA 3R2BA 4FOCA 4CSVA 5HTIA 3N4VA 2VX0A 3UIUA 4IXPA 3D2IA 3WF9A 5L2TA 2LAVA 4E20A 3CQUA 1J7UA 4HYUA 2YACA 2QURA 3UDZA 4GK2A 4F70A 4ZJJA 3O50A 5IA0A 3KREA 5EM5A 5BYZA 1Q61A 3I7BA 3Q4UA 2W9FB 4O96A 3QKLA 5HVJA 3GEQA 3DJ6A 4ALVA 3QD3A 5A54A 4O2ZA 4DG0E 3QA8A 4F7NA 3LXNA 3QALE 5AP4A 4QMWA 2C47A 3DK6A 2AUHA 3R1SA 4JLCA 2GDOA 4K1BA 3NMUF 2P55A 3RAHA 3LMIA 1KE6A 4L68A 5FDXA 4QMMA 3M11A 1PXNA 2I0EA 2VWWA 4R7BA 1ZLTA 2JEDA 3R9HA 2QC6A 3PJ2A 2W1IA 3QD0A 4LQMA 4ZZOA 4HYHA 4S31A 4CV9A 5E8VA 3MB7A 3P86A 3UDBA 4TL0A 4YO4A 5HE2A 3WZKA 4U3ZA 2JKMA 4ZZMA 2JIUA 2UZDA 1OM1A 3KMMA 5M09A 3NX8A 2X81A 3LCDA 2OF4A 2QR7A 4GVJA 1NVQA 2IZTA 3HDMA 3E8EA 3SVVA 3Q4TA 2W1FA 5I5ZA 2BAJA 5IA1A 4P4CA 3EIDA 4XP3A 5K5NA 4GU9A 4JDJA 4HGSA 4XP2A 5J8IA 4OAUC 4UN0C 3UVPA 2CNUA 4FC0A 1JNKA 4QQJA 3UIMA 4DFBA 3AD6A 3NUAA 4YNEA 3UOKA 5BVKA 4R3RA 2P0CA 4BCOA 5L8LA 5TR6A 3R73A 3AC8A 4RVTA 3ALOA 5F20A 4XRLA 4O1PA 4ACGA 4D2TA 3AD4A 3QQKA 1TVOA 1XH8A 4JBPA 3SG8A 3OEFX 5HD4A 4APCA 2ONLA 3C4CA 3E64A 3LCSA 1PW2A 2WQBA 4TWNA 4ZAUA 4XG4A 2E9PA 2JFMA 5AP5A 3BEGA 2BDJA 4NTTA 5HCYA 4ACMA 2E9VA 2RFSA 3R9OA 1OITA 2ZV8A 1RDQE 3FZSA 3QZIA 5DT3A 3SC1A 2WMSA 2I0YA 4AOJA 3FQEA 2XK6A 4Y46A 4GIHA 4Y73A 2BKKA 5GZ8A 2VWBA 4U81A 2VGOA 4QMOA 4YBKA 2QG5A 3OG7A 3VHKA 3BGPA 4TXCA 4D9UA 2B1PA 3FMKA 2PVFA 4WNPA 1FMKA 3WARA 4C2VA 1PYXA 3G6GA 2FSTX 3G6HA 3OFMA 3OWLA 4FOBA 2WTKB 5CAUA 4EH9A 2FO0A 4BCNA 3PPJA 3UNJA 3F3WA 4IEBA 5GIOE 4TY1A 1SVGA 2P3GX 3UOLA 4BDJA 3R8ZA 4BCFA 4RC4A 3NZ0A 3CSVA 4H3PA 5DMZA 2GNHA 4I6LA 1H08A 1JWHA 2BDWA 3JPVA 4GT3A 4ERWA 3AKKA 2UW5A 3RAKA 4YJPA 5CX9A 5K4JA 1Y57A 4IM0A 3ZU7A 2CKOA 4FTRA 4X6RA 3VUKA 3P5JC 3H0YA 1WBSA 3I79A 3KF4A 4BTMA 4BICA 2Y8OA 3L8XA 2O65A 1PHKA 4JIAA 4F64A 4Z7GA 3UQFA 2ZM4A 4K8AA 4PL5A 4LOQA 4IQ6A 2PUNA 4G3DA 5IQCA 4J8MA 4ENYA 1XBBA 2X4ZA 3R04A 5AV1A 1UV5A 4ANNA 1H25A 3MV5A 4FVPA 5D12A 3F66A 5B2LA 5HBJA 1LPUA 2FSLX 4P90A 5FGKA 4X0MA 3KVXA 5J9LA 4FKVA 2WTKC 3V8WA 5DI1A 4D0WA 2ESMA 3GQIA 1ZXEA 4QT1A 4TYHA 5CU6A 3WIGA 2GS6A 5AUZA 1LEWA 3NYVA 3VIDA 4G9RA 3VVHA 5GIPE 4IB0A 5J5SA 4QMLA 4KKEA 4MWIA 1M2RA 4JT3A 4ARKA 2CNQA 4ASXA 1UWJA 2IVUA 3PXZA 4IAKA 4EL9A 3TNIA 2W5BA 3EQPA 5T6KA 3VHEA 4BHZA 3UJGA 3Q2JA 1JKSA 1ZOEA 1R39A 5A4CA 3R28A 2IZRA 1O6YA 2HIWA 2YERA 4CZYB 4NCTA 3PVWA 4E6QA 5L6PA 1FGIA 2XIYA 3WZJA 2REIA 3P5KA 1XBAA 4HNFA 1UWHA 5EH0A 1UU9A 1BL6A 3BV2A 5KHWA 5CQUA 3D15A 3AC3A 4F6SA 3PG3A 4UMQA 4LI5A 3HMOA 4NT4A 5DH3A 3II5A 5DT0A 5KZ0A 4UWBA 3UNKA 2DS1A 2X8EA 3U54A 3DU8A 4EHEA 4LRKA 2VTAA 1GNGA 3VBWA 2XVDA 4CFXA 2XK7A 5CI6A 5HHWA 4IE9A 4A4XA 4AG8A 3U8WA 3M42A 3OXTA 2XKDA 4GG5A 2C6EA 3TKUA 5K3YA 3VUDA 5J9ZA 1Q8TA 5JEBA 2E2BA 2WNTA 5AV2A 3TG1A 4CLJA 3PWYA 2Z8CA 4C4FA 3EB0A 3AMBA 4FL2A 4FZAB 3ZH8A 4XV3A 4FIHA 3IO7A 2OH4A 4RWIA 3NW6A 5C03A 3GP0A 4D4YA 4JR7A 4GT4A 3W55A 4L3LA 3EZVA 1W2DA 3HLLA 3NW7A 2PE1A 4C0TA 2W4OA 2O0UA 4FKLA 3R02A 4MXOA 2CGXA 3PJ1A 3SXSA 3HZTA 5HO8A 2ITOA 3BLRA 4TYJA 2PSQA 2JKQA 5CT7A 3ZRMA 4OT6A 3FXXA 3N9XA 4FYNA 1OIQA 2G15A 4FNXA 4FIIA 4UB7A 4C59A 1UA2A 3DBCA 3EL7A 2C6IA 1TQPA 2JIVA 3RWQA 4QMSA 4ZLYA 4PL3A 5ETCA 4R6VA 2VTRA 5IKWA 2PUIA 3BQRA 3C13A 3A2CA 4B8LA 3DAJA 2ZYBA 4E73A 1OPJA 4N6ZA 2OIDA 4F7JA 4G17A 3GU7A 5AMNA 3VW8A 2WELA 4EOLA 5ANOA 5KMNA 3T8OA 3UQGA 4D1XA 3PE1A 3I4BA 3A4OX 2F57A 4M0YA 1JSVA 4BCHA 2C6MA 3JUHA 2B54A 5BVOA 2X2KA 2R2PA 5HNIX 2UZEA 4KUJA 3FV8A 4KS7A 4U40A 5HKMA 4WOVA 1Q3DA 1FVRA 4RX8A 2P2IA 3RK7A 1XWSA 3QQUA 3WBLA 4RVKA 4PDYA 2WMQA 3Q5IA 3C5UA 1A9UA 4E26A 1BYGA 1LEZA 2J0IA 2QLQA 4IANA 3QFVA 3PXRA 3OBGA 4JR3A 4Z55A 3ACKA 3FHIA 3HA8A 4F7LA 2IO6A 2AC3A 4PUZA 3MFTA 2X0OA 3OTVA 5K0XA 3ZMMA 5E7RA 4QMXA 5KUPA 5AR8A 3ORZA 5BNJA 5HX8A 2GHMA 4O1OA 1HCLA 3DJ5A 5T68A 3IW4A 4WIHA 4Y5QA 5M06A 4EORA 4F63A 2CCHA 4CTBA 5FEDA 3V8SA 4GG7A 3WF6A 3TJCA 4EH7A 3TV6A 2UZNA 4AZFA 3MN3A 4PPAA 1JAMA 3E7OA 3ZSHA 3Q9ZA 4IFCA 1H1WA 4HJOA 2X9FA 4IX4A 3E3PA 3A4PA 5H9BA 4UMUA 3NDMA 5JK3A 1ST4A 3AD5A 3LE6A 4EUUA 1NW1A 5BVWA 2WMUA 2W9ZB 3R7VA 2FSMX 3GFEA 2XP2A 1ZYSA 4TYIA 5IA4A 1H07A 2ZDTA 3MFUA 5E8XA 4ZJIA 2I40A 3ANRA 4X2JA 4YZBA 1F5QA 2RG5A 4AGUA 3O23A 3GT8A 3LJ0A 5HEZA 3K3JA 3NUXA 3GCVA 2BHHA 5IA5A 2C5NA 1YWRA 2WTIA 3D4QA 4JBVA 3RTPA 2GQGA 2Q0NA 4DC2A 4FV9A 3A8XA 4I4FA 4C3FA 1G3NA 5DRBA 5ANDA 4L8MA 2RIOA 3V5WA 4D0XA 5I9UA 4A9SA 5EM7A 5HG8A 4AN9A 3FYKX 3S0OA 4ANOA 4FG7A 2G2HA 4A9TA 3TWJA 3VF8A 3UZPA 3MY1A 3VW6A 2I0HA 4RGJA 3OW3A 4TWOA 4X2FA 3OVVA 1AGWA 2R3PA 3UG2A 5KMMA 3ZCLA 2C5XA 4MAOA 5AR5A 3VBVA 4BB4A 4QO9A 3SAYA 5KHXA 2XKCA 3D94A 3DGKA 4IAZA 2Y6MA 3VBYA 5KCVA 1GZNA 3GOKA 2O3PA 4BR3A 5HESA 2BRBA 2X0GA 1WZYA 4OTGA 3DQXA 5JSMA 2XK9A 4XBRA 4BJJA 3NSZA 2G1TA 3O71A 2GFCA 1DAWA 4G5JA 3MPAA 3L1SA 1YHSA 2A2AA 3SXFA 3UDSA 4XV1A 1MRYA 4NYEA 4MUQA 1PF8A 3W0SA 2XEYA 5CF4A 3BRBA 5I4NA 5E8SA 2VTMA 2OJJA 4RG0A 3C9WA 4RQVA 2R64A 4C38A 2BIYA 2PYWA 4G3EA 3TNWA 4KIKA 2YLFA 1H00A 3LFAA 3S00A 4EOIA 4R3CA 4EKKA 3ZM9A 4L3JA 4DLJA 3PIZA 3P0MA 3PIYA 4FA2A 5J7BA 5FWKK 3GNIB 2QQ7A 4FTOA 1PY5A 3TV7A 3ENMA 4YR8A 3E8CA 2O2UA 3G90X 1YWNA 3SKCA 3CPCA 4UMRA 4NK9A 3MY5A 4WO5A 2PY3A 5L3AA 2ZM1A 3K5VA 4QNAA 4HCTA 4E4LA 5CU2A 3HX4A 4YMJA 5FP5A 2WIPA 5DPVA 4WNMA 4EOOA 4FEWA 4J7BA 5C9CA 4MX9A 4C33A 2PE0A 3AT3A 2VTNA 4TWPA 5HTBA 2QOOA 4UBAA 2R3OA 3IDPA 4EKLA 4O22A 1XBCA 2QR8A 2A19B 4O0XA 3EQGA 5HU3A 2CN8A 2ERZE 4UV0A 1KE9A 4NIFA 3R9NA 2NNWB 4RZWA 4DFYA 2WAJA 1V1KA 1FPUA 5EQEA 1OPKA 2R3MA 3MW1A 4FV7A 3NS9A 4PTCA 3GBZA 5B7VA 3FMLA 4AQKA 2JITA 4QMQA 3MWUA 2HXLA 2HW6A 4JRVA 5J7HA 3QRIA 5E8UA 4CD0A 4UYAA 2O8YA 3PZEA 3OP5A 2QOCA 4IADA 4IHPA 1K9AA 4LG4A 3DZQA 3CTHA 4D28A 3ZM4A 5J9YA 4L3PA 4WUAA 4C58A 2OICA 2BVAA 2WTWA 2JGZA 3DCVA 4C3PA 2XARA 5LMKC 3KRRA 2G2IA 3AOXA 4HGLA 5KBQA 4U5JA 4L00A 2DYLA 3RWPA 3TNPC 3W0NA 5C4KA 3FE3A 3QL8A 4KRCA 5IQFA 4IZAA 3E5AA 5JT2A 1J1BA 4XH6A 1WAKA 4GU6A 3O5AA 2V7OA 3QZFA 5HE1A 5M56A 2CJMA 1BI7A 3IDCA 3F5UA 4JAJA 4QP8A 5DIAA 3RPYA 3UMWA 1UNGA 3NEWA 1TZDA 3OUNB 4BDBA 5HX6A 1EH4A 3R9RA 1H27A 2XZSA 3D7TB 4PDSA 2UW4A 4ZY6A 2ITQA 4HGTA 5ICPA 4GH2A 4Q2AA 5GJDA 2OJIA 1QPDA 2GSFA 4ZSJA 4BDEA 3JXWA 3MI9A 5DHJA 4ANBA 5KBRA 4DHZA 2UZWE 4X2NA 2HW7A 1B39A 2YCSA 3L8SA 4CKJA 3MSSA 5CVFA 4BJJB 2BIKB 5JQ5A 3LJ2A 4GSBA 2BPMA 5C8MA 3JVSA 3WYXA 4CT1A 3KY2A 4X3FA 4HW7A 4Q5HA 3RAWA 3CQEA 3UG1A 3RZFA 4UZHA 4B99A 4TN6A 4XV2A 3VJOA 3FMNA 5CWZA 3SOAA 5IQHA 2ZOQA 3PFYA 5HG7A 4QP9A 3R8MA 3ZDIA 5E8YA 1JPAA 2OFVA 4IWDA 2ETRA 5BUEA 5ACKA 5IQAA 1DAYA 3BLQA 3EL8A 3QZGA 4IM3A 4KBKA 5CENA 5J1VA 4FJVA 5E4HA 2XB7A 4RA4A 3FPQA 4AACA 3ET7A 2W1CA 1XQZA 1ZY5A 1BX6A 2W4KA 1F0QA 3IGOA 4M13A 4YNOA 4O7YA 1IAJA 5JQ8A 2JBOA 2PVMA 2RFNA 2XIXA 3DBDA 3EH9A 1Y8YA 4QYYA 3VS4A 4YZCA 3PA4A 3WYYA 4F7SA 1PXJA 3KA0A 4O4DA 4RA5A 3AMAA 3E8NA 5FBOA 4D1SA 1FVVA 4I6FA 3ZDUA 5AAGA 4ASEA 4RT7A 2VWVA 5FM3A 3ID6C 4FT0A 1URCA 3RPRA 4J8NA 4DCAA 3OCGA 3DLZA 3EQBA 4J53A 3W0RA 3CD8A 1PMUA 4MNEB 5ANKA 2VTPA 3FZPA 3QC4A 4FT3A 5AUXA 3TNHA 5JMSA 4C7TA 3LAUA 3LM0A 2OG8A 4KBAA 3S1HA 1CKPA 4TNDA 3Q53A 3U55A 3IONA 4FSTA 4PMTA 5ANGA 3ZO1A 5AA9A 1Y6BA 4KIQA 3MVHA 2BZJA 2QU6A 4NIFB 3WE4A 4DTKA 1BKXA 3W2SA 4E4XA 4F6UA 5BVNA 3RCJA 2C69A 4FGRA 2GU8A 2IEWA 4YJRA 4ZTNA 2BR1A 4XP0A 3VONA 1W2CA 1DI8A 5EOLA 2Y4IB 1NA7A 3BWJA 4OLIA 1T45A 1RW8A 3D5UA 3MBLA 3WOWA 1TFFA 5EOBA 3DTWA 5E9EA 4ZP5A 3NCZA 4QTBA 3FQHA 3KK8A 3FXZA 4CFMA 4O0TA 2OXYA 3GU4A 4MNFA 3QRTA 3DS6A 3NVKI 3AT2A 2C1AA 5DVRA 3LCTA 3COIA 1GJOA 3U6IA 3TL8A 5CASA 5D11A 3MPMA 3QUEA 2F9GA 4O2PA 5AX3A 1R0EA 3EKNA 3F5GA 2XYNA 4DFZE 3L8VA 2HZ4A 1O6LA 3UOJA 3R6XA 5AP6A 2NP8A 5JN2A 3AG9A 4H3QA 2CGVA 2WQOA 3F2AA 3HRCA 3TYKA 3TKHA 3HNGA 4C4GA 4I6HA 3UPZA 3FI8A 1VR2A 3KU2A 3QUPA 4JS8A 4CFWA 4DDIA 2ACXA 2QO9A 3M2WA 5TF9A 4FIGA 4ZY4A 2IVTA 3TUCA 2PVNA 3OCBA 1QPCA 2WQNA 4AT5A 2VNWA 3RM6A 2YA9A 3MH2A 1J1CA 3E3BX 2P33A 4AE6A 2XM9A 4BDCA 3ULIA 2Y4IC 1TKIA 1UU7A 5DT4A 4IBMA 4BDDA 3LFDA 4DH7A 2X4FA 3SW4A 4QYHA 4MVFA 3UP7A 2C6LA 3R8VA 3UE4A 5GZAA 1OL7A 4FV1A 4JG7A 3T9TA 3ZO4A 4DEHA 1M2QA 3PSBA 4KWPA 2NRUA 5IDPA 2YIQA 3ZUTA 1UKIA 3FHRA 3W8LA 3ZUUA 4ZSEA 3LLAA 3DXNA 3QTUA 4YLLA 2F49A 4QMTA 4X3FB 1PYEA 3IPHA 4QYGA 4UWCA 3FEGA 3A62A 3MH0A