2XYNA

Human abl2 in complex with aurora kinase inhibitor vx-680
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
266
structure length
264
Chain Sequence
b'KWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN KINASE ABL2
publication title Crystal Structures of Abl-Related Gene (Abl2) in Complex with Imatinib, Tozasertib (Vx-680), and a Type I Inhibitor of the Triazole Carbothioamide Class.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 264
sequence length 266
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xynA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xynA01
4FG8A 3ATSA 3LPBA 5CAOA 1U46A 5B0XA 4OTGA 3DAKA 4HVDA 3IDCA 4O0VA 4CFWA 1GNGA 3R1YA 3F9NA 4E4LA 3ALNA 3PXZA 3CY3A 4DITA 4HNIA 5LMAA 4EZ3A 5CX9A 5IQCA 5EW3A 3HUBA 3OCBA 1O6LA 4QO9A 3NUAA 3EFWA 1SVGA 2BDFA 4LMUA 5E8XA 3OEZA 4E5BA 3CGOA 2WB8A 4UXLA 4NYEA 2JKQA 3BIZA 2QLQA 4BIBA 4BKYA 4FV9A 4XV1A 3HEGA 3BX5A 2W1HA 4W8DA 4ZZNA 4GUEA 5EM7A 5BX0A 2YCRA 1AQ1A 4ZLZA 4DFBA 2QG5A 3H3CA 4ALVA 4EZ5A 3W2RA 1UWHA 3I6WA 4IX4A 5CU3A 3EQDA 5JN2A 3O7LD 1Q4LA 4YMJA 1H1SA 2VTOA 4MAOA 2BFYA 4UMTA 1M14A 4BDBA 4ORKA 3DAJA 5AAEA 3IS5A 4BWXA 5LCJA 4YBJA 2EB3A 2J0MB 5CNNA 4XP0A 3S2PA 4GIHA 3T3VA 3R9OA 5HBJA 4XS2A 2Y4IB 3ROCA 5ANOA 4D2RA 4ENYA 5EK7A 2P2HA 4LRKA 5KMOA 2C47A 4JIAA 4RVMA 1YVJA 4IAZA 5BNJA 3BHVA 2JIIA 3MDYA 3LXNA 4FNYA 2PUIA 4G31A 5J5TA 3Q04A 2PZYA 2ITOA 4QMOA 4R7BA 4WSQA 5DGZA 3V5LA 4KBKA 4AG8A 1FVRA 3UMWA 5BPYA 2CKEA 3FZTA 4QYYA 5I9WA 3VBVA 4EHVA 2I0HA 5DN3A 3DBEA 4BBEA 4NIFB 3FI8A 4ZJJA 3P7AA 3ZLYA 4I0RA 1OKVA 2X7OA 4L67A 1TQIA 5EHOA 4C3FA 4CCUA 1HCKA 4I6QA 4NK9A 3RALA 4XG8A 2XRUA 2WMXA 3SD0A 4MTAA 2GFSA 4BBMA 3NW7A 5HORA 2R0IA 2XBAA 4GH2A 3RMFA 5DMZA 1Y6AA 4FKPA 1H4LA 3VQHA 4FV1A 5E91A 4D5HA 3PZHA 4FKOA 1J7LA 3COKA 4MEDA 4FOBA 2QOQA 4MXZA 3KGAA 4C3PA 4Q9ZA 3GU4A 3ZZEA 2ZDTA 3GB2A 3G90X 4BTFA 3A2CA 4GUBA 4AOTA 3VBWA 1PY5A 3Q9ZA 3EWHA 3MVMA 5CEMA 3U6JA 3CD3A 2CHLA 4O0SA 1YXUA 2OZAB 1OITA 4O21A 3KF4A 4FE2A 3KA0A 4G3GA 3VNTA 5LMKA 4QTBA 4CQGA 4KRCA 4IIRA 3GQLA 4G6OA 2RGPA 4TWPA 5HNIX 1BKXA 2RKUA 3UQFA 3PE1A 4KB8A 1M52A 1WBSA 3QRTA 4OUCA 5CF5A 4K77A 2PVNA 2W5BA 4C3RA 4NJDA 3UVPA 2R0UA 2X0GA 4L52A 4NM5A 2FUMA 5FWKK 1J3HA 3DXPA 1PXIA 2QHMA 2JIUA 2FO0A 2BHHA 5AP7A 1UNGA 5DE2A 3RZBA 2VNYA 3DBQA 3E64A 4L3PA 3SQQA 4YNEA 4MNEA 4ZJVA 3FI2A 4O7TA 2ZMDA 2HY81 2BRGA 3P08A 1MQ4A 1FINA 3V8TA 4PV0A 4DEAA 3FQSA 4AWIA 3Q4ZA 4FV3A 1R0EA 2QODA 2Y4PA 1FBNA 3JUHA 4UALA 4LFIA 4RSSA 4QMXA 1B38A 3WZUA 3MESA 2RFDA 5HD4A 3RPSA 4K18A 3PRIA 4W9XA 3D2KA 3R01A 3I5ZA 5EW8A 1Q61A 3OXIA 4G9CA 2UZOA 3OCGA 4MK0A 2R3GA 4TPTA 3AD4A 5IKWA 3ZRMA 2XRWA 1A06A 2RL5A 3NRMA 4BZDA 3LKMA 1GOLA 4IWOA 3QD0A 3POZA 5HOAA 4ANSA 5AUZA 2Z8CA 4HW7A 2WPAA 3HDMA 4CFFA 3IQ7A 2HK5A 4FL1A 3VUGA 4FC0A 5C03A 2V0DA 1Q3WA 4UB7A 3JPVA 3TNPC 5KKRB 3OW3A 4GKIA 1Y8YA 4EOLA 1MRUA 5E4HA 4QMYA 2VV9A 4C7TA 2EWAA 4BGGA 2R3QA 1Q3DA 4XG4A 5TR6A 4ANMA 4PP7A 3MY5A 2QNJA 5DR6A 3RZFA 3U6HA 3EQBA 4AACA 2GTNA 3HUCA 3KULA 2PVFA 3RHXA 3SHEA 4RWJA 2J0IA 1YHSA 4FTTA 3RM6A 3DTWA 4PNIA 1H26A 3NAYA 4QP2A 2PUPA 2E9PA 3FLSA 4XUFA 4JR7A 2BKKA 4X0MA 4F6SA 2OU7A 3NUYA 5T3QA 4U3ZA 3PYYA 4CCBA 3TNQB 1BI8A 1XBAA 4IANA 4XJ0A 4II5A 4AA5A 4A4XA 4QTDA 5A4EA 4RVTA 3R9HA 1Q8YA 1W98A 4Q5EA 4C36A 3ZXTA 3KRJA 3MJ2A 4R1YA 3TV6A 1Q62A 5HG9A 3UGCA 4ZLYA 3H9RA 4D2VA 3QTIA 4LL0A 3AC2A 3B2TA 2XK8A 3NCGA 3W2PA 3DXQA 1A9UA 2GQGA 4FV6A 4FTOA 3NUUA 4QMSA 3FZPA 5TKDA 3PXRA 3PXFA 1OECA 4ACDA 4I4FA 5CSXA 3F61A 3VRZA 4YZDA 5DA3A 1JQHA 5H8GA 3AXWA 3ERKA 2OJIA 3O7LB 3VF8A 1YDRE 1U59A 2OH0E 4FNXA 3TIZA 3P5KA 3QXPA 2BRMA 4EK6A 5DYJA 4M14A 2GNHA 4M97A 3ALOA 4KINA 4RIYB 4GT5A 4I24A 4R6VA 4BI1A 5F95A 3FI3A 5IZFA 2HW6A 3P7BA 3OY1A 4ASEA 3A61A 4FVPA 4CFNA 4QP1A 4G6NA 5FM3A 4OT6A 2J6MA 3QU0A 4ACMA 5LMKC 4R5SA 3LFSA 5TE0A 2ZDUA 3R8VA 5AX9A 3L8VA 3PZEA 5CEOA 4BYJA 4A9YA 3C1XA 5LCKA 3F3VA 3RAWA 4EK5A 4AZTA 4QYEA 4JJRA 4FUXA 3IK3A 4UY9A 4GIIA 4YZMA 2YIXA 4ANLA 4ANBA 5IU2A 4UYAA 3R28A 2C5VA 2W1DA 1OKWA 2C6KA 2V7OA 3EQFA 3BU6A 4FIFA 4FT0A 4IM2A 3RI1A 2CKPA 4U9AA 3TL8A 4J98A 3II5A 5FQDC 3FXZA 5KMKA 4F0FA 4Y95A 2HZIA 4J99A 5FP5A 4FSZA 3CTQA 5BYZA 3PJCA 4FIIA 4G9RA 4L3LA 3ID6C 2WZJA 3I60A 4C34A 4C8BA 3GEQA 3P23A 3E3BX 3KN5A 4J8NA 2YAKA 4KRDA 3VS3A 3W33A 1ZMVA 5IEYA 4BY9E 1IEPA 3QTRA 2OLCA 1U54A 5JEBA 3D2IA 4BCJA 1FQ1B 3R1NA 4XRJA 4ANOA 3FV8A 3D5UA 3R7OA 5CASA 4CT2A 5K3YA 5CAUA 2IW8A 1OKYA 4RJ3A 4OTQA 4PX6A 4JDIA 5L8LA 3A62A 5K4JA 1IAHA 3BYOA 3PPJA 3UOJA 4D1XA 4CVAA 4YU2A 3RK5A 4YO6A 2VO0A 4TZRA 1XH4A 4EI4A 2QC6A 2BKZA 2BRHA 2X7FA 4U6RA 4JL9A 2W96B 4BI2A 4E73A 4U80A 3SV0A 3FHRA 4D2WA 3ZLSA 4C4IA 1YOJA 4DGMA 4IZYA 2Z02A 3EN9A 4D4YA 4PPAA 3U6IA 1WVYA 2QURA 4USEA 2ZV7A 3VS2A 4ZK5A 5D7VA 5CAVA 4I5PA 4C62A 3FZRA 2G2IA 3QUDA 3MSSA 4M7IA 3W32A 4ZY5A 3MTLA 4FT3A 5FLFA 4HVHA 2QU6A 3HAMA 3L9LA 4U43A 3GUBA 3SRVB 3ZH8A 5IA1A 1REKA 4FK6A 2VTHA 4OGRA 4C38A 4EUTA 1IRKA 5EOLA 2ZVAA 5AP2A 4BCKA 2CSNA 4V0GA 3CJGA 3HA6A 4PRJA 4O38A 4YLJA 2W1CA 3WIKA 4DH5A 1SM2A 2VTQA 2IW9A 4H36A 3ZC6A 2ITQA 5JSMA 4CNHA 4HVIA 3BWJA 1BX6A 2OIDA 4CRSA 2W1FA 5HU9A 1ND4A 5I9XA 2WTCA 2PUNA 3QUPA 4OW8A 4CD0A 2O63A 4AW0A 4O7SA 3HP5A 3FMJA 4H1MA 3DK3A 4J53A 4JNWA 3ZCLA 3M11A 4PDSA 3ZO1A 1Q8TA 4J71A 3C4CA 5CT0A 4D0XA 4LOQA 2BALA 2Z2WA 4C35A 4DGNA 3DDQA 4FT9A 3KC3A 3MW1A 4O7ZA 2AUHA 4QRCA 4BDEA 1SMHA 1KV2A 5LQFA 3PIYA 4NWMA 3I7BA 3NNXA 3Q5IA 2WXVA 4FKVA 1XH7A 2WQMA 3DZQA 4IH8A 5B7VA 2UZEA 2QOHA 4K8AA 1PJKA 2G2HA 2OZOA 2ZV9A 3P1AA 3R7UA 5IH4A 1OIYA 2BROA 3DKCA 3BBWA 3V5PA 5AA9A 5CQUA 3PDTA 3VUHA 3MS9A 4EJNA 1KE7A 3FMEA 3OMVA 1OMWA 3GOPA 4N4SA 4M3QA 5IA0A 2C5XA 3VVHA 3RWPA 2F2UA 4O96A 5JRSA 4RJ6A 5IPJA 5CWZA 5E90A 5M07A 5K0KA 3E8NA 3BEGA 3I0QA 3O51A 4K2RA 3G5DA 4QQ5A 3KXGA 3QGYA 4C2VA 2BDJA 5FTOA 2R4BA 3DU8A 4LYNA 4QTAA 4UEUA 4PPBA 2J0JA 1LUFA 3ULIA 2WMQA 3DPKA 1YOLA 1M2PA 4D58A 2Z60A 2XEYA 4FTNA 4KIQA 2X4FA 4NKAA 3TV4A 2RIOA 2WNTA 1H1QA 3ZDIA 3AQVA 4FA2A 3TZ9A 4XBUA 2X8DA 4BCHA 4IXPA 3ZO2A 3AT4A 4OTWA 3RPYA 2OFVA 3MH2A 4EYJA 2PUUA 2C3IB 4OBQA 2NPQA 1RE8A 2C6LA 2VX1A 2YJSA 5CEKA 4IJ9A 2ZOQA 4DEBA 3RTPA 4TYGA 1WBOA 4RJ8A 3ZFMA 3CQEA 4G5PA 2H9VA 4PWNA 3A7GA 4KIPA 4BC6A 4Z3VA 3KMWA 3WIGA 3D5VA 3QL8A 3MB6A 3OCTA 4YSMA 4D4VA 4LV5A 3LJ1A 3H10A 3KCFA 3VS7A 4YC8A 5IDPA 4QQTA 3UZRA 3L8PA 2DS1A 4FKGA 3QKMA 4PL4A 5EQPA 5CVHA 4KIKA 5AP0A 1NW1A 4RQVA 2HELA 2Z7RA 3K3JA 2JKMA 4S33A 2VGPA 4DFUA 2HAKA 5CZIA 2VO6A 4ZSLA 1ZMWA 3U9CA 5DRBA 5I3RA 4U44A 3R8PA 3G51A 4Y85A 1B39A 4GG7A 4PMPA 3R6XA 1RDQE 2YISA 2Z7LA 2XNEA 4JVGA 4OTPA 5E8SA 4KABA 5BVWA 4BGQA 4F7NA 3VUMA 3A8XA 2BZKB 2PL0A 4O84A 3NR9A 3TG1A 5AX3A 1JBPE 2YIRA 1MRYA 3IECA 5ANGA 1PMEA 3ORLA 4MNEB 5E92A 3A7HA 5CF8A 2P2IA 3FYKX 4V05A 3S95A 2VWWA 2JKKA 4U0IA 4TYHA 5ITAA 3BE2A 4O27B 1R1WA 4Q5HA 2JDSA 4X6QC 3NS9A 5CU2A 3LVPA 3AC3A 3RAHA 4XP3A 5A3XA 2VWXA 4OTHA 3UJGA 3PJ2A 3QWKA 4O22A 4IM3A 4QQCA 4RQKA 4IDTA 3PXKA 4TN6A 3DTCA 4HGTA 4UMPA 3G6GA 4I5HA 2EVAA 2XK9A 4GKHA 4FV8A 4HOKA 2RSVA 5L2SA 2XKEA 3MFSA 4FNZA 4KBCA 4L00A 2OXDA 4EC9A 2YCQA 3W2SA 4QYFA 2ERZE 3EQPA 2E2BA 4P5ZA 4O6EA 4I1ZA 3A4OX 4A07A 3PY1A 2RFNA 3LFAA 1YHWA 4BDJA 1ZYDA 4B6LA 2CN5A 4FTJA 3Q9WA 4UN0C 2P4IA 5JGBA 4DEEA 2O64A 2B53A 3P9JA 3KRRA 4ACHA 2RFEA 3CIKA 4BYIA 3F2AA 4HJOA 2OFUA 1UKHA 2PK9A 3ORKA 4O7VA 3Q4CA 5M4FA 2FGIA 3UYTA 1WBWA 2XIXA 4FZ7A 3RINA 4OTIA 4XLIA 1GZOA 4EOIA 5A14A 5HO7A 4FT5A 5I0BA 4IWQA 4KNBA 4EH2A 3BPRA 3MY0A 4D9TA 1UV5A 5J1WA 3G2FA 5ETAA 5M51A 4KKGA 3S00A 2GFCA 5BQ0A 1NT2A 2JEDA 4HZRA 4PL3A 3OWJA 5HX6A 4J52A 1OL6A 1Q8ZA 4HYUA 5CVFA 3KMMA 2UZBA 5J8IA 4DFXE 4JI9A 3AMYA 5CAPA 3FQHA 5LVOA 3SVVA 3PRFA 2GHMA 3IW6A 2VWUA 1R0PA 3FQEA 2NRYA 4ZIMA 2OXYA 3KRXA 2Y6MA 3OOGA 5AMNA 5CI6A 4RRVA 5ANEA 2BZIB 5FG8A 1OL7A 3ZU7A 4UMRA 1PRYA 3EQIA 4ZP5A 4YURA 1TVOA 5DEYA 4EOSA 4IHPA 3NIZA 4EH7A 3K54A 4LRJA 2ITNA 2E9NA 5J9YA 4QYHA 1G5SA 1W84A 2CMWA 1QCFA 4YJPA 2YWPA 5HCXA 3ZM4A 4C4JA 3NNVA 4JRVA 5HVJA 1AD5A 2PTKA 4X2JA 1OKZA 5LWMA 2H96A 2XNBA 3VO3A 2GNJA 4E20A 1P5EA 1FMOE 2YLEA 4YPDA 4CFXA 5JMSA 1J7UA 1XKKA 4W9WA 3EQCA 4IB1A 1TKIA 1H00A 5BVFA 4I5MA 4MNFA 3OFMA 4JDHA 1H1WA 4ARKA 4R7HA 5EYDA 4QMMA 1YQJA 4CTCA 1YOMA 3Q4UA 1I09A 3D15A 4FSYA 2W4OA 2YN8A 3GU6A 4RWKA 1PHKA 3TNHA 1MQBA 2IVVA 4GYIA 2ETRA 2VWIA 3IDPA 3F3WA 2KTYA 4FKSA 1ZXEA 4FGBA 3C50A 3W55A 4AXAA 2C6IA 3EN5A 4BWKA 1F3MC 3V5TA 2IZUA 5HNBA 1GZKA 2BPMA 2QOBA 4GK3A 3C4EA 3EN4A 5C8MA 1PMNA 3F5PA 5CEQA 3NNWA 3OY3A 4AGDA 5J9LA 4YTFA 4FEVA 3ORIA 3AD6A 4DFZE 2R3NA 2X2LA 4CZYB 4JBQA 2HIWA 2F4JA 4I41A 1FGKA 1JSTA 4R7IA 5KBQA 5K0XA 1SVEA 3DNDA 3E8EA 4RLKA 3GU8A 3NGAA 4CYIA 5KE0A 3OXZA 3A99A 4RX5A 4JG7A 3NUPA 3ZHPC 4AN2A 4GK2A 2HZNA 2OJGA 5DR2A 3ZZWA 4YTCA 1ZZLA 3OWKA 4KAOA 4DLJA 5CU6A 3O71A 4D1ZA 4A4OA 2ITVA 3JXWA 3VULA 3ZRKA 1GAGA 3OVVA 3UIMA 4EK3A 1QPDA 2PZRA 2IW6A 4FI1A 4FG7A 2JDOA 3CQWA 5AM7A 5CAQA 4EHGA 3QAME 3O2MA 4I6BA 4IBMA 4MBIA 5EM8A 3UODA 3VJOA 4F9CA 2BRBA 5CLPA 4APPA 2HOGA 3BQRA 5EG3A 3E3PA 2WTKC 5E8ZA 4ERKA 2BVAA 3UP2A 2UZNA 2PPQA 1UNLA 5IEVA 5A4QA 2B9JA 3F3TA 3Q4TA 3F88A 3Q6UA 3TN8A 1R78A 2FVDA 4GT3A 4X21A 4M67A 4R3CA 2B4SB 1Y57A 4A4LA 4F1MA 2XYNA 4MH7A 3CXWA 5E1SA 1NVQA 3EYHA 1YDSE 3OT3A 1P2AA 3EYGA 5D12A 3PA3A 5E8WA 1WAKA 2OIBA 4I22A 4HCUA 4HPUE 5BUEA 2BIYA 3A4PA 2VGOA 4H3QA 3U51A 2E9VA 2A4LA 4J96A 5FBNC 5C01A 3HAVA 3F5GA 5L2QA 2GPHA 3QTUA 3S4QA 2WTWA 3GVUA 3LW0A 4MF0A 2BILB 5CTPA 2JDVA 2ZM1A 4K33A 4FTRA 4RIXA 2UZDA 2EU9A 4YR8A 2PZIA 2XNGA 4I5CA 4OBPA 4TWCA 3DKFA 5FEEA 4IVAA 4JAIA 3C4FA 5KMJA 3SA0A 4IAAA 3F2NA 5CANA 3TUDA 3RAKA 1ZY4A 3OS3A 4R3RA 4E1ZA 4PL5A 2J5EA 2XM8A 4WOVA 1MRVA 5IQBA 3BELA 2RFSA 4X7QA 4KSQA 4AFJA 3C0IA 3W8QA 2GQSA 4CV9A 1QPJA 4IFGA 1BL7A 5CT7A 4PMMA 5JGDA 3OC1A 2BMCA 3FLZA 4O0XA 3ZBXA 3QD3A 3M42A 4MVFA 2VU3A 3FSKA 5IQGA 5C9CA 5EYKA 3QHRA 4KUJA 2UW8A 4WG5A 4AF3A 2WIPA 3I4BA 2QOKA 3FC2A 3I0OA 2WOUA 3Q9XA 1E1VA 2C69A 1XR1A 3T8OA 5KMNA 2R3PA 1WMKA 3QTWA 3R2YA 5E8TA 2B9HA 3BV3A 3TKHA 3R04A 3VBYA 3ORZA 4JDJA 3PSDA 4QD6A 2XKDA 4C58A 3S0OA 1UKIA 2XH5A 4BZOA 2A1AB 3FC1X 3TUBA 4ZSGA 4KWPA 5EYCA 3RPRA 4MXXA 4FUYA 4QP6A 4EH8A 2J9MA 1PXOA 4DEHA 3O0GA 4M12A 4AA4A 1WFCA 2BRNA 3PPKA 3FZOA 4RC2A 4M0YA 4RT7A 2XZSA 4OLIA 1OPKA 5HKMA 3RK9A 4DG0E 2X8EA 3CR0A 1VEBA 2ITPA 2X1NA 3QWJA 4FIHA 5AEPA 5JFWA 4J97A 2OJJA 3EQHA 5FM2A 4XG2A 5ACKA 3U4WA 4C2WA 5IA5A 5IUIA 3HMPA 2FYSA 3ITZA 2LGCA 5LXMA 4RIWA 1LP4A 3BLHA 1XH5A 2GNIA 4G3DA 4WUAA 3IOKA 5CF4A 1OM1A 3FE3A 3ANRA 4FT7A 4BR3A 4M68A 4Y8DA 1CDKA 4RPVA 5DFPA 3MVLA 5EDQA 4NM7A 5CXZA 5HEZA 4O7YA 3LMHA 1Q8WA 3SDJA 3EFJA 2HZ4A 1DAWA 3MPTA 3ODZX 4J8MA 5CY3A 4CKRA 3KEXA 3PTGA 5JQ8A 3FSFA 4QPMA 2VTPA 2R7BA 4LI5A 3NCZA 4ZXTA 1F0QA 4H3BA 4UX9A 2CGVA 3UZTA 3IDBA 5JQ5A 5FEQA 4X2FA 4NSTA 4GCJA 5IH5A 5G1XA 5TO8A 4XRLA 4IWDA 4KIKB 4EOMA 3TKIA 4KS7A 2QOFA 1Q99A 2YIWA 1KUTA 4WT6A 4L7SA 4AOIA 3BGQA 3QALE 3UOLA 5EI8A 4AT4A 4R78A 3NW5A 4FEWA 1YXTA 3RBWA 2C6TA 2RG5A 3SW4A 5GZ8A 1KE6A 3UPXA 4G3FA 4ZTLA 5BVOA 4O7NA 5KHWA 5AAFA 3VN9A 1UU8A 4AOJA 1Q8UA 1XH9A 3MPMA 1XQZA 3DT1A 3PWYA 4K11A 2YIYA 4UYNA 1WBNA 3NVKI 2ZJWA 3VW6A 4EK4A 4N70A 3UO5A 4U79A 1KWPA 3PP1A 3E7OA 1ZARA 2QLUA 1IG1A 3SXRA 3REPA 2C6EA 4O1OA 2P55A 2VWYA 3Q96A 5AV3A 2OWBA 1JVPP 4AGWA 4IJPA 2XNMA 2Y9QA 4F4PA 4NT4A 3Q53A 3EB0A 5IQHA 4AX8A 4K9YA 3V51A 3FKLA 4QMWA 4YZ9A 5J7BA 3LOKA 2R3OA 3ZS5A 2GHGA 3PP0A 4IW0A 4M15A 4BDDA 3UG1A 4JAJA 4L6QA 1IA9A 2J7TA 3FZSA 4GL9A 3MH0A 4GU6A 2XCHA 2XNPA 4YHFA 4ZZMA 3TNIA 2EXEA 5D7AA 2A2AA 2Q0BA 4X6RA 1RQQA 4M13A 4QMLA 2QCSA 3V8WA 4PY1A 4ONAA 3AOXA 3QRJA 3QZHA 2W5AA 2UV2A 4BCQA 4RJ5A 4EBWA 5L8KA 2XNNA 2JIVA 3NUNA 3UC4A 5IUHA 5AUWA 2OI4X 2OJ9A 3TZ7A 2J5FA 3L9PA 4WG3A 1ZYCA 4D4RA 4FVQA 3SOAA 5E7RA 5BYYA 1OBDA 2PMNX 4ANNA 4ENXA 2PVHA 1GZNA 3DNEA 3LCTA 1ZLTA 3V3VA 2VUWA 3GCVA 3P0MA 3MJ1A 4L68A 4U5JA 2R3JA 2HY0A 5DRDA 2YERA 4O0RA 3JY9A 4WUNA 3TT0A 2PMIA 2ERKA 4XG6A 3QRIA 4RWIA 4D0WA 2E9UA 2ONLA 5TF9A 2NRUA 3U9NA 3CY2A 4U45A 3FPMA 3OWLA 3QX4A 4DFYA 4YHTA 4AZWA 4EKKA 1OUKA 1YWNA 3VBTA 1OL2A 5HG8A 3QCXA 2QO7A 5J87A 3LFQA 2QU5A 1BYGA 4GW8A 2W99B 5AP3A 3BRBA 5M4CA 4AZVA 2QOIA 3R02A 2YA9A 3QA0A 3RNYA 4F9WA 3EZRA 3ZSGA 4I0TA 4A7CA 4FTCA 5KUPA 1J91A 3EOCA 5F94A 3VUKA 4MD8E 3D5WA 3BE9A 4FV7A 4S30A 4R3PA 3PSCA 5JZJA 5M08A 4DEIA 3E62A 3ZXZA 5KNJA 3NDMA 4N57A 3E8DA 5AP4A 1Q41A 5DVRA 4ZTSA 1FOTA 4D9UA 2XK7A 3UNZA 5FP6A 3KFAA 4BZNA 4D55A 2R2PA 3JR1A 2XF0A 2OKRA 3E5AA 5FBOA 3V6RA 3OWPA 4LGHA 3ZRLA 4U8ZA 1YI6A 2YWVA 2R3RA 1ZYJA 1JKSA 4FSMA 3QCYA 1T45A 1UNHA 4I4EA 4RC4A 3QGWA 3JY0A 3HP2A 5M55A 4XH6A 4F1OA 4LL5A 4U42A 5A9UA 4MWHA 4BL1A 4YJSA 3LJ0A 2LAVA 3VRYA 4TYIA 5DBXA 2CLXA 2VWBA 2I0VA 4Y5QA 2JAMA 4AUAA 2C6MA 2W1ZA 4CQEA 2IO6A 3NUSA 3CSVA 1PKDA 5GIOE 5J95A 5BYLA 1BMKA 4TKSA 2GU8A 2PE0A 2R3HA 3FI4A 5AV0A 3A8WA 5HTCA 4ZS4A 2XUUA 4C33A 4NM3A 1SYKA 4RLLA 4WNMA 3R21A 2BHEA 2QR7A 3KU2A 2V62A 1J1BA 5EM6A 4QMQA 2EXMA 5HLPA 4UMUA 5JFXA 3HMNA 4LOOA 5GNKA 3W1FA 3KY2A 1BLXA 4KSPA 4IMYA 2OXXA 2HW7A 4TT7A 4GVJA 2QOCA 4XX9A 4IQ6A 4EONA 5KHXA 4O2PA 1M7NA 4BKJA 3P79A 2A19B 4C61A 5CSPA 3HV7A 2GS6A 3H30A 4LQMA 5BVNA 2VNWA 3HV5A 2XIYA 4FZAB 2ZMCA 3QRUA 4PPCA 4RZVA 3AC5A 1JKLA 3CD8A 1NA7A 4FMQA 3WF7A 2H6DA 3IONA 4K6ZA 5DI1A 4B9DA 4CYJA 1ERKA 2JFMA 2WAJA 3MWUA 5EOBA 2GS7A 5DT4A 2YAAA 1SZMA 3F3ZA 3H0ZA 3MH3A 4GJ3A 3R8UA 2XEZA 3D0EA 2OK1A 3BHUA 3DGKA 3SC1A 2VTNA 4D2TA 4UZHA 3FXXA 3N4VA 4XCUA 1H1RA 2XK6A 3LCKA 5ANJA 1AGWA 1IA8A 1YWRA 2JBOA 2PMLX 3BU3A 1Q97A 3MN3A 2VWZA 3PXQA 4ZJIA 4DTKA 5AIKA 4D1SA 2W05A 4B0GA 5JZNA 2BIKB 1DI8A 1YI3A 3OUNB 4EH6A 2R3LA 5AV1A 5CVGA 4GT4A 2VTLA 4E6QA 3DBDA 3DQWA 4EUUA 2AC3A 3JS2A 1U5QA 4YP8A 1H07A 4IE9A 4L42A 3ELJA 4FBXA 3K5UA 3WARA 5HI2A 4IDVA 2ONLC 3NYOA 3O17A 5ANDA 1GY3A 3GU5A 4AE9A 4DFLA 4RIXB 3C4WA 1H27A 3I1AA 2BTSA 3BYUA 3MY1A 5E9EA 1P4OA 1PKGA 4NUSA 3U87A 2UZUE 1V0OA 3ORXA 4PMTA 4O1PA 4IZ7A 3QLGA 3ZEWA 3MVHA 4R1VA 3W16A 4PF4A 4DA5A 1T46A 3BGZA 2OSCA 2R3FA 1P4FA 3DKGA 2HWOA 3GENA 1A48A 3PLSA 4OTRA 4ZS0A 2XBJA 4BCFA 4YZBA 3DKOA 4RA4A 2J0LA 3E8CA 3PG1A 4C4EA 1FVVA 4EH9A 3TUCA 2OH4A 2V7AA 5DG5A 1GIIA 1XH8A 4E5AX 2IZTA 1OVEA 5EKOA 1ZYSA 5HTIA 4CMUA 2WU7A 2FSOX 5AR8A 4YSJA 4L8MA 1W8CA 4F65A 3WF9A 5HBEA 2CNVA 2C30A 3BYMA 1ZOGA 4BCOA 2C5OA 1UU3A 4XP2A 1XBCA 4YBKA 3OXTA 3C5IA 2PU8A 3LFEA 4F9AA 3SG8A 3NW6A 5LMBA 3OP5A 1YKRA 3EIDA 3PY3A 3QBNA 4IVBA 4YC3A 3VUDA 3ZSHA 4BDAA 2E9OA 4QP9A 4Y73A 4ANQA 5EYMA 3F69A 4YJOA 2QR8A 1HOWA 3ZM9A 2Y6OA 3Q60A 4QMUA 3FL4A 2VZ6A 2JC6A 4G3CA 4RZWA 3GCUA 1R39A 5CSHA 3HLLA 5IG1A 4P90A 3OCSA 2UW6A 4CZTA 1EH4A 4E4MA 2R7IA 4QMNA 4D2SA 3NYVA 1U5RA 3B8QA 2WMAA 4TYJA 2UVZA 2XVDA 3VUTA 5AADA 1ATPE 2C1BA 2VTMA 4EJ7A 2FSMX 4MXYA 4Z7GA 4JBVA 2JDTA 2R5TA 4XG9A 5HE2A 3BZ3A 2HXLA 5L6WL 2UZVA 2PYWA 5EI2A 3BU5A 2HZ0A 1URWA 1PYEA 3GCQA 2JBPA 3FKNA 4JS8A 4QP8A 4NJ3A 4AQCA 4IB5A 4BFMA 2F7ZE 1RJBA 4USFA 1H24A 4CT1A 3G6HA 3VS4A 2PY3A 3VHEA 2IZRA 3TEIA 3LZBA 5FUTA 4DG3E 4ZAUA 1W7HA 4BDFA 3ZFYA 3I5NA 1UU9A 4Y72A 5BMMA 5T6KA 2WTIA 3QTXA 3QTZA 3A7JA 4EC8A 4A9RA 4GMYA 2W5HA 4XHKB 3ULZA 1Y6BA 2X9EA 3R63A 1ZRZA 2CJMA 4F6WA 1NVSA 4DINA 2X81A 4XV2A 5H8EA 3DJ5A 2IWIA 4I6HA 4L45A 4RFZA 5TOZA 3ORMA 2P33A 3T9TA 4RX8A 5HHWA 3UBDA 3D5XA 3PVGA 4RWLA 3RAIA 2OF4A 2WMSA 2F49A 3WYXA 3CKWA 4O0YA 4Q2AA 3QQFA 4B8MA 1XHAA 3HV6A 4CMOA 3UMXA 2XJ2A 4FKRA 1XBBA 1OUYA 3QYZA 5HIDA 3DJ6A 1Q24A 3KCKA 2UZLA 4N6YA 5DLSA 4KD1A 3KXHA 2W1IA 2WKMA 3ENMA 2WMBA 2G15A 2G1TA 4BCMA 3KK9A 4EQCA 4MBJA 4BWPA 3ZUUA 2YZLA 2W06A 4TY1A 3V5JA 3O23A 5HZNA 2ITWA 4IB3A 3FYJX 3CPCA 3ATTA 4QMZA 3LXPA 3VW8A 2OZAA 1PYXA 2G9XA 2VTRA 4LUEA 2ETMA 4X3JA 2QKWB 4DTBA 3EMGA 3R22A 3RHKA 1ZOHA 3ZLWA 3NYXA 2YIQA 3FHIA 4C4GA 4PQNA 4IZ5A 5E8VA 4IFCA 5FTGA 3IW4A 3P4KA 4FOCA 2XIRA 5I9VA 5HQ0A 3FMNA 4D2PA 5IMEA 3GFEA 2C0IA 2V22A 4ZLOA 3IOPA 2PE1A 4FICA 3R83A 3BLQA 3FY2A 4X2KA 2V5QA 3U54A 2V55A 5I3OA 3EKKA 5K5XA 3Q5ZA 3KXNA 3RCDA 4NTTA 4BHZA 2UVYA 4FSUA 3CP9A 2BTRA 2C1AA 2QONA 5KX8A 1JKKA 5AP6A 2VX0A 4HCTA 3MH1A 2J51A 3SOCA 5M53A 3GU7A 3PFQA 3NYNA 4IADA 1NY3A 4H3PA 3G9NA 3PVUA 4DH8A 3G15A 4NZWB 3UNKA 4FZ6A 4AP7A 4R77A 4KA3A 1JPAA 3FXWA 3KULB 2XB7A 1KOAA 1PF8A 3LFNA 3T3UA 3ZMMA 4ZOGA 4B8LA 4I23A 4E4XA 2VTIA 4H05A 2JDRA 3CEKA 3FMKA 4YJQA 4NKSA 5L6PA 3NUXA 4KBAA 2Z7QA 3L9NA 5LOHA 4YC6A 3I81A 4TRLA 2CKOA 5EKNA 2G01A 3E93A 3E63A 5CENA 4FYNA 5L8JA 2B54A 3PVWA 3QZFA 4NCTA 5M4IA 2C3LA 4MQ1A 4C57A 3NMUF 2WMUA 5FXRA 2R3IA 5ETCA 3Q2MA 5D11A 5EH0A 1V0PA 2YJRA 3TJDA 3UE4A 1MP8A 4I3ZA 3R7YA 5LVMA 5EM5A 2XKCA 3PVBA 3TZMA 2WQEA 3KXXA 3NLBA 4L46A 4NTSA 5I4NA 2B9IA 1Z5MA 3HMOA 4U81A 5GHVA 3U8WA 4PDOA 4PNKA 3BHTA 4HGEA 3OTUA 3ANQA 1O9UA 4FTLA 3U55A 3F7ZA 3QQKA 4QP7A 2J2IB 3T9IA 4HGLA 4GS6A 3OW4A 4QMTA 4RA5A 4LV8A 3WOWA 3QZIA 3EJ1A 3MPAA 3EZVA 2Q83A 1KE5A 4BCPA 4ITIA 4N0SA 4BHNA 4KKHA 3IGOA 4TWOA 3NVMB 2JITA 3B2WA 4FTIA 3G0EA 3L8XA 3EN6A 3Q9YA 3NIEA 4GSBA 4ERWA 4CEGA 5IQIA 5F4NA 2YM6A 1M7QA 1TQPA 3GXLA 5H3QA 4QP3A 4MHAA 3LQ8A 4EQUA 4FL2A 5JKGA 3TXOA 2CKQA 4CLJA 5L4QA 4FKUA 3FPQA 4QMVA 3S3IA 4XV9A 4F6UA 4ZSAA 5JRQA 2XK4A 3IW8A 5C27A 5CALA 2UW9A 3ZO4A 2XNOA 5AM6A 2GSFA 4DGLC 4UWCA 2UW5A 3O50A 4RJ7A 4BBFA 3EL7A 4YLLA 3W10A 4RIYA 4J1RA 3RM7A 4PDYA 5E8YA 3ZDUA 4W4VA 3QF9A 5A46A 4O83A 5E1EA 4BI0A 3UQGA 5AV4A 3LE6A 4FX3A 4R5YA 1UU7A 2VTTA 3LFCA 2YZAA 4EZ7A 5FXSA 4IAFA 5J1VA 1QPEA 4MQ2A 2I40A 3FJQE 1DM2A 4OBOA 2YDKA 3NAXA 5HE0A 4D28A 4ZTMA 1GZ8A 4TWNA 3IW7A 4QYGA 2ZB1A 5KMIA 5CZHA 5DEWA 3RK7A 1OB3A 3GI3A 1U54B 1YXXA 2CGUA 5ACBC 1OPJA 4BICA 2DUVA 3TJCA 1P14A 5GJGA 4I92A 2ZYBA 3ZO3A 4HPTE 3KVWA 5HE1A 5HX8A 4YHJA 3C7QA 4OR5A 3UOHA 3VS6A 5H8BA 2JAVA 1FGIA 4BDIA 4C4HA 4CFVA 4ACGA 5A54A 2Y0AA 4ALWA 4AN3A 4DH7A 3LM0A 4CSVA 3HVCA 5KMLA 1E1XA 2XM9A 4JQ8A 5GZAA 5CQWA 2XMYA 4H1JA 4DBXA 2ZAZA 1W83A 2WTVA 4DH3A 3R8ZA 4E93A 4XG7A 4Y83A 2AYPA 2XP2A 3GQIA 4E3CA 3ZSIA 5FEDA 1KV1A 4O0TA 4AZSA 4F09A 4UV0A 4C4FA 2UUEA 4N6ZA 2HCKA 4YJVA 3V8SA 4BCIA 3R9RA 3N4UA 2OGVA 4HYHA 4YPSA 4NW6A 3TI1A 4ID7A 4OTDA 2O3PA 4EOPA 2WMWA 5J9ZA 1ZAOA 2BAQA 2QO2A 4NW5A 2ZB0A 3BEAA 4DGGA 3TZ8A 5D10A 5CEPA 4E7WA 5E8UA 1JWHA 3FAAA 4CMTA 4DEDA 1IAJA 1J1CA 1OIQA 4DFNA 3DXNA 4NCTC 4CZUA 4DG2E 4TW9A 4AU8A 4L53A 5IF1A 5C4LA 3COHA 3CCNA 4V0GB 1TQMA 3AT3A 3DFAA 3F5UA 4EH3A 4O82A 2UW0A 3O8PA 4EK8A 3ZLXA 4FTKA 1OPLA 3FEGA 2GS2A 5FGKA 3BLRA 4BGHA 3C0HA 4O91A 5I9UA 3EKNA 4FKTA 3PA4A 4JXFA 3VS5A 4UBAA 3LMIA 3E7VA 3GCSA 4FV0A 3OT8A 5IH6A 1E9HA 2VTJA 3KL8A 4IC8A 4Q9SA 3ORPA 4TYEA 2CLQA 3IGGA 5H9BA 5J5SA 4CRLA 5DHJA 3N4TA 4F99A 2W0JA 2OF2A 4DYMA 4YO4A 3DB8A 1CMKE 4FEUA 2PVYA 3EN7A 3R1SA 4MXOA 2XS0A 2YEXA 1KSWA 4NH1A 4YJUA 5HICA 3SW7A 4NL0A 3OOMA 2YCSA 4FSNA 5D1JA 5FXQA 3QYWA 3TCPA 4IACA 1OI9A 3R7EA 3UIXA 2NO3A 3LXKA 2ITTA 2PVKA 4X3FA 3BCEA 4G1WA 4AW5A 2KULA 4WD5A 2UW4A 4FSRA 2VX3A 2Z7SA 1JSVA 3UVQA 3HZTA 2YM5A 1LEWA 2FH9A 4XOYA 5CF6A 4GYGA 4V01A 3MA3A 4QQJA 4DTAA 3F82A 3NZ0A 2WEIA 1VYWA 3MA6A 4GU9A 4MYGA 3ROYA 2VTSA 3CJFA 3MFTA 4PMSA 5HO8A 5M44A 5HNGA 2IN6A 1Z9XA 3LCSA 4MCVA 4LOPA 1B6CB 5AV2A 3CTHA 4DGOA 4G16A 1XH6A 4LG4A 1CSNA 3E88A 3PA5A 5HVYA 3AT2A 3DLZA 3LCOA 3WZDA 4CGAA 4EHZA 3QQHA 3OROA 3DK7A 4RX7A 3C51A 4E26A 2PZPA 4MWIA 4ZTRA 4BTJA 4Z9LA 3QX2A 4OT5A 4WHZA 5I5ZA 3NNUA 2REIA 2WMTA 3DS6A 2F57A 3GT8A 4JT3A 5HIBA 1H8FA 2XCKA 2ZM3A 3CBLA 2ESMA 4I6FA 4TNBA 3ZEPA 3CPBA 4YJTA 3CQUA 4V04A 2NP8A 4CV8A 1WVXA 1G8AA 3P78A 1YWVA 3GNIB 3AG9A 3PY0A 4JLCA 3V01A 3R8MA 4FTUA 2PVMA 3UTOA 3Q6WA 3I79A 4AGCA 4BIEA 5IQAA 4DT9A 3VBXA 4O7LA 3ODYX 2XJ1A 4DH1A 4YZCA 2WFYA 4YZNA 4W8EA 4WBBB 3BHYA 4IZAA 2NNWB 2QG7A 2ETKA 4L43A 3C0GA 1K3AA 2HYYA 2WIHA 3MIYA 3BWFA 4RIOA 3UVRA 2OO8X 2QOOA 5HLWA 3BHHA 3VQUA 4BB4A 3GOKA 4LMNA 4R8QA 3R7IA 4EBVA 5ANIA 2BAJA 3LLAA 5A6OA 3D7TA 5ETIA 4YJRA 1DI9A 2R9SA 5HG7A 5BVDA 1PXJA 4J95A 4RX9A 3C4XA 3KXZA 3OF0A 3LQ3A 1APME 4ZMEA 2ITXA 4L44A 2QO9A 5FD2A 4DT8A 2C0TA 2W1GA 3D9VA 3FLYA 3LFDA 5GJFA 4BCGA 3ZC5A 3IW5A 3FZ1A 4C02A 4WO5A 3LM5A 3MI9A 2C0OA 1NVRA 2X6DA 3G33A 2B52A 4FR4A 2WHBA 4G17A 5I9ZA 5AIRA 1H0VA 1Y8GA 4TYHB 4FZFB 3KQ7A 2ZV2A 3ZBFA 1R3CA 2C3KA 3HMIA 3RPVA 4WG4A 1M17A 3K5VA 5IMXA 3M1SA 4AZEA 1O6KA 2R64A 1OIUA 5LVNA 1YW2A 1Q5KA 3O8TA 1SNXA 5HE3A 3I7CA 4LM5A 3DOGA 4G6LA 4JOAA 3KKVA 3WYYA 1OGUA 2I1MA 4FKQA 4WA9A 4A06A 5CS6A 2C6OA 5B2KA 1QPCA 4RFYA 2VTAA 1PXNA 4WNKA 3UO4A 4MXAA 1GJOA 3R2BA 2J50A 4BCNA 3RPOA 5M4UA 4E4NA 4G5JA 3PE2A 3UYSA 3DLSA 4DC2A 4IAYA 4X3FC 2WTKB 3DFCB 4U3YA 3C13A 4GFGA 3WE8A 3SX9A 4ASXA 3QHWA 5L2WA 2DWBA 2UZWE 2C5YA 3ORTA 3R73A 3VWAA 4M0ZA 5AUUA 2QKRA 4AFEA 1H0WA 3W2CA 3UQCA 4G2FA 1JNKA 2ZV8A 4CFUA 2VN9A 2P0CA 5AP5A 3DAEA 3DJ7A 4YGAA 3V04A 3S1HA 2DYLA 4G3EA 5LVPA 4CG9A 2GNFA 3P7CA 3TKUA 3EHAA 2W17A 2Q0NA 3OG7A 5EQYA 2ZM4A 3A60A 2EB2A 3SG9A 3C9WA 2GHLA 1JKTA 4I0SA 1M2RA 2BZHB 2HXQA 1DAYA 1FPUA 4M66A 5DNRA 3COMA 2WTDA 3EQGA 5AAGA 2VRXA 5FDPA 4OTFA 4UMQA 4FGRA 2F9GA 3K3IA 4O2ZA 2OIQA 2PVLA 1V1KA 4QNYA 4FIGA 4E6CA 3KRWA 1K2PA 1YI4A 3AC8A 5HCYA 4BDHA 3KK8A 3HKOA 4EWQA 3QKLA 5KBRA 3GP0A 5GIPE 1XO2B 3TTIA 4AS0A 4PTGA 3MYGA 4BN1A 2WGJA 2O65A 5HGIA 2IJMA 2Y7JA 1WVWA 3F6XA 5CEIA 4Z55A 3FDNA 1I44A 4XLVA 2YM4A 4JG6A 2XIZA 4DCAA 5GINE 4TL0A 3VS0A 3PPZA 2SRCA 4QTCA 5JFSA 2GDOA 3QZGA 4DLIA 4FSWA 4DHFA 5L2TA 2RF9A 4FEQA 3PJ8A 1BUHA 4JRNA 5AR7A 4C37A 4EOJA 4FEXA 4FTMA 2H8HA 3PSBA 4JQ7A 2XIKA 3NPCA 4MXCA 3JVSA 4RBLA 1L3RE 2C3JA 1S9JA 3LQ5A 3U4UA 3WF6A 4AW2A 5K5NA 3AC1A 2VD5A 2GNLA 1VJYA 4M84A 4ITJA 4FIEA 5H2UA 4C0TA 3QTSA 1J7IA 5DR9A 4AW1A 2CN8A 4O0UA 3SAYA 4QPSA 3GFWA 4B99A 2B9FA 4E5WA 4MD7E 4CFMA 4X2GA 2B7AA 2BUJA 4U97A 4QNAA 5EDRA 3UG2A 1H28A 3HV4A 3TV7A 4L3JA 3WBLA 4FV2A 1UVRA 3W2OA 2IG7A 3HNGA 3HGKA 3ACJA 3CS9A 3WILA 3HRBA 3KN6A 3KRLA 4EHEA 4JX3A 2UZTA 1KE8A 1H25A 3D4QA 5IDNA 2JGZA 3MGYA 2WMVA 5AUXA 4IC7A 2WQNA 3FWQA 3W2QA 5M09A 4M69A 2OG8A 3COIA 4AGUA 1YXSA 3BYVA 3MIAA 4IB0A 2PVRA 1YDTE 4EH5A 4EQMA 3KREA 4S32A 4IAIA 4OAUC 3R30A 3HMMA 2F2CB 4D4SA 5AR5A 4M8TA 3BBTB 4GK4A 5HVKA 5IA2A 1PXKA 4O7RA 1IR3A 1K9AA 2JLDA 2PMOX 3CKXA 2X6EA 3HRCA 3QQJA 2OBJA 4UWBA 5IEXA 4F7LA 4K0YA 2A27A 3MBLA 4W4WA 4GFOA 3A7FA 3UIUA 2C5NA 3Q32A 3KVXA 5IA3A 4B7TA 3CTJA 3DCVA 2P3GX 2UW7A 2H34A 4MKCA 1V0BA 2FSTX 1QL6A 2CGXA 3ETAA 5L3AA 3G9LX 2QVSE 2ITZA 3QLFA 5EHYA 3PG3A 5GZ9A 2IPXA 4S2ZA 2IZSA 4FKIA 4UXQA 4U40A 5HTBA 4EYMA 4ACCA 5HU3A 4C59A 5CYIA 4P5QA 3QTQA 3DBFA 1WBVA 3GC9A 3LXLA 3E87A 4I20A 3W18A 4CXAA 3VAPA 1LR4A 4FL3A 2B1PA 4FZDB 3VJNA 4LUDA 2JFLA 3FY0A 2PZ5A 4FVRA 1ZOEA 2GQRA 4FODA 2BR1A 1VR2A 4O6LA 2X2MA 1SNUA 4NFMA 4EOOA 3HL7A 4F9BA 3CC6A 2J4ZA 3IG7A 2WOTA 1XWSA 3R7GA 4I94A 1QMZA 1URCA 2PULA 4F7JA 3WF8A 5JT2A 4ZY4A 3QA8A 4ZTNA 4USDA 3ZOSA 5A6NA 1W0XC 4ZTHA 3EH9A 2GNGA 3LFFA 4E6DA 5A4LA 5C8NA 2WQOA 2W4KA 4NEUA 1ZZ2A 3ZONA 2B0QA 4QPAA 1YRPA 4G34A 2IVTA 3POOA 4XOZA 4AAAA 5CSWA 2JKOA 3SXFA 3WZKA 2OICA 1G3NA 3OD6X 3QXOA 4S31A 3MFUA 4AZFA 2X39A 3UOKA 4EOKA 4F7SA 2YM7A 3WI6A 3AMBA 4PTCA 3QD2B 4JBPA 4EKLA 4QTEA 4S34A 5F9EA 5BVEA 3IPHA 4I93A 4A9UA 2XA4A 4X3FB 3P86A 3PJ1A 3R0TA 3EFLA 4WIHA 1PW2A 5GJDA 3RKBA 3D83A 4ZSEA 4A9SA 1W82A 1YHVA 3UP7A 1X8BA 4E8AA 3PWDA 4EL9A 4DF3A 3HA8A 2W9ZB 4IX6A 2R3KA 4H39A 5DOSA 4F08A 2BZJA 4F63A 5HBHA 2I6LA 2X8IA 2XJ0A 3ENHA 2VO3A 2QD9A 2WELA 2HENA 3TIYA 1OZ1A 2I0EA 1BI7A 2C6DA 3TTJA 3VC4A 4FNWA 3PJ3A 1FMKA 4L01A 4TXCA 1WBTA 3BKBA 5DH3A 2W4JA 4RIWB 3FUPA 3THBA 3EL8A 3L1SA 2A0CX 3MVJA 4DEGA 3O96A 4FYOA 4GG5A 2CCHA 3DDPA 1GIJA 4RFMA 4JDKA 3NEWA 3CLYA 3OUKA 5EFQA 3PLAE 4W4YA 5C1QB 1ZYLA 5D41A 2WEVA 5EDPA 3V6SA 4BDGA 5A4CA 1CTPE 3UNJA 3BQCA 3TDWA 3FKOA 3O8UA 4FK3A 4AA0A 4UZDA 4HCVA 2PWLA 2CCIA 3GC8A 3H0YA 2HWPA 3BV2A 5BUJA 3R9DA 5M06A 3VS1A 1JSUA 3RWQA 3DK6A 3FLNC 3H4JA 5KCVA 3SGCA 3PIZA 2JD5A 5BVKA 4NIFA 2PE2A 2QHNA 3EFKA 4IVDA 3OBJA 2YABA 4F9YA 1PXPA 2RG6A 1JAMA 5JFVA 1KE9A 3FLQA 4O0WA 5C26A 3LHJA 5IISA 5IQEA 4RVKA 1CM8A 4RMZA 2O2UA 4KKEA 4WNOA 3UPZA 4RVLA 3IO7A 3L8SA 3H9FA 4FTAA 3TM0A 1VZOA 5AR4A 4F64A 2GTMA 2O8YA 3CE3A 2EUFB 4I21A 4FSQA 3D7TB 5CSVA 4ZSJA 3VHKA 4F70A 2YDJA 3OHTA 3QUEA 4P2KA 4RJ4A 4IX3A 3ORNA 1IASA 4MD9E 5CI7A 5ETFA 5JK3A 3FMDA 3QKKA 4BIDA 3QC9A 4ZZOA 3AC4A 3VBQA 1O6YA 2IVUA 4ITHA 2X7GA 5KZIA 4XBRA 4AN9A 1SVHA 2QI8A 4JBOA 3GGFA 4L9IA 4XV3A 5K4IA 5DT0A 5F1ZA 5A4TA 4TTHB 3GC0A 3QFVA 3W8LA 4ZEGA 3TNWA 4FV4A 2UVXA 1LEZA 3WZEA 3MV5A 4JX7A 2B55A 2PHKA 3GBZA 4LRMA 4OAVB 3N9XA 3RJCA 1Z57A 3QRKA 4HVSA 4WKQA 3PXYA 3BYSA 4XMOA 1F5QA 3F7WA 4TNDA 4QMPA 4HYIA 4FG9A 5DWRA 2YFXA 3FLWA 4EORA 4XG3A 4ASZA 5AR2A 4F0GA 3D94A 2UW3A 3DZOA 4ZY6A 2CPKE 3QCSA 2J90A 4APCA 3IKAA 1BL6A 4E6AA 1GIHA 4JR3A 3UDBA 5JGAA 4DN5A 3L9MA 1FVTA 1KOBA 3B8RA 3H9OA 3G0FA 3V5QA 1OL5A 2CDZA 4KS8A 2W7XA 2OJFE 2PVJA 3KMUA 5K9IA 4IEBA 4L7FA 3FMMA 2WMRA 4GJ2A 4ASDA 3A7IA 3HV3A 5AFVA 5AA8A 4RC3A 3GC7A 4BDKA 5KMMA 1DS5A 1JLUE 4HGSA 4X2NA 4ZTQA 2XK3A 2W1EA 3HDNA 4XYFA 3BI6A 3R7VA 4Z16A 4WBOA 5M56A 4MF1A 3Q3BA 4FKJA 3JVRA 4RGJA 5J79A 1UA2A 5HG5A 4O81A 4BRXA 1G8SA 1UWJA 4Y5HA 4BF2A 4EH4A 3LFBA 5L2IA 1LPUA 4YJNA 3Q2JA 4IM0A 3F66A 3QQLA 5AUYA 3TWJA 3UO6A 2GCDA 3FMHA 3PUPA 4EEVA 2F7EE 1PMVA 5LARA 2VO7A 3GCPA 3LMGA 3ACKA 4YTIA 3VF9A 4DAWA 3RCJA 2CNQA 5EQEA 1Y91A 2Y4IC 3TDVA 1H01A 4FSTA 3M2WA 3DQXA 3HECA 4KIOA 4QOXA 2FSLX 3JYAA 4P7EA 3R8LA 3SLSA 5BUIA 2O5KA 5ICPA 5EW9A 1HCLA 3LAUA 1H08A 2XYUA 3MTFA 3AD5A 2X4ZA 1XJDA 3QQGA 4WRGA 4WNPA 3MFRA 4JG8A 5ANKA 5AP1A 4AT3A 3R71A 2O0UA 4IX5A 1PXLA 4MX9A 5HD7A 3QQUA 4XEYA 3SKCA 4LGDA 2WQBA 5CNOA 5HIEA 5HLNA 4IAKA 4BTMA 3UZPA 5JH6A 4QP4A 2QQ7A 2YITA 3R1QA 4Y46A 5LVLA 3ZTXA 2PSQA 3NSZA 3SXSA 4GEOA 4DCEA 3DB6A 3CGFA 2YM3A 3FMLA 2WO6A 3HYHA 4P4CA 2FB8A 2QOLA 3HX4A 2XKFA 4CKIA 2WU6A 5F20A 3DV3A 4PTEA 4ZMFA 3R00A 4U41A 2YACA 2EXCX 2OW3A 1JOWB 4PDPA 3ZYAA 3VUIA 4NU1A 4DE4A 4D5KA 2FA2A 3BGPA 1U4DA 3UC3A 2I0YA 3OEFX 5AR3A 4F1TA 4EWHA 4XNEA 1CKIA 4EOQA 3LCDA 3OBGA 3TACA 5B2MA 5IUGA 1WZYA 3VIDA 4PP9A 3C5UA 4JIKA 2Y8OA 4YNOA 4CKJA 4ALUA 4DBNA 2BAKA 1S9IA 5AWMA 3ZFXA 2C4GA 4FTQA 3FBVA 3LIJA 3NWWA 2I7QA 2BDWA 3NX8A 4O86A 4GV1A 3Q52A 3AMAA 3QCQA 5DIAA 4CG8A 3WE4A 1PMUA 2YM8A 3F5XA 4GFMA 1ZWSA 5EHLA 3PIXA 3D14A 4H58A 4NM0A 5AUVA 3RNIA 3QC4A 2CGWA 1CKPA 4M69B 4BDCA 1ZY5A 4W4XA 3AGLA 2DQ7X 4CTBA 4AT5A 4FV5A 1NXKA 4BKZA 1WBPA 1OBGA 2YHVA 4K1BA 4PUZA 5TT7A 3DBCA 3FL5A 3RVGA 3ZUTA 3DY7A 4FKLA 4LGGA 5IQDA 5IQFA 3C4ZA 4UWYA 2BCJA 4GRBA 4BVUA 2YLFA 4NFNA 1VYZA 2AC5A 3F3UA 3N51A 2ITYA 3EQRA 2J0KA 4YUQA 5D9HA 3AGMA 4GVAA 3I6UA 4FF8A 4YTHA 4QT1A 4HVGA 1STCE 1PXMA 5BMSA 5CU0A 5L6OA 3KB7A 3LLTA 1ZMUA 1M2QA 2IVSA 3V5WA 3LJ2A 4A9TA 3E92A 4MBLA 5HO6A 5T68A 5AJQA 2X9FA 5AUTA 5I9YA 1REJA 2YCFA 3WZJA 2GMXA 3HRFA 2CNUA 2VWVA 2ITUA 1H1PA 2ACXA 4BTKA 4HNFA 5DT3A 5B2LA 3KXMA 2X2KA 5KKRC 4J7BA 1YXVA 4JQEA 3R9NA 4B4LA 5FDXA 1OL1A 4Z7HA 5IA4A 3OZ6A 4HYSA 5FTQA 5C4KA 3OTVA 5KO1A 1L8TA 3MB7A 4RG0A 2WD1A 3K2LA 1OIRA 4IWPA 4YLKA 4WSYA 3KF7A 4F0IA 5HCZA 2VAGA 2WTJA 2W9FB 5CXHA 4AE6A 5HESA 5C8KA 5CU4A 1WCCA 4U7ZA 3WF5A 2BFXA 2C68A 3F2RA 3ET7A 2R3MA 1CKJA 2G2FA 2YDIA 3D7ZA 5DPVA 3RGFA 3DA6A 5J7HA 5M57A 2F7XE 4FKWA 3RP9A 3ZUVA 5LJJA 1RW8A 4HZSA 4IVCA 4FIJA 5EI6A 5FRIA 4WRSA 3SRVA 4CLIA 3UIBA 1MUOA 5KZ0A 4O7WA 5G6VA 3QD4A 5LWNA
chains in the Genus database with same CATH superfamily
4FG8A 3ATSA 3VONA 3LPBA 5CAOA 1U46A 5B0XA 4OTGA 3DAKA 4HVDA 3IDCA 4O0VA 4CFWA 1GNGA 3R1YA 3F9NA 4E4LA 3ALNA 3PXZA 3CY3A 4DITA 4HNIA 5LMAA 4EZ3A 5CX9A 5IQCA 5EW3A 3HUBA 3OCBA 1O6LA 4QO9A 3NUAA 3EFWA 1SVGA 2BDFA 4LMUA 5E8XA 3OEZA 4E5BA 3CGOA 2WB8A 4UXLA 4NYEA 2JKQA 3BIZA 2QLQA 4BIBA 4BKYA 4FV9A 4XV1A 3HEGA 3BX5A 2W1HA 4W8DA 4ZZNA 4GUEA 5EM7A 5BX0A 2YCRA 1AQ1A 4ZLZA 4DFBA 2QG5A 3H3CA 4ALVA 4EZ5A 3W2RA 1UWHA 3I6WA 4IX4A 5CU3A 3EQDA 5JN2A 3O7LD 1Q4LA 4YMJA 1H1SA 2VTOA 4MAOA 2BFYA 4UMTA 1M14A 4BDBA 4ORKA 4I6LA 3DAJA 5AAEA 3IS5A 4BWXA 5LCJA 4YBJA 2EB3A 2J0MB 5CNNA 4XP0A 3S2PA 4GIHA 3T3VA 3R9OA 5HBJA 4XS2A 2Y4IB 3ROCA 5ANOA 4D2RA 4ENYA 5EK7A 2P2HA 4LRKA 5KMOA 2C47A 4JIAA 4RVMA 1YVJA 4IAZA 5BNJA 3BHVA 2JIIA 3MDYA 3LXNA 4FNYA 2PUIA 4G31A 5J5TA 3TMOA 3Q04A 2PZYA 2ITOA 4QMOA 4R7BA 4WSQA 5DGZA 3V5LA 4KBKA 4AG8A 1FVRA 3UMWA 5BPYA 2CKEA 3FZTA 4QYYA 5I9WA 3VBVA 4EHVA 2I0HA 5DN3A 3DBEA 4BBEA 4NIFB 3FI8A 4ZJJA 3P7AA 3ZLYA 4I0RA 1OKVA 2X7OA 4L67A 1TQIA 5EHOA 4C3FA 4CCUA 1HCKA 4I6QA 4NK9A 3RALA 4XG8A 2XRUA 2WMXA 3SD0A 4MTAA 2GFSA 4BBMA 3NW7A 4DHZA 5HORA 2R0IA 2XBAA 4GH2A 3RMFA 5DMZA 1Y6AA 4FKPA 1H4LA 3VQHA 4FV1A 5E91A 4D5HA 3PZHA 4FKOA 1J7LA 3COKA 4MEDA 4FOBA 2QOQA 4MXZA 3KGAA 4C3PA 4Q9ZA 3GU4A 3ZZEA 2ZDTA 3GB2A 3G90X 4BTFA 3A2CA 4GUBA 4AOTA 3VBWA 1PY5A 3Q9ZA 3EWHA 3MVMA 5CEMA 3U6JA 3CD3A 2CHLA 4O0SA 1YXUA 2OZAB 1OITA 4O21A 3KF4A 4FE2A 3KA0A 4G3GA 3VNTA 5LMKA 4QTBA 4CQGA 4KRCA 4IIRA 3GQLA 4G6OA 2RGPA 4TWPA 5HNIX 1BKXA 2RKUA 3UQFA 3PE1A 4KB8A 1M52A 1WBSA 3QRTA 4OUCA 3W0QA 5CF5A 4K77A 2PVNA 2W5BA 4C3RA 4NJDA 3UVPA 2R0UA 2X0GA 4L52A 4NM5A 2FUMA 5FWKK 1J3HA 3DXPA 3UDTA 1PXIA 2QHMA 2JIUA 2FO0A 2BHHA 5AP7A 1UNGA 5DE2A 3RZBA 2VNYA 3DBQA 3E64A 4L3PA 3SQQA 4YNEA 4MNEA 4ZJVA 3FI2A 4O7TA 2XALA 2ZMDA 2HY81 2BRGA 3P08A 1MQ4A 1FINA 3V8TA 4PV0A 4DEAA 3FQSA 4AWIA 3Q4ZA 4FV3A 1R0EA 2QODA 2Y4PA 1FBNA 3JUHA 4UALA 4LFIA 4RSSA 4QMXA 1B38A 3WZUA 3MESA 2RFDA 5HD4A 3RPSA 4K18A 3PRIA 4W9XA 3D2KA 3R01A 3I5ZA 5EW8A 1Q61A 3OXIA 4G9CA 2UZOA 3OCGA 4MK0A 2R3GA 4TPTA 3AD4A 5IKWA 3ZRMA 2XRWA 1A06A 2RL5A 3NRMA 4BZDA 3LKMA 1GOLA 4IWOA 3QD0A 3POZA 5HOAA 4ANSA 5AUZA 2Z8CA 4HW7A 2WPAA 3HDMA 4CFFA 3IQ7A 2HK5A 4FL1A 3VUGA 4FC0A 3BL9A 5C03A 2V0DA 1Q3WA 4UB7A 3JPVA 3TNPC 5KKRB 3UDSA 3OW3A 4GKIA 1Y8YA 4EOLA 1MRUA 5E4HA 4QMYA 2VV9A 4C7TA 2EWAA 4BGGA 2R3QA 1Q3DA 4XG4A 5TR6A 4ANMA 4PP7A 3MY5A 2QNJA 5DR6A 3RZFA 3U6HA 3EQBA 4AACA 2GTNA 3HUCA 3KULA 2PVFA 3RHXA 3SHEA 4RWJA 2J0IA 1YHSA 4FTTA 3RM6A 3DTWA 4PNIA 1H26A 3NAYA 4QP2A 2PUPA 2E9PA 3FLSA 4XUFA 4JR7A 2BKKA 4X0MA 4F6SA 2OU7A 3NUYA 5T3QA 4U3ZA 3PYYA 4CCBA 3TNQB 1BI8A 1XBAA 4IANA 4XJ0A 4II5A 4AA5A 4A4XA 4QTDA 5A4EA 4RVTA 3R9HA 1Q8YA 1W98A 4Q5EA 4C36A 3ZXTA 3KRJA 3MJ2A 4R1YA 3TV6A 1Q62A 5HG9A 3UGCA 4ZLYA 3H9RA 4D2VA 3QTIA 4LL0A 3AC2A 3B2TA 2XK8A 3NCGA 3W2PA 3DXQA 1A9UA 2GQGA 4FV6A 4FTOA 3NUUA 4QMSA 3FZPA 5TKDA 3PXRA 3PXFA 1OECA 4ACDA 4I4FA 5CSXA 3F61A 2A98A 3VRZA 4YZDA 5DA3A 1JQHA 5H8GA 3AXWA 3ERKA 1W2FA 2OJIA 3O7LB 3VF8A 1YDRE 1U59A 2OH0E 4FNXA 3TIZA 3P5KA 3QXPA 2BRMA 4EK6A 5DYJA 4M14A 2GNHA 4M97A 3ALOA 4KINA 4RIYB 4GT5A 4I24A 4R6VA 4BI1A 5F95A 2IF8A 3FI3A 5IZFA 2HW6A 3P7BA 3OY1A 4ASEA 3A61A 4FVPA 4CFNA 4QP1A 4G6NA 5FM3A 4OT6A 2J6MA 3QU0A 4ACMA 5LMKC 4R5SA 3LFSA 5TE0A 2ZDUA 3R8VA 5AX9A 3L8VA 3PZEA 5CEOA 4BYJA 4A9YA 3C1XA 5LCKA 3F3VA 3RAWA 4EK5A 4AZTA 4QYEA 4JJRA 4FUXA 3IK3A 4UY9A 4GIIA 4YZMA 2YIXA 4ANLA 4ANBA 5IU2A 4UYAA 3R28A 2C5VA 2W1DA 1OKWA 2C6KA 2V7OA 3EQFA 3BU6A 4FIFA 4FT0A 4IM2A 3RI1A 2CKPA 4U9AA 3TL8A 4J98A 3II5A 5FQDC 3FXZA 5KMKA 4F0FA 4Y95A 2HZIA 4J99A 5FP5A 4FSZA 3CTQA 5BYZA 3PJCA 4FIIA 4G9RA 4L3LA 3ID6C 2WZJA 3I60A 4C34A 4C8BA 3GEQA 3P23A 3E3BX 3KN5A 4J8NA 2YAKA 4KRDA 3VS3A 3W33A 1ZMVA 5IEYA 4BY9E 1IEPA 3QTRA 2OLCA 1U54A 5JEBA 3D2IA 4BCJA 1FQ1B 3R1NA 4XRJA 4ANOA 3FV8A 3D5UA 3R7OA 5CASA 4CT2A 5K3YA 5CAUA 2IW8A 1OKYA 4RJ3A 4OTQA 4PX6A 4JDIA 5L8LA 3A62A 5K4JA 1IAHA 3BYOA 3PPJA 3UOJA 4D1XA 4CVAA 4YU2A 3RK5A 4YO6A 2VO0A 4TZRA 1XH4A 4EI4A 2QC6A 2BKZA 2BRHA 2X7FA 4U6RA 4JL9A 3W0RA 2W96B 4BI2A 4E73A 4U80A 3SV0A 3FHRA 4D2WA 1TFFA 3ZLSA 2XAOA 4C4IA 1YOJA 2ZFYA 4DGMA 4IZYA 2Z02A 3EN9A 4D4YA 4PPAA 3U6IA 1WVYA 2QURA 4USEA 2ZV7A 3VS2A 4ZK5A 5D7VA 5CAVA 4I5PA 4C62A 3FZRA 2G2IA 3QUDA 3MSSA 4M7IA 3W32A 4ZY5A 3MTLA 4FT3A 5FLFA 4HVHA 2QU6A 3HAMA 3L9LA 4U43A 3GUBA 3SRVB 3ZH8A 5IA1A 1REKA 4FK6A 2VTHA 4OGRA 4C38A 4EUTA 1IRKA 5EOLA 2ZVAA 5AP2A 4BCKA 2CSNA 4V0GA 3CJGA 3HA6A 4PRJA 4O38A 4YLJA 2W1CA 3WIKA 4DH5A 3ML1A 1SM2A 2VTQA 2IW9A 4H36A 3ZC6A 2ITQA 5JSMA 4CNHA 4HVIA 3BWJA 1BX6A 2OIDA 4CRSA 2W1FA 5HU9A 1ND4A 5I9XA 2WTCA 2PUNA 3QUPA 4OW8A 4CD0A 2O63A 4AW0A 4O7SA 3HP5A 3FMJA 4H1MA 3DK3A 4J53A 4JNWA 3ZCLA 3M11A 4PDSA 3ZO1A 1Q8TA 4J71A 3C4CA 2XARA 5CT0A 4D0XA 4LOQA 2BALA 2Z2WA 4C35A 4DGNA 3DDQA 4FT9A 3KC3A 3MW1A 4O7ZA 2AUHA 4QRCA 4BDEA 1SMHA 1KV2A 5LQFA 3PIYA 4NWMA 3I7BA 3NNXA 3Q5IA 2WXVA 4FKVA 1XH7A 2WQMA 3DZQA 4IH8A 5B7VA 2UZEA 2QOHA 4K8AA 1PJKA 2G2HA 2OZOA 2ZV9A 3P1AA 3R7UA 5IH4A 1OIYA 2BROA 3DKCA 3BBWA 3V5PA 5AA9A 5CQUA 3PDTA 3VUHA 3TYKA 3MS9A 4EJNA 1KE7A 3FMEA 3OMVA 4JMQA 1OMWA 3GOPA 4N4SA 4M3QA 5IA0A 2C5XA 3VVHA 3RWPA 2F2UA 4O96A 5JRSA 4RJ6A 5IPJA 5CWZA 5E90A 5M07A 5K0KA 3E8NA 3BEGA 3I0QA 3O51A 4K2RA 3G5DA 4QQ5A 3KXGA 3QGYA 4C2VA 2BDJA 5FTOA 2R4BA 3DU8A 4LYNA 4QTAA 4UEUA 3NFGB 4PPBA 2J0JA 1LUFA 3ULIA 2WMQA 3DPKA 1YOLA 1M2PA 4D58A 2Z60A 2XEYA 4FTNA 4KIQA 2X4FA 4NKAA 3TV4A 2RIOA 2WNTA 1H1QA 3ZDIA 3AQVA 4FA2A 3TZ9A 4XBUA 2X8DA 4BCHA 4IXPA 3ZO2A 3AT4A 4OTWA 3RPYA 2OFVA 3MH2A 4EYJA 2PUUA 2C3IB 4OBQA 2NPQA 1RE8A 2C6LA 2VX1A 2YJSA 5CEKA 4IJ9A 2ZOQA 4DEBA 3RTPA 4TYGA 1WBOA 4RJ8A 3ZFMA 3CQEA 4G5PA 2H9VA 4PWNA 3A7GA 4KIPA 4BC6A 4Z3VA 3KMWA 3WIGA 3D5VA 3QL8A 3MB6A 3OCTA 4YSMA 4D4VA 4LV5A 3LJ1A 3H10A 3KCFA 3VS7A 4YC8A 5IDPA 4QQTA 3UZRA 3L8PA 2DS1A 4FKGA 3QKMA 4PL4A 5EQPA 5CVHA 4KIKA 5AP0A 1NW1A 4RQVA 2HELA 2Z7RA 3K3JA 2JKMA 4S33A 2VGPA 4DFUA 2HAKA 5CZIA 2VO6A 4ZSLA 1ZMWA 3U9CA 5DRBA 5I3RA 4U44A 3R8PA 3G51A 4Y85A 1B39A 4GG7A 4PMPA 3R6XA 1RDQE 2YISA 2Z7LA 2XNEA 4JVGA 4OTPA 5E8SA 4KABA 5BVWA 4BGQA 4F7NA 3VUMA 3A8XA 2BZKB 2PL0A 4O84A 3NR9A 3TG1A 5AX3A 1JBPE 2YIRA 1MRYA 3IECA 5ANGA 1PMEA 3ORLA 4MNEB 5E92A 3A7HA 5CF8A 2P2IA 3FYKX 4V05A 3AKJA 3S95A 2VWWA 2JKKA 4U0IA 4TYHA 5ITAA 3BE2A 4O27B 1R1WA 4Q5HA 2JDSA 4X6QC 3NS9A 5CU2A 3LVPA 3AC3A 3RAHA 4XP3A 5A3XA 2VWXA 4OTHA 3UJGA 3PJ2A 3QWKA 4O22A 4IM3A 4QQCA 4RQKA 4IDTA 3PXKA 4TN6A 3DTCA 4HGTA 4UMPA 3G6GA 4I5HA 2EVAA 2XK9A 4GKHA 4FV8A 4HOKA 2RSVA 4QDEA 5L2SA 2XKEA 3MFSA 4FNZA 4KBCA 4L00A 2OXDA 4EC9A 2YCQA 3W2SA 4QYFA 2ERZE 3EQPA 2E2BA 4P5ZA 4O6EA 4I1ZA 3A4OX 4A07A 3PY1A 2RFNA 3LFAA 1YHWA 4BDJA 1ZYDA 4B6LA 2CN5A 4FTJA 3Q9WA 4UN0C 2P4IA 5JGBA 4DEEA 2O64A 2B53A 3P9JA 3KRRA 4ACHA 2RFEA 3CIKA 4BYIA 3F2AA 4HJOA 2OFUA 1UKHA 2PK9A 3ORKA 4O7VA 3Q4CA 5M4FA 2FGIA 3UYTA 1WBWA 2XIXA 4FZ7A 3RINA 4OTIA 4XLIA 1GZOA 4EOIA 5A14A 5HO7A 4FT5A 5I0BA 4IWQA 4KNBA 4EH2A 3BPRA 3MY0A 4D9TA 1UV5A 5J1WA 3G2FA 5ETAA 5M51A 4KKGA 3S00A 3KIOC 2GFCA 5BQ0A 1NT2A 2JEDA 4HZRA 4PL3A 3OWJA 5HX6A 4J52A 1OL6A 1Q8ZA 4HYUA 5CVFA 3KMMA 2UZBA 5J8IA 4DFXE 4JI9A 3AMYA 5CAPA 3FQHA 5LVOA 3SVVA 3PRFA 2GHMA 3IW6A 2VWUA 1R0PA 3FQEA 2NRYA 4ZIMA 2OXYA 3KRXA 2Y6MA 3OOGA 5AMNA 5CI6A 4RRVA 5ANEA 2BZIB 5FG8A 1OL7A 3ZU7A 4UMRA 1PRYA 3EQIA 4ZP5A 4YURA 1TVOA 5DEYA 4EOSA 4IHPA 3NIZA 2AQXA 4EH7A 3K54A 4LRJA 2ITNA 2E9NA 5J9YA 4QYHA 1G5SA 1W84A 2CMWA 1QCFA 4YJPA 2YWPA 5HCXA 3ZM4A 4C4JA 3NNVA 4JRVA 5HVJA 1AD5A 2PTKA 4X2JA 1OKZA 2X0PA 2H96A 2XNBA 3VO3A 2GNJA 4E20A 1P5EA 1FMOE 2YLEA 4YPDA 4CFXA 5JMSA 1J7UA 1XKKA 4W9WA 3EQCA 4IB1A 1TKIA 1H00A 5BVFA 4I5MA 4MNFA 3OFMA 4JDHA 1H1WA 4ARKA 4R7HA 5EYDA 4QMMA 1YQJA 4CTCA 1YOMA 3Q4UA 1I09A 3D15A 4FSYA 2W4OA 2YN8A 3GU6A 4RWKA 1PHKA 1G8JA 3TNHA 1MQBA 2IVVA 4GYIA 2ETRA 2VWIA 3IDPA 3F3WA 2KTYA 4FKSA 1ZXEA 4FGBA 3C50A 3W55A 4AXAA 2C6IA 3EN5A 4BWKA 1F3MC 3V5TA 2IZUA 5HNBA 1GZKA 2BPMA 2QOBA 4GK3A 3C4EA 3EN4A 5C8MA 1PMNA 3F5PA 5CEQA 3NNWA 3OY3A 4AGDA 5J9LA 4YTFA 4FEVA 3ORIA 3AD6A 4DFZE 2R3NA 2X2LA 4CZYB 4JBQA 2HIWA 2F4JA 4I41A 1FGKA 1JSTA 4R7IA 5KBQA 5K0XA 1SVEA 3DNDA 3E8EA 4RLKA 3GU8A 3NGAA 4CYIA 5KE0A 3OXZA 3A99A 4RX5A 4JG7A 3NUPA 3ZHPC 4AN2A 4GK2A 2HZNA 2OJGA 5DR2A 3ZZWA 4YTCA 1ZZLA 3OWKA 4KAOA 4DLJA 5CU6A 3O71A 4D1ZA 3P5JC 4A4OA 2ITVA 3JXWA 3VULA 3ZRKA 1GAGA 3OVVA 3UIMA 4EK3A 1QPDA 2PZRA 2IW6A 4FI1A 4FG7A 2JDOA 3CQWA 5AM7A 5CAQA 4EHGA 3QAME 3O2MA 4I6BA 4IBMA 4MBIA 5EM8A 3UODA 3VJOA 4F9CA 2BRBA 5CLPA 4APPA 2HOGA 3BQRA 5EG3A 3E3PA 2WTKC 5E8ZA 4ERKA 2BVAA 3UP2A 2UZNA 2PPQA 1UNLA 5IEVA 5A4QA 2B9JA 3F3TA 3Q4TA 3F88A 3Q6UA 3TN8A 1R78A 2FVDA 4GT3A 4X21A 4M67A 4R3CA 2B4SB 1Y57A 4A4LA 4F1MA 2XYNA 4MH7A 3CXWA 5E1SA 3W0OA 1NVQA 3EYHA 1YDSE 3OT3A 1P2AA 3EYGA 5D12A 3PA3A 5E8WA 1WAKA 2OIBA 4I22A 4HCUA 4HPUE 5BUEA 2BIYA 3A4PA 2VGOA 4H3QA 3U51A 2E9VA 2A4LA 4J96A 5FBNC 5C01A 3HAVA 3F5GA 5L2QA 2GPHA 3QTUA 3S4QA 2WTWA 3GVUA 3LW0A 4MF0A 2BILB 5CTPA 2JDVA 2ZM1A 4K33A 4FTRA 4RIXA 2UZDA 2EU9A 4YR8A 2PZIA 2XNGA 4I5CA 4OBPA 4TWCA 3DKFA 5FEEA 4IVAA 4JAIA 3C4FA 5KMJA 3SA0A 4IAAA 3F2NA 5CANA 3TUDA 3RAKA 1ZY4A 3OS3A 4R3RA 4E1ZA 4PL5A 2J5EA 2XM8A 4WOVA 1MRVA 5IQBA 3BELA 2RFSA 4X7QA 4KSQA 4AFJA 3C0IA 3W8QA 2GQSA 4CV9A 1QPJA 4IFGA 1BL7A 5CT7A 4PMMA 5JGDA 3OC1A 2BMCA 3FLZA 4O0XA 3ZBXA 3QD3A 3M42A 4MVFA 2VU3A 3FSKA 5IQGA 5C9CA 5EYKA 3QHRA 4KUJA 2UW8A 4WG5A 4AF3A 2WIPA 3I4BA 2QOKA 3FC2A 3I0OA 2WOUA 3Q9XA 1E1VA 2C69A 1XR1A 3T8OA 5KMNA 2R3PA 1WMKA 3QTWA 3R2YA 5E8TA 2B9HA 3BV3A 3TKHA 3R04A 3PUFC 3VBYA 3ORZA 4JDJA 3PSDA 4QD6A 2XKDA 4C58A 3S0OA 1UKIA 2XH5A 4BZOA 2A1AB 3FC1X 3TUBA 4ZSGA 4KWPA 5EYCA 3RPRA 4MXXA 4FUYA 4QP6A 4EH8A 2J9MA 1PXOA 4DEHA 3O0GA 4M12A 4AA4A 1WFCA 2BRNA 3PPKA 3FZOA 4RC2A 4M0YA 4RT7A 2XZSA 4OLIA 1OPKA 5HKMA 3RK9A 4DG0E 2X8EA 3CR0A 1VEBA 2ITPA 2X1NA 3QWJA 4FIHA 5AEPA 5JFWA 4J97A 2OJJA 3EQHA 5FM2A 4XG2A 5ACKA 3U4WA 4C2WA 5IA5A 5IUIA 3HMPA 2FYSA 4LDTA 3ITZA 2LGCA 5LXMA 4RIWA 1LP4A 3BLHA 1XH5A 2GNIA 4G3DA 4WUAA 3IOKA 5CF4A 1OM1A 3FE3A 3ANRA 4FT7A 4BR3A 4M68A 4Y8DA 1CDKA 4RPVA 5DFPA 3MVLA 5EDQA 4NM7A 5CXZA 5HEZA 4O7YA 3LMHA 1Q8WA 3SDJA 3EFJA 2HZ4A 1DAWA 3MPTA 1XMLA 3ODZX 4J8MA 5CY3A 4CKRA 3KEXA 3PTGA 5JQ8A 3FSFA 4QPMA 2VTPA 2R7BA 4LI5A 3NCZA 4ZXTA 1F0QA 4H3BA 4UX9A 2CGVA 3UZTA 3IDBA 5JQ5A 5FEQA 4X2FA 4NSTA 4GCJA 5IH5A 5G1XA 5TO8A 4XRLA 4IWDA 4KIKB 4EOMA 3TKIA 4AXDA 4KS7A 2QOFA 1Q99A 2YIWA 1KUTA 4WT6A 4L7SA 4AOIA 3BGQA 3QALE 3UOLA 5EI8A 4AT4A 4R78A 3NW5A 4FEWA 1YXTA 3RBWA 2C6TA 2RG5A 3SW4A 5GZ8A 1KE6A 3UPXA 4G3FA 4ZTLA 5BVOA 4O7NA 5KHWA 5AAFA 3VN9A 1UU8A 4AOJA 1Q8UA 1XH9A 3MPMA 1XQZA 3DT1A 3PWYA 4K11A 2YIYA 4UYNA 1WBNA 3NVKI 2ZJWA 3VW6A 4EK4A 4N70A 3UO5A 4U79A 4MUQA 1KWPA 3PP1A 3E7OA 1ZARA 2QLUA 1IG1A 4FJVA 3SXRA 3REPA 2C6EA 4O1OA 4DHJA 2P55A 2VWYA 3Q96A 5AV3A 2OWBA 1JVPP 4AGWA 4IJPA 2XNMA 2Y9QA 4F4PA 4NT4A 3Q53A 3EB0A 5IQHA 4AX8A 4K9YA 3V51A 3FKLA 4QMWA 4YZ9A 5J7BA 3LOKA 2R3OA 3ZS5A 2GHGA 3PP0A 4IW0A 4M15A 4BDDA 3UG1A 4JAJA 4L6QA 1IA9A 2J7TA 3FZSA 4GL9A 3MH0A 4GU6A 2XCHA 2XNPA 4YHFA 4ZZMA 3TNIA 2EXEA 5D7AA 2A2AA 2Q0BA 4X6RA 1RQQA 4M13A 4QMLA 2QCSA 3V8WA 4PY1A 4ONAA 3AOXA 3QRJA 3QZHA 2W5AA 2UV2A 4BCQA 4RJ5A 4EBWA 5L8KA 2XNNA 2JIVA 3NUNA 3UC4A 5IUHA 5AUWA 2OI4X 2OJ9A 3TZ7A 2J5FA 5BV3A 3L9PA 4WG3A 1ZYCA 4D4RA 4FVQA 3SOAA 5E7RA 5BYYA 1OBDA 2PMNX 4ANNA 4ENXA 2PVHA 1GZNA 3DNEA 3LCTA 1ZLTA 3V3VA 2VUWA 3GCVA 3P0MA 3BLAA 3MJ1A 4L68A 4U5JA 2R3JA 2HY0A 5DRDA 2YERA 4O0RA 3JY9A 4WUNA 3TT0A 2PMIA 2ERKA 4XG6A 3QRIA 4RWIA 4D0WA 2E9UA 2ONLA 5TF9A 2NRUA 3U9NA 3CY2A 4U45A 3FPMA 3OWLA 3QX4A 4DFYA 4YHTA 4AZWA 4EKKA 1OUKA 1YWNA 3VBTA 1OL2A 5HG8A 3QCXA 2QO7A 5J87A 3LFQA 2QU5A 1BYGA 4GW8A 2W99B 5AP3A 3BRBA 5M4CA 4AZVA 2QOIA 3R02A 2YA9A 3QA0A 3RNYA 4AXEA 4F9WA 3EZRA 3ZSGA 4I0TA 4A7CA 4FTCA 5KUPA 1J91A 3EOCA 5F94A 3VUKA 4MD8E 3D5WA 3BE9A 4FV7A 4S30A 4R3PA 3PSCA 5JZJA 5M08A 4DEIA 3E62A 3ZXZA 5KNJA 3NDMA 4N57A 3E8DA 5AP4A 1Q41A 5DVRA 4ZTSA 1FOTA 4D9UA 2XK7A 3UNZA 5FP6A 3KFAA 4BZNA 4D55A 2R2PA 3JR1A 2XF0A 2OKRA 3E5AA 5FBOA 3V6RA 3OWPA 4LGHA 3ZRLA 4U8ZA 1YI6A 2YWVA 2R3RA 1ZYJA 1JKSA 4FSMA 3QCYA 1T45A 1UNHA 4I4EA 4RC4A 3QGWA 3JY0A 3HP2A 5M55A 4XH6A 4F1OA 4LL5A 4U42A 5A9UA 4MWHA 4BL1A 4YJSA 3LJ0A 2LAVA 3VRYA 4TYIA 5DBXA 2CLXA 2VWBA 2I0VA 4Y5QA 2JAMA 4AUAA 2C6MA 2W1ZA 4CQEA 2IO6A 3NUSA 3CSVA 1PKDA 5GIOE 5J95A 5BYLA 1BMKA 4TKSA 2GU8A 2PE0A 2R3HA 3FI4A 5AV0A 3A8WA 5HTCA 4ZS4A 3W0PA 2XUUA 4C33A 4NM3A 1SYKA 4RLLA 4WNMA 3R21A 2BHEA 2QR7A 3KU2A 2V62A 1J1BA 5EM6A 4QMQA 2EXMA 5HLPA 4UMUA 5JFXA 3HMNA 4LOOA 5GNKA 3W1FA 3KY2A 1BLXA 4KSPA 4IMYA 1W2DA 2OXXA 2HW7A 4TT7A 4GVJA 2QOCA 4XX9A 4IQ6A 4EONA 5KHXA 4O2PA 1M7NA 4BKJA 3P79A 2A19B 4C61A 5CSPA 3HV7A 2GS6A 3H30A 4LQMA 5BVNA 2VNWA 3HV5A 2XIYA 4FZAB 2ZMCA 3QRUA 4PPCA 4RZVA 3AC5A 1JKLA 3CD8A 1NA7A 4FMQA 3WF7A 2H6DA 3IONA 4K6ZA 5DI1A 4B9DA 4CYJA 1ERKA 2JFMA 2WAJA 3MWUA 5EOBA 2GS7A 5DT4A 2YAAA 1SZMA 3F3ZA 3H0ZA 3MH3A 4GJ3A 3R8UA 2XEZA 3D0EA 2OK1A 3BHUA 3DGKA 3SC1A 2VTNA 4D2TA 4UZHA 3FXXA 3N4VA 4XCUA 1H1RA 2XK6A 3LCKA 5ANJA 1AGWA 1IA8A 1YWRA 2JBOA 2PMLX 3BU3A 1Q97A 3MN3A 2VWZA 3PXQA 4ZJIA 4DTKA 5AIKA 4D1SA 2W05A 4B0GA 5JZNA 2BIKB 1DI8A 1YI3A 3OUNB 4EH6A 2R3LA 5AV1A 5CVGA 4GT4A 2VTLA 4E6QA 3DBDA 3DQWA 4EUUA 2AC3A 3JS2A 1U5QA 4YP8A 1H07A 4IE9A 4L42A 3ELJA 4FBXA 3K5UA 3WARA 5HI2A 4IDVA 2ONLC 3NYOA 3O17A 5ANDA 1GY3A 3GU5A 4AE9A 4DFLA 4RIXB 3C4WA 1H27A 3I1AA 2BTSA 3BYUA 3MY1A 5E9EA 1P4OA 1PKGA 4NUSA 3U87A 2UZUE 1V0OA 3ORXA 4PMTA 4O1PA 4IZ7A 3QLGA 3ZEWA 3MVHA 4R1VA 3W16A 4PF4A 4DA5A 1T46A 3BGZA 4AQKA 2OSCA 2R3FA 1P4FA 3DKGA 2HWOA 3GENA 1A48A 3PLSA 4DDGA 4OTRA 4ZS0A 2XBJA 4BCFA 4YZBA 3DKOA 4RA4A 2J0LA 3E8CA 3PG1A 4C4EA 1FVVA 4EH9A 3TUCA 2OH4A 2V7AA 5DG5A 1GIIA 1XH8A 4E5AX 2IZTA 1OVEA 5EKOA 1ZYSA 5HTIA 4CMUA 2WU7A 2FSOX 5AR8A 4YSJA