2OU7A

Structure of the catalytic domain of human polo-like kinase 1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
292
structure length
292
Chain Sequence
AKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKVLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK1
publication title Structure of the catalytic domain of human polo-like kinase 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 292
sequence length 292
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ou7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ou7A01
1X8BA 4FSMA 3CY2A 1FPUA 5AR8A 2BKZA 4CYIA 2BIYA 3V5WA 4F7SA 3CGOA 4DA5A 1CSNA 4AW0A 4K77A 5FD2A 3I6UA 4JRNA 1XKKA 5FXQA 1PJKA 1R39A 4JG7A 4M3QA 3GU4A 3WIGA 5IU2A 4CEGA 3FZPA 2VTOA 4IMYA 3LCDA 4E26A 4QMOA 3U4WA 5HG5A 2F7EE 4NW6A 2WTKB 3ORIA 5HE3A 4XYFA 5IF1A 2YABA 2CKPA 2B7AA 4UMRA 3ZM9A 4RC3A 3P08A 2ONLA 2B1PA 3NS9A 3BEGA 4A9SA 3RWPA 2V55A 4F63A 3GB2A 2VTRA 3KCFA 3R8MA 4LGDA 3CTQA 2YM7A 2F7XE 5E92A 5AV0A 3W2SA 3F2RA 3ZRMA 4FL2A 4YTCA 2W1EA 4EL9A 1PXOA 5EW9A 2BDFA 3ZU7A 4RIXB 5IQIA 4FK6A 3BGQA 3ET7A 1PHKA 4FA2A 4B4LA 3MS9A 2Y4IC 4CZTA 4FTNA 5C4KA 5H9BA 3T9TA 1XHAA 4FV9A 4MXYA 4C4GA 2PE2A 4G6NA 4L46A 2ETMA 2WELA 4DFNA 2H6DA 3JXWA 3KMUA 4I5HA 5HI2A 4HVSA 5AAEA 3EN4A 5L2IA 3M42A 3ANQA 3PP1A 3V6RA 3AQVA 3VS7A 2UW0A 3BE2A 2JEDA 3O17A 2BFXA 3TUCA 4ZLZA 4MF0A 4ZSLA 3EN5A 5CU0A 5BUEA 3QQGA 4II5A 5DT4A 5CTPA 5LVNA 5AR2A 4WG5A 5FBNC 3Q2JA 4L42A 4MCVA 3QBNA 4FG7A 4BTKA 3BHTA 3PLAE 3KGAA 1SZMA 5BUJA 1LP4A 2OFUA 3D83A 4BDIA 4EOQA 4U3ZA 2R3GA 3EQDA 4LMNA 5CSVA 4BGQA 3WE8A 5EHYA 4ERWA 5M09A 3TTJA 4JRVA 3QGYA 2YZAA 2JDRA 3MJ1A 5M4IA 4V04A 4YO4A 3FL4A 5TO8A 3MFSA 3VBVA 2IJMA 1M17A 5BYYA 4JXFA 5B2KA 3RVGA 4XRJA 5E4HA 4RIWA 5ANKA 2PMIA 2R5TA 2UZOA 3BELA 3ZLYA 4IZYA 4G31A 4D1ZA 4R1VA 4QP4A 3V51A 3SW7A 2GTMA 4TYEA 2GNIA 4NL0A 2YIYA 1JQHA 4N4SA 4L8MA 4XP2A 4FEVA 2ZB0A 4BI1A 1LUFA 4N70A 3BHVA 3PIZA 4RJ3A 4UWYA 1K3AA 4F0GA 4DYMA 1DI9A 2WPAA 2XKFA 3UBDA 1MQBA 4A9TA 4ANSA 2X2LA 2QHNA 3M11A 1NVRA 2QOKA 3SHEA 5HIDA 4C4EA 4IVBA 5AV1A 4BCIA 1Z5MA 2ZVAA 5T6KA 4O1OA 4GUBA 1ZOGA 3OW3A 4EK8A 3I60A 2F57A 4DH8A 2PVLA 3VBWA 3GCQA 3HDMA 4Y72A 1OIQA 4XG4A 4YP8A 4O7TA 3I79A 4CMOA 4UXQA 2GPHA 3MDYA 2R3NA 2QCSA 4FTQA 4C35A 2F4JA 4P90A 3FKNA 3R9RA 4YLJA 3COMA 3BV3A 2YLEA 4O7NA 4X2FA 2BHHA 2VRXA 4HPUE 1PXNA 4QRCA 4FNXA 2I0YA 1Q8TA 4G5PA 4YZDA 2BZJA 3DU8A 4F6SA 3CKWA 3CQEA 4H3PA 1JWHA 4PMSA 3RWQA 4D4YA 1YXXA 4AOTA 5K4IA 5M57A 3KXMA 4L52A 5IISA 3R7UA 4A9YA 4FOBA 3R83A 3E8NA 5DIAA 4ANOA 2W96B 5HBJA 3NNUA 2QOOA 5H8GA 4F1TA 4X7QA 1W83A 2V7AA 2FSLX 1NY3A 3F82A 4RIWB 4EOLA 4BZNA 4R6VA 3UOKA 3LLTA 4UEUA 4ACDA 5HBHA 1JSTA 2A0CX 5AP6A 4YJOA 1I44A 3VAPA 4D0WA 2CGWA 4TWPA 3P79A 5I9ZA 2FUMA 4R77A 3BEAA 2YM6A 3A7JA 3F3VA 1ATPE 3MPMA 4QTDA 5KMKA 3OCSA 4X3FB 4E6CA 3GFEA 1OIYA 4ZTQA 1OIUA 4EWQA 5LMKC 4EUUA 2WMSA 3SC1A 3UMXA 3M2WA 4CFUA 3KKVA 3FLSA 3FQHA 3W55A 1PXPA 3DBCA 4G16A 4E3CA 3FZRA 3CD3A 3K2LA 3O96A 1J3HA 1PYXA 4FTCA 4KSPA 1PXKA 3UQGA 1NW1A 2P4IA 3LFAA 1H27A 3QUPA 3D9VA 4RG0A 3ZO2A 5EKOA 5HTBA 1YXUA 5KZ0A 4BFMA 1OUKA 3DKGA 4IBMA 5EI8A 5M06A 3BWFA 5L8JA 4WKQA 4GIIA 3TIYA 2HIWA 4IW0A 3OXIA 2HWOA 3GU7A 3MV5A 3GFWA 4JDHA 5FWKK 3DB8A 3HLLA 3FXZA 3SG9A 3UG1A 2BIKB 5DHJA 4DH7A 4MBJA 4FKPA 3IS5A 1ZYSA 3C13A 4YPSA 3BGPA 3ORKA 2VWXA 3TJDA 2W5AA 1RE8A 3OOMA 4MXXA 3BHUA 4Y95A 3WI6A 4NH1A 4GV1A 4IB3A 1UV5A 2Z2WA 3ORXA 3W1FA 2WU6A 4EHVA 1YQJA 3WIKA 2BPMA 3QZGA 2XKEA 4CMTA 3HV4A 5KMMA 4NFNA 3ATTA 4YC6A 4E20A 5HU3A 1WAKA 2X4FA 3HGKA 1PXMA 3HNGA 2XIXA 3K5UA 3VN9A 2XIZA 4CKRA 3G15A 2PZ5A 4USFA 3PE2A 3FQSA 2BTRA 3DZQA 5C8MA 4TRLA 4RZVA 3MYGA 3PZEA 2GHMA 3BYUA 5AUZA 2BILB 2YCSA 4KD1A 4KA3A 3ORNA 4ACGA 2PMNX 1JPAA 4XG2A 3R7EA 4AZVA 4BCFA 4QYGA 3D94A 3IO7A 2HY0A 3M1SA 2C3IB 3D7TA 2FA2A 5EW3A 2HZ0A 3HVCA 2B54A 3IG7A 3UC4A 5IDNA 5J5TA 3UO5A 3RAHA 3ETAA 3O2MA 4G1WA 1OITA 2VTTA 3OWLA 4IB5A 3S3IA 4AG8A 4Q5EA 4V01A 5JFSA 3VO3A 4CFXA 3FI8A 4J7BA 4UMUA 2J9MA 4QP1A 4ANBA 2XVDA 3KC3A 3D7ZA 4QMZA 4RIOA 1DI8A 2Z02A 3DKCA 3QD4A 4DBXA 3JVRA 4QTAA 2QKWB 4PPBA 3RNIA 4LV5A 3WF5A 1Y91A 3A99A 4RSSA 5BMSA 2R3IA 5CANA 4X6RA 5I5ZA 3I1AA 4FIHA 5HNGA 4OLIA 1Q61A 2PPQA 3BHYA 3PXQA 5J9LA 5EM8A 3W33A 3DGKA 3RP9A 4RX9A 4JS8A 4C4HA 2JKQA 3P7BA 5AUUA 2O64A 3G2FA 4FMQA 3VNTA 3BV2A 1OIRA 4TYJA 2CPKE 4EYJA 4DBNA 4U80A 3BZ3A 5M53A 2O8YA 2CGVA 2BTSA 2WTJA 3L8XA 3MH1A 4RVMA 2VO6A 4RC2A 2YFXA 5CU3A 3FMHA 5GZ8A 1IA9A 4WNMA 1OKYA 1YHWA 3LVPA 1GIJA 2WEVA 3GOKA 4GG5A 4GS6A 1KOBA 3HP5A 3P7CA 3QYZA 4NFMA 3OG7A 3UP7A 2JC6A 4A07A 4F64A 5B0XA 2OU7A 4EH7A 3IKAA 3UNJA 4BHZA 5CVGA 4QQJA 4Y85A 1WBVA 2QNJA 5T3QA 4K9YA 4GVAA 3U4UA 3UOLA 3V04A 3T8OA 5J5SA 1O9UA 2QQ7A 2UVZA 3DZOA 2XIKA 1IR3A 1XH6A 1GZNA 2CLXA 4B8LA 1WBPA 4LM5A 1Q8YA 3LJ0A 5F1ZA 4AU8A 4C4JA 2ITQA 3ANRA 3KEXA 5AIKA 1ERKA 4FICA 5BPYA 1PXJA 4IVDA 4F08A 3UODA 1VJYA 3LOKA 5LXMA 1P5EA 5FEEA 2VTJA 5I0BA 4OTFA 2OK1A 2R0UA 2UW6A 3I4BA 1JKLA 3QD0A 3CY3A 4FNYA 4BHNA 4EK4A 3U87A 4PP7A 4O91A 3DLSA 4JDJA 5M44A 4PV0A 2CN8A 3PPJA 1YWVA 4OGRA 3ORTA 3HV7A 3UYSA 2W9FB 4YSJA 4OBPA 2GCDA 4KIQA 3WF8A 2RG6A 3EFWA 4EOOA 4IZ5A 2ZMCA 4DG3E 2YERA 3Q5IA 2UZBA 2WTKC 3KU2A 4AGCA 1G8SA 4BDJA 4KRDA 5E7RA 3TXOA 3UOHA 5IQCA 3A7HA 1XH7A 4HVIA 2VGPA 2B4SB 4B99A 4CFNA 5HCXA 5HD7A 3K3IA 3QQKA 4GVJA 2I0EA 2LAVA 3KA0A 3PIXA 4QMQA 2GMXA 2QOBA 4M15A 2WIHA 5DRDA 3RPSA 2UZEA 4XHKB 4USDA 4YR8A 3EN7A 3RI1A 4Z7GA 4HZSA 5CEPA 4DFUA 3COKA 2R9SA 3MH0A 2DS1A 3RPOA 3EB0A 3R1QA 3HA6A 1OPJA 1SVGA 4EC8A 3NYVA 4O27B 3A62A 3I81A 2X4ZA 1BYGA 3TJCA 3V5TA 3DOGA 4FTLA 5EYDA 1J91A 3DNEA 1J7LA 2JIIA 3KVXA 4JBOA 4MNEA 4O7LA 2FH9A 5LCJA 4RC4A 3PYYA 3FEGA 5AR3A 4NIFB 3PJCA 5E8SA 2R7IA 3EFLA 4F6UA 3VW8A 4UY9A 4BCMA 3I0QA 4XV3A 3WZJA 3ZTXA 3L9LA 3OCTA 3OW4A 4QP6A 3R2BA 3O7LB 2GNLA 4QMYA 3UIBA 2VWUA 3GI3A 4IACA 2DYLA 1TQPA 2CDZA 5HG7A 5HVKA 2VX3A 4ZTHA 1PMEA 2AC5A 3GP0A 3AT3A 4CV9A 4FKGA 1U5RA 3PVWA 4E5WA 5H8EA 5HORA 2OZAA 3BIZA 4S33A 1QMZA 3FC1X 3QAME 5LOHA 4FV8A 4G34A 4YTHA 4EOSA 3LJ2A 4NU1A 5EG3A 5FP5A 2IZSA 4EH3A 1XR1A 3IGGA 3PA5A 2NO3A 5CX9A 3F3UA 4XUFA 1E1XA 4FUXA 4FI1A 4RX5A 3D0EA 3MVLA 2IN6A 2F49A 3O71A 4DH5A 5A4LA 3QTZA 2BZHB 3H9OA 5HESA 3EQCA 4FV0A 5J8IA 1ZMWA 4ZTSA 5BVOA 4LV8A 4U0IA 4U41A 3NYXA 1PW2A 4GEOA 4EK3A 4NKAA 4BB4A 4PMPA 3VUTA 4AE9A 3CLYA 3LAUA 2W1GA 3BLQA 3CXWA 3EFKA 1Q97A 3LMGA 4FSUA 4HW7A 4RVLA 4JQ8A 2JDVA 4KWPA 4MNEB 3OVVA 1W8CA 5ANJA 1ND4A 3ERKA 4XX9A 4G6LA 2FSMX 1H26A 4MF1A 2PVNA 2IZUA 3DT1A 3GU6A 3RMFA 3BQCA 1OKWA 4F65A 2G01A 2WFYA 4RMZA 1W84A 3W8LA 1ZYJA 3JUHA 5HICA 5KHXA 3UNKA 5BVKA 3CS9A 2CNQA 5EM5A 4JR7A 5KNJA 1OMWA 3QRKA 1ZRZA 1H1RA 5IA2A 2X9EA 3PXYA 1JKKA 4IH8A 3RPVA 2VTIA 3MH3A 4MXZA 3UE4A 4OAVB 3HA8A 3QQJA 4IANA 4NCTA 2V7OA 3KN5A 1IAHA 1ZY5A 2B9JA 2OZAB 3BQRA 1Q24A 3QD2B 4C4FA 3CPCA 4N0SA 1HCKA 3O7LD 2WQNA 2XS0A 3P86A 4FV4A 2GS6A 2BALA 4I41A 4RA5A 1GZ8A 3EQFA 4B9DA 4IAZA 4IVAA 3F88A 2QVSE 3AD5A 5D7AA 3UYTA 3DDPA 1G3NA 4IX5A 4QYFA 4RA4A 3FQEA 2OBJA 3KK9A 4ITIA 4BN1A 4MNFA 3K5VA 2WO6A 3KVWA 4KS7A 4U3YA 4O6EA 1J1CA 3B2WA 3GC7A 3AGLA 4C61A 4I23A 3I5ZA 2WD1A 3MN3A 1B38A 4IFGA 2O5KA 1GJOA 3PDTA 4M67A 4YTFA 4JR3A 3KULA 3COHA 3F7WA 4FEQA 5EYMA 4CZYB 2C47A 4IWQA 3FZ1A 4UWCA 4DEIA 4FTKA 2YA9A 1PMVA 4JG6A 3D4QA 3B8QA 3VBTA 1WCCA 3TG1A 2B53A 2BAQA 2F9GA 3F2AA 2EB3A 2IVSA 4G3FA 2PTKA 1OL6A 4GJ3A 1SMHA 1U4DA 2V0DA 3CBLA 3KF7A 4PQNA 2BDWA 1UA2A 5K0XA 5EDQA 3UNZA 5I9VA 5M4CA 1KE5A 3AG9A 5DT3A 4ZMFA 3VJOA 1OI9A 2BCJA 4FE2A 1VYZA 1KV1A 3OMVA 2V62A 4XV9A 4OTQA 1ZMUA 3D5UA 4R1YA 4O0RA 5CT0A 3EZRA 3IQ7A 3NUNA 2B55A 4Y8DA 4XOZA 4AW2A 5I4NA 4IAIA 3WARA 3LFFA 5CF6A 1O6YA 3EQGA 2YM4A 4TYIA 4PPCA 3IDCA 5ANIA 4CRSA 1XH8A 3FMKA 4DCEA 3ORLA 2EXMA 3BYMA 3U9CA 4OTRA 3V6SA 4BDCA 4E4XA 4Z7HA 4CSVA 3R8ZA 4QOXA 3KMWA 3ACKA 4EORA 4UB7A 4NK9A 4AA4A 3F3WA 4ZTRA 2VWBA 4FOCA 1BKXA 4TY1A 3BBTB 4UMTA 4FKLA 3TV4A 1YVJA 4U45A 3R7OA 3W18A 3Q04A 5C27A 4YZMA 2FB8A 4NM7A 4RLLA 4DEEA 4D2WA 2Q0BA 4GFGA 4ENYA 1J7IA 5TKDA 2BRGA 2W4JA 2JITA 5GHVA 3KULB 5L6PA 2ZDTA 2UZWE 5FGKA 3R01A 1NXKA 1XH4A 2P33A 3MY0A 3RKBA 2UW7A 4FZDB 4EHGA 4EKLA 5FXRA 2RGPA 3FMMA 4CMUA 3KXNA 5IKWA 5KMNA 4S30A 2IVTA 3H0YA 3UO6A 5A4QA 3G90X 3KB7A 2GNFA 4U8ZA 4BDEA 4IADA 4KABA 4Q5HA 3DAJA 4TYGA 5J87A 4ZTMA 5BMMA 4DLJA 4EH8A 5AUTA 3ORZA 4DFYA 3WF7A 3CTJA 2IZTA 3HV3A 4WNKA 5CEQA 4EOPA 4AACA 3G0FA 3FLWA 3O50A 5EQPA 1DAYA 5DE2A 1ZY4A 2G15A 4LFIA 5HE2A 1DM2A 4EJ7A 1URCA 2QO7A 2R3MA 3DBEA 4YZ9A 5KE0A 4IX3A 4QMXA 4ALWA 5A3XA 4C62A 3ULZA 1P2AA 2C68A 2Y6MA 4U81A 3ZOSA 3R1NA 3EKKA 3E3PA 3PY3A 3OBJA 2H9VA 3LXLA 4M66A 3VS5A 4B6LA 2BKKA 4QMUA 3UG2A 4F9WA 4D55A 3Q6WA 1J7UA 5E9EA 4MQ1A 2GHLA 3PVGA 2W7XA 4BBFA 2R3OA 1M14A 1GIHA 3REPA 2OJGA 2WMWA 3FLNC 3BX5A 3NNXA 1YOJA 3U6HA 3UDBA 3CD8A 3A4OX 3IOPA 3W10A 4C7TA 3LFSA 5JKGA 4NT4A 4R8QA 4QT1A 4XNEA 1GNGA 5HO6A 4BCHA 5D9HA 4AZEA 4ZTLA 3DXPA 4TZRA 5EYCA 4IZAA 4JX3A 4RLKA 1H07A 3LQ8A 3OROA 1Q3DA 2CCIA 4O2ZA 4TYHA 5FTQA 2PZRA 3ELJA 4ANMA 4BTFA 2I0HA 4R3RA 1MUOA 3R28A 5D11A 3SXRA 3BCEA 5HKMA 2E9PA 1WBWA 1P14A 2QLUA 2ZV2A 4UMPA 2E9UA 2OH0E 4DTAA 3Q9ZA 2BDJA 3KRLA 3ZFXA 2ITPA 4QD6A 3S95A 1GY3A 3OD6X 3Q9WA 3KRRA 2CKQA 3ALOA 2XNMA 3TKUA 4DAWA 3Q4UA 4EWHA 3NIZA 4S31A 2OXDA 3WYYA 2WHBA 4CG9A 2RF9A 2GHGA 4ALVA 4QTBA 4TL0A 3TNPC 2NRYA 3EQBA 5CVFA 1KUTA 4F4PA 4KSQA 2P2HA 2X0GA 2PUPA 2A27A 4BZOA 2RKUA 4C58A 3GUBA 4HNIA 3Q4ZA 3UVPA 4IB1A 2VTQA 1FVTA 1UVRA 2W99B 2WNTA 1DAWA 2XBAA 4IVCA 2OJFE 2WZJA 4OTPA 3SLSA 4EHZA 2YAKA 2IW9A 5HTIA 1MQ4A 5ANGA 1MRUA 3PJ3A 2P0CA 2XNGA 3ORPA 4YJTA 5E8XA 4ZZOA 2CKOA 2JKMA 2REIA 4KKHA 2XZSA 4NKSA 3GT8A 2OO8X 4D9TA 4YU2A 4HPTE 3GEQA 2VTAA 4ASXA 4EJNA 4MTAA 4Z3VA 3A7IA 5A9UA 3PUPA 2VTNA 3FSFA 1AGWA 3ZFYA 3KQ7A 3LCTA 3QKKA 4DTKA 2YJRA 5D10A 2GU8A 5D7VA 4XOYA 3WOWA 4XG9A 4F9CA 4F7JA 1I09A 1NT2A 2Z7SA 3QRTA 4TN6A 4TYHB 4D2TA 3RCJA 4EZ3A 2C0IA 2E9OA 3WF6A 2YIWA 5AJQA 4A9RA 4M14A 3EN9A 3PRIA 5AIRA 3DDQA 4DC2A 4YBJA 1JVPP 3RAKA 3MI9A 2WMVA 4BDHA 4KINA 4F9BA 4XMOA 3RCDA 5LJJA 3N4TA 4FTRA 4F70A 2X7GA 3GBZA 4DHFA 2Z8CA 4CNHA 3DB6A 5FTOA 3UIMA 4M7IA 3MIAA 3HZTA 4DH3A 3WZDA 4G3EA 5CI7A 5GJFA 3CQUA 4IDVA 3AC8A 4Y46A 5CT7A 2QG7A 5L6OA 1A48A 3QUDA 4KKEA 4C57A 2P3GX 5CAQA 3AGMA 5HG9A 4DCAA 4DGLC 5DI1A 1FQ1B 5JH6A 4MK0A 2C6KA 2YDKA 3VC4A 4CGAA 4FIJA 4AW5A 3E93A 4XG7A 3R21A 3R7YA 1UU8A 2QURA 4XJ0A 3S2PA 4I93A 3FLQA 4CCUA 3NWWA 3OT3A 2PMLX 2RFDA 3QTRA 1WVXA 2PWLA 3T3VA 3TZ7A 1OBDA 2YIXA 3NZ0A 4O22A 4XBUA 3U54A 5I9WA 1ZLTA 3KMMA 4CQGA 5ITAA 3Q4TA 4X3FA 3R63A 5AR7A 2C3LA 3EQIA 3MFRA 2HW7A 4FEWA 4PDOA 2QOLA 2CGXA 2OIQA 3BWJA 1UKIA 3NEWA 3CTHA 3QGWA 2R3LA 2BRHA 1REJA 3QX4A 1QPEA 5HCYA 3QKMA 1R3CA 1H1WA 3G9LX 2X1NA 5DRBA 3DJ5A 2ITWA 3W2PA 4ZJIA 1G5SA 4JBQA 4MEDA 5CAPA 2R3RA 5FDXA 1YKRA 2A19B 2OKRA 3EZVA 4CTCA 3KN6A 4BDKA 5A46A 2XRUA 3NDMA 2W05A 1MP8A 2PL0A 1M7NA 4GRBA 3UZRA 3HL7A 4O2PA 3UC3A 2IG7A 3FI3A 4IAAA 3SOCA 4N6ZA 5EQEA 3MVMA 3PXRA 4OUCA 3R22A 4UZDA 4EQMA 4AZSA 1H8FA 4LOPA 4FVRA 1VZOA 4AXAA 5FBOA 4KS8A 4XEYA 1RQQA 5EHLA 4AZWA 4BKZA 4I0TA 4EUTA 2PYWA 4FKTA 1BI8A 3E7VA 4JL9A 3Q52A 4HYUA 3RINA 4TNDA 4X2KA 4FKUA 5CXHA 3VHEA 3CJFA 1DS5A 5DVRA 4IFCA 2C6EA 3BE9A 4NSTA 5DG5A 3NVMB 2BHEA 2VWVA 2Y8OA 4W4WA 2HZ4A 3DKOA 2XIYA 3MESA 4RJ6A 4OTHA 2WOUA 5EYKA 1KE6A 4AGWA 5KKRB 3PY0A 3EJ1A 3TZ9A 2YIRA 4J8NA 3QC9A 4OBQA 5JZJA 4JLCA 4BDDA 4EH9A 2Y0AA 1Q99A 2VU3A 5I3RA 1B6CB 2ZM1A 4E5AX 3UQFA 3FMNA 4IAYA 3RZFA 3RK5A 3GQLA 2C1AA 4AUAA 3FLYA 3HECA 5LVPA 3EFJA 2WKMA 1H0VA 5AP7A 2VTLA 4LOQA 4ZS0A 3VUMA 3VUIA 3R00A 2WQBA 4I3ZA 4A4XA 2OJ9A 4MBIA 4BKJA 4D1SA 4XBRA 1ZZ2A 1JSUA 3WE4A 4ASDA 3LFBA 1WBTA 4DN5A 2PVFA 4ZSAA 2BRBA 4C3RA 3H0ZA 4C3PA 5M4UA 3VVHA 4BF2A 3SA0A 2R2PA 2DUVA 3H30A 4PDSA 4U44A 2XK8A 2HYYA 1OPKA 4R5YA 2G2IA 4O84A 3V5JA 4XLIA 2CGUA 4EZ5A 1UU3A 2VWYA 3ZEWA 1MRYA 4FTAA 3R2YA 4RX8A 3PTGA 4NCTC 2P55A 3PPZA 5IQHA 1HOWA 3GCPA 5DA3A 5TE0A 4M12A 3P1AA 4YC8A 2PE0A 4DT9A 2CLQA 4QYEA 4NZWB 2BUJA 2WMUA 2H34A 5TF9A 1OL1A 1YXVA 2C5VA 4AFJA 3ZFMA 3EL7A 2WQOA 3FL5A 3RZBA 1ZYCA 1F5QA 5HTCA 4HYSA 3U6IA 3D2IA 1H1PA 2OIBA 4U5JA 2PE1A 1XH5A 2UW3A 3LFDA 3NLBA 3ZSGA 4ASEA 4EOMA 5CASA 3ZDUA 2ACXA 3ZLWA 4BDBA 1G8AA 4ZMEA 2PMOX 2OW3A 3PSBA 3UPZA 1O6KA 1WVYA 2RFSA 4IJPA 4J95A 3MPAA 1WBOA 4KBAA 1YW2A 5B2MA 4MAOA 2VTPA 2ITOA 3W32A 5BQ0A 2YITA 1L3RE 4QQCA 4OR5A 5HE0A 5IQAA 4RQVA 3FC2A 2JBPA 4JT3A 5ETAA 4I0SA 5C26A 3O8TA 4JG8A 1XWSA 2R3FA 4CV8A 4OTGA 4BIEA 3E8DA 3VJNA 1K9AA 3KREA 2XM8A 3LXPA 2PUNA 1PKGA 2YDJA 5ANDA 2EXEA 3FXXA 1T46A 2A4LA 2BAKA 3HRCA 4QTCA 4WSYA 4EC9A 1Y8YA 4FG9A 4CT1A 1OUYA 2I1MA 2JAMA 1FMKA 3DTWA 3FSKA 3HMPA 4ENXA 3KRJA 4J53A 2XCHA 5EH0A 5L8KA 2PVHA 1H24A 3OS3A 4WG4A 5E8ZA 3QWKA 1L8TA 4BYIA 1K2PA 3QALE 2QR8A 1FGIA 2BZKB 3ROCA 2GS2A 2XNPA 1Y6AA 3II5A 4DGGA 2VGOA 1SNXA 3NGAA 4FODA 2YHVA 1MRVA 3PVUA 4J52A 5LCKA 4E4NA 5C01A 5E91A 4BYJA 3TM0A 4GYGA 3NRMA 4GMYA 2GQSA 4O7SA 5HEZA 2XCKA 4PTGA 5A6OA 4L44A 5C03A 3Q9XA 3CPBA 4FV6A 3QQHA 4MWHA 4J98A 4HVDA 2XYNA 4A4LA 4FIIA 2XKCA 3L8PA 3MGYA 4QYYA 4FSYA 3TDWA 5AA9A 4LL5A 2ZOQA 1PKDA 1W82A 3KY2A 3FMLA 2CCHA 2OSCA 2R64A 4E4LA 1UWHA 3QRUA 1CM8A 4K6ZA 5GIOE 3FBVA 4ZLYA 4RQKA 5EI2A 4RGJA 4I6FA 3FUPA 5BVWA 4ALUA 1KE7A 4QP3A 4BC6A 4EEVA 2ZM4A 4RWLA 3SGCA 4DEDA 5KMJA 1ZOEA 1UU9A 1W98A 3C1XA 5KMIA 3TUDA 1QCFA 2KULA 5HX6A 4NIFA 4ONAA 4PUZA 4XP0A 3C7QA 3NSZA 3KRWA 3SDJA 3GC8A 3R8LA 2XNBA 2X7FA 3LKMA 3GNIB 3UVQA 4ZAUA 4BI0A 2YLFA 2OF2A 1Q4LA 4K8AA 2J5EA 2RIOA 3C0GA 3LW0A 3TI1A 3NCZA 3ZO4A 5IA3A 2QONA 4AA0A 4O86A 2FSTX 3V8WA 3NIEA 4BBEA 5AUVA 3TN8A 4CKIA 2C5OA 5GNKA 3EH9A 4O0TA 2YWPA 4W8EA 5HLPA 4DFZE 4EH4A 4NWMA 3RNYA 4FEUA 2G2FA 2JDTA 2O65A 3NAXA 2HELA 2ITXA 4FEXA 3QFVA 2WEIA 3GCSA 5B7VA 3TL8A 2V22A 2RL5A 4HCVA 5CNOA 4C59A 3OXTA 5D1JA 4F1MA 2J2IB 5IQEA 2UVYA 3I5NA 3UZPA 4I4EA 3U55A 3TNHA 3BBWA 4DGNA 5G6VA 4CD0A 5CI6A 3HRBA 5KBQA 3ITZA 4E6DA 2XM9A 3R04A 4N57A 1CTPE 2PVYA 2E2BA 3FYJX 2OIDA 1TKIA 2G1TA 3MFUA 4NM5A 4G6OA 5BYLA 2WTVA 3FWQA 1E9HA 3OWPA 4FSRA 2SRCA 2XUUA 2X2KA 4FKJA 3R8PA 3QTSA 5AP4A 4S34A 3QUEA 5LARA 3KFAA 4K2RA 2IO6A 3QTUA 4QYHA 4EI4A 3DXQA 4ZSGA 3OT8A 1RW8A 1H0WA 1NVSA 1T45A 3CQWA 3QKLA 4RX7A 3NUXA 4KUJA 5IDPA 5K5XA 2UZDA 4FSTA 5HLNA 2GFCA 5BVDA 3F3ZA 4FK3A 4UWBA 4QMTA 1JSVA 4E73A 4E7WA 1A06A 3PSDA 3LLAA 5AR5A 2QOQA 3QTXA 1PXIA 4J1RA 5H2UA 2VWIA 4MD9E 2PVRA 4WIHA 3HDNA 4G9RA 3MW1A 4BCGA 1FBNA 3LMHA 3LM5A 3VUDA 4KBKA 5IA1A 5I9YA 3MVJA 4XCUA 2Y4IB 3PWYA 4YJVA 4FC0A 3E7OA 3FHIA 4FV5A 4R5SA 5AV2A 1ZMVA 4MX9A 4ERKA 2CNUA 2BROA 4GK2A 2VTHA 3G6GA 1YOMA 5F4NA 3KXGA 5CZIA 2QR7A 5FRIA 1LR4A 4TWCA 5AP0A 1GZOA 1SYKA 4DF3A 1Z9XA 4AP7A 2B9IA 3K54A 3Q53A 4MXOA 5IUGA 4E5BA 2WMRA 2W1CA 3BRBA 3TV7A 1ZARA 2ONLC 3RK9A 4F9AA 2WMAA 5JGDA 3F5XA 2WTDA 3ODZX 3LQ5A 3I0OA 1YHSA 4BL1A 4H3QA 1Q8WA 3AMYA 3VS2A 5FM2A 5A4TA 3IPHA 5JRQA 2C5XA 4YJUA 4ZSJA 3LIJA 1OM1A 5JSMA 4FTJA 3QLFA 3Q5ZA 4K33A 4X21A 4JIKA 4AQCA 4Q9ZA 1LPUA 2J6MA 5E90A 4WRSA 5AV3A 4F0IA 1IAJA 1YDTE 3IDPA 3Q9YA 4LL0A 5IH4A 2ZV7A 3TIZA 4FX3A 3OTVA 3I7BA 4B0GA 4MWIA 5J9ZA 4BCOA 4GJ2A 4GT4A 3PFQA 1SM2A 3IW8A 3OWJA 5AUXA 2VO7A 4XRLA 4O82A 4R3PA 3RBWA 4AA5A 4S32A 3IW7A 4J96A 3P23A 1Q8UA 2UZNA 1A9UA 1M2PA 4LUEA 4WRGA 4CLIA 2NP8A 3DBDA 4FT0A 5J7BA 3MSSA 3FJQE 4HOKA 2XB7A 4XH6A 1VEBA 5EOLA 3ENHA 2J0IA 5ETCA 4GFMA 5C9CA 3TKIA 5IA0A 3TWJA 3EYGA 2HZIA 3EYHA 4J71A 3TUBA 1FGKA 2YJSA 5E8UA 2QOHA 3LHJA 2ZJWA 4R3CA 4H58A 4KAOA 5DR6A 2XJ0A 1XBBA 4PWNA 4XP3A 1V1KA 1QPCA 5J1WA 1AD5A 5KZIA 4HVHA 3RTPA 5JGBA 2NRUA 2Q0NA 3GU8A 2GTNA 1O6LA 2VN9A 3PJ8A 2WMBA 4OTIA 4E93A 4CT2A 5HQ0A 1EH4A 2RG5A 5M55A 3HYHA 2PULA 2I6LA 3Q4CA 1F3MC 3FE3A 4AF3A 4AZFA 3GXLA 4X3FC 4H36A 4UX9A 1SVEA 1WBNA 2QOIA 3LXNA 3Q3BA 3C0HA 2C6LA 2DQ7X 3R6XA 5AADA 4YJSA 1XBCA 4QNYA 5EM7A 2KTYA 4FKRA 4BVUA 3HMOA 1IEPA 2JGZA 3HP2A 2ITUA 4L01A 4NM3A 5DBXA 1VR2A 2YISA 3W8QA 4AAAA 3EQRA 4O0VA 3R9NA 3ULIA 5JMSA 3LZBA 4GKIA 1FOTA 4NEUA 5CU2A 4C37A 4JIAA 2YACA 3RAIA 4GCJA 2W4OA 1B39A 3LMIA 2IVUA 3HMIA 5AWMA 3ZZWA 3GU5A 4V0GB 3BLRA 3MB7A 3RPRA 4CQEA 2HOGA 3JYAA 5HO7A 3A7FA 2JIVA 2WU7A 4O7WA 3Q60A 4R78A 3IONA 3GC0A 4NTSA 2OJJA 3HAMA 4PRJA 4R7HA 4I20A 4HGSA 5IMEA 3PA3A 3VUGA 3W16A 3QHRA 5JQ8A 1R1WA 3OF0A 4FIGA 4CFWA 5CY3A 4B8MA 3P0MA 4I92A 4CFMA 1GIIA 3UGCA 3G9NA 2OICA 4ZS4A 2QO2A 3TTIA 4EZ7A 2VD5A 3R9HA 3DFCB 2OFVA 2QO9A 2BAJA 2WQMA 4D2RA 5F94A 2ZDUA 5AEPA 3E87A 4GFOA 1WMKA 1Y8GA 2FGIA 3QLGA 3QRIA 4G3CA 3QXOA 4FTMA 2ZAZA 3NW5A 4HVGA 3D5VA 5IEYA 4QMPA 3AD6A 4JQ7A 2B0QA 4YBKA 3QCYA 4JNWA 3SRVB 2JFMA 2A2AA 3R8UA 1UNLA 3WZUA 5TT7A 4ACCA 4CYJA 3MA6A 2V5QA 2B52A 5KHWA 2JIUA 3WZKA 4D58A 2XEZA 2PK9A 3FY2A 3OUNB 5HLWA 2X81A 3NYNA 4QO9A 3BKBA 5AR4A 5TR6A 4UALA 5LMBA 3I6WA 4D4RA 4I4FA 4LRKA 2UVXA 4GW8A 3MTLA 3E88A 3HV6A 4F1OA 5BVEA 4FT9A 3VS1A 2ITTA 2EVAA 3OZ6A 2VV9A 2W5BA 3ZBXA 4ZJJA 5EKNA 3RPYA 4MKCA 2IW6A 4I5PA 4FTIA 5EDPA 3BLHA 4KIOA 5CAVA 2Y9QA 4GKHA 3Q32A 5CLPA 5IUHA 2C6MA 4EQUA 4FBXA 4U79A 3FXWA 3QRJA 2W1IA 2CMWA 2ZV8A 3AOXA 4QPSA 5E1SA 4KIKA 4E8AA 3ROYA 1ZXEA 5ETIA 4D2PA 5F9EA 5EK7A 4BDAA 2J0LA 3ZRKA 4U7ZA 4BIDA 3ZMMA 3FPMA 4P5ZA 5JQ5A 1IASA 2C1BA 4E6QA 4EOJA 3LJ1A 2BR1A 2C3KA 4TWOA 4QP9A 2HW6A 3NX8A 4WBBB 4WO5A 5TOZA 4H1MA 3QTQA 2WB8A 3SW4A 4EYMA 2FYSA 4Z16A 2ZB1A 3EQPA 5HVJA 2UZUE 3ZH8A 1LEZA 1ZAOA 2CSNA 4BCKA 2YIQA 5GINE 3VS3A 3P4KA 3BYVA 5D12A 3MIYA 2H96A 4HCTA 1KWPA 3Q2MA 3H10A 4V05A 3TNWA 3V5QA 2C6TA 5CXZA 1YXTA 4DINA 2R7BA 4U9AA 5EI6A 4MBLA 3E63A 4O81A 3ZM4A 2H8HA 5LMAA 4LUDA 4ANQA 2QI8A 4WNOA 4ZJVA 1UKHA 1S9IA 4EQCA 2QD9A 4DEHA 5A14A 4KBCA 3ZXZA 5LVOA 1GOLA 4EH2A 3L1SA 4W8DA 3D5XA 2IWIA 4BI2A 4D5KA 4EBWA 4OAUC 2UUEA 4FL1A 3JPVA 3MFTA 4XG8A 5HZNA 5JZNA 2OI4X 3G51A 3WYXA 5LQFA 2W4KA 2DWBA 4WNPA 5JFXA 2WXVA 1M52A 3W2RA 3THBA 2WTIA 3HMMA 3LFCA 4R7BA 3CGFA 4MVFA 4PP9A 4CXAA 2O0UA 1YI3A 5JK3A 3F3TA 3SG8A 4C8BA 1YWRA 2Z60A 3CKXA 2WGJA 3VS6A 4ASZA 4W4XA 1V0BA 4EHEA 1YXSA 4KIKB 2ITZA 2CJMA 1OB3A 4DEBA 3DA6A 4TPTA 5BYZA 4IC7A 5CALA 4GT3A 2PZIA 4F0FA 2C30A 4X2JA 4I0RA 4IM0A 3PXFA 3RM7A 4MH7A 1P4FA 4FSQA 3IW4A 3WZEA 3DNDA 3FI4A 3AC5A 2E9VA 5IH6A 3A60A 4CZUA 2W5HA 3ZCLA 4O0YA 3UOJA 3E8CA 4FKOA 4C2VA 4I1ZA 4D2SA 1H1QA 2UZTA 4RWJA 4M84A 2JLDA 1IRKA 2XK9A 2GNGA 3UPXA 3IECA 3S00A 4C33A 3VUKA 4PTCA 3UVRA 4FSZA 3SD0A 1YHVA 3GQIA 3R9DA 4GL9A 4F9YA 5CF8A 5K9IA 4KNBA 4YLLA 3V01A 5CSHA 3F69A 4M69B 3A2CA 3ZDIA 4L3PA 2R4BA 4HNFA 3DY7A 2C6OA 4S2ZA 4AE6A 3R02A 3SVVA 1E1VA 3PY1A 4RJ5A 2YN8A 2GDOA 1H1SA 1KSWA 3OEZA 3QZFA 3QQUA 4Z9LA 4P5QA 3FAAA 4O7YA 4H39A 1LEWA 4ZOGA 1QPDA 5FP6A 4D2VA 4X6QC 5IEXA 3NCGA 2PUUA 3DCVA 5M56A 2PVJA 4GYIA 5L2QA 2R3QA 4HZRA 5AP1A 4PDYA 5KUPA 4FV2A 3TDVA 5ETFA 2JAVA 3PG3A 4PY1A 3OWKA 2C6DA 2ITVA 4RPVA 4OBOA 4X0MA 1WBSA 5FLFA 3QA0A 4JBPA 4EKKA 4O38A 5CSXA 1WVWA 2YM8A 3O8UA 4QQ5A 3QCSA 2HXLA 3W2QA 2HZNA 3C9WA 3NUAA 4FKIA 2OJIA 4Z55A 1ZYDA 3DBQA 3ZO3A 2R3KA 3NUSA 3EMGA 4RFZA 4CLJA 1YWNA 3HMNA 4IWPA 4L00A 4AW1A 4U97A 2EB2A 3UTOA 3P5KA 5ANEA 4AOJA 5DLSA 3R0TA 4TNBA 4LYNA 4C34A 3R7IA 3D14A 4M13A 4NJDA 3S1HA 3P78A 4G9CA 3VBYA 2R3HA 1UWJA 4C36A 3EL8A 3VQUA 3AT2A 3ZO1A 5AV4A 2HWPA 4YHTA 5F95A 4F7NA 2O2UA 4W9WA 4TXCA 1GAGA 3NNVA 5EHOA 5CNNA 1NVQA 5HG8A 1KE8A 4BWPA 4I94A 3MBLA 3QWJA 2YAAA 5EFQA 3NAYA 2G2HA 3IDBA 4CCBA 3PA4A 4W4VA 2XK4A 3ZBFA 4APCA 2QG5A 5J7HA 5I9XA 2PHKA 2YDIA 4U40A 1FVVA 3HAVA 4FNWA 2B9HA 2VNWA 3B8RA 3MTFA 3C5UA 4A06A 3DK3A 1XBAA 2R0IA 4FUYA 3FI2A 4MQ2A 5AP2A 4ITHA 2XJ1A 3AXWA 4BR3A 4JAIA 5C4LA 4L7SA 2JDSA 4IWDA 3QCXA 1OL5A 3U8WA 5DT0A 5FM3A 1IG1A 3LXKA 4BGHA 4AWIA 1V0PA 5CAOA 3VBXA 1OKVA 1SVHA 2C0OA 4Y83A 2QC6A 4RZWA 4EOKA 3OUKA 3OTUA 4GSBA 3DQWA 4WOVA 4QMVA 1H28A 2XK6A 5JGAA 2C5NA 3BYSA 2QOFA 4AX8A 4LRMA 3ZLXA 3EOCA 1RDQE 4GK4A 4IXPA 5HD4A 3L9NA 1CKPA 5JT2A 4IB0A 2OLCA 3HUBA 4DG0E 3W2CA 3RAWA 4FKSA 5KMOA 3KF4A 4FZAB 4WUAA 5EDRA 2Y6OA 2OF4A 1XQZA 5DWRA 3BU3A 4HYHA 5JN2A 5IQBA 2B9FA 1M2QA 2J7TA 3RHKA 4ACMA 2EU9A 4BRXA 4M8TA 3HV5A 2EWAA 2JDOA 3LFNA 4PTEA 4DTBA 4KKGA 4F7LA 4Y5HA 4CFVA 4USEA 4IM2A 2YCQA 3CR0A 2ZM3A 5FTGA 4I5CA 2VTMA 5AX9A 4FT3A 4W4YA 2VUWA 4J8MA 4BBMA 5KO1A 4NYEA 3IW5A 5E8TA 5L6WL 4YNOA 3MPTA 3GGFA 4X2NA 1URWA 4KRCA 3CEKA 2BRMA 1YI4A 4LGGA 5T68A 2CNVA 3O51A 4L53A 2XYUA 3WILA 1FINA 4C3FA 1BLXA 2RFNA 2J0MB 1Q5KA 4K18A 3ZRLA 2JBOA 4AT4A 5M51A 4RRVA 5DYJA 3PWDA 4PMMA 3DTCA 4M68A 3C51A 4DT8A 4AS0A 2W0JA 4MD7E 4O1PA 4CTBA 4I5MA 5CU4A 1TVOA 1NA7A 2Z7QA 3CCNA 1TQMA 3AC2A 3AT4A 4FYNA 4G2FA 3O8PA 4FR4A 4AN3A 3PXKA 4YJNA 4CKJA 3A61A 1Z57A 4O0UA 4WBOA 2F2UA 2PZYA 2X2MA 2ZV9A 3A8XA 3EQHA 4IC8A 1YRPA 5HNBA 5HOAA 3QF9A 5CU6A 1RJBA 3H9FA 3LCSA 2GFSA 4GG7A 5FEQA 5HE1A 2F7ZE 3QZHA 2YCFA 3FZOA 5BVNA 4P7EA 5L4QA 2X8EA 3RJCA 3ZC6A 4ZZNA 5A4CA 5CF4A 5BVFA 1UNHA 1V0OA 4RFYA 1GZKA 3ORMA 3ZUUA 5LVMA 4O0WA 4UBAA 2JKKA 1U5QA 5IA4A 1JBPE 3E92A 3PIYA 3ZLSA 2W1DA 4ID7A 1OGUA 5KMLA 2VWZA 3Q96A 3QTIA 3LM0A 2X7OA 4XG6A 5IH5A 4O83A 2AC3A 3SQQA 3DBFA 3SAYA 3TNIA 3V8SA 1H08A 2OWBA 4FTTA 5EM6A 5BUIA 5HIEA 3MB6A 2XK7A 3R8VA 3EN6A 3N4UA 3AC4A 1F0QA 1KOAA 3C50A 3E5AA 2IVVA 5K3YA 4EBVA 4O96A 5FEDA 2X6DA 2C6IA 4O0SA 5HHWA 4L68A 4RJ7A 4BCNA 2XIRA 5ICPA 2Z7RA 2UW9A 5FUTA 1OL2A 4XV1A 3NPCA 4X2GA 1U46A 1BL7A 3SX9A 5CSPA 1R0EA 2VWWA 4YUQA 4DH1A 3VHKA 4IAFA 3LCOA 4QMNA 4CFFA 2ITNA 3PLSA 3ZUTA 2J5FA 5DNRA 5ANOA 2J0KA 5HNIX 4CG8A 5GIPE 3E8EA 3I7CA 4JOAA 4U43A 3UIUA 4E1ZA 4YJRA 2O63A 3IW6A 4IDTA 4NW5A 5AP3A 4IX4A 5BX0A 3DAEA 4ZZMA 4YHJA 2GSFA 3LFEA 2YEXA 2VX0A 3BI6A 3C4EA 3MJ2A 4K1BA 3OHTA 3VIDA 4Y5QA 4XLVA 3F5UA 4IJ9A 4BTMA 5IPJA 2O3PA 3C0IA 3DFAA 4FT5A 2VTSA 3SOAA 3V5PA 3ZONA 5L2SA 2X39A 2Y7JA 3QU0A 4I6QA 3ZHPC 4MD8E 1CKJA 4TW9A 4QP7A 4XV2A 4FGRA 3BYOA 2X8IA 3BU5A 5C8NA 3WF9A 2XP2A 4FIEA 4I6HA 4CRLA 4FZFB 3VW6A 2VNYA 4Y73A 4D9UA 3BPRA 3OP5A 4I24A 2C3JA 5H3QA 3T9IA 3CE3A 4C4IA 5I3OA 4BY9E 2FSOX 2XEYA 3KXXA 4MYGA 4NUSA 1PMUA 4EK6A 2J50A 3ZC5A 3VULA 5IQGA 3FHRA 3H4JA 3RALA 5DN3A 3U9NA 4FT7A 3NUUA 3DQXA 3GVUA 4ZY6A 4RIYA 2PSQA 1BUHA 2UV2A 4FZ7A 3UJGA 4C2WA 5IMXA 3CJGA 4IE9A 2AYPA 3S4QA 5IEVA 3C4XA 3F5PA 5LWNA 3AC1A 3A4PA 4FL3A 5DR2A 4HGTA 2QU6A 4FGBA 4MXAA 4ZLOA 2XNOA 4C38A 4R7IA 2WMXA 4GH2A 4ANLA 4UYNA 3VBQA 3HEGA 2BFYA 2OGVA 3HX4A 2FO0A 2WTWA 3E64A 5G1XA 3TACA 3BHHA 4FSNA 1TQIA 2F2CB 4WUNA 3DK7A 2YM3A 3Q6UA 3PJ2A 4PDPA 2PU8A 2OH4A 4WT6A 4L9IA 4LQMA 3V3VA 3D7TB 3TNQB 3SXFA 3PZHA 2ETRA 3F5GA 4AN2A 4DLIA 5JFWA 2VZ6A 3MWUA 4FTOA 3NMUF 3V8TA 2W1FA 1R0PA 3ENMA 4YZBA 5K0KA 3C4ZA 3DXNA 4QP8A 4FVQA 1J1BA 5GJGA 3QTWA 4A4OA 1OBGA 2GS7A 3L8SA 4JJRA 4U42A 4AGDA 4LMUA 3RGFA 4C02A 3NW7A 5JRSA 5CEIA 2XMYA 4BDFA 5HIBA 4NM0A 1XJDA 1XO2B 4PL5A 4PX6A 4W9XA 5ACBC 2R3JA 4BCPA 5K5NA 4BDGA 1IA8A 2I7QA 2YWVA 1Q41A 3N51A 3HUCA 5DFPA 1Q3WA 3UIXA 4OTDA 2YZLA 3ACJA 3QZIA 3UP2A 1PRYA 4TWNA 4FF8A 1R78A 3LFQA 3R71A 4O7VA 1ZOHA 4WD5A 3MVHA 2W9ZB 4FKVA 3R30A 5EW8A 4LRJA 3HKOA 3EWHA 3NUYA 4MHAA 1BMKA 4YMJA 5JEBA 1WZYA 3BGZA 4H3BA 4RJ8A 4UMQA 3OC1A 4ZP5A 5ACKA 4RIYB 3FDNA 3JY9A 4PL4A 1JLUE 4X3JA 4QPMA 3W2OA 3NYOA 3SXSA 4YC3A 4RVKA 4G3GA 1PF8A 4TTHB 1U59A 4UZHA 2Q83A 1YDSE 2EXCX 2NPQA 3C4WA 4NTTA 5CQWA 3RHXA 4J99A 4JBVA 3FKLA 3KXHA 5CEKA 1YDRE 3F9NA 2CKEA 2J0JA 5D41A 4ZY4A 2XF0A 5BNJA 3DPKA 4CVAA 5LVLA 5E8YA 5DEYA 1YI6A 3FMEA 4YSMA 4ZK5A 3TZ8A 4EH6A 4LGHA 3RK7A 3QQLA 3QL8A 4GT5A 4QQTA 4HGEA 3T3UA 4L6QA 1KE9A 3PRFA 5A54A 1BX6A 1APME 2WAJA 1Y57A 4GUEA 4L43A 1OVEA 5IZFA 4ZXTA 2GNHA 5M08A 5J1VA 2HK5A 4Q2AA 1Q8ZA 2WTCA 2UW4A 4F6WA 4GIHA 2C4GA 5FQDC 2HXQA 3PVBA 4I22A 4EOIA 3COIA 5AAGA 2WOTA 4TKSA 4UYAA 3TV6A 5H8BA 5K4JA 5GZAA 3KXZA 5CENA 3TZMA 4LI5A 4IZ7A 2XK3A 4LOOA 4UV0A 4WG3A 3DV3A 3L9PA 4DFLA 3AMAA 4FYOA 4MXCA 1XH9A 4NJ3A 5DGZA 4APPA 1CDKA 2R3PA 1HCLA 3K3JA 3OCBA 4IEBA 3VS0A 3EIDA 4FV1A 5HBEA 2W06A 5A6NA 2YM5A 1Q62A 2UW5A 1W0XC 3BU6A 4O6LA 4F99A 2X8DA 5CAUA 4M0ZA 3WBLA 1PXLA 3OCGA 3POOA 4D4VA 3GC9A 5HX8A 3ID6C 3EHAA 3C5IA 5GZ9A 4JVGA 4IWOA 2IW8A 4JDKA 2XBJA 4FG8A 4RVTA 3G0EA 3DLZA 4V0GA 4WHZA 3OFMA 4YLKA 1OKZA 4I6BA 4IX6A 5CF5A 3FMJA 3G33A 4BCJA 5FDPA 3KK8A 2QODA 4IIRA 4O7RA 4DITA 4AFEA 3GENA 3ZEPA 2GQGA 3CC6A 4QMLA 3QXPA 2FVDA 4I21A 4AOIA 5EQYA 3FKOA 1REKA 5LMKA 3POZA 1FMOE 3R1SA 4JQEA 4YHFA 4YZNA 4ZY5A 5I9UA 3VRYA 5F20A 4AGUA 1ZWSA 2W17A 3VS4A 3DAKA 3PSCA 4BZDA 4OT6A 4PNKA 5AA8A 3S0OA 4A7CA 3E3BX 4H1JA 3B2TA 2A1AB 3HRFA 3OXZA 4FV7A 4G3DA 3ZSHA 3EKNA 4JI9A 4D5HA 5KKRC 3P7AA 5J79A 4KIPA 2ZMDA 4PNIA 3F2NA 4FTUA 3FMDA 3QHWA 5AX3A 4QMSA 3MA3A 3SRVA 4RJ4A 5DR9A 4BKYA 4YO6A 5IUIA 4YGAA 5J9YA 1JNKA 1H25A 1UU7A 2WMTA 3UZTA 2OXYA 1BI7A 4ZEGA 3L9MA 5CYIA 3P9JA 2J90A 4L7FA 4A9UA 5M07A 2HENA 3LPBA 4FKQA 4YNEA 5CSWA 3MY1A 3KL8A 4WA9A 3R1YA 5CEMA 3R7GA 3CIKA 3LE6A 4QPAA 4P2KA 2PY3A 5CS6A 3UMWA 3N4VA 2PZPA 2C69A 4RBLA 1BL6A 2UZLA 3JS2A 3QA8A 2J51A 5AP5A 4ARKA 5CEOA 5L3AA 4O7ZA 5DH3A 2XKDA 5HCZA 1U54A 3SV0A 3NUPA 1H4LA 1OPLA 5AAFA 3DS6A 3LQ3A 3VUHA 3C4CA 4O21A 3QX2A 3FZTA 4QP2A 3ZSIA 5CZHA 2VX1A 3DJ7A 3QCQA 3H3CA 3R73A 4RFMA 4UXLA 5AFVA 5IG1A 4IM3A 4HJOA 3V5LA 3NR9A 2WMQA 1VYWA 2QLQA 3ZS5A 4Q9SA 2RFEA 3OY1A 4FV3A 2HAKA 1OECA 3F6XA 4K11A 3CP9A 4B7TA 2I40A 3H9RA 3MH2A 4E4MA 3L8VA 5CQUA 1QL6A 3C4FA 3ZYAA 4E6AA 3TEIA 4OT5A 4YPDA 2OG8A 5A4EA 2XJ2A 4FKWA 1M7QA 3D5WA 5E1EA 4DEGA 4JAJA 1PMNA 3FLZA 5HO8A 4DE4A 5DPVA 3R9OA 4QMMA 5IQFA 1Y6BA 3VF8A 4GU9A 4EK5A 3QC4A 2G9XA 4WSQA 1SNUA 2PUIA 2VO3A 2ESMA 3D2KA 3TT0A 3G5DA 4YJQA 4BWXA 5DMZA 2J4ZA 1PY5A 3PG1A 3PXZA 3PE1A 4ZIMA 2XA4A 1OZ1A 3ALNA 2JKOA 3NNWA 4FZ6A 4AN9A 2QU5A 2RSVA 4QMWA 1JOWB 2XNNA 3A8WA 4EONA 3DKFA 3KCKA 2GQRA 1H00A 5FG8A 1M2RA 2OZOA 3AD4A 4GU6A 4L3JA 5AM7A 3FZSA 3O23A 4HGLA 4BCQA 3OOGA 4HYIA 4IQ6A 1YOLA 3SKCA 3TCPA 2XRWA 2P2IA 4DGMA 3NVKI 3QYWA 5CWZA 4YJPA 2GNJA 3OBGA 3RM6A 1U54B 1H01A 2WIPA 4ZSEA 2UW8A 1P4OA 2X9FA 3F61A 2NNWB 2OXXA 2XNEA 4OTWA 5IQDA 2QKRA 2ETKA 5AMNA 2BRNA 3ATSA 3VF9A 3QQFA 4DG2E 4M0YA 4L3LA 4PPAA 2QOCA 2QHMA 3UO4A 4P4CA 5JFVA 3D15A 2BMCA 4D1XA 5KCVA 4IHPA 3GOPA 3LCKA 2HY81 3AMBA 2Y4PA 4PMTA 3ODYX 2W1HA 4RT7A 5J95A 4PL3A 4D0XA 2YCRA 3IOKA 4M97A 5KBRA 4JX7A 3N9XA 3VQHA 1ZYLA 2BZIB 2IZRA 4LG4A 3VWAA 3UQCA 3AC3A 1QPJA 3OEFX 4FNZA 2ITYA 5HVYA 2LGCA 4YZCA 2IPXA 3IGOA 3FY0A 2ERKA 3GCUA 2X6EA 4ACHA 4BICA 1JKSA 3ZUVA 4YURA 5M4FA 2ZYBA 5AM6A 4DFXE 3G6HA 5B2LA 4HCUA 5L8LA 2E9NA 2JD5A 3FYKX 4M69A 2W1ZA 2I0VA 1CMKE 4DGOA 4DEAA 4BGGA 4YTIA 4AZTA 5C8KA 2VO0A 4QTEA 5KX8A 4JDIA 4UN0C 5E8VA 4QNAA 4EH5A 1WFCA 4PF4A 4U6RA 4TT7A 1KV2A 2JFLA 3PJ1A 5LWMA 4FSWA 2VAGA 1W7HA 3F7ZA 5FXSA 2AUHA 4BIBA 1CKIA 5DEWA 3E62A 4ZTNA 5HGIA 2HCKA 3U6JA 5AUWA 3MY5A 3QD3A 3A7GA 4C0TA 4ITJA 4GK3A 3KRXA 4G17A 5AUYA 4RIXA 2PVKA 1UNGA 5IA5A 3CSVA 2EUFB 5L2TA 4XG3A 2Z7LA 4G5JA 2CHLA 4XS2A 4BWKA 5DOSA 5GJDA 3ZXTA 3O0GA 4IAKA 2WQEA 4L45A 4RWIA 5CVHA 4DFBA 1JAMA 1S9JA 4L67A 5E8WA 2BVAA 3DK6A 5C1QB 4ORKA 4FVPA 3JVSA 2C0TA 4D4SA 4AT5A 4N6YA 2XH5A 3F66A 4D28A 3VRZA 4FIFA 4RWKA 5L2WA 4H05A 3OY3A 2PVMA 1PYEA 2C5YA 4AT3A 3ZZEA 3JY0A 1FVRA 3GCVA 3FV8A 5EOBA 5HU9A 3PP0A 3PPKA 1ZZLA 4BTJA 1OL7A 3JR1A 1JKTA 2CN5A 2UZVA 3DJ6A 3NW6A 1STCE 3IK3A 4OW8A 3R7VA 2ERZE 3FPQA 4K0YA 4O0XA 4J97A 3TKHA 1AQ1A 4F09A 4ANNA 4KB8A 3U51A
chains in the Genus database with same CATH superfamily
1X8BA 4FSMA 3CY2A 1FPUA 5AR8A 2BKZA 4CYIA 2BIYA 3V5WA 4F7SA 3CGOA 4DA5A 1CSNA 4AW0A 4K77A 5FD2A 3I6UA 4JRNA 1XKKA 5FXQA 1PJKA 1R39A 4JG7A 4M3QA 3GU4A 3WIGA 5IU2A 4CEGA 3FZPA 2VTOA 4IMYA 3LCDA 4E26A 4AXFA 4QMOA 3U4WA 5HG5A 2F7EE 4NW6A 2WTKB 3ORIA 5HE3A 4XYFA 5IF1A 2YABA 2CKPA 2B7AA 4UMRA 3ZM9A 4RC3A 3P08A 2ONLA 2B1PA 3NS9A 3BEGA 4A9SA 3RWPA 2V55A 4F63A 3GB2A 2VTRA 3KCFA 3R8MA 4LGDA 3CTQA 2YM7A 2F7XE 5E92A 5AV0A 3W2SA 3F2RA 3ZRMA 4FL2A 4YTCA 2W1EA 4EL9A 1PXOA 5EW9A 2BDFA 3ZU7A 4RIXB 5IQIA 4FK6A 3BGQA 3ET7A 1PHKA 4FA2A 4B4LA 3MS9A 2Y4IC 4CZTA 4FTNA 5C4KA 5H9BA 3T9TA 3O5AA 1XHAA 4FV9A 4MXYA 4C4GA 2PE2A 4G6NA 4L46A 2ETMA 2WELA 4DFNA 2H6DA 3JXWA 3KMUA 4I5HA 5HI2A 4HVSA 5AAEA 3EN4A 5L2IA 3M42A 3ANQA 3PP1A 3V6RA 3AQVA 3VS7A 2UW0A 3BE2A 2JEDA 3O17A 2BFXA 3TUCA 4ZLZA 4MF0A 4ZSLA 3EN5A 5CU0A 5BUEA 3QQGA 4II5A 5DT4A 5CTPA 1OGYA 5LVNA 5AR2A 4WG5A 5FBNC 3Q2JA 4L42A 4MCVA 3QBNA 4FG7A 4BTKA 3BHTA 3PLAE 3KGAA 1SZMA 5BUJA 1LP4A 2OFUA 3D83A 4BDIA 4EOQA 4U3ZA 2R3GA 3EQDA 4LMNA 1W2CA 5CSVA 3WE8A 4BGQA 5EHYA 4ERWA 5M09A 3TTJA 4JRVA 3QGYA 2YZAA 2JDRA 3MJ1A 5M4IA 4V04A 4YO4A 3FL4A 5TO8A 3MFSA 3VBVA 2IJMA 1M17A 5BYYA 4JXFA 5B2KA 3RVGA 4XRJA 5E4HA 4RIWA 5ANKA 2PMIA 2R5TA 2UZOA 3BELA 3ZLYA 4IZYA 4G31A 4D1ZA 4R1VA 4QP4A 3V51A 3SW7A 2GTMA 4O4EA 4TYEA 2GNIA 4NL0A 2YIYA 1JQHA 4N4SA 4L8MA 4XP2A 4FEVA 2ZB0A 4BI1A 1LUFA 4N70A 3BHVA 3PIZA 4RJ3A 4UWYA 1K3AA 4F0GA 4DYMA 1DI9A 2WPAA 2XKFA 3UBDA 1MQBA 4A9TA 4ANSA 2X2LA 2QHNA 3M11A 1NVRA 2QOKA 3SHEA 5HIDA 4C4EA 4IVBA 1ST0A 5AV1A 4BCIA 1Z5MA 2ZVAA 5T6KA 4O1OA 2XARA 4GUBA 1ZOGA 3OW3A 4EK8A 3I60A 2F57A 4DH8A 2PVLA 3VBWA 3GCQA 3HDMA 4Y72A 1OIQA 4XG4A 4YP8A 4O7TA 3I79A 4CMOA 4UXQA 2GPHA 3MDYA 2R3NA 2QCSA 4FTQA 4C35A 2F4JA 4P90A 3FKNA 3R9RA 4YLJA 3COMA 3BV3A 2YLEA 4O7NA 4X2FA 2BHHA 2VRXA 4HPUE 1PXNA 4QRCA 4FNXA 2I0YA 1Q8TA 4G5PA 4YZDA 2BZJA 3DU8A 4F6SA 3CKWA 3CQEA 4H3PA 1JWHA 4PMSA 3RWQA 4D4YA 1YXXA 4AOTA 5K4IA 5M57A 3KXMA 4L52A 5IISA 3PUFC 3R7UA 4A9YA 4I6LA 4FOBA 3R83A 3E8NA 5DIAA 4ANOA 2W96B 5HBJA 3NNUA 2QOOA 5H8GA 4F1TA 4X7QA 1W83A 2V7AA 2FSLX 1NY3A 3F82A 4RIWB 4EOLA 4BZNA 4R6VA 3UOKA 3LLTA 4UEUA 4ACDA 5HBHA 1JSTA 2A0CX 5AP6A 4YJOA 1I44A 3VAPA 4D0WA 2CGWA 4TWPA 3P79A 5I9ZA 2FUMA 4R77A 3BEAA 2YM6A 3A7JA 3F3VA 1ATPE 3MPMA 4QTDA 5KMKA 3OCSA 4X3FB 4E6CA 3GFEA 4LV7A 1OIYA 4ZTQA 1OIUA 4EWQA 5LMKC 4EUUA 2WMSA 3SC1A 3UMXA 3M2WA 4CFUA 3KKVA 3FLSA 3FQHA 3W55A 1PXPA 3DBCA 4G16A 4E3CA 3FZRA 3CD3A 3K2LA 3O96A 1J3HA 1PYXA 4FTCA 4KSPA 1PXKA 3UQGA 1NW1A 2P4IA 3LFAA 1H27A 3QUPA 3D9VA 4RG0A 3ZO2A 5EKOA 5HTBA 1YXUA 5KZ0A 4BFMA 1OUKA 3DKGA 4IBMA 5EI8A 5M06A 3BWFA 5L8JA 4WKQA 4GIIA 3TIYA 2HIWA 4IW0A 3OXIA 2HWOA 3GU7A 3MV5A 3GFWA 4JDHA 5FWKK 3DB8A 3HLLA 3FXZA 3SG9A 3UG1A 2BIKB 5DHJA 4DH7A 4MBJA 4FKPA 3IS5A 4MUQA 1ZYSA 3C13A 4YPSA 3BGPA 3ORKA 2VWXA 3TJDA 2W5AA 1RE8A 3OOMA 4MXXA 3BHUA 4Y95A 3WI6A 3AKJA 4NH1A 4GV1A 4IB3A 1UV5A 2Z2WA 3ORXA 3W1FA 2WU6A 4EHVA 1YQJA 3WIKA 2BPMA 3QZGA 2XKEA 4CMTA 3HV4A 5KMMA 4NFNA 3ATTA 4YC6A 4E20A 5HU3A 1WAKA 2X4FA 3HGKA 1PXMA 3HNGA 2XIXA 3K5UA 3VN9A 2XIZA 4CKRA 3G15A 2PZ5A 4USFA 3PE2A 3FQSA 2BTRA 3DZQA 5C8MA 4TRLA 4RZVA 3MYGA 3PZEA 2GHMA 3BYUA 5AUZA 2BILB 2YCSA 4KD1A 4KA3A 3ORNA 4ACGA 2PMNX 1JPAA 4XG2A 3R7EA 4AZVA 4BCFA 4QYGA 3D94A 3IO7A 2HY0A 3M1SA 2C3IB 3D7TA 2FA2A 5EW3A 2HZ0A 3HVCA 2B54A 3IG7A 3UC4A 5IDNA 5J5TA 3UO5A 3RAHA 3ETAA 3O2MA 4G1WA 1OITA 2VTTA 3OWLA 4IB5A 3S3IA 4AG8A 4Q5EA 4V01A 5JFSA 3VO3A 4CFXA 3FI8A 4J7BA 4UMUA 2J9MA 4QP1A 4ANBA 2XVDA 3KC3A 3D7ZA 4QMZA 4RIOA 1DI8A 2Z02A 3DKCA 3QD4A 4DBXA 3JVRA 4QTAA 2QKWB 4PPBA 3RNIA 4LV5A 3WF5A 1Y91A 3A99A 4RSSA 5BMSA 2R3IA 5CANA 4X6RA 5I5ZA 3I1AA 4FIHA 5HNGA 4OLIA 1Q61A 2PPQA 3BHYA 3PXQA 5J9LA 5EM8A 3W33A 3DGKA 3RP9A 4RX9A 4JS8A 4C4HA 2JKQA 3P7BA 5AUUA 2O64A 3G2FA 4FMQA 3VNTA 3BV2A 1OIRA 4TYJA 2CPKE 4EYJA 4DBNA 4U80A 3BZ3A 5M53A 2O8YA 2CGVA 2BTSA 2WTJA 3L8XA 3MH1A 4RVMA 2VO6A 4RC2A 2YFXA 5CU3A 3FMHA 5GZ8A 1IA9A 4WNMA 1OKYA 1YHWA 3LVPA 1GIJA 2WEVA 3GOKA 4GG5A 4GS6A 1KOBA 3HP5A 3P7CA 3QYZA 4NFMA 3OG7A 3UP7A 2JC6A 4A07A 4F64A 5B0XA 2OU7A 3W0SA 4EH7A 3IKAA 3UNJA 4BHZA 5CVGA 4DDGA 4QQJA 4Y85A 1WBVA 2QNJA 5T3QA 4K9YA 4GVAA 3U4UA 3UOLA 3V04A 3T8OA 5J5SA 1O9UA 2QQ7A 2UVZA 3DZOA 2XIKA 1IR3A 1XH6A 1GZNA 2CLXA 4B8LA 1WBPA 4LM5A 1Q8YA 3LJ0A 5F1ZA 4AU8A 4C4JA 2ITQA 3ANRA 3KEXA 5AIKA 1ERKA 3NFFB 4FICA 5BPYA 1PXJA 2ZFYA 4IVDA 4F08A 3UODA 1VJYA 3LOKA 5LXMA 1P5EA 5FEEA 2VTJA 5I0BA 4OTFA 2OK1A 2R0UA 2UW6A 3I4BA 1JKLA 3QD0A 3CY3A 4FNYA 4BHNA 4EK4A 3U87A 4PP7A 4O91A 3DLSA 4JDJA 5M44A 4PV0A 2CN8A 3PPJA 1YWVA 4OGRA 3ORTA 3HV7A 3UYSA 2W9FB 4YSJA 4OBPA 2GCDA 4KIQA 3WF8A 2RG6A 3EFWA 4EOOA 4IZ5A 2ZMCA 4DG3E 2YERA 3Q5IA 2UZBA 2WTKC 3KU2A 4AGCA 1G8SA 4BDJA 4KRDA 5E7RA 3TXOA 3UOHA 5IQCA 3A7HA 1XH7A 4HVIA 2VGPA 2B4SB 4B99A 4CFNA 5HCXA 5HD7A 3K3IA 3QQKA 4GVJA 2I0EA 2LAVA 3KA0A 3PIXA 4QMQA 2GMXA 2QOBA 4M15A 2WIHA 5DRDA 3RPSA 2UZEA 4XHKB 4USDA 4YR8A 3EN7A 3RI1A 4Z7GA 4HZSA 5CEPA 4DFUA 3COKA 2R9SA 3MH0A 2DS1A 3RPOA 3EB0A 3R1QA 3HA6A 1OPJA 1SVGA 4EC8A 3NYVA 4O27B 3ML1A 3A62A 3I81A 2X4ZA 1BYGA 3TJCA 3V5TA 1ST4A 4BJJA 3DOGA 4FTLA 5EYDA 1J91A 3DNEA 1J7LA 2JIIA 3KVXA 4JBOA 4MNEA 4O7LA 2FH9A 5LCJA 4RC4A 3PYYA 3FEGA 5AR3A 4LDTA 4NIFB 3PJCA 5E8SA 2R7IA 3EFLA 4F6UA 3VW8A 4UY9A 4BCMA 1G8KA 3I0QA 4XV3A 3WZJA 3ZTXA 3L9LA 3OCTA 3OW4A 4QP6A 3R2BA 3O7LB 4F78A 2GNLA 4QMYA 3UIBA 2VWUA 3GI3A 4IACA 2DYLA 1TQPA 2CDZA 5HG7A 5HVKA 2VX3A 4ZTHA 1PMEA 2AC5A 3GP0A 3AT3A 4CV9A 4FKGA 1U5RA 3PVWA 4E5WA 5H8EA 5HORA 2OZAA 3BIZA 4S33A 1QMZA 3FC1X 3QAME 5LOHA 4FV8A 4G34A 4YTHA 4EOSA 3LJ2A 4NU1A 5EG3A 5FP5A 2IZSA 4EH3A 1XR1A 2IF8A 3IGGA 3PA5A 2NO3A 5CX9A 3F3UA 4XUFA 1E1XA 4FUXA 2NYAA 4FI1A 4RX5A 3D0EA 3MVLA 2IN6A 2F49A 3O71A 4DH5A 5A4LA 3QTZA 2BZHB 3H9OA 5HESA 3EQCA 4FV0A 5J8IA 1ZMWA 4ZTSA 5BVOA 4LV8A 4U0IA 4U41A 3UDTA 3NYXA 1PW2A 4GEOA 4EK3A 4NKAA 4BB4A 4PMPA 3VUTA 4AE9A 3CLYA 3LAUA 2W1GA 3BLQA 4BJJB 3CXWA 3EFKA 1Q97A 3LMGA 4FSUA 4HW7A 4RVLA 4JQ8A 2JDVA 4KWPA 4MNEB 3OVVA 1W8CA 5ANJA 1ND4A 3ERKA 4XX9A 4G6LA 2FSMX 1H26A 4MF1A 2PVNA 2IZUA 3DT1A 3GU6A 3RMFA 3BQCA 1OKWA 4F65A 2G01A 2WFYA 4RMZA 1W84A 3W8LA 1ZYJA 3JUHA 5HICA 5KHXA 3UNKA 5BVKA 3CS9A 3PFYA 2CNQA 5EM5A 4JR7A 5KNJA 1OMWA 3QRKA 1ZRZA 1H1RA 5IA2A 2X9EA 3PXYA 1JKKA 4IH8A 3RPVA 2VTIA 3MH3A 4MXZA 3UE4A 4OAVB 3HA8A 3QQJA 4IANA 4NCTA 2V7OA 3KN5A 1IAHA 1ZY5A 2B9JA 2OZAB 3BQRA 1Q24A 3QD2B 4C4FA 3CPCA 4N0SA 1HCKA 3O7LD 2WQNA 2XS0A 3P86A 4FV4A 2GS6A 2BALA 4I41A 4DHJA 4RA5A 1GZ8A 3EQFA 4B9DA 4IAZA 4IVAA 3F88A 2QVSE 4QDVA 3AD5A 5D7AA 3UYTA 2XALA 3DDPA 1G3NA 4IX5A 4QYFA 4RA4A 3FQEA 2OBJA 3KK9A 4ITIA 4BN1A 4MNFA 3K5VA 2WO6A 3KVWA 4KS7A 4U3YA 4O6EA 1J1CA 3B2WA 3GC7A 3AGLA 4C61A 4I23A 3I5ZA 2WD1A 3MN3A 1B38A 4IFGA 2O5KA 1GJOA 3PDTA 4M67A 4YTFA 4JR3A 3KULA 3COHA 3F7WA 4FEQA 5EYMA 4CZYB 2C47A 4IWQA 3FZ1A 4UWCA 4DEIA 4FTKA 2YA9A 1PMVA 4JG6A 3D4QA 3B8QA 3VBTA 1WCCA 3TG1A 2B53A 2BAQA 2F9GA 3F2AA 2EB3A 2IVSA 4G3FA 2PTKA 1OL6A 4GJ3A 1SMHA 1U4DA 2V0DA 3CBLA 3KF7A 4PQNA 2BDWA 1UA2A 5K0XA 5EDQA 3UNZA 5I9VA 5M4CA 1KE5A 3AG9A 5DT3A 4ZMFA 3VJOA 4O4BB 1OI9A 2BCJA 4FE2A 1VYZA 1KV1A 3OMVA 2V62A 4XV9A 4OTQA 1ZMUA 3D5UA 4R1YA 4O0RA 5CT0A 3EZRA 3IQ7A 3NUNA 2B55A 4Y8DA 4XOZA 4AW2A 5I4NA 4IAIA 3WARA 3LFFA 5CF6A 1O6YA 3EQGA 2YM4A 4TYIA 4PPCA 3IDCA 5ANIA 4CRSA 1XH8A 3FMKA 4DCEA 3ORLA 2EXMA 3BYMA 3U9CA 4OTRA 3V6SA 4BDCA 4E4XA 4Z7HA 4CSVA 3R8ZA 4QOXA 3KMWA 3ACKA 4EORA 4UB7A 4NK9A 4AA4A 3F3WA 4ZTRA 2VWBA 4FOCA 1BKXA 4TY1A 3BBTB 4UMTA 4FKLA 3TV4A 1YVJA 4U45A 3R7OA 3W18A 3Q04A 5C27A 4YZMA 2FB8A 4NM7A 4RLLA 4DEEA 4D2WA 2Q0BA 4GFGA 4ENYA 1J7IA 5TKDA 2BRGA 2W4JA 2JITA 5GHVA 3KULB 5L6PA 2ZDTA 2UZWE 5FGKA 3R01A 1NXKA 1XH4A 2P33A 3MY0A 3RKBA 2UW7A 4FZDB 4EHGA 4EKLA 5FXRA 3AKLA 2RGPA 3FMMA 4CMUA 3KXNA 5IKWA 5KMNA 4S30A 2IVTA 3H0YA 3UO6A 5A4QA 3G90X 3KB7A 2GNFA 4U8ZA 4BDEA 4IADA 4KABA 4Q5HA 3DAJA 4TYGA 5J87A 4ZTMA 5BMMA 4DLJA 4EH8A 5AUTA 3ORZA 4DFYA 3WF7A 3CTJA 2IZTA 3HV3A 4WNKA 5CEQA 4EOPA 4AACA 3G0FA 3FLWA 3O50A 5EQPA 1DAYA 5DE2A 1W2FA 1ZY4A 2G15A 4LFIA 5HE2A 1DM2A 4EJ7A 1URCA 2QO7A 2R3MA 3DBEA 4YZ9A 5KE0A 4IX3A 4QMXA 4ALWA 5A3XA 4C62A 3ULZA 1P2AA 2C68A 2Y6MA 4U81A 3ZOSA 2XAMA 3R1NA 3EKKA 3E3PA 3PY3A 3OBJA 2H9VA 3LXLA 4M66A 3VS5A 4B6LA 2BKKA 4QMUA 3UG2A 4F9WA 4D55A 3Q6WA 1J7UA 5E9EA 4MQ1A 2GHLA 3PVGA 2W7XA 4BBFA 2R3OA 1M14A 1GIHA 3REPA 2OJGA 2WMWA 3FLNC 3BX5A 3NNXA 1YOJA 3U6HA 3UDBA 3CD8A 3A4OX 3IOPA 3W10A 4C7TA 3LFSA 5JKGA 4NT4A 4DHZA 4R8QA 4QT1A 4XNEA 1GNGA 5HO6A 4BCHA 5D9HA 4AZEA 4ZTLA 3DXPA 4TZRA 5EYCA 4IZAA 4JX3A 4RLKA 1H07A 3LQ8A 3OROA 1Q3DA 2CCIA 4O2ZA 4TYHA 5FTQA 2PZRA 3ELJA 4ANMA 4BTFA 2I0HA 4R3RA 1MUOA 3R28A 5D11A 3SXRA 3BCEA 5HKMA 2E9PA 1WBWA 1P14A 2QLUA 2ZV2A 4UMPA 2E9UA 2OH0E 4DTAA 3Q9ZA 2BDJA 3KRLA 3ZFXA 2ITPA 4QD6A 3S95A 1GY3A 3OD6X 3Q9WA 3KRRA 2CKQA 3ALOA 2XNMA 3TKUA 4DAWA 3Q4UA 4EWHA 3NIZA 4S31A 2OXDA 3WYYA 2WHBA 4CG9A 2RF9A 2GHGA 3W0NA 4ALVA 4QTBA 4TL0A 3TNPC 2NRYA 3EQBA 5CVFA 1KUTA 4F4PA 4KSQA 2P2HA 2X0GA 2PUPA 2A27A 4BZOA 2RKUA 4C58A 3GUBA 4HNIA 3TMOA 3Q4ZA 3UVPA 4IB1A 2VTQA 1FVTA 1UVRA 2W99B 2WNTA 1DAWA 2XBAA 4IVCA 2OJFE 2WZJA 4OTPA 3SLSA 4EHZA 2YAKA 2IW9A 5HTIA 1MQ4A 5ANGA 1MRUA 3PJ3A 2P0CA 2XNGA 3ORPA 4YJTA 5E8XA 4ZZOA 2CKOA 2JKMA 2REIA 4KKHA 2XZSA 4NKSA 3GT8A 2OO8X 4D9TA 4YU2A 4HPTE 3GEQA 2VTAA 4ASXA 4EJNA 4MTAA 4Z3VA 3A7IA 5A9UA 3PUPA 2VTNA 3FSFA 1AGWA 3ZFYA 3KQ7A 3LCTA 3QKKA 4DTKA 2YJRA 5D10A 2GU8A 5D7VA 4XOYA 3WOWA 4XG9A 4F9CA 4F7JA 1I09A 1NT2A 2Z7SA 3QRTA 4TN6A 4TYHB 4D2TA 3RCJA 4EZ3A 2C0IA 2E9OA 3WF6A 2YIWA 5AJQA 4A9RA 4FRFA 4M14A 3EN9A 3PRIA 5AIRA 3DDQA 4DC2A 4YBJA 1JVPP 3RAKA 3MI9A 2WMVA 4BDHA 4KINA 4F9BA 4XMOA 3RCDA 5LJJA 3N4TA 4FTRA 4F70A 2X7GA 3GBZA 4DHFA 2Z8CA 4CNHA 3DB6A 5FTOA 3UIMA 4M7IA 3MIAA 3HZTA 4DH3A 3WZDA 4G3EA 5CI7A 5GJFA 3CQUA 4IDVA 3AC8A 4Y46A 5CT7A 2QG7A 5L6OA 1A48A 3QUDA 4KKEA 4C57A 2P3GX 5CAQA 3AGMA 5HG9A 4DCAA 4DGLC 5DI1A 1FQ1B 5JH6A 4MK0A 2C6KA 2YDKA 3VC4A 4CGAA 4FIJA 4AW5A 3E93A 4XG7A 3R21A 3R7YA 1UU8A 2QURA 4XJ0A 3S2PA 4I93A 3FLQA 4CCUA 3NWWA 3OT3A 2PMLX 2RFDA 3QTRA 1WVXA 2PWLA 3T3VA 3TZ7A 1OBDA 2YIXA 3NZ0A 4O22A 4XBUA 3U54A 5I9WA 1ZLTA 3KMMA 4CQGA 5ITAA 3Q4TA 4X3FA 3R63A 5AR7A 2C3LA 3EQIA 3MFRA 2HW7A 4FEWA 4PDOA 2QOLA 2CGXA 2OIQA 3BWJA 1UKIA 3NEWA 3CTHA 3QGWA 2R3LA 2BRHA 1REJA 3QX4A 1QPEA 5HCYA 3QKMA 1R3CA 1H1WA 3G9LX 2X1NA 5DRBA 3DJ5A 2ITWA 3W2PA 4ZJIA 1G5SA 4JBQA 4MEDA 5CAPA 2R3RA 5FDXA 1YKRA 2A19B 2OKRA 3EZVA 4CTCA 3KN6A 4BDKA 5A46A 2XRUA 3NDMA 2W05A 1MP8A 2PL0A 1M7NA 4GRBA 3UZRA 3HL7A 4O2PA 3UC3A 2IG7A 3FI3A 4IAAA 3SOCA 4N6ZA 5EQEA 3MVMA 3PXRA 4OUCA 3R22A 4UZDA 4EQMA 4AZSA 1H8FA 4LOPA 4FVRA 1VZOA 4AXAA 5FBOA 4KS8A 4XEYA 1RQQA 5EHLA 4AZWA 4BKZA 4I0TA 4EUTA 2PYWA 4FKTA 1BI8A 3E7VA 4JL9A 3Q52A 4HYUA 3RINA 4TNDA 4X2KA 4FKUA 5CXHA 3VHEA 3CJFA 1DS5A 5DVRA 4IFCA 2C6EA 3BE9A 4NSTA 5DG5A 3NVMB 2BHEA 2VWVA 2Y8OA 4W4WA 2HZ4A 3DKOA 2XIYA 3MESA 4RJ6A 4OTHA 2WOUA 5EYKA 1KE6A 4AGWA 5KKRB 3PY0A 3EJ1A 3TZ9A 2YIRA 4J8NA 3QC9A 4OBQA 5JZJA 4JLCA 4BDDA 4EH9A 2Y0AA 1Q99A 2VU3A 5I3RA 1B6CB 2ZM1A 4E5AX 3UQFA 3FMNA 4IAYA 3RZFA 3RK5A 3GQLA 2C1AA 4AUAA 3FLYA 3HECA 5LVPA 3EFJA 2WKMA 1H0VA 5AP7A 2VTLA 4LOQA 4ZS0A 3VUMA 3VUIA 3R00A 2WQBA 4I3ZA 4A4XA 2OJ9A 4MBIA 4BKJA 4D1SA 4XBRA 1ZZ2A 1JSUA 3WE4A 4ASDA 3LFBA 1WBTA 4DN5A 2PVFA 4ZSAA 2BRBA 4C3RA 3H0ZA 4C3PA 5M4UA 3VVHA 4BF2A 3SA0A 2R2PA 2DUVA 3H30A 4PDSA 4U44A 2XK8A 2HYYA 1OPKA 4R5YA 2G2IA 4O84A 3V5JA 4XLIA 2CGUA 4EZ5A 1UU3A 2VWYA 3ZEWA 1MRYA 4FTAA 3R2YA 4RX8A 3PTGA 4NCTC 2P55A 3PPZA 5IQHA 1HOWA 3GCPA 5DA3A 5TE0A 4M12A 3P1AA 4YC8A 2PE0A 4DT9A 2CLQA 4QYEA 4NZWB 2BUJA 2WMUA 2H34A 5TF9A 1OL1A 1YXVA 2C5VA 4AFJA 3ZFMA 3EL7A 2WQOA 3FL5A 3RZBA 1ZYCA 1F5QA 5HTCA 4HYSA 3U6IA 3D2IA 1H1PA 2OIBA 4U5JA 2PE1A 1XH5A 2UW3A 3LFDA 3NLBA 3ZSGA 4ASEA 4EOMA 5CASA 3ZDUA 2ACXA 3ZLWA 4BDBA 1G8AA 4ZMEA 2PMOX 2OW3A 3PSBA 3UPZA 1O6KA 1WVYA 2RFSA 4IJPA 4J95A 3MPAA 1WBOA 4KBAA 1YW2A 5B2MA 4MAOA 2VTPA 2ITOA 3W32A 5BQ0A 2YITA 1L3RE 4QQCA 4OR5A 5HE0A 5IQAA 4RQVA 3FC2A 2JBPA 4JT3A 5ETAA 3BLAA 4I0SA 5C26A 3O8TA 4JG8A 1XWSA 2R3FA 4CV8A 4OTGA 4BIEA 3E8DA 3BL7A 3VJNA 1K9AA 3KREA 2XM8A 3LXPA 2PUNA 1PKGA 2YDJA 5ANDA 2EXEA 3FXXA 1T46A 2A4LA 2BAKA 3HRCA 4QTCA 4WSYA 4EC9A 1Y8YA 4FG9A 4CT1A 1OUYA 2I1MA 2JAMA 1FMKA 3DTWA 3FSKA 3HMPA 4ENXA 3KRJA 4J53A 2XCHA 5EH0A 5L8KA 2PVHA 1H24A 3OS3A 4WG4A 5E8ZA 3QWKA 1L8TA 4BYIA 1K2PA 3QALE 2QR8A 1FGIA 2BZKB 3ROCA 2GS2A 2XNPA 1Y6AA 3II5A 4DGGA 2VGOA 1SNXA 3NGAA 4FODA 2YHVA 4QEBA 1MRVA 3PVUA 4J52A 5LCKA 4E4NA 4AXCA 5C01A 5E91A 4BYJA 3TM0A 4GYGA 3NRMA 4GMYA 2GQSA 4O7SA 5HEZA 2XCKA 4PTGA 5A6OA 4L44A 5C03A 3Q9XA 3CPBA 4FV6A 3QQHA 4MWHA 4J98A 4HVDA 2XYNA 4A4LA 4FIIA 2XKCA 3L8PA 3MGYA 4QYYA 4FSYA 3TDWA 5AA9A 4LL5A 2ZOQA 1PKDA 1W82A 3KY2A 3FMLA 2CCHA 2OSCA 2R64A 4E4LA 1UWHA 3QRUA 1CM8A 4K6ZA 5GIOE 3FBVA 4ZLYA 4RQKA 5EI2A 4RGJA 4I6FA 3FUPA 5BVWA 4ALUA 1KE7A 4QP3A 4BC6A 4EEVA 2ZM4A 4RWLA 3SGCA 4DEDA 5KMJA 1ZOEA 1UU9A 1W98A 3C1XA 5KMIA 3TUDA 1QCFA 2KULA 5HX6A 4NIFA 4ONAA 4PUZA 4XP0A 3C7QA 3NSZA 3KIOC 3KRWA 3SDJA 3GC8A 3R8LA 2XNBA 2X7FA 3LKMA 3GNIB 3UVQA 4ZAUA 4BI0A 2YLFA 2OF2A 3W0OA 1Q4LA 4K8AA 2J5EA 2RIOA 3C0GA 3LW0A 3TI1A 3NCZA 3ZO4A 5IA3A 2QONA 4AA0A 4O86A 2FSTX 3V8WA 3NIEA 4BBEA 5AUVA 3TN8A 4CKIA 2C5OA 5GNKA 3EH9A 4O0TA 2YWPA 4W8EA 5HLPA 4DFZE 4EH4A 4NWMA 3RNYA 4FEUA 2G2FA 2JDTA 2O65A 3NAXA 2HELA 2ITXA 4FEXA 3QFVA 2WEIA 3GCSA 5B7VA 3TL8A 2V22A 2RL5A 4HCVA 5CNOA 4C59A 3OXTA 5D1JA 4F1MA 2J2IB 5IQEA 2UVYA 3I5NA 3UZPA 4I4EA 3U55A 3TNHA 3BBWA 4DGNA 5G6VA 4CD0A 5CI6A 3HRBA 5KBQA 3ITZA 4E6DA 2XM9A 3R04A 4N57A 1CTPE 2PVYA 2E2BA 3FYJX 2OIDA 1TKIA 2G1TA 3MFUA 4NM5A 4G6OA 5BYLA 2WTVA 3FWQA 1E9HA 3OWPA 4FSRA 2SRCA 2XUUA 2X2KA 4FKJA 3R8PA 3QTSA 5AP4A 4S34A