2XYNA

Human abl2 in complex with aurora kinase inhibitor vx-680
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
266
structure length
264
Chain Sequence
KWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN KINASE ABL2
publication title Crystal Structures of Abl-Related Gene (Abl2) in Complex with Imatinib, Tozasertib (Vx-680), and a Type I Inhibitor of the Triazole Carbothioamide Class.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 264
sequence length 266
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xynA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xynA01
1Q8ZA 4XOYA 3JVRA 2O5KA 1PXPA 3QZIA 5FD2A 2EVAA 1XKKA 4R5YA 3CGOA 4XUFA 1XR1A 3ZRMA 4IVCA 1XH9A 2WQOA 5CU0A 3JYAA 2OK1A 3GCUA 1YI4A 3QYZA 3OS3A 3IW8A 3E88A 4EQUA 1MRYA 3PWYA 3R8MA 2EB3A 3MFRA 2QOLA 4KRDA 3VBVA 4DH7A 4X3FA 3FMLA 5HBJA 1Q61A 3CQEA 2E9NA 3ZONA 5AEPA 3B2TA 1I44A 1ZZ2A 2WIPA 3HP5A 3LVPA 4UMQA 2PVKA 3RWQA 3V5WA 4MBJA 1ATPE 3CBLA 4U97A 3OXZA 4NH1A 2PHKA 4X3FC 2VTQA 4ZS0A 5I4NA 4YPSA 2A0CX 4C35A 2UVYA 2YAKA 2IVVA 3BHUA 2YIRA 4X2NA 2BZIB 3W32A 4ANOA 5DG5A 5M4CA 3AMAA 4F09A 3R02A 3I60A 5FDXA 3SW4A 3U6HA 3MVMA 3ZSIA 3R71A 2C6IA 4F7LA 2ITYA 2V22A 3C50A 4DTAA 3A4PA 4DBXA 3REPA 3LAUA 2Y4IB 1G3NA 3A4OX 3PSCA 2ZVAA 3OP5A 3GUBA 4BCFA 3G2FA 2F7EE 3LXKA 3NVKI 5F94A 4AXAA 4OT5A 5DVRA 5FTQA 3OD6X 4NT4A 4EJ7A 3FHRA 3FJQE 5DN3A 3DBFA 3W16A 3WIKA 5CASA 3CD3A 3Q04A 4FKUA 1KE7A 4O2ZA 4CYIA 3M42A 4C37A 2CLXA 3PWDA 3ALOA 3BZ3A 5F4NA 3SOCA 3R1SA 5CU3A 4AE9A 1XBAA 3PZHA 3CTJA 5C8KA 5F9EA 3C13A 5C8MA 3VVHA 4E5BA 3EIDA 4IJPA 4EC9A 5J7HA 1OVEA 2J7TA 4ASXA 3QTZA 2J6MA 2GNGA 4P5ZA 5DGZA 3W33A 4U42A 5EI2A 4AW1A 5BVFA 1U5RA 1H08A 1UV5A 4AA5A 3FLSA 4BDJA 3PLAE 4Y83A 2OW3A 4F99A 5L8KA 4WKQA 3NW5A 4XMOA 4BICA 2VTAA 5AA9A 1OECA 2QO9A 2HENA 3PIXA 4I5HA 2WTKB 4OTWA 3GGFA 4KKGA 3KRRA 4D58A 4FZ6A 3V8TA 2VO7A 2XJ1A 3GU4A 2IZUA 4ZY4A 3BYMA 2YM8A 2QHMA 4KKHA 4GMYA 3U55A 1JKTA 4EOIA 1T45A 1ZARA 4EYJA 2FA2A 5C26A 2A2AA 3D15A 5AR7A 3R7IA 3N4VA 2Z02A 3ZS5A 1J7LA 3AC5A 2GNFA 4GIHA 5FXQA 2GMXA 3RBWA 4GS6A 3MJ1A 3Q53A 1KV1A 1YRPA 2GNIA 5A4CA 5HQ0A 3QTUA 2VTJA 3RCJA 2QONA 4RVTA 5L6PA 3ZXZA 3PVBA 3A8XA 4QQCA 2O64A 4EZ3A 2CKOA 5DE2A 4AN2A 2JFLA 4XG2A 4JAIA 4F9WA 5KMJA 4CCBA 3SRVA 3QUPA 5D41A 4DT8A 2ITQA 3R9HA 5CEKA 2XIRA 4PRJA 4ARKA 3VN9A 3NYVA 4GK3A 2OJJA 5EDRA 5EM6A 5C9CA 3RM6A 1PYEA 3SLSA 2Z8CA 3UC4A 2E9PA 4BIEA 2X4ZA 2YIWA 5CVGA 3R01A 1SMHA 4XS2A 3PFQA 2UW7A 5LVNA 4PP7A 4ANBA 1MRUA 1GNGA 4BKYA 2RKUA 4QP2A 2JIUA 3TIYA 2WEIA 3OCSA 2ZOQA 2XIXA 1CTPE 4E6AA 3QZHA 3G15A 1OI9A 2OJIA 4JG8A 3UIMA 5CXHA 4CTBA 3DLZA 3ORZA 4GL9A 3DLSA 2Y6OA 4FSRA 4BIBA 2WELA 2XYUA 4EK4A 5LCJA 2C3LA 5ETCA 4KS7A 2ZB1A 4IMYA 4G5PA 2P3GX 1H00A 1YVJA 4E6CA 3L1SA 3KREA 4IX4A 4K6ZA 1XBBA 5HE0A 3CCNA 1ZYSA 3PVGA 3ZU7A 1XH6A 4PMPA 4XYFA 3C4EA 4O91A 3FY2A 1ZOGA 2X0GA 4C36A 4JI9A 3HDNA 3I81A 4FIJA 1CMKE 2PWLA 2XH5A 4ITJA 1R3CA 3G33A 4CYJA 4YR8A 5I5ZA 2H8HA 3NAXA 3P4KA 4FKWA 3I1AA 2OFUA 4H58A 4HJOA 1DS5A 4K2RA 3HAMA 3K3JA 4DGNA 5GZ9A 2OI4X 4EK5A 3V5PA 1Y57A 5KHWA 4IC7A 4USFA 2I7QA 3UNKA 1ZMVA 2V0DA 4FTTA 4DCEA 3OUNB 4UX9A 4O81A 4V01A 3ZFMA 2XEYA 4RWKA 5J5SA 5KCVA 4O1OA 4L8MA 5GIOE 3WBLA 4F6SA 1OKVA 5DH3A 2EXEA 4II5A 4FF8A 5L6WL 2HCKA 4DGMA 4GUBA 2VTMA 4MNEA 5AP5A 4QNAA 1YXSA 4IB5A 3DBDA 3P5KA 4XG3A 3QCSA 5JFXA 4TYJA 3FI8A 3PJ2A 4ALUA 4O0UA 4JIAA 4R6VA 4YPDA 1XHAA 5AFVA 3OT8A 4FT9A 1ZOHA 3NZ0A 2F57A 2UZBA 2YDKA 3OBJA 5AV1A 4Z3VA 1H01A 4FTMA 4Q2AA 3E8NA 3KB7A 3F5PA 2GS7A 3PG3A 4HCUA 3UE4A 3HX4A 4OTPA 4UXLA 4FUYA 1RQQA 2UW0A 1H07A 3DBEA 3MFUA 4V05A 1PY5A 2YJSA 4PL4A 4YBJA 5ANGA 3N4UA 1YWRA 4K77A 5FBOA 5HTIA 5E9EA 3UOKA 3Q60A 2FSOX 2JBPA 4N4SA 5T6KA 4QMXA 2JGZA 3VBQA 3CIKA 4MXCA 3TNIA 3CJFA 1M14A 4I23A 4DGLC 3MIYA 3WZJA 2IN6A 5CQWA 1IASA 3UVRA 3BX5A 3MPTA 3F9NA 2PUPA 3BE2A 3GCVA 3HLLA 1Q3DA 3BHHA 3F2AA 3QCQA 3PE2A 4YLKA 3UBDA 1W98A 3NYNA 4I6HA 4O7TA 2SRCA 3UZTA 2J5EA 3QZGA 4EUUA 2BMCA 4R77A 4O96A 2O2UA 2ETMA 4WUNA 3UO4A 5A46A 5L2SA 2J0MB 5DT0A 3COMA 3QQHA 3W8QA 4FIHA 4ASEA 1KE6A 3SHEA 4JQEA 4EWHA 3FMJA 3MSSA 2YCSA 5AX3A 2YDIA 4YJUA 4E8AA 3LKMA 4W4XA 4AOJA 2R2PA 4O0RA 4RC3A 3IECA 5ITAA 1OPJA 3BU5A 4RMZA 3ZDIA 5M51A 4FKLA 4JJRA 5HNGA 3UOLA 2VWUA 5C03A 2VX3A 3SG8A 2ZM1A 3Q4TA 2Z7RA 4I0RA 3H9RA 2XM9A 4X2JA 3D5UA 2ZYBA 3E92A 4FV7A 4E5WA 4XBRA 3OOMA 4XBUA 3VS6A 3LFEA 3W2SA 3LCKA 3UZPA 1UVRA 5E8XA 1JVPP 3FPQA 3WZDA 4EHZA 5M53A 3HMMA 3PRIA 2Y0AA 3IOPA 4MF1A 4ZTHA 3C0IA 2JEDA 5H2UA 2W96B 4K33A 3BGQA 1ZWSA 5IQFA 1IR3A 4ZSJA 2ZAZA 1SVGA 4KUJA 3JPVA 3HUBA 4O22A 2O65A 4IQ6A 4M3QA 4WNKA 2Y4PA 4WNPA 5I0BA 4YJSA 3RALA 1UNLA 3NEWA 2UZLA 3L9NA 4GH2A 4QPMA 4QYHA 4U41A 3WYXA 4BYIA 1WBTA 4USEA 5IISA 4O21A 4PUZA 5CY3A 3MY5A 2HYYA 2UZDA 2VO3A 4WBBB 4HGEA 5HHWA 4HW7A 4XNEA 3VRYA 4OAVB 4YO4A 2W1CA 5G6VA 4E93A 5IEYA 1YDSE 3BHYA 5EW8A 5D7AA 2Y9QA 3QTIA 4FZFB 4KD1A 3VJNA 3E3PA 5AUYA 1AD5A 4ANMA 4LOOA 3TKIA 3F3WA 4ZSGA 4C3FA 4TYHA 4EZ7A 4HCVA 3QLGA 2R64A 2ZMDA 4M69A 5KNJA 1U46A 4TW9A 5KZIA 4QMMA 3Q4CA 4H3BA 5J1WA 4B6LA 3CGFA 4HZRA 3LIJA 2WQNA 4ZZOA 4GKIA 2FB8A 2PPQA 4J8MA 1REJA 1YI3A 2YERA 3H30A 2X6EA 3OTUA 4FTOA 4U43A 3K5UA 5M56A 4K18A 2PVLA 3OEZA 4FMQA 2QHNA 5GJGA 3ROYA 4CKJA 2J2IB 2PUNA 5CAOA 4BI0A 4QP8A 2HZNA 4BWXA 5AAFA 4D2VA 2BRNA 2OIQA 2GCDA 3D7ZA 4BDIA 1OBDA 2QNJA 3QYWA 2VWYA 1BI8A 2W1DA 3QWJA 5DLSA 3LFQA 3UOJA 2QODA 4L67A 4O7NA 3S4QA 4NW6A 1UKHA 2IZRA 1GZOA 4DA5A 3O8TA 3PJ1A 3Q2MA 3CSVA 2QD9A 2W5AA 4BHNA 4TWPA 4QMLA 2B55A 1YWNA 2GFSA 1H1WA 3AD5A 4R7BA 3DK3A 4B0GA 2CPKE 4YC6A 1Z5MA 4TWOA 1VJYA 2J5FA 3UGCA 3V5TA 2RG5A 2JC6A 5CTPA 2HZIA 3EN4A 4XH6A 4L43A 4PTGA 2GDOA 2ERKA 5IDNA 5ICPA 4M7IA 4IZ7A 4X21A 4JRNA 4ZSAA 3E62A 1H28A 4L3PA 5AP7A 4O86A 3DDPA 5BVKA 4CTCA 3O8UA 2XNBA 4Z7GA 4FSWA 4FSYA 4QP9A 3AC8A 1P14A 5AM6A 2QR8A 5CI6A 4D9UA 4GVJA 4DH1A 3AQVA 4KIKA 4NM3A 3S2PA 3LZBA 3FEGA 2KULA 2G01A 3R8PA 4QTCA 2R3HA 2W05A 4FNXA 4AT4A 4QOXA 3FLZA 5HG8A 2R3MA 2RG6A 5ANIA 2XB7A 1Q8WA 4FKIA 4QMSA 4AZWA 4I5PA 2UW6A 4ZLZA 3FYKX 3HKOA 5JGAA 2BIKB 3KK8A 5JZNA 3W10A 5M4FA 1OPLA 4W8DA 1K3AA 2IZSA 5EM5A 3NYOA 4D1XA 4RGJA 2X8EA 2JIVA 5FG8A 2OXXA 3GT8A 1BUHA 5GNKA 4QTEA 4ZMEA 3DDQA 4C4HA 1OUKA 2W4JA 4PPCA 3WARA 4MBLA 5AR5A 1YQJA 3FMKA 4MKCA 2RL5A 2H6DA 4HGLA 5TE0A 4BDBA 4E7WA 3DPKA 3MW1A 3K2LA 5FP5A 1U54B 5JEBA 3EFLA 5HVKA 4IDTA 5AJQA 4BC6A 4LV8A 2AC5A 4BBMA 2ZV2A 3PXQA 2ETKA 3HDMA 3R63A 4U0IA 5AR8A 5T68A 3PUPA 4IDVA 4O7ZA 4FV9A 4JS8A 4GEOA 2BR1A 3LE6A 4BWPA 2GS2A 2YA9A 2E9OA 4JDJA 2ZDUA 4K0YA 4BWKA 1WMKA 3NIEA 2J9MA 2I0YA 4FGBA 1VYWA 4G3FA 3FQHA 2W5BA 5E4HA 2AUHA 3BV2A 2PYWA 3ZO3A 4W9WA 3DBQA 4OLIA 3CTHA 3RZFA 2BZKB 4BDAA 3R83A 4HVHA 4CG9A 1X8BA 3ITZA 3R7YA 3KULB 3O0GA 4BR3A 3VUIA 4NJDA 4P5QA 4XEYA 3TV6A 4NM7A 2EXCX 5AUXA 3UYTA 3ZC5A 2BRHA 2QVSE 3E64A 2WXVA 3UC3A 4WRSA 4U81A 5A4EA 4HPUE 2XCHA 1SM2A 3ORNA 4L01A 3HMNA 4KIQA 4BCPA 3UVPA 4QNYA 3UDBA 5LVPA 2XCKA 3H9OA 3PVUA 4EOQA 3MJ2A 3QU0A 4KKEA 3E7OA 3AXWA 4LUEA 3FMMA 3FMHA 4U3ZA 4IFGA 3F5GA 3RAIA 5EQPA 3GC0A 5EKNA 1R39A 5DR6A 2VUWA 3IONA 3TN8A 2B9HA 2WGJA 3QKLA 4QP3A 3ACJA 2WMQA 4N6YA 4FR4A 1RE8A 4G3EA 4KB8A 4XX9A 2WO6A 4C61A 5I9XA 1SNUA 3DZQA 1SVHA 2WFYA 3KN6A 4IAIA 4BTMA 4IAAA 2GNJA 2WTIA 4QMVA 5BYYA 4FV1A 4D4VA 5DYJA 4GJ3A 3Q32A 3QQFA 2PVHA 1PMEA 3C4XA 2Q0NA 3I6UA 2ZB0A 3TZMA 4OT6A 3AT4A 5FTGA 2JLDA 2CJMA 4Y72A 2XK9A 3VS5A 4EJNA 2OF2A 4ZS4A 3ET7A 4MK0A 4TXCA 4G6OA 3ZSGA 5DRDA 3ZSHA 2VRXA 2YCQA 3NWWA 1V1KA 4H36A 4KSPA 2F9GA 2PZ5A 4NCTA 5CEIA 3KXNA 3OWJA 3L8PA 3R73A 4BCKA 1NT2A 4IFCA 5GINE 2P2IA 4I4EA 2WMSA 3P7BA 4IAFA 4MEDA 4QTDA 1WFCA 2QOIA 4X7QA 4DG0E 4F7NA 2QOQA 2YLFA 3LXLA 4TTHB 5JGDA 4AAAA 4NCTC 4RIXB 4FZDB 2UZEA 4BN1A 1ZLTA 4D9TA 3D5VA 4U45A 4RQVA 3BHVA 1P5EA 3OROA 4OTDA 3OMVA 3QC9A 4QO9A 4RG0A 4A4XA 5AV4A 3SA0A 2IPXA 4YJTA 2X1NA 4CRSA 4O7YA 4A9UA 1MQ4A 3ENMA 2X6DA 3UG1A 3QCYA 3QD0A 5JT2A 4GKHA 2NP8A 3EQHA 3PSDA 3QUDA 3RCDA 4F6UA 4RLKA 1FPUA 4A9RA 5DMZA 3POOA 4RVMA 3O17A 3RKBA 4RVLA 3RINA 3OT3A 3JY9A 4LOPA 3RPVA 2W4KA 4DFXE 4L7SA 5HX8A 4YO6A 2QO7A 1FGKA 3EH9A 3V04A 2J51A 5EDQA 5IA4A 4YU2A 2C4GA 2QOCA 3KKVA 4U3YA 3DJ6A 5E8YA 2A19B 4QMOA 4TY1A 2X7FA 4EK8A 1YOLA 2BZJA 4DGGA 3FZPA 3GCQA 4C2VA 2VWXA 2C1BA 2PZPA 3QQKA 1URWA 2IVUA 3TNPC 5J5TA 2B52A 4DHFA 5HO7A 2H9VA 3PY3A 2A1AB 5A4QA 3BRBA 3NAYA 2F2UA 5I3OA 4ASDA 4BBEA 3G5DA 4G9RA 4RIYB 3GFWA 4MHAA 5H8EA 5HNIX 5HKMA 4NM0A 4CMUA 2PVJA 2IO6A 5FEDA 5BVWA 4LV5A 4G31A 4YHTA 4A07A 3QTRA 2PMNX 4A9YA 2GSFA 2OIBA 5HG5A 5B2KA 3PZEA 3UMWA 3MY0A 3UODA 2C3JA 1CKJA 2EWAA 4S2ZA 3MWUA 2C0OA 3CJGA 3VULA 3LLTA 4XV9A 2C30A 2FSMX 2RF9A 2XKCA 3W2RA 2BTRA 4O27B 3DKGA 4HNFA 4AGCA 4ANSA 4FK3A 4ERWA 3HV7A 2YJRA 1T46A 3VIDA 1TVOA 4FEXA 3SAYA 4BCIA 1PXMA 2W17A 3F69A 4Q9SA 3VAPA 4LI5A 4NTSA 5CEQA 4QTBA 3UQGA 5BUEA 1H0VA 1F0QA 1B38A 2V7OA 2ZMCA 3BU6A 4H1MA 3TL8A 4BY9E 5AP0A 4JDHA 3G6GA 3D7TB 2PVFA 4L44A 4CV8A 4ZTLA 4N70A 1I09A 4XP2A 5DOSA 3A7FA 5KMMA 1BMKA 3PA4A 2YWPA 3ORIA 3L8SA 4F0IA 2C5YA 2V5QA 4RJ5A 4CT2A 2X9EA 4E4MA 3MN3A 4ZTQA 5LCKA 4F9AA 3NRMA 5A3XA 3VUHA 4BVUA 4M68A 2BDWA 3AMBA 3OCBA 4GSBA 2Q83A 4FTIA 4QTAA 3UIBA 3HA8A 3R30A 4QQTA 3LQ5A 4NWMA 4DFYA 1ZMWA 2UW5A 3TIZA 4Q9ZA 1FVRA 4IWQA 3BYUA 3ZEWA 3KK9A 1E1VA 1PXIA 3E8EA 3KXMA 4AGDA 1UKIA 4XG8A 1KSWA 1NW1A 4RRVA 1Q24A 3HV6A 5D10A 3RP9A 5IQBA 4YNOA 4WSQA 3P0MA 1BKXA 2OIDA 5EYMA 2XRUA 3FKOA 3RK7A 3TZ8A 3IKAA 5KBRA 3O50A 1ZY4A 3QQLA 4FT3A 4M15A 3D2KA 5F20A 2O63A 3DTWA 3QCXA 2IZTA 3FE3A 4FKGA 4RWLA 3EQCA 4FC0A 1OL5A 3BYSA 5EDPA 3EN5A 3EQDA 2QOFA 4LRJA 4QMPA 4Y5HA 4M13A 5ANJA 2FO0A 4MXOA 4CD0A 1BX6A 3FMDA 4EOLA 4YGAA 4BCHA 5ETFA 3UPZA 2HW6A 4FTKA 4YNEA 2WTWA 3UOHA 1VYZA 4U44A 2I6LA 2R3KA 2YISA 3DS6A 3ERKA 5TF9A 3DB8A 5JN2A 1OITA 3IDBA 3OG7A 3C9WA 3VQUA 4ANNA 2HW7A 3F82A 2QURA 5DT3A 3VW6A 4HVIA 5IUGA 2JDTA 4YJVA 3IO7A 3KXHA 3P79A 4G1WA 1EH4A 4FL3A 4EH7A 3OXIA 3EZVA 4FX3A 3ZDUA 4FEQA 4ZSLA 3ZZWA 1P4FA 3QLFA 1G5SA 4FTNA 3AD4A 1QMZA 4TKSA 4D5HA 5BUJA 5AUVA 3KC3A 3C4WA 2GNLA 2IW6A 4QRCA 3DAJA 3I5NA 3L9PA 4YTFA 5KMKA 2VWWA 4JBPA 4L00A 4UXQA 2C0TA 3HUCA 2P33A 5KKRC 3QD4A 3KXXA 3CTQA 4CZTA 3QTSA 4JR7A 5CF6A 3C51A 3OCGA 4OTRA 5CSPA 5FXRA 4MD7E 2YIQA 5HZNA 4BGGA 4FGRA 4BKJA 3HYHA 3RGFA 2WHBA 3U6JA 1JNKA 2YABA 1Q41A 2YM7A 4PTCA 1PMUA 2WMXA 4E5AX 3V6RA 1Y6BA 3ZOSA 5J1VA 1WZYA 3LJ0A 4O6EA 2OGVA 3UO5A 3EQIA 3TNHA 3EMGA 2QG5A 4FV4A 1HOWA 3FXXA 4I24A 3A7IA 3FZ1A 3AC2A 5K5NA 1UNHA 1M2QA 4JG6A 3TZ7A 3PIZA 4FTCA 4IZAA 4UMRA 3NUXA 5I3RA 4OTFA 4FTLA 4BDHA 3P7AA 4I20A 3K5VA 3MFSA 4M66A 4A9TA 1FGIA 5B7VA 1SNXA 4Z9LA 2G1TA 5IQIA 5AADA 1QPDA 3TEIA 4ZTMA 5CU2A 2XK4A 5CU4A 4O0SA 4CKIA 1R0EA 3UP2A 1H0WA 1ZYJA 4XHKB 4DEIA 3CQUA 1GJOA 5AWMA 3MVLA 2VGPA 5IH6A 4I93A 5EKOA 3EFWA 3TV7A 2I1MA 3I0OA 4FG9A 4ALWA 4BDFA 4RC2A 1W82A 4TYEA 3TZ9A 3BLQA 5BMSA 1XH4A 3A61A 4A9SA 4GT5A 1PJKA 3F5XA 2VTLA 3Q5ZA 4OBQA 2FSLX 4D5KA 3NUNA 3D14A 4YZNA 3N51A 3TV4A 3S1HA 4DFUA 1JKKA 1LEZA 4LGHA 2ERZE 2VWVA 5C01A 3LFDA 1CM8A 1V0BA 4RJ4A 4QT1A 2VN9A 1R78A 2OJGA 4UZHA 2Z7SA 4CT1A 4R7IA 4RT7A 3MESA 4EH2A 5E8WA 3N9XA 2E2BA 3B2WA 3H3CA 3WF7A 2QCSA 3S95A 3KRJA 3EN6A 4EUTA 3BI6A 1Y6AA 2W06A 2OXDA 2BAQA 5HE3A 3QD3A 3RHKA 5I9YA 4TL0A 3DY7A 2OO8X 4MCVA 4BCMA 1G8SA 2VTIA 4S34A 2XM8A 2ZV7A 4I41A 4BHZA 4PX6A 1XWSA 3G0EA 3OUKA 4C33A 2LAVA 2R0IA 2X4FA 4XLVA 5B2MA 2UZVA 2PZIA 2XF0A 4F7JA 5KMLA 4RJ3A 2HIWA 2X81A 3DQXA 3JS2A 2XYNA 3OFMA 4FODA 2VTSA 3LFAA 4R1YA 4C3PA 3A99A 3OOGA 2YEXA 3NW7A 3FAAA 3GCPA 3GOPA 3QQUA 2ITXA 4FSTA 3NIZA 5EFQA 5DEWA 3PXYA 4HGTA 4AZTA 2Y8OA 4NIFB 2PU8A 4IH8A 3K54A 4JAJA 1H1PA 1YI6A 2R3RA 2ZV9A 2QI8A 5IQAA 5IG1A 4JL9A 5K4IA 4WRGA 4UWYA 3C1XA 4WHZA 1UNGA 1U4DA 5HVYA 3FLQA 3ULIA 2ZV8A 4FUXA 3EFKA 4U7ZA 5BPYA 2PMOX 4DT9A 3FLWA 2OJ9A 2VX1A 2OZAA 3OC1A 5FM2A 4BGQA 4AT5A 4EH9A 4IB0A 1BYGA 4ENXA 4TN6A 4F6WA 3EJ1A 4P2KA 3G9LX 4O38A 3BQCA 3L8VA 3W2QA 4A4OA 3ID6C 3D5WA 3DU8A 3ODYX 4LGGA 3ZO1A 4QYFA 1KE8A 4P7EA 4LRKA 4XG4A 4FV6A 4FZ7A 5CNNA 4E6DA 4J8NA 4GT4A 3SOAA 3EB0A 1Y8GA 4JRVA 2UW3A 3DKOA 4AA4A 3HL7A 3ORMA 5K9IA 2XK3A 3QXOA 3DFCB 1H1SA 1H26A 5DR9A 4XRLA 4FTQA 4DE4A 2OWBA 4EKKA 4UWCA 4YHJA 2PL0A 2VTTA 2YITA 2QU6A 4RJ6A 4O82A 2OH0E 1WCCA 4I6QA 4IANA 5J8IA 4C4IA 3ATTA 1P2AA 3PXRA 4DTBA 3JXWA 3PXZA 4U9AA 1PXOA 4YTHA 1YDRE 2UZWE 4LUDA 3S3IA 3VS3A 3NUAA 5AIKA 1PXLA 4PPAA 5BYLA 3FI4A 3W18A 4KIPA 3ZLXA 1CKPA 2DUVA 1H24A 3GU7A 4RFMA 3VHKA 1O6YA 3ZO2A 2UZOA 4E1ZA 2R9SA 4APCA 4FTAA 4W4WA 2CNUA 4R78A 2JAVA 3V01A 3RAWA 4EOPA 3TDVA 3TI1A 2P55A 3U4UA 3H0ZA 4D0XA 4I92A 3R28A 4FIFA 4RIYA 1Q97A 3C4CA 2CHLA 3KXGA 5JQ8A 3Q2JA 4ID7A 3Q9WA 4BDCA 3EL7A 3ZRLA 4BKZA 4EK3A 4FVRA 5AR2A 2UV2A 4IAZA 4Q5HA 1NVSA 3VC4A 3GU8A 4B8MA 4OTGA 2UZTA 1J7UA 4ORKA 4UEUA 1ZYDA 4FKVA 4IZ5A 4NEUA 3V5QA 4GYGA 4IB3A 1SZMA 4J97A 1FINA 2C6OA 4JXFA 2EB2A 3FC2A 1W84A 1URCA 2W7XA 3LXPA 3P9JA 3VF8A 1QL6A 5IZFA 4FA2A 4FOCA 3AD6A 3BWJA 5HE1A 1ZYLA 1M52A 5T3QA 1U59A 2VTPA 3TM0A 1LPUA 2AYPA 3KMMA 1IG1A 4AW0A 3QD2B 1TQMA 2XKEA 5AUTA 3II5A 1J91A 2B54A 3QX2A 4E6QA 4DN5A 5M07A 4NU1A 2QOBA 2XKFA 4G16A 2F2CB 2QO2A 3FC1X 3NNWA 2J0IA 5DHJA 3HMOA 2CCHA 3OEFX 5TOZA 4TT7A 2VAGA 3MV5A 4O7SA 3BIZA 5GHVA 3MA3A 2PK9A 1WBWA 4DEAA 5IQGA 5CAPA 5EH0A 5EM8A 4UYAA 3FKNA 5L2TA 3C5UA 4DINA 4YZCA 1H27A 1W83A 3QTWA 1KV2A 4XV3A 2W1FA 3MTFA 4Q5EA 5BYZA 5HE2A 3RK5A 4LMNA 4RSSA 3NGAA 4C34A 2JDVA 3QRTA 4QYEA 4TWCA 3JR1A 1DI8A 2CN8A 2WMBA 4FSZA 3ZLYA 3QGYA 4MD9E 3P08A 2BDFA 3ORKA 4FT5A 4X6QC 3E63A 1YW2A 4EH4A 3E5AA 3KF7A 5EYCA 1LR4A 2GTNA 4PF4A 3R1NA 2X8IA 4FTRA 4MAOA 3WE4A 2WOTA 4ACHA 1ZRZA 1OKZA 4DG2E 2G2HA 4FKSA 5IA2A 5TKDA 3EZRA 4X2GA 2R3IA 3IQ7A 3ZRKA 3PJ3A 2BILB 4ITHA 5H8GA 4CNHA 4DITA 3W1FA 2VX0A 2WMTA 3NUYA 4WNOA 4CRLA 3NNVA 4DFNA 3DZOA 3VBWA 4XP3A 1NA7A 3ZEPA 4R5SA 3HA6A 3RNIA 4LL5A 5JRSA 2F7XE 5A14A 3DK6A 4CFXA 3PY0A 1DM2A 4BCQA 1ZOEA 4EI4A 2BRGA 4QQJA 5FQDC 5K4JA 2FGIA 2O3PA 1W7HA 3MH2A 2BRBA 4J96A 2JDSA 3ORPA 3RI1A 2PMIA 1P4OA 1PXNA 4ZIMA 4AZEA 3RPRA 1Z9XA 3M2WA 4N6ZA 4RX7A 1APME 2HOGA 2YZAA 3IW5A 3LFNA 4JQ7A 4BDKA 4RIWB 2HK5A 2R3JA 4R7HA 5I9ZA 2BZHB 4V0GB 2W9FB 5C8NA 5JZJA 1OBGA 5BNJA 2I0HA 3CP9A 3FYJX 3F61A 2DWBA 5D11A 4IX3A 3VS1A 4AT3A 4FV5A 3VWAA 2OFVA 1Q8UA 2VTOA 2Y6MA 4NJ3A 5HO8A 3IOKA 2Y4IC 3Q52A 4PPBA 1M17A 3MB6A 4X0MA 1LUFA 5DT4A 3UG2A 4BZNA 4F63A 4Z55A 3G51A 4O0WA 4ACMA 3BELA 2R4BA 5LXMA 3F7ZA 5K3YA 4LOQA 3TUDA 1Q5KA 2R3PA 2WB8A 2H96A 2J0LA 5HU3A 4KABA 1Q8YA 5LVOA 5KMOA 4U40A 2ZM4A 4FEWA 1TKIA 4WBOA 4O7VA 3MH0A 2JKOA 2WQBA 1PHKA 4KWPA 1K2PA 3BBTB 3I6WA 2GQSA 4MWIA 4PL5A 4M84A 1AQ1A 5CQUA 4GFOA 5KX8A 3T9TA 4ZLOA 2UW9A 1IAJA 3IG7A 1G8AA 5KBQA 5J95A 3NVMB 2WOUA 4QP1A 3PSBA 3UO6A 4X2FA 4C57A 2GHGA 2I40A 4D1ZA 4AA0A 3HEGA 4D0WA 2JFMA 3SVVA 3FZRA 4PDPA 3NPCA 4UY9A 5BVNA 3LCSA 3LMIA 3LJ2A 5HICA 4YTIA 2V7AA 2IW9A 2CMWA 2X7GA 3DT1A 3NCZA 5IUHA 2WTKC 4RPVA 4RZVA 3WF5A 3LMHA 3TJCA 3R8LA 3ELJA 4HYUA 4I0TA 2JKMA 4USDA 5CSHA 3ZC6A 1STCE 2W4OA 3ULZA 1DAWA 1R0PA 4KBKA 3O96A 1FQ1B 3P23A 3PIYA 4L3JA 2NRYA 1BL6A 4BIDA 5AV2A 5FGKA 4X3FB 3VUMA 5JK3A 4M8TA 3V51A 4EH8A 2G15A 3BYOA 4M12A 5D12A 4PDOA 3LW0A 4NZWB 4EBVA 1QPEA 3GQLA 3NUUA 3OHTA 3D0EA 4HYIA 3LCOA 2C6LA 4Y95A 5EI6A 5DA3A 3SXRA 3AG9A 4TZRA 5DNRA 1WBSA 3RPYA 4J1RA 3VS0A 1JSVA 3SDJA 3FBVA 1FOTA 5IEXA 1S9JA 2WZJA 3VS4A 4FV0A 4G3CA 3SW7A 4XRJA 3A7GA 5CS6A 3PLSA 4BFMA 3SGCA 1XO2B 2ITZA 2QR7A 3D94A 3SQQA 3W55A 4MX9A 2WMRA 4L3LA 4FNWA 1ERKA 3O51A 4NSTA 3DTCA 2G2IA 4W4YA 5JSMA 3KMUA 3O7LD 5AIRA 3ZTXA 4LGDA 3QAME 2CNVA 2WTCA 3H0YA 4AE6A 4WUAA 4O6LA 3BV3A 4Y85A 3CQWA 3U8WA 5BVDA 4A06A 3VBYA 2YCRA 5CX9A 2FVDA 2CKEA 1NVRA 2XNNA 5F95A 3QWKA 3DOGA 2W1GA 4K1BA 3PXFA 4XV2A 1YHVA 2GQGA 2W0JA 3DK7A 4ZTNA 1WBOA 4BBFA 3D83A 4U8ZA 4TPTA 3RHXA 3WOWA 2XUUA 2Z2WA 3AOXA 4G6NA 4JX7A 2R0UA 3A60A 3EWHA 4IW0A 5AV0A 5IU2A 3BU3A 3F3VA 1UU7A 4JIKA 3VS7A 5AMNA 3BLRA 4H1JA 5HTBA 1GIHA 2J0JA 2I0EA 1BI7A 2WAJA 3FI3A 3OWLA 2EUFB 4HVGA 2JD5A 3ANQA 4L7FA 3ZCLA 5A6OA 3ZZEA 1OZ1A 5HBHA 5JQ5A 4E26A 1OKWA 5FP6A 4AWIA 1ZZLA 2C47A 3R21A 5CZIA 2IWIA 3E3BX 3EQBA 1IEPA 4RLLA 2ITNA 4O0XA 4D4YA 2XNPA 1BLXA 5DI1A 5CWZA 3LLAA 4JBVA 5D1JA 5K5XA 4QMZA 3OY1A 2UVXA 4G6LA 4TYGA 5L6OA 4KBAA 5FRIA 3FZSA 3LCTA 3QC4A 4EQCA 4UALA 4UMTA 4G17A 4CMTA 2CKQA 3GU5A 3VO3A 4BZDA 5CYIA 2ONLC 3IDPA 2JBOA 3Q4ZA 3A62A 4GU6A 3SXSA 4BCGA 3KRXA 2XNEA 2QKRA 4P4CA 4M67A 5CAUA 3KU2A 4RQKA 1HCLA 2WU7A 5HCZA 2B1PA 3C0HA 4EYMA 3P86A 2GS6A 3P78A 3OF0A 4IX6A 4L46A 3RM7A 1GOLA 2OKRA 1OL1A 3VNTA 5CEPA 4AW2A 4JNWA 3D4QA 3F3UA 3TJDA 4HOKA 4JLCA 4Y5QA 5E8ZA 4F64A 1V0PA 4ZJJA 3FUPA 4TNBA 2B7AA 4WG3A 3BCEA 3R8VA 3WILA 3F3TA 3TUBA 3QKMA 3HZTA 2Z7QA 4EZ5A 4EWQA 3R04A 4UV0A 2C5VA 4DTKA 5CNOA 4YURA 3LQ8A 5HLWA 2Y7JA 4P90A 5HVJA 3LM5A 3PE1A 5DRBA 4AOTA 4FV2A 5E1EA 5ACKA 2CCIA 3SRVB 2JDOA 3P1AA 3QFVA 4JBOA 4BDGA 4V04A 3EN7A 4HVDA 4EOMA 4ZTSA 3ROCA 5E7RA 5I9VA 3QUEA 3GEQA 3PG1A 4GYIA 2BTSA 2UW8A 1GZNA 4CFFA 4F4PA 3PA3A 3IW7A 2C5NA 4O0VA 2CGVA 1OUYA 4FKOA 3GQIA 4DLIA 3U9CA 2REIA 5AUZA 5C27A 5HEZA 3HV4A 3PJCA 3NUSA 3LQ3A 4FT0A 4OTHA 4YBKA 1JBPE 1QPCA 2Z60A 4XP0A 3P7CA 3IS5A 4R3PA 2F7ZE 5IQEA 2ZJWA 3UP7A 3FPMA 4HCTA 4WG5A 3U4WA 4QP7A 4F0FA 4JQ8A 1IA9A 2FYSA 3M1SA 4CLIA 3IGOA 3A8WA 4M97A 4DGOA 2PE0A 1S9IA 2P4IA 4YJPA 4LYNA 3TKHA 1CKIA 5FEEA 4YSJA 3D5XA 4JVGA 4KNBA 1MQBA 2OU7A 1IAHA 3GCSA 5KMNA 4WG4A 4YJRA 4BCNA 4CQEA 4ZJIA 4FSQA 3EFJA 1E1XA 2XNOA 4LQMA 1WBNA 4FTJA 4GIIA 1NXKA 3ZH8A 4IIRA 4Z16A 2YHVA 2YFXA 4CGAA 2C69A 3EQRA 5CSVA 3TTJA 4FEUA 2OZOA 2XZSA 4U79A 3ALNA 5L2QA 3FMNA 1F3MC 4O2PA 4CFWA 2C5XA 2OF4A 2RFSA 4FKRA 2Q0BA 4I5MA 5IA1A 1VR2A 3BWFA 2WTDA 3PDTA 1AGWA 4WT6A 4ZSEA 5IPJA 2C5OA 3O71A 2B53A 4FK6A 2DQ7X 3EQPA 5L8JA 5CF4A 2VO6A 4X3JA 4GW8A 3SKCA 4PMSA 5HLNA 5ETAA 3VUDA 4CZYB 3G90X 4MNEB 4ONAA 2W9ZB 3C0GA 4FKJA 3EYGA 4W8EA 1OL2A 5A6NA 5IH4A 5GIPE 3MB7A 1GIJA 2LGCA 2BFXA 4S32A 5J9ZA 2WIHA 3I7CA 3G9NA 5AP4A 1ZAOA 2P2HA 3BKBA 3TNWA 3Q9XA 2WKMA 3MY1A 4J53A 4WD5A 3WF8A 3OWKA 5L2IA 4IWOA 1XH7A 2GQRA 3M11A 4EOKA 3E8DA 3VBXA 3LFBA 2R3LA 4HNIA 3GP0A 4FBXA 4G34A 3GC7A 5GJDA 2YM6A 3CKWA 3FZOA 2JIIA 3ZMMA 3BHTA 5C1QB 3ANRA 3R00A 4BL1A 3UVQA 3KY2A 4CFMA 5AP3A 3R9OA 4NFMA 2WD1A 4F1MA 4B7TA 3FXZA 3LFSA 2RFEA 2UUEA 4DH8A 3DKCA 4XG9A 1FVTA 4GRBA 1VZOA 4QPAA 3ZYAA 5L8LA 2WU6A 3IW4A 2BCJA 2YIYA 3FL5A 4ZZNA 1GIIA 1KWPA 5A4TA 4IVDA 4KBCA 5CAVA 5HX6A 4IAYA 4OTIA 4RA5A 4X2KA 5E91A 4C4FA 2PULA 4BDDA 3L9LA 3V8SA 2BVAA 3FMEA 4NYEA 4EK6A 3S0OA 5HIEA 3KA0A 2C3KA 4EL9A 1FMOE 4G3GA 4PMTA 2FSTX 1WAKA 4C62A 5HG7A 3ZXTA 3I5ZA 3ZO4A 2UZUE 4FNYA 3NNXA 4MVFA 4APPA 1Z57A 3OW3A 4FEVA 4D4SA 4MXXA 3SG9A 4GCJA 3V5LA 4JDKA 1OM1A 3CY2A 5HTCA 3FLYA 3IW6A 4KRCA 3KXZA 3QKKA 4HYHA 4TWNA 2KTYA 4G3DA 1J1CA 2V55A 5GZ8A 3Q6WA 4FIIA 4NKAA 3CEKA 4IXPA 2XJ0A 4S31A 5AUUA 4FVQA 5AX9A 4IM3A 2YDJA 1MP8A 3F7WA 4HYSA 3ZLSA 4PNKA 5BX0A 3UIXA 1OIUA 4YC3A 1PMNA 1YKRA 3KGAA 4K11A 4PQNA 5C4KA 4OBPA 2C6DA 4ACCA 3ZUVA 4OGRA 4YSMA 2PVYA 3EKNA 4RFYA 2WQMA 3CC6A 1REKA 3F2NA 4DAWA 4UZDA 4W9XA 4CEGA 4NUSA 4XCUA 2HAKA 1ZXEA 4D4RA 3CLYA 4O84A 4PDYA 3CD8A 4FV8A 2XMYA 3HMPA 3C7QA 2PZRA 5HO6A 4RIOA 4AP7A 3GOKA 3Q4UA 5A4LA 1WVYA 4FKPA 1VEBA 1GZ8A 5EG3A 3F3ZA 4ANLA 3HV5A 1PKGA 4FIGA 4GG5A 4QYGA 1Q4LA 4FVPA 5DWRA 4F1TA 2OBJA 1UWHA 3FWQA 3HP2A 3MI9A 4H3QA 1PKDA 2XIKA 4YJOA 4F7SA 5BMMA 4MQ1A 5IDPA 3EN9A 4C2WA 3NDMA 3NNUA 2ACXA 4I5CA 5TO8A 5DFPA 3LFFA 2QLQA 4YTCA 4I6BA 2QOOA 2OH4A 3IK3A 3IGGA 1PMVA 2VTRA 4IZYA 2VO0A 5LJJA 3LCDA 2GTMA 4I94A 3U54A 2CN5A 4TYHB 3DXNA 2YWVA 4FTUA 2IG7A 3R9RA 4M69B 2VD5A 4M0ZA 2YM4A 3QHRA 4B4LA 5EQEA 1U54A 4HGSA 4UBAA 3BE9A 5EOLA 3IDCA 4DC2A 4ZJVA 2YCFA 2FH9A 4IADA 3DXQA 1UU8A 3OBGA 3R0TA 1RDQE 3WZUA 5HIDA 2PE1A 3AC4A 2IVTA 4KAOA 3KVXA 4EHVA 2C6EA 2GU8A 5DR2A 5AM7A 4YMJA 4FNZA 2X2KA 1L8TA 3OVVA 3RMFA 5FTOA 3VUTA 4FICA 2R5TA 3FKLA 4LG4A 5AR4A 3OTVA 3BGZA 2PVMA 3E7VA 2W99B 3JVSA 5C4LA 1J1BA 5CEMA 3KULA 2O0UA 1UA2A 4AU8A 1YOJA 4MNFA 1YDTE 2GHLA 5HCYA 5KMIA 4FG8A 2BPMA 4R3CA 2JKQA 2X2LA 2WEVA 2WNTA 3UQFA 1LEWA 2YLEA 2WMUA 5CEOA 1B6CB 2G9XA 4L68A 3DGKA 3RJCA 4AS0A 3NLBA 5EYDA 4QPSA 5CSWA 2HELA 2R3QA 3L8XA 4I4FA 2R3GA 4YP8A 2OXYA 3UMXA 4IX5A 4CQGA 3PYYA 5CVFA 1OKYA 5JFWA 5L3AA 5J79A 1PW2A 2NPQA 5EQYA 2WMVA 4F9BA 5M44A 1U5QA 3DA6A 4D2WA 3W2PA 5LQFA 3UQCA 4FI1A 5KO1A 5EM7A 3EQGA 3UJGA 1O9UA 1BL7A 2C68A 2CLQA 2QQ7A 1YHWA 2OSCA 4KIKB 4M0YA 4ANQA 3Q5IA 4FYNA 3ORLA 3DCVA 3F2RA 5IQDA 3PPKA 3TXOA 3OZ6A 5M08A 2A27A 3UIUA 1GY3A 3RAKA 4F1OA 4PP9A 2IW8A 4GFMA 4O7LA 4OUCA 3UYSA 3ATSA 5FEQA 3FSKA 3KN5A 4MTAA 5K0KA 3QRUA 4IWDA 3H10A 2BROA 5ANDA 4YZBA 2IJMA 4LL0A 5JGBA 3TWJA 4EQMA 2XRWA 4NTTA 4DEEA 3RPOA 5L2WA 4RC4A 4KSQA 2OG8A 3DJ7A 4U80A 3MVHA 4RIXA 2W5HA 2YAAA 3RVGA 4BZOA 4AGUA 1O6KA 3TACA 1JSUA 3EHAA 2VTNA 3DNDA 4D1SA 3MH3A 2YN8A 3LOKA 3PRFA 4AGWA 5L4QA 4E3CA 3U9NA 3KQ7A 3OWPA 5E8UA 3CXWA 5FBNC 5IA0A 1GZKA 2F4JA 3ORTA 2O8YA 4UMUA 3BBWA 1M7QA 2X8DA 4G5JA 1XJDA 5M4UA 4DFBA 4MXAA 2QU5A 3OY3A 4Y46A 5IKWA 5HI2A 3ZUUA 5JH6A 2Z7LA 1KOAA 3MA6A 4FL2A 2RFDA 3QALE 4TRLA 2OLCA 3C5IA 4IVAA 2QC6A 5IH5A 4CV9A 3HMIA 2H34A 4L45A 3A7JA 4EEVA 2ITPA 3WYYA 1OMWA 4IM2A 3WE8A 2RFNA 3H9FA 4MBIA 4AQCA 1J7IA 1WBPA 1M2PA 3Q3BA 4D28A 5LVMA 4GUEA 4R3RA 5LARA 3MGYA 2DS1A 1H8FA 4NW5A 2VWBA 3V6SA 1QPJA 4E73A 5J9YA 2C6MA 4KA3A 2AC3A 5DPVA 1A9UA 2QOKA 4F08A 5CT7A 5IMEA 5CZHA 4GK2A 3U87A 2YACA 1ZY5A 4BYJA 4GU9A 3GC9A 3ZBFA 5TR6A 2VWZA 4YJQA 1WVXA 3FI2A 5ANEA 4MXZA 2VU3A 4RVKA 4WIHA 4O7WA 5HU9A 1H1RA 2XJ2A 3F6XA 2VTHA 2F49A 5FXSA 3RK9A 3QL8A 4C4GA 3GXLA 3LPBA 2HY0A 4AFJA 1A06A 3HGKA 2XK6A 3DAEA 1Q99A 3A2CA 2JAMA 3GC8A 3G0FA 3CPBA 1UU9A 2GPHA 4IHPA 5CXZA 1RJBA 2X2MA 3IPHA 3PP1A 2ITTA 5E90A 5E92A 4WNMA 4BTJA 3G6HA 5BVEA 4BTKA 5JRQA 3GFEA 3DAKA 3T8OA 1NVQA 4QMUA 4AZVA 4BF2A 2ITUA 4D2RA 3QRIA 5AP1A 5AP2A 4EH5A 3FQSA 4OAUC 1XH8A 3VF9A 3COKA 4NKSA 3ZBXA 3FLNC 1LP4A 1ZYCA 2RSVA 3ENHA 1YXUA 3D7TA 4GK4A 3R7OA 3WF6A 1JSTA 3R7GA 4M14A 3WZEA 5AR3A 4YLJA 3NW6A 2FUMA 1FBNA 1YXXA 4DH5A 3ORXA 4K9YA 4R8QA 4J7BA 2ITOA 3DFAA 3T3UA 4UN0C 3RZBA 4F70A 2YM3A 4BI2A 3PY1A 2B0QA 2CDZA 3TUCA 2X9FA 4O1PA 1HCKA 3L9MA 4OBOA 2PY3A 4EOOA 5CVHA 3S00A 5IQCA 4XJ0A 3WIGA 3VUGA 3MBLA 4CG8A 3HAVA 4AX8A 4UMPA 3HVCA 4ALVA 4IACA 5HLPA 5GZAA 3KFAA 1OL7A 1JWHA 2XBJA 5AP6A 3TT0A 4CVAA 3GENA 3SV0A 3SXFA 5DBXA 3SC1A 4B8LA 2P0CA 4I21A 3CPCA 1JKLA 5J9LA 2XK7A 4AN9A 2XS0A 3TG1A 5D9HA 5M09A 4Y73A 5IMXA 2BHHA 4C7TA 1YXVA 4RX9A 2VWIA 2E9VA 4AOIA 3R22A 3R1YA 2ESMA 4YHFA 5LMAA 1M2RA 4FZAB 2XK8A 4YJNA 2W1IA 4EONA 2BALA 4IB1A 3QTQA 4O7RA 4XV1A 2BUJA 2BFYA 3WZKA 2DYLA 3PJ8A 2XNMA 3QX4A 4QP4A 3NR9A 3HNGA 3GVUA 2GFCA 2ZDTA 2BAKA 1OIRA 2NRUA 5HOAA 5JKGA 5CU6A 5BVOA 2B9IA 5LWMA 2HZ0A 2I0VA 3BQRA 1OL6A 4GFGA 2BAJA 3R8UA 1UU3A 1JPAA 5CT0A 4FYOA 1WBVA 3DKFA 5H8BA 4QMYA 4EOJA 3NYXA 3O23A 3QGWA 1A48A 4LFIA 2PZYA 2XBAA 2WPAA 2PTKA 3Q6UA 4FIEA 4IAKA 3COHA 3MDYA 4ZLYA 2BIYA 4EHGA 3F88A 4ZY5A 4WA9A 4IVBA 3VW8A 5LMBA 4H39A 2GHMA 4MD8E 4ZMFA 4ZOGA 4RBLA 5ETIA 1KE9A 2B9JA 4CSVA 3PXKA 4RZWA 4EBWA 1Y91A 2VNWA 5AA8A 2YIXA 3EL8A 3Q96A 3THBA 2OICA 5JFVA 3MFTA 4MQ2A 3SX9A 4RX5A 2BKKA 4IM0A 4IWPA 5CI7A 1KOBA 4KIOA 2ITWA 4U6RA 4RJ7A 3FL4A 3DJ5A 5E8TA 3ZHPC 4BTFA 3WF9A 4LMUA 4DBNA 4O0YA 4EOSA 3TDWA 3DQWA 3W2OA 2PSQA 3TCPA 4FKQA 2VV9A 3QRJA 4C38A 2PVRA 3HECA 4ENYA 5I9UA 4WSYA 3V8WA 3KVWA 1OGUA 4RFZA 3MVJA 2QKWB 3R2YA 2VNYA 5HORA 4ACDA 2XA4A 3C4FA 2PUIA 4I6FA 4DEHA 4QMTA 4F65A 5AAGA 3COIA 2VGOA 4GV1A 4D2SA 3QA8A 2OJFE 3FHIA 4UB7A 1YHSA 1K9AA 3MH1A 4J98A 4LM5A 4WOVA 2QOHA 3T3VA 1JQHA 4AF3A 4C58A 1FVVA 3QQGA 1H25A 1Y8YA 1YOMA 2BHEA 2R3NA 3JUHA 3OCTA 3QA0A 5M06A 5HBEA 4AZFA 5HD7A 5CF5A 2C0IA 1W0XC 4C59A 3W8LA 5M4IA 3QRKA 1SVEA 2EU9A 3FQEA 3KRWA 3R6XA 4HPTE 4DEDA 5J7BA 4FL1A 1V0OA 4K8AA 1F5QA 2HXLA 3B8QA 3F66A 1OB3A 3PP0A 3UTOA 3VBTA 4FKTA 1PXJA 1H1QA 2HWPA 1NY3A 3KRLA 4DG3E 5IF1A 3H4JA 1DI9A 5AV3A 5ANKA 4C02A 4ZEGA 3MTLA 3EOCA 1R1WA 5IUIA 2ZM3A 3KL8A 3NSZA 2C1AA 3DB6A 3LJ1A 3NUPA 4DH3A 4PWNA 4E20A 4DF3A 2RGPA 2A4LA 3AGMA 3SD0A 5KHXA 4JBQA 4FOBA 4PDSA 4JT3A 3MPAA 1DAYA 1CSNA 2HY81 2NO3A 4FSUA 2CGUA 4MYGA 1OIQA 3EKKA 3R2BA 2WQEA 4A7CA 3VS2A 4J71A 4C4EA 4DLJA 5KKRB 4JX3A 4HVSA 4G9CA 4IC8A 4Y8DA 3UPXA 3UNJA 5EW3A 3NMUF 4UYNA 2HZ4A 3AMYA 4D55A 3ZFXA 3DXPA 3TTIA 3CS9A 3WI6A 3U6IA 5F1ZA 3HRBA 3K3IA 4NIFA 4R1VA 1ND4A 3TKUA 3BLHA 4YLLA 3MYGA 5EK7A 5CENA 3GBZA 4ZTRA 2W1EA 4CFUA 2YZLA 3I79A 2HXQA 3GU6A 1JOWB 5KZ0A 3PA5A 2C3IB 2XP2A 1W8CA 5D7VA 5GJFA 5H3QA 2X7OA 2BRMA 3NS9A 5CLPA 3EYHA 2ETRA 3R8ZA 4C0TA 4EHEA 4DFLA 3I0QA 3VUKA 4WO5A 1KUTA 4RWIA 2J0KA 4G2FA 5FLFA 4BCJA 4BRXA 2ONLA 4CFNA 2CSNA 4X6RA 1MRVA 3E93A 3CR0A 4NFNA 5LOHA 3FZTA 2BKZA 3CE3A 1FMKA 3W2CA 2WTJA 5FWKK 4AFEA 5M55A 3PTGA 2PMLX 5FDPA 4FV3A 3E8CA 3V5JA 2YM5A 4FSMA 1Q62A 4L53A 2ITVA 2R7BA 2WMWA 3EQFA 3B8RA 4KINA 1YXTA 3VJOA 3HV3A 5J87A 5BUIA 5IQHA 4DEGA 2JITA 4TNDA 4YC8A 3AGLA 4YUQA 4I22A 3DNEA 5HCXA 5JMSA 1RW8A 2R7IA 4OW8A 4CKRA 4JG7A 4JR3A 5DEYA 4U5JA 4C4JA 3CY3A 2XKDA 1B39A 3BEGA 4L52A 4PV0A 3POZA 4EC8A 3LM0A 4J52A 5LMKA 4LRMA 1TQPA 3PPJA 5HESA 1PXKA 3AC1A 5E1SA 1YWVA 4E4LA 5HG9A 4S33A 4AUAA 1IA8A 2J50A 4IBMA 4IE9A 2CGXA 3QHWA 5K0XA 1QCFA 4EKLA 5B2LA 5HGIA 1JAMA 3A7HA 5FUTA 4MH7A 3TNQB 4E4NA 5LMKC 4BDEA 4D2PA 4FT7A 2R3OA 4IEBA 1XBCA 3AT3A 5H9BA 3R9NA 4AACA 3Q9ZA 4PL3A 4CFVA 3FV8A 4F0GA 3BEAA 1OPKA 4OTQA 4XG6A 3N4TA 4ZZMA 3QBNA 1TQIA 4I3ZA 4QP6A 4ASZA 3PPZA 4NL0A 3LHJA 4W4VA 3QQJA 5ANOA 3AC3A 4GT3A 4PMMA 1OIYA 3ACKA 3ETAA 4O0TA 3CKXA 4CCUA 2XNGA 1UWJA 3DV3A 3FY0A 3QF9A 5B0XA 4EH3A 2J4ZA 2IVSA 4NM5A 2B4SB 5E8SA 4XOZA 2V62A 3MS9A 4NK9A 4A4LA 3UNZA 4AZSA 4BGHA 5CAQA 4QD6A 4ACGA 3ZFYA 3O8PA 2QG7A 4E4XA 4FG7A 4F9CA 5I9WA 3ZM9A 2XIZA 5AUWA 3RTPA 4CMOA 3FSFA 3OW4A 3HRCA 4QMNA 2PUUA 2CNQA 4XLIA 4DEBA 4MF0A 4YZDA 3DBCA 3QZFA 1JLUE 4QQ5A 3R1QA 4B9DA 2VZ6A 3GB2A 3Q9YA 2HWOA 2W1HA 4HZSA 2WTVA 2XVDA 2QLUA 3GNIB 1ZMUA 4F9YA 4CLJA 1H4LA 1O6LA 1MUOA 3OXTA 5KUPA 1GAGA 2NNWB 3KMWA 1XH5A 2G2FA 3JY0A 4MWHA 4QYYA 3I4BA 4ZP5A 5KE0A 3PVWA 3R7VA 4DFZE 1E9HA 1XQZA 3F5UA 4XG7A 5IA5A 5EI8A 4AN3A 2OZAB 5EOBA 1PF8A 1PRYA 3RAHA 4ZK5A 4ITIA 2JDRA 2RIOA 3C4ZA 3KF4A 5EW9A 3D9VA 3QXPA 3I7BA 5G1XA 3VRZA 4DCAA 2XIYA 5E8VA 3D2IA 4EORA 5M57A 5FM3A 2XEZA 5JFSA 3R9DA 1Q8TA 4YZMA 4H3PA 5IA3A 3RPSA 5HD4A 5LWNA 3MIAA 3ZUTA 4KS8A 3O7LB 3NCGA 4PY1A 4RWJA 1PYXA 4YZ9A 2EXMA 3BPRA 5AAEA 4L42A 3KCFA 1KE5A 4OR5A 4BB4A 4ERKA 5DIAA 1SYKA 4B99A 5EHLA 4QMQA 3FDNA 4IJ9A 5A54A 2UZNA 3LMGA 3E87A 4RJ8A 3LFCA 4Z7HA 5HIBA 3LXNA 3R7UA 4D2TA 4JOAA 2BDJA 4ZY6A 1CDKA 2GNHA 3GI3A 1IRKA 3UZRA 2B9FA 3MPMA 2JKKA 3NX8A 3VHEA 5A9UA 4FSNA 3ZLWA 4RX8A 2UVZA 5LVLA 3T9IA 4J99A 4L6QA 3FXWA 4CZUA 4PNIA 4RIWA 1L3RE 3HRFA 4V0GA 5HNBA 5CF8A 4AG8A 4ZAUA 1J3HA 3QTXA 3U51A 4DYMA 4UWBA 2PVNA 2WMAA 5EHYA 4C8BA 2CKPA 4GVAA 3ZM4A 1M7NA 5BQ0A 4O83A 2C6KA 3BGPA 3VQHA 4FE2A 3V3VA 4C3RA 4QMWA 4S30A 4AW5A 2R3FA 5CSXA 5CALA 5TT7A 5EHOA 2E9UA 4GJ2A 5ACBC 4CXAA 5IEVA 3BYVA 2J90A 4TYIA 4BI1A 4EH6A 4N57A 2CGWA 4MXYA 3KEXA 4I0SA 3KCKA 4JDIA 2PE2A 2C6TA 2X39A 2UW4A 3O2MA 3AT2A 4PTEA 4GG7A 4BCOA 1WVWA 4H05A 3R7EA 3RNYA 5CANA 5EYKA 4J95A 3RWPA 4N0SA 4ZXTA 1JKSA 1Q3WA 4L9IA 2W1ZA 3ODZX 4I1ZA 4RA4A
chains in the Genus database with same CATH superfamily
1Q8ZA 4XOYA 3JVRA 2O5KA 1PXPA 3QZIA 5FD2A 2EVAA 1XKKA 4R5YA 3CGOA 4XUFA 1XR1A 3ZRMA 4IVCA 1XH9A 2WQOA 5CU0A 3JYAA 4O4EA 2OK1A 3GCUA 1YI4A 3QYZA 3OS3A 3IW8A 3E88A 4EQUA 1XMLA 1MRYA 3PWYA 3R8MA 4AXEA 2EB3A 3MFRA 2QOLA 4KRDA 3VBVA 4DH7A 4X3FA 3FMLA 5HBJA 1Q61A 3CQEA 2E9NA 3ZONA 5AEPA 3B2TA 1I44A 1ZZ2A 2WIPA 3HP5A 3LVPA 4UMQA 2PVKA 3RWQA 3V5WA 4MBJA 1ATPE 3CBLA 4U97A 3OXZA 4NH1A 2PHKA 4DDGA 4X3FC 2VTQA 4ZS0A 5I4NA 4YPSA 2A0CX 4C35A 2UVYA 2YAKA 2IVVA 3BHUA 2YIRA 4X2NA 2BZIB 3W32A 4ANOA 5DG5A 5M4CA 3AMAA 4F09A 3R02A 3I60A 5FDXA 3SW4A 3U6HA 3MVMA 3ZSIA 3R71A 2C6IA 4O4FA 4F7LA 2ITYA 2V22A 3C50A 4DTAA 3A4PA 4DBXA 3REPA 3LAUA 2Y4IB 1G3NA 3A4OX 3PSCA 2ZVAA 3OP5A 3GUBA 4BCFA 4BJJA 3G2FA 2F7EE 3LXKA 4AXFA 4QDVA 3NVKI 5F94A 4AXAA 4OT5A 5DVRA 4FRFA 5FTQA 3OD6X 4NT4A 4EJ7A 3FHRA 3FJQE 5DN3A 3DBFA 3W16A 3WIKA 5CASA 3CD3A 3Q04A 4FKUA 1KE7A 4O2ZA 4CYIA 3M42A 4C37A 2CLXA 3PWDA 3ALOA 3BZ3A 5F4NA 3SOCA 3R1SA 5CU3A 4AE9A 1XBAA 3PZHA 3CTJA 5C8KA 5F9EA 3C13A 5C8MA 3VVHA 4E5BA 3EIDA 4IJPA 4EC9A 5J7HA 1OVEA 2J7TA 4ASXA 3QTZA 2J6MA 2GNGA 4P5ZA 5DGZA 3W33A 4U42A 5EI2A 4AW1A 5BVFA 1U5RA 1H08A 1UV5A 4AA5A 3FLSA 4BDJA 5BV3A 4Y83A 3PLAE 2OW3A 4F99A 5L8KA 4WKQA 3NW5A 4XMOA 4BICA 2VTAA 5AA9A 1OECA 2QO9A 2HENA 3PIXA 4I5HA 2WTKB 4OTWA 3GGFA 4KKGA 3KRRA 4D58A 4FZ6A 3V8TA 2VO7A 2XJ1A 3GU4A 2IZUA 4ZY4A 3BYMA 2YM8A 2QHMA 4KKHA 4GMYA 3U55A 1JKTA 4EOIA 1T45A 1ZARA 4EYJA 2FA2A 5C26A 2A2AA 3D15A 5AR7A 3R7IA 3N4VA 2Z02A 3ZS5A 1J7LA 3AC5A 2GNFA 4GIHA 5FXQA 1TFFA 2GMXA 3RBWA 4GS6A 3MJ1A 2X0OA 1KV1A 1YRPA 3Q53A 2GNIA 5A4CA 5HQ0A 3QTUA 2VTJA 3RCJA 2QONA 4RVTA 1W2CA 5L6PA 3ZXZA 3PVBA 3A8XA 4QQCA 2O64A 4EZ3A 2CKOA 5DE2A 4AN2A 2JFLA 4XG2A 4JAIA 4F9WA 5KMJA 4CCBA 3SRVA 3QUPA 5D41A 4DT8A 2ITQA 3R9HA 5CEKA 2XIRA 4PRJA 4ARKA 3VN9A 3NYVA 4GK3A 2OJJA 5EDRA 5EM6A 5C9CA 3RM6A 1PYEA 3SLSA 2Z8CA 3UC4A 2E9PA 4BIEA 2X4ZA 2YIWA 5CVGA 3R01A 1SMHA 4XS2A 3PFQA 2UW7A 5LVNA 4PP7A 4ANBA 1MRUA 1GNGA 4BKYA 2XARA 2RKUA 4QP2A 2JIUA 3TIYA 2WEIA 3OCSA 2ZOQA 2XIXA 1CTPE 4E6AA 3QZHA 3G15A 1OI9A 2OJIA 4JG8A 3UIMA 5CXHA 4CTBA 3DLZA 3ORZA 4GL9A 3DLSA 2Y6OA 4FSRA 4BIBA 2WELA 2XYUA 4EK4A 5LCJA 2C3LA 5ETCA 4KS7A 2ZB1A 4IMYA 4G5PA 2P3GX 1H00A 1YVJA 4E6CA 3L1SA 3KREA 4IX4A 4K6ZA 1XBBA 5HE0A 3CCNA 1ZYSA 3PVGA 3ZU7A 1XH6A 4PMPA 4XYFA 3C4EA 4O91A 3FY2A 1ZOGA 2X0GA 4C36A 4JI9A 3HDNA 3I81A 4FIJA 1CMKE 2PWLA 2XH5A 4ITJA 1R3CA 3G33A 4CYJA 4YR8A 5I5ZA 2H8HA 3NAXA 3P4KA 4FKWA 3I1AA 2OFUA 4H58A 4HJOA 1DS5A 4K2RA 3HAMA 3K3JA 4DGNA 5GZ9A 2OI4X 4EK5A 3V5PA 1Y57A 4JMQA 2XAOA 5KHWA 4IC7A 4USFA 2I7QA 3W0SA 3UNKA 1ZMVA 2V0DA 4FTTA 4O4DA 3OUNB 4DCEA 4UX9A 4O81A 4V01A 3ZFMA 2XEYA 4RWKA 5J5SA 5KCVA 4O1OA 4L8MA 5GIOE 3WBLA 4F6SA 1OKVA 5DH3A 2EXEA 4II5A 4FF8A 5L6WL 2HCKA 4DGMA 4GUBA 2VTMA 4MNEA 5AP5A 4QNAA 1YXSA 4IB5A 3DBDA 3P5KA 4XG3A 3QCSA 5JFXA 4TYJA 3FI8A 3PJ2A 4ALUA 4O0UA 4JIAA 4R6VA 4YPDA 1XHAA 5AFVA 3OT8A 4FT9A 1ZOHA 3NZ0A 2F57A 2UZBA 2YDKA 3OBJA 5AV1A 4Z3VA 1H01A 4FTMA 4Q2AA 3E8NA 3KB7A 3F5PA 2GS7A 3PG3A 4HCUA 3UE4A 3HX4A 4OTPA 4UXLA 4FUYA 1RQQA 2UW0A 1H07A 3DBEA 3MFUA 4V05A 1PY5A 2YJSA 4PL4A 4YBJA 5ANGA 3N4UA 1YWRA 4K77A 5FBOA 5HTIA 5E9EA 3UOKA 3Q60A 2FSOX 2JBPA 4N4SA 5T6KA 4QMXA 2JGZA 3VBQA 3CIKA 4MXCA 3TNIA 3CJFA 1M14A 4I23A 4DGLC 3MIYA 3WZJA 2IN6A 5CQWA 1IASA 3UVRA 3BX5A 3MPTA 3F9NA 2PUPA 3BE2A 3GCVA 3HLLA 1Q3DA 3BHHA 3F2AA 3QCQA 3PE2A 4YLKA 3UBDA 1W98A 3NYNA 4I6HA 4O7TA 2SRCA 3UZTA 2J5EA 3QZGA 4EUUA 2BMCA 4R77A 4O96A 2O2UA 2ETMA 4WUNA 3UO4A 5A46A 5L2SA 2J0MB 5DT0A 3COMA 3QQHA 3W8QA 4FIHA 4ASEA 1KE6A 3SHEA 4JQEA 4EWHA 3FMJA 3MSSA 2YCSA 5AX3A 2YDIA 4YJUA 4E8AA 3LKMA 4W4XA 4AOJA 2R2PA 4O0RA 4RC3A 3IECA 5ITAA 1OPJA 3BU5A 4RMZA 3ZDIA 5M51A 4FKLA 4JJRA 5HNGA 3UOLA 2VWUA 5C03A 2VX3A 3SG8A 2ZM1A 3Q4TA 2Z7RA 4I0RA 3H9RA 2XM9A 4X2JA 3D5UA 2ZYBA 3E92A 4FV7A 4E5WA 4XBRA 3OOMA 4XBUA 3VS6A 3LFEA 3W2SA 3LCKA 3UZPA 1UVRA 5E8XA 1JVPP 3FPQA 3WZDA 4EHZA 5M53A 3HMMA 4FJVA 3PRIA 2Y0AA 3IOPA 4MF1A 4ZTHA 3C0IA 2JEDA 3O5AA 5H2UA 2W96B 4K33A 3BGQA 1ZWSA 5IQFA 1IR3A 4ZSJA 2ZAZA 1SVGA 4KUJA 3JPVA 3HUBA 4O22A 2O65A 4IQ6A 4M3QA 4WNKA 2Y4PA 4WNPA 5I0BA 4YJSA 3RALA 1UNLA 3NEWA 2UZLA 3L9NA 4GH2A 4QPMA 4QYHA 4U41A 3WYXA 4BYIA 1WBTA 4USEA 5IISA 4O21A 4PUZA 5CY3A 3MY5A 2HYYA 2UZDA 2VO3A 4WBBB 4HGEA 5HHWA 4HW7A 4XNEA 3VRYA 4OAVB 4YO4A 2W1CA 5G6VA 4E93A 5IEYA 1YDSE 3BHYA 5EW8A 3W0MA 5D7AA 2Y9QA 3QTIA 4FZFB 4KD1A 3VJNA 3E3PA 5AUYA 1AD5A 4ANMA 4LOOA 3TKIA 3F3WA 4ZSGA 4C3FA 4TYHA 4EZ7A 4HCVA 3QLGA 2R64A 2ZMDA 4M69A 5KNJA 1U46A 4TW9A 5KZIA 4QMMA 3Q4CA 4H3BA 5J1WA 4B6LA 3CGFA 4HZRA 3ML1A 3LIJA 2WQNA 4ZZOA 4GKIA 2FB8A 2PPQA 4J8MA 1REJA 1YI3A 2YERA 3H30A 2X6EA 3OTUA 4FTOA 4U43A 3K5UA 5M56A 4K18A 2PVLA 3OEZA 4FMQA 2QHNA 5GJGA 3ROYA 4CKJA 2J2IB 2PUNA 5CAOA 4BI0A 4QP8A 2HZNA 4BWXA 5AAFA 4D2VA 2BRNA 2OIQA 2GCDA 3D7ZA 4BDIA 1OBDA 2QNJA 3QYWA 2VWYA 1BI8A 2W1DA 3QWJA 5DLSA 3LFQA 3UOJA 2QODA 4L67A 4O7NA 3S4QA 4NW6A 1UKHA 2IZRA 1GZOA 4DA5A 3O8TA 3PJ1A 3Q2MA 3CSVA 2QD9A 2W5AA 4BHNA 4TWPA 4QMLA 2B55A 1YWNA 2GFSA 4DHIB 1H1WA 3AD5A 4R7BA 3DK3A 4B0GA 2CPKE 4YC6A 1Z5MA 4TWOA 1VJYA 2J5FA 3UGCA 3V5TA 3UDZA 2RG5A 2JC6A 5CTPA 2HZIA 3EN4A 4AQKA 4XH6A 4L43A 4PTGA 2GDOA 2ERKA 5IDNA 5ICPA 4M7IA 4IZ7A 4X21A 4JRNA 4ZSAA 3E62A 3W0PA 1H28A 4L3PA 5AP7A 4O86A 3DDPA 5BVKA 4CTCA 3O8UA 2XNBA 4Z7GA 4FSWA 4FSYA 4QP9A 3AC8A 1P14A 5AM6A 2QR8A 5CI6A 4D9UA 4GVJA 4DH1A 3AQVA 4KIKA 4NM3A 3S2PA 3LZBA 3FEGA 2KULA 2G01A 3R8PA 4QTCA 2R3HA 2W05A 4FNXA 4AT4A 4QOXA 3FLZA 5HG8A 2R3MA 2RG6A 5ANIA 2XB7A 1Q8WA 4FKIA 4QMSA 4AZWA 4I5PA 2UW6A 4ZLZA 3FYKX 3HKOA 5JGAA 2BIKB 3KK8A 5JZNA 3W10A 5M4FA 1OPLA 4W8DA 1K3AA 2IZSA 5EM5A 3NYOA 4D1XA 4RGJA 2X8EA 2JIVA 5FG8A 2OXXA 3GT8A 1BUHA 5GNKA 4QTEA 4ZMEA 3DDQA 4C4HA 3P5JC 1OUKA 2W4JA 4PPCA 3WARA 4MBLA 5AR5A 1YQJA 3FMKA 4MKCA 2RL5A 2H6DA 4HGLA 5TE0A 4BDBA 4E7WA 2IF8A 3DPKA 3MW1A 3K2LA 5FP5A 1U54B 5JEBA 3EFLA 5HVKA 4IDTA 5AJQA 4BC6A 4LV8A 2AC5A 4BBMA 2ZV2A 3PXQA 2ETKA 3HDMA 3R63A 4U0IA 5AR8A 5T68A 3PUPA 4IDVA 4O7ZA 4O4BB 4FV9A 4JS8A 4GEOA 2BR1A 3LE6A 4BWPA 2GS2A 2YA9A 2E9OA 4JDJA 2ZDUA 4K0YA 4BWKA 1WMKA 2A98A 2J9MA 2I0YA 3NIEA 1VYWA 4FGBA 3FQHA 4G3FA 2W5BA 5E4HA 2AUHA 3BV2A 2PYWA 1XMMA 3ZO3A 4W9WA 3DBQA 4OLIA 3CTHA 3RZFA 2BZKB 4BDAA 3R83A 4HVHA 4CG9A 1X8BA 3ITZA 3R7YA 3KULB 3O0GA 4BR3A 3VUIA 4NJDA 4P5QA 4XEYA 3TV6A 4NM7A 2EXCX 5AUXA 3UYTA 3ZC5A 2BRHA 2QVSE 3E64A 2WXVA 3UC3A 4WRSA 4U81A 5A4EA 4HPUE 2XCHA 1SM2A 3ORNA 4L01A 3HMNA 4KIQA 4BCPA 3UVPA 4QNYA 3UDBA 5LVPA 2XCKA 3H9OA 3PVUA 4EOQA 3MJ2A 3QU0A 4KKEA 3E7OA 3AXWA 4LUEA 3FMMA 3FMHA 4U3ZA 4IFGA 3F5GA 3RAIA 5EQPA 3GC0A 5EKNA 1R39A 5DR6A 3TYKA 2VUWA 3IONA 3TN8A 2B9HA 2WGJA 3QKLA 4QP3A 3ACJA 2WMQA 4N6YA 4FR4A 1RE8A 4G3EA 4KB8A 4XX9A 2WO6A 4C61A 5I9XA 1SNUA 3DZQA 1SVHA 2WFYA 3KN6A 4IAIA 4BTMA 4IAAA 2GNJA 2WTIA 4QMVA 5BYYA 4FV1A 4D4VA 5DYJA 4GJ3A 3Q32A 3QQFA 2PVHA 1PMEA 3C4XA 2Q0NA 3I6UA 2ZB0A 3TZMA 4OT6A 3AT4A 5FTGA 2JLDA 2CJMA 4Y72A 2XK9A 3VS5A 4EJNA 2OF2A 4ZS4A 3ET7A 4MK0A 4TXCA 4G6OA 3ZSGA 5DRDA 3ZSHA 2VRXA 2YCQA 3NWWA 1V1KA 4H36A 4KSPA 2F9GA 2PZ5A 4NCTA 5CEIA 3KXNA 3OWJA 3L8PA 3R73A 4BCKA 1NT2A 4IFCA 5GINE 2P2IA 4I4EA 2WMSA 3P7BA 4IAFA 4MEDA 4QTDA 1WFCA 2QOIA 4X7QA 4DG0E 4F7NA 2QOQA 2YLFA 3LXLA 4TTHB 5JGDA 4AAAA 4NCTC 4RIXB 4FZDB 2UZEA 4BN1A 1ZLTA 4D9TA 3D5VA 4U45A 4RQVA 3BHVA 1P5EA 3OROA 4OTDA 3OMVA 3QC9A 4QO9A 4RG0A 4A4XA 5AV4A 3SA0A 2IPXA 4YJTA 2X1NA 4CRSA 4O7YA 4A9UA 1MQ4A 3ENMA 2X6DA 3UG1A 3QCYA 3QD0A 5JT2A 4GKHA 2NP8A 3EQHA 3PSDA 3QUDA 3RCDA 4F6UA 4RLKA 1FPUA 4A9RA 5DMZA 3POOA 4RVMA 3O17A 3RKBA 4RVLA 3RINA 3OT3A 3JY9A 4LOPA 3RPVA 2W4KA 4DFXE 4L7SA 5HX8A 4YO6A 2QO7A 1FGKA 3EH9A 3V04A 2J51A 5EDQA 5IA4A 4YU2A 2C4GA 2QOCA 3KKVA 4U3YA 3DJ6A 5E8YA 2A19B 4QMOA 4TY1A 2X7FA 4EK8A 1YOLA 2BZJA 4DGGA 3FZPA 3GCQA 4C2VA 2VWXA 2C1BA 2PZPA 3QQKA 1URWA 2IVUA 3TNPC 5J5TA 2B52A 4DHFA 5HO7A 2H9VA 3PY3A 2A1AB 5A4QA 3BRBA 3NAYA 2F2UA 5I3OA 4ASDA 4BBEA 3G5DA 4G9RA 4RIYB 3GFWA 4MHAA 5H8EA 5HNIX 5HKMA 4NM0A 4CMUA 2PVJA 2IO6A 5FEDA 5BVWA 4LV5A 4G31A 4YHTA 4A07A 3QTRA 2PMNX 4A9YA 2GSFA 2OIBA 5HG5A 5B2KA 3PZEA 3UMWA 3MY0A 3UODA 2C3JA 1CKJA 2EWAA 4S2ZA 3MWUA 2C0OA 3CJGA 3VULA 3LLTA 4XV9A 2C30A 2FSMX 2RF9A 2XKCA 3W2RA 2BTRA 4O27B 3DKGA 4HNFA 4AGCA 4ANSA 4FK3A 4ERWA 3HV7A 2YJRA 1T46A 3VIDA 1TVOA 4FEXA 3SAYA 4BCIA 1PXMA 2W17A 3F69A 4Q9SA 3VAPA 4LI5A 4NTSA 5CEQA 4QTBA 3UQGA 5BUEA 1H0VA 1F0QA 1B38A 2V7OA 2ZMCA 3BU6A 4H1MA 3TL8A 4BY9E 5AP0A 4JDHA 3G6GA 3D7TB 2PVFA 4L44A 4CV8A 4ZTLA 4N70A 1I09A 4XP2A 5DOSA 3A7FA 5KMMA 1BMKA 3PA4A 2YWPA 3ORIA 3L8SA 4F0IA 2C5YA 2V5QA 4RJ5A 4CT2A 2X9EA 4E4MA 3MN3A 4ZTQA 5LCKA 4F9AA 3NRMA 5A3XA 3VUHA 4BVUA 4M68A 2BDWA 3AMBA 3OCBA 4GSBA 2Q83A 4FTIA 4QTAA 3UIBA 3HA8A 3R30A 4QQTA 3LQ5A 4NWMA 4DFYA 1ZMWA 2UW5A 3TIZA 4Q9ZA 1FVRA 4IWQA 3BYUA 3ZEWA 3KK9A 1E1VA 1PXIA 3E8EA 3KXMA 4AGDA 1UKIA 4XG8A 1KSWA 1NW1A 4RRVA 1Q24A 3HV6A 5D10A 3RP9A 5IQBA 4YNOA 4WSQA 3P0MA 1BKXA 2OIDA 5EYMA 2XRUA 3FKOA 3RK7A 3TZ8A 3IKAA 5KBRA 3O50A 1ZY4A 3QQLA 4FT3A 4M15A 3D2KA 5F20A 2O63A 3DTWA 3QCXA 2IZTA 3FE3A 4FKGA 4RWLA 3EQCA 4FC0A 1OL5A 3BYSA 5EDPA 3EN5A 3EQDA 2QOFA 4LRJA 4QMPA 4Y5HA 4M13A 5ANJA 2FO0A 4MXOA 4CD0A 1BX6A 3FMDA 4EOLA 4YGAA 4BCHA 5ETFA 3UPZA 2HW6A 4FTKA 4YNEA 2WTWA 3UOHA 1VYZA 4U44A 2I6LA 2R3KA 2YISA 3DS6A 3ERKA 5TF9A 3DB8A 5JN2A 1OITA 3IDBA 3OG7A 3C9WA 3VQUA 4ANNA 2HW7A 3F82A 2QURA 5DT3A 3VW6A 4HVIA 5IUGA 2JDTA 4YJVA 3IO7A 3KXHA 3P79A 4G1WA 1EH4A 4FL3A 4EH7A 3OXIA 3EZVA 4FX3A 3ZDUA 4FEQA 4ZSLA 3ZZWA 1P4FA 3QLFA 1G5SA 4FTNA 3AD4A 1QMZA 4TKSA 4D5HA 5BUJA 1G8KA 5AUVA 3KC3A 3C4WA 2GNLA 2IW6A 4QRCA 3DAJA 3I5NA 3L9PA 4YTFA 5KMKA 2VWWA 4JBPA 3NFGB 4L00A 4UXQA 2C0TA 3HUCA 2P33A 5KKRC 3QD4A 3KXXA 3CTQA 4CZTA 3QTSA 4JR7A 5CF6A 3C51A 3OCGA 4OTRA 5CSPA 5FXRA 4MD7E 2YIQA 5HZNA 4BGGA 4FGRA 4BKJA 3HYHA 3RGFA 2WHBA 3U6JA 1JNKA 2YABA 1Q41A 2YM7A 4PTCA 1PMUA 2WMXA 4E5AX 3V6RA 1Y6BA 3ZOSA 5J1VA 1WZYA 3LJ0A 4O6EA 2OGVA 3UO5A 3EQIA 3TNHA 3EMGA 3PUFC 2QG5A 4FV4A 1HOWA 3FXXA 4I24A 3A7IA 3FZ1A 3AC2A 5K5NA 1UNHA 1M2QA 4JG6A 3TZ7A 3PIZA 4FTCA 4IZAA 4UMRA 3NUXA 5I3RA 4OTFA 4FTLA 4BDHA 3BL9A 3P7AA 4I20A 3K5VA 3MFSA 4M66A 4A9TA 1FGIA 5B7VA 1SNXA 4Z9LA 2G1TA 5IQIA 5AADA 1QPDA 3TEIA 4ZTMA 5CU2A 2XK4A 5CU4A 4O0SA 4CKIA 1R0EA 3UP2A 1H0WA 1ZYJA 4XHKB 4DEIA 3CQUA 1GJOA 5AWMA 3MVLA 2VGPA 5IH6A 4I93A 5EKOA 3EFWA 3TV7A 2I1MA 3I0OA 4FG9A 4ALWA 4BDFA 4RC2A 1W82A 4TYEA 3TZ9A 3BLQA 5BMSA 1XH4A 3A61A 4A9SA 4GT5A 1PJKA 3F5XA 2VTLA 3Q5ZA 4OBQA 4MUQA 2FSLX 4D5KA 3NUNA 3D14A 4YZNA 3N51A 3TV4A 3S1HA 4DFUA 1JKKA 1LEZA 4LGHA 2ERZE 2VWVA 5C01A 3LFDA 1CM8A 1V0BA 4RJ4A 4QT1A 2VN9A 1R78A 2OJGA 4UZHA 2Z7SA 4CT1A 4R7IA 4RT7A 3MESA 4EH2A 5E8WA 3N9XA 2E2BA 3B2WA 3H3CA 3WF7A 2QCSA 3S95A 3KRJA 3EN6A 4EUTA 3BI6A 1Y6AA 2W06A 2OXDA 2BAQA 5HE3A 3QD3A 3RHKA 5I9YA 4TL0A 3DY7A 2OO8X 4MCVA 4BCMA 1G8SA 2VTIA 4S34A 2XM8A 2ZV7A 4I41A 4BHZA 4PX6A 1XWSA 3G0EA 3OUKA 4C33A 2LAVA 2R0IA 2X4FA 4XLVA 5B2MA 2UZVA 2PZIA 2XF0A 4F7JA 5KMLA 4RJ3A 2HIWA 2X81A 3DQXA 3JS2A 2AQXA 2XYNA 3OFMA 4FODA 2VTSA 3LFAA 4R1YA 4C3PA 3A99A 3OOGA 2YEXA 3NW7A 3FAAA 3GCPA 3GOPA 3QQUA 2ITXA 4FSTA 3NIZA 5EFQA 5DEWA 3PXYA 4HGTA 4AZTA 2Y8OA 4NIFB 2PU8A 4IH8A 3K54A 4JAJA 1H1PA 1YI6A 2R3RA 2ZV9A 2QI8A 5IQAA 5IG1A 4JL9A 5K4IA 4WRGA 4UWYA 3C1XA 4WHZA 1UNGA 1U4DA 5HVYA 3FLQA 3ULIA 2ZV8A 4FUXA 3EFKA 4U7ZA 5BPYA 2PMOX 4DT9A 3FLWA 2OJ9A 2VX1A 2OZAA 3OC1A 5FM2A 4BGQA 4AT5A 4LDTA 4EH9A 4IB0A 1BYGA 4ENXA 4TN6A 4F6WA 3EJ1A 4P2KA 3G9LX 4O38A 3BQCA 3L8VA 3W2QA 4A4OA 3ID6C 3D5WA 3DU8A 3ODYX 4LGGA 3ZO1A 4QYFA 1KE8A 4P7EA 4LRKA 4XG4A 4FV6A 4FZ7A 5CNNA 4E6DA 4J8NA 4GT4A 3SOAA 3EB0A 1Y8GA 4JRVA 2UW3A 3AKLA 3DKOA 4AA4A 3HL7A 3ORMA 5K9IA 2XK3A 3QXOA 3DFCB 1H1SA 1H26A 5DR9A 4XRLA 4FTQA 4DE4A 2OWBA 4EKKA 4UWCA 4YHJA 2PL0A 2VTTA 2YITA 2QU6A 4RJ6A 4O82A 2OH0E 1WCCA 4I6QA 4IANA 5J8IA 4C4IA 3ATTA 1P2AA 3PXRA 4DTBA 3JXWA 3PXZA 4U9AA 1PXOA 4YTHA 1YDRE 2UZWE 4LUDA 3S3IA 3VS3A 3NUAA 5AIKA 1PXLA 4PPAA 5BYLA 3FI4A 3W18A 4KIPA 3ZLXA 1CKPA 2DUVA 1H24A 3GU7A 4RFMA 3VHKA 1O6YA 3ZO2A 2UZOA 4E1ZA 2R9SA 4APCA 4FTAA 4W4WA 2CNUA 4R78A 2JAVA 3V01A 3RAWA 4EOPA 3TDVA 3TI1A 2P55A 3U4UA 3H0ZA 4D0XA 4I92A 3R28A 4FIFA 4RIYA 1Q97A 3C4CA 2CHLA 3KXGA 5JQ8A 3Q2JA 4ID7A 3Q9WA 4BDCA 3EL7A 3ZRLA 4BKZA 4EK3A 4FVRA 5AR2A 2UV2A 4IAZA 4Q5HA 1NVSA 3VC4A 3GU8A 4B8MA 4OTGA 2UZTA 1J7UA 4ORKA 4UEUA 1ZYDA 4FKVA 4IZ5A 4NEUA 3V5QA 4GYGA 4IB3A 1SZMA 4J97A 1FINA 2C6OA 4JXFA 2EB2A 3FC2A 1G8JA 1W84A 1URCA 2W7XA 3LXPA 3P9JA 3VF8A 1QL6A 5IZFA 4FA2A 4FOCA 3AD6A 3BWJA 5HE1A 1ZYLA 1M52A 5T3QA 1U59A 2VTPA 3TM0A 1LPUA 2AYPA 3KMMA 1IG1A 4AW0A 3QD2B 1TQMA 2XKEA 5AUTA 3II5A 1J91A 2B54A 3QX2A 3UDSA 4E6QA 4DN5A 5M07A 4NU1A 2QOBA 2XKFA 4G16A 2F2CB 2QO2A 3FC1X 3NNWA 2J0IA 5DHJA 3HMOA 2CCHA 3OEFX 5TOZA 4TT7A 2VAGA 3MV5A 4O7SA 3BIZA 5GHVA 3MA3A 2PK9A 1WBWA 4DEAA 5IQGA 5CAPA 5EH0A 5EM8A 4UYAA 3FKNA 5L2TA 3C5UA 4DINA 4YZCA 1H27A 1W83A 3QTWA 1KV2A 4XV3A 2W1FA 3MTFA 4Q5EA 5BYZA 5HE2A 3RK5A 4LMNA 4RSSA 3NGAA 4C34A 2JDVA 3QRTA 4QYEA 4TWCA 3JR1A 1DI8A 2CN8A 2WMBA 4FSZA 3ZLYA 3QGYA 4MD9E 3P08A 2BDFA 3ORKA 4FT5A 4X6QC 3E63A 1YW2A 4EH4A 3E5AA 3KF7A 5EYCA 1LR4A 2GTNA 4PF4A 3R1NA 2X8IA 4FTRA 4MAOA 3WE4A 2WOTA 4ACHA 1ZRZA 1OKZA 4DG2E 2G2HA 4FKSA 5IA2A 5TKDA 3EZRA 4X2GA 2R3IA 3IQ7A 3ZRKA 3PJ3A 2BILB 4ITHA 5H8GA 4CNHA 4DITA 3W1FA 2VX0A 2WMTA 3NUYA 4WNOA 4CRLA 3NNVA 4DFNA 3DZOA 3VBWA 4XP3A 1NA7A 3ZEPA 4R5SA 3HA6A 3RNIA 4LL5A 5JRSA 2F7XE 5A14A 3DK6A 4CFXA 3PY0A 1DM2A 4BCQA 1ZOEA 4EI4A 2BRGA 4QQJA 5FQDC 5K4JA 2FGIA 2O3PA 1W7HA 3MH2A 2BRBA 4J96A 2JDSA 3ORPA 3RI1A 2PMIA 1P4OA 1PXNA 4ZIMA 4AZEA 3RPRA 1Z9XA 3M2WA 4N6ZA 4RX7A 1APME 2HOGA 2YZAA 3IW5A 3LFNA 4JQ7A 4BDKA 4RIWB 2HK5A 2R3JA 4R7HA 5I9ZA 2BZHB 4V0GB 2W9FB 5C8NA 5JZJA 1OBGA 5BNJA 2I0HA 3CP9A 3FYJX 3F61A 2DWBA 5D11A 4IX3A 3VS1A 4AT3A 4FV5A 3VWAA