2XYNA

Human abl2 in complex with aurora kinase inhibitor vx-680
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
266
structure length
264
Chain Sequence
KWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TYROSINE-PROTEIN KINASE ABL2
publication title Crystal Structures of Abl-Related Gene (Abl2) in Complex with Imatinib, Tozasertib (Vx-680), and a Type I Inhibitor of the Triazole Carbothioamide Class.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 264
sequence length 266
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xynA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xynA01
1ZLTA 4E1ZA 5BUEA 4UX9A 4WBOA 3U51A 1H08A 2GNGA 2QOKA 3FI2A 3NUUA 2QKWB 3PP0A 5LJJA 3S1HA 2XB7A 4AWIA 4D4VA 2WQOA 4JG8A 4V0GB 2ESMA 3QWKA 2F9GA 1FBNA 3P7BA 3HUBA 3KN5A 3KF7A 1J91A 4JR7A 5HE3A 5KZIA 2QOHA 2WZJA 4RFMA 4UYAA 4ZLZA 4S30A 1G3NA 3Q9XA 1SNUA 4CKRA 1YXUA 4RX9A 3FLZA 3TV6A 1YOLA 3ZO4A 2P0CA 2PVRA 3R71A 4GRBA 5EKNA 5HLNA 4FT5A 1ZY4A 4BDEA 3I0QA 4Q5HA 2J9MA 3UOHA 5IH5A 4FEVA 3MWUA 3DFAA 4IEBA 4ZTRA 3ALOA 2WB8A 4U7ZA 5HG9A 4GW8A 3IW6A 5HEZA 2IZRA 3V51A 2CLQA 3F61A 2VWIA 1PXKA 1QL6A 3MVMA 2WFYA 3AT4A 3GBZA 4D0WA 4KRCA 4ASDA 4IAKA 3TM0A 5F9EA 3H30A 5HX6A 4HCVA 3K5UA 4M0YA 4Q9SA 4RJ7A 4E5WA 3AMAA 1IA9A 2BR1A 4PPCA 3UNKA 5HD7A 3P9JA 4TNDA 3UG2A 3ZO3A 4TWCA 1R3CA 4AA5A 4PMMA 3IKAA 4J71A 2OF2A 3NLBA 3SC1A 1GZNA 3BHUA 3PXQA 3GCSA 1QCFA 4ITHA 3SXRA 3AC5A 1W82A 3TZMA 2VTLA 3IK3A 4BVUA 3SG9A 2RGPA 3TKUA 5IF1A 4P2KA 5HGIA 3A61A 1M7NA 4U3YA 1BI7A 4YLJA 3BEAA 3GT8A 2GFSA 2IVTA 2ZM1A 3QCQA 2REIA 4FKOA 2PL0A 4B7TA 4CTBA 5HG5A 3NNXA 5HHWA 3TV4A 3EN9A 4YJRA 4FKWA 1CMKE 2R3FA 5CY3A 3DV3A 3FHIA 4Y95A 2CN8A 2KULA 2X4FA 4K2RA 3V04A 3W2SA 2GS7A 3EQRA 3UO4A 4GKIA 3HV6A 3QTXA 4AP7A 4CZTA 4AG8A 4DT9A 1W8CA 2UVZA 3EL7A 3IDCA 3QHWA 5AR2A 4JX3A 3QZGA 5AR3A 5KCVA 3R0TA 3QHRA 3O17A 2BKKA 3UO5A 3PRIA 2A0CX 1YKRA 3EZRA 3UNJA 4KIOA 2YABA 1YXTA 4L43A 3DA6A 4FKPA 4O2PA 3TTIA 5C01A 4GS6A 1IA8A 2YZAA 3CP9A 3HMPA 5H8BA 2J6MA 4DFYA 1KE8A 4BZDA 2XJ1A 2CKQA 5C4KA 5DLSA 3R8MA 4F1OA 3OWJA 4HCTA 4FKUA 5IG1A 2XK4A 3R63A 3SGCA 2OH4A 5LMKC 4ZSJA 1TKIA 3FXZA 2X8IA 3PJ1A 3RHKA 3LLTA 3LCKA 4F6SA 3AD4A 1ZYSA 2C6TA 2PMIA 2XYNA 4IBMA 3SOAA 1BKXA 1OKZA 4CD0A 3PPJA 3H9OA 4I4FA 3ZCLA 4L6QA 3FV8A 3FYKX 3GVUA 3T9TA 4L67A 1UWJA 4YZDA 2VD5A 4DFXE 4QMPA 3NAYA 4GFOA 4QMZA 4WG3A 4M12A 3DXQA 3RAHA 3PXRA 3AC2A 4FIEA 2E9OA 3ZMMA 3HDNA 2HZIA 2DYLA 3BBWA 1QMZA 4L3JA 2VUWA 4ENXA 4MF1A 1H07A 3MH2A 4D4YA 3U6JA 3MH0A 2F7EE 4WNKA 4O7VA 3QQJA 4C34A 1O6KA 3Q60A 4YO6A 2B1PA 3C0IA 4HZSA 3RBWA 2R9SA 4IHPA 4OW8A 3DJ7A 4MD9E 3R01A 4G9CA 5J79A 3LKMA 3FJQE 4C3PA 3LFFA 5I9XA 4DA5A 3IGOA 4FV3A 4KS8A 3RZFA 3Q4CA 1U46A 1ERKA 2PULA 3HAMA 2JEDA 4II5A 3QTQA 1SZMA 3V6RA 3A7FA 1MQ4A 4BGHA 2CNQA 3C5UA 3DZOA 2YISA 3R21A 4RMZA 4S32A 3PXFA 2I0EA 4IZAA 3CJFA 5AV0A 3WE4A 4YHTA 4M97A 3C4EA 5L8LA 4FKQA 5IQBA 5LQFA 4H3QA 5FGKA 5HNBA 5IMXA 4JR3A 3P7CA 3QGWA 3W32A 3FI8A 4XP0A 2X4ZA 5AADA 2KTYA 2VX1A 4QMOA 4UY9A 3UDBA 2ITTA 5FDXA 4DEEA 3FZOA 5L6OA 3QTSA 4IB5A 3LCSA 1FMKA 5HORA 2VTIA 4JLCA 3QKKA 4FYOA 4B4LA 1ZYCA 2QHMA 4UMUA 4O81A 5DG5A 1REJA 3OTUA 1BYGA 1M2QA 2C6EA 5JH6A 3ERKA 3BX5A 3DKCA 3WF8A 2WMBA 4QP7A 4EK5A 4O7RA 3EL8A 1BX6A 2DQ7X 5GJFA 3TIZA 4J8NA 4CLIA 2EWAA 1JSTA 4RIWB 3VBVA 4DTBA 3GXLA 4J95A 4HVGA 5JZJA 5DFPA 2X6EA 5IQHA 4O96A 5EW3A 5LWNA 3LMIA 2ONLA 4RIXA 2R0UA 5GINE 5I9UA 4UZDA 4FTRA 2VAGA 4FV6A 4YBJA 3VHKA 1OL2A 2NO3A 5HU9A 5CEQA 4HGTA 4CVAA 1P14A 3AMYA 3CJGA 2X2KA 4IM3A 4ONAA 3U9CA 1GNGA 2UW6A 4ZY5A 4FSTA 5CF6A 2B54A 5AAGA 2PZRA 3QQLA 4FODA 2IWIA 2VO6A 5A14A 2C0TA 4QRCA 4AT5A 4APPA 4ANMA 2GHLA 3GQIA 2HW6A 3MB6A 3D2IA 4JQ7A 3FZPA 3GU4A 5EI2A 3VRYA 3E5AA 3UZRA 2GHMA 2WU7A 3D83A 4R6VA 4XS2A 3ZLYA 4E6DA 3BWFA 4IWQA 3RTPA 1J1BA 3RPVA 2YCRA 4AW0A 4BCIA 5FM2A 4QTAA 3MA6A 5LARA 4XV2A 2R3OA 4XG3A 4YMJA 4RWJA 1V0PA 3NWWA 2R0IA 3RAWA 3IW4A 2B9JA 2DS1A 3FXXA 1IG1A 2O5KA 1KV1A 3HMIA 5IPJA 5LCJA 4HYUA 5A6NA 5HQ0A 4DHFA 4PUZA 4M15A 3HV3A 1JVPP 3VUTA 3W2CA 4Y73A 2BDFA 2EB2A 3RWPA 5C8KA 4WA9A 3OCBA 2ZDUA 1R0PA 4EH6A 4AZWA 1ZAOA 4U5JA 3MDYA 3VULA 1CM8A 2P55A 3G5DA 2HW7A 3FI3A 3AT3A 3VWAA 1XH8A 2I1MA 3QD4A 2IW9A 3T8OA 4ACGA 2UZNA 1OGUA 2YM3A 3UVQA 2F4JA 2WGJA 2C3LA 4BL1A 3O2MA 4K1BA 3WZJA 2BVAA 4FT7A 4YZNA 4WT6A 4PNKA 1YXSA 3UVPA 1IASA 3SX9A 4C35A 4M67A 3HRFA 4ASEA 3A7IA 5K5NA 3L8SA 3U9NA 2C30A 2BZHB 5IA0A 2YJRA 4C3RA 3NX8A 2OZAA 2XRUA 3FLWA 2WQEA 3II5A 2F7XE 5AUWA 2J90A 3T3VA 2OZOA 3EQHA 3PIXA 1HCKA 3UMXA 1Z5MA 4Z9LA 4EH7A 3EN5A 4BFMA 2YAKA 3GCPA 1GIJA 4XOYA 3CQUA 5AV4A 3BGZA 3CY2A 3FI4A 5CVGA 4FICA 2RFDA 5D10A 2W1CA 2XBJA 3TIYA 4K8AA 1U5RA 4ERKA 3UO6A 4JIKA 5HTBA 4UN0C 3C4XA 1MUOA 2WQNA 4ZXTA 3LW0A 4RA4A 4LUEA 4NCTC 4JDKA 4EOJA 4ZLOA 3EQDA 3OY1A 4DEHA 3GU7A 3TZ8A 4A9YA 3MJ1A 3O7LB 2BZKB 4IWOA 5CQUA 5JT2A 4CFUA 3TNIA 4AW1A 1JQHA 4USEA 3SAYA 5LMKA 4R7BA 1H1RA 4XG8A 1H00A 3ENHA 3V5QA 4E5BA 1FGKA 2Q83A 3HAVA 3F5PA 3LFSA 4JRNA 3ZFMA 4JBOA 2VTJA 3HP2A 4DH7A 3LM0A 4DFBA 1V1KA 2E9UA 5FP6A 4YHFA 2VWBA 4QP6A 1STCE 4JS8A 4W8DA 5AR8A 3V6SA 4YR8A 5IMEA 4CRLA 4DLJA 4DGOA 3WF9A 2W05A 4ZSLA 4FNWA 3D15A 2FUMA 5EW9A 3ACKA 3AC1A 3NW6A 4YJNA 5AIKA 3D0EA 5FEQA 3SVVA 3TG1A 4YHJA 2ZV7A 4L42A 2WHBA 2QU6A 4FIFA 1Q3DA 4NH1A 3TXOA 2J5EA 3BU3A 1T45A 1OIQA 4GL9A 4EH8A 2ZDTA 4R5YA 3C4FA 2YM7A 3G6GA 2Z7QA 4UMPA 5IDPA 3CIKA 3GC0A 3ODZX 4TW9A 4V05A 5CTPA 4CFWA 2I0YA 2XS0A 3ORIA 4OAUC 4EQMA 2YA9A 3MYGA 4MBLA 3PP1A 4J98A 3RAIA 3V8WA 4EOQA 3GFWA 4WO5A 4O38A 3BQCA 4QMMA 2GNHA 5FLFA 2QOQA 2B55A 2G2FA 5KMLA 1I09A 2DWBA 2Z60A 4EK3A 2BIKB 2VWVA 5AJQA 2GSFA 4OR5A 2BIYA 2QO2A 3VW8A 2QI8A 1KOBA 2J0LA 4JT3A 5LCKA 4Q9ZA 3ZLXA 2V0DA 2EVAA 2W1EA 2HIWA 5TT7A 2BZIB 3VO3A 4OTGA 3WI6A 5GIPE 4KKHA 1ND4A 4FKGA 2WTDA 5L6PA 2B4SB 3L9NA 4QTCA 2PMLX 3RWQA 4BCJA 1BUHA 3EQFA 1PJKA 4MCVA 3AT2A 4GK3A 4R3CA 4RJ4A 4FKRA 5EHLA 2JDSA 4CYJA 2HZ0A 4JVGA 3VRZA 4GU9A 3BLQA 3GOPA 5BMSA 2WEIA 2B53A 3ALNA 4YLKA 3EH9A 5IA2A 2VTNA 4FNXA 3KXMA 3HMMA 4M69A 2IW6A 4DGGA 2JBPA 3TN8A 4FTTA 3VS6A 2UV2A 3W8LA 4L3PA 1O6LA 4G3CA 5CYIA 4C62A 4FBXA 3V5TA 3VUIA 4AXAA 3AC8A 4B6LA 1H28A 3DK6A 4CZYB 4G34A 2CKOA 2HZNA 3T9IA 2YERA 1JPAA 4UXLA 5E8VA 2HWOA 1OBDA 3IW5A 2P2IA 4DFZE 4O83A 5J95A 2AC3A 4DN5A 4AE9A 2ITYA 4O0YA 5L8JA 5I9ZA 3NUYA 3KXNA 2BRHA 3Q4UA 4F4PA 3NCGA 4EZ5A 1Q62A 5CF8A 2GNLA 1A9UA 1PMNA 3DCVA 3IW7A 1YXXA 4OBPA 2W9ZB 3V01A 4W4VA 2W99B 5IA5A 1MQBA 3LJ2A 4H36A 3SW4A 3LJ0A 1ZMVA 3MH1A 4KA3A 3ZU7A 2NRYA 3JXWA 3EQBA 4XV9A 2R2PA 5C26A 2PVLA 3GI3A 3R9HA 5HG7A 1SVEA 2VGOA 2GNJA 3DB8A 2GCDA 3JY0A 5KMKA 4S2ZA 1MP8A 3OFMA 5DVRA 2V55A 5GZ9A 4E6CA 3WIKA 2H96A 2XKEA 4R7HA 4RC2A 5FEDA 1UV5A 1LPUA 4D2WA 4XG7A 5AR7A 3SLSA 4FIJA 4FTIA 2WMTA 5C1QB 4F7JA 4BDBA 5G1XA 1CKIA 1PXIA 3A8XA 3QZFA 4IH8A 4C3FA 3L8PA 5F95A 4RPVA 4I93A 4A9TA 2ZJWA 4RBLA 4BCQA 3ZFYA 5BUIA 1KSWA 4K9YA 4R78A 3GC8A 4R3PA 3FMKA 3VUGA 4D5HA 1REKA 3MBLA 5CASA 1YHWA 3H9RA 3NCZA 1GZOA 1XH5A 4L46A 3LPBA 5A3XA 2OU7A 3AC4A 2QLUA 2OK1A 3P4KA 1FQ1B 2CNUA 4G6NA 3RVGA 3LMGA 1WBPA 4FVQA 1O6YA 4KIPA 4BBFA 4YPDA 4QPSA 4R1YA 3V8SA 5AR5A 3W2QA 3S0OA 4NUSA 3PA3A 4PMSA 4TYHA 3DBDA 3GUBA 4RFZA 4GT5A 4Y85A 4EBVA 3GB2A 4BHNA 4ACDA 3LLAA 3MTLA 2Z8CA 3TCPA 4FX3A 3OBGA 4MQ1A 3JR1A 3FPMA 3TNPC 4BZOA 3FKLA 3QL8A 4C8BA 3U6HA 4YJUA 4FEWA 2OKRA 3P1AA 1VJYA 4XX9A 2IVUA 2CGXA 4NCTA 4ZTLA 3DAKA 4F9WA 3QA0A 1OIUA 3FMHA 4FTKA 3NUXA 1QPDA 5LXMA 2YN8A 3RK7A 4RWKA 4TYJA 4BTFA 3TUDA 4BWKA 2W5AA 3QD3A 4D58A 4G2FA 5EQPA 5EOBA 4DEDA 3DGKA 1VYWA 2B9IA 4DGNA 5AX9A 5FM3A 4CQEA 3UGCA 3A7GA 4D0XA 2YFXA 4BY9E 4BGGA 1B6CB 1OM1A 3QF9A 4OTQA 3QTUA 3TTJA 5FTGA 4V0GA 4CKJA 1BL7A 4NM3A 4DTKA 3ID6C 3PG3A 4FGBA 5GZAA 3OCTA 3AQVA 3TDWA 2J0IA 1XHAA 2ZV2A 1QPJA 1UU3A 2O0UA 2XA4A 1UNLA 4EH3A 4FNZA 2ZOQA 3DK3A 2BALA 4I20A 3R9RA 5DN3A 4B0GA 4QQ5A 4G6LA 2QQ7A 3R9NA 1YDSE 3EHAA 4LM5A 3Q32A 3MPAA 3PSDA 4W9WA 4JJRA 4WNOA 4CCBA 5AR4A 4EOOA 2R64A 4IAIA 2HXQA 4C2VA 4DG3E 4WIHA 4QMXA 5L2QA 2FH9A 4C58A 2VWUA 4CMUA 3HUCA 2XF0A 4YTHA 2XK7A 2XVDA 3QA8A 3C51A 2X2MA 3ZBXA 5E90A 3LZBA 4YC8A 4OTWA 3DBFA 3TJCA 3HX4A 5T68A 3PFQA 2GQGA 3R7IA 3R6XA 1P4OA 3ZC5A 3TACA 5EM6A 3KVXA 1BL6A 2W1GA 1NXKA 4G5PA 4BIEA 2UW4A 4I6FA 1CDKA 3B2WA 4IWDA 3MVHA 5AA9A 1GAGA 2UW3A 4E6AA 3KRLA 4BDCA 2RG5A 4H1JA 4O7NA 5CSXA 3VS5A 2R3KA 1NA7A 3E7VA 1L3RE 4W9XA 5CS6A 4O7WA 5M08A 3KQ7A 5EI8A 3OXZA 4GK4A 2R5TA 4ZY4A 2QD9A 3O96A 1P4FA 1XO2B 3HZTA 3OWPA 3CS9A 3UQFA 3ET7A 4IB1A 1Q3WA 2R3MA 1PMEA 5EFQA 1OECA 4GFMA 4GVJA 4FTMA 3CC6A 4JL9A 5HIBA 2XNEA 5DT3A 3R2BA 4R7IA 1JWHA 3DT1A 5HCYA 3RALA 5E1SA 3E8EA 3QKLA 5I4NA 1J3HA 4E4XA 4IQ6A 2XM8A 5H9BA 3M11A 1TVOA 2JIUA 5DEWA 4BDKA 2OLCA 1ZYLA 2ITWA 1M14A 1WMKA 1DM2A 2C6LA 1GY3A 1HOWA 3FLYA 2F2CB 3OF0A 1LP4A 3H0YA 1WAKA 3VF8A 4YU2A 4IM0A 1GOLA 4MEDA 4H3BA 2PVKA 3FHRA 4QP8A 4BCOA 1ZOEA 3GQLA 4DFLA 3ORKA 4KAOA 2GTNA 4DT8A 3D5UA 4BDIA 3K2LA 1Q5KA 2VTMA 3ZO2A 4F0IA 1H1SA 3VW6A 2XMYA 5CZHA 4KKGA 5HESA 1UU7A 3PY0A 5IZFA 1FVTA 3I7BA 3O71A 2HELA 4P7EA 5ANEA 1ZMWA 4I6BA 3Q9YA 2ITQA 2YHVA 4D4RA 2PHKA 1CSNA 5CSPA 2QO7A 3ZM4A 3KK8A 2OO8X 4Y5HA 2XK8A 4HGEA 3ZTXA 3NYNA 4NWMA 4C4GA 3G51A 4JXFA 4UMQA 5HBHA 4E4LA 5IQIA 1U54A 3DLZA 1J7LA 5B7VA 2WQBA 4NW6A 5L2SA 2OI4X 4FV9A 3TV7A 3LOKA 5GJDA 3OMVA 5ANIA 4BCMA 3R7OA 5C8MA 4LGDA 1ZY5A 4JQEA 3WOWA 5JK3A 2BILB 4IANA 5CVHA 3PVWA 4NM0A 2Y8OA 3CXWA 4FV0A 5FTQA 3DJ5A 4FSUA 3A99A 3I79A 2PZ5A 4F99A 4E93A 2PU8A 4E7WA 3LHJA 4PQNA 2HOGA 4G3EA 5HKMA 2C69A 4WD5A 5CEIA 4AZFA 5TKDA 3NUNA 4DEBA 4RSSA 4LI5A 3NUAA 2QO9A 4IX3A 3COHA 4HGLA 4RIYA 3SXFA 4R5SA 1WBVA 5AWMA 2QU5A 3ACJA 4G16A 4O6LA 4CT1A 2WMAA 2PUNA 2B9HA 3LXKA 4FE2A 3N4TA 5E8YA 4XLVA 1AGWA 4FIIA 2Z7SA 3ZSGA 1Q24A 4QMNA 5IH4A 4CXAA 4QNAA 5J7BA 1W83A 3DPKA 4TXCA 2UZDA 4FUXA 3REPA 4C4JA 4RWLA 2YEXA 2SRCA 4L7SA 3VS2A 4CCUA 5KMJA 2R3PA 2BHEA 3QTIA 4G9RA 3BI6A 4X6QC 3SHEA 2ZM3A 5ANGA 2G1TA 3I81A 4FSRA 4RIWA 1H27A 2OJJA 2WMVA 4YJOA 4YNOA 1BLXA 4I1ZA 3UIXA 3Q5ZA 4IMYA 4G3DA 5I9YA 4BB4A 4QQTA 1W0XC 3LQ3A 3OEZA 2XIZA 1F0QA 3QQGA 2UZUE 4XHKB 4MWHA 3TZ7A 3H4JA 3I4BA 1E1VA 4RQVA 1OVEA 1TQIA 2ITXA 4NJ3A 5M44A 4F9CA 4F0FA 3W8QA 5L4QA 4MXXA 4XNEA 2YIRA 4AT3A 1H26A 1Y8GA 4XRLA 5CEMA 2JDVA 3MSSA 4QTBA 3FC2A 4I6HA 5AAFA 3DTCA 3EOCA 4YJQA 1OIRA 4F7LA 5EQYA 3F5GA 5FEEA 1S9IA 4D5KA 2PUUA 2W1HA 2QR7A 3LFEA 4EI4A 4XEYA 4C36A 5L2TA 5JN2A 1YDRE 2RL5A 5KHXA 1FPUA 1NT2A 3QTRA 3PYYA 5M09A 3OBJA 4FSWA 2UW5A 3RAKA 4ZAUA 3QQFA 2YM5A 4WG5A 3KRXA 5HOAA 4M66A 4CFXA 3SV0A 4FTAA 3DQXA 4OT5A 3ZS5A 2XCHA 3SRVB 3IGGA 5AP2A 5DMZA 1WFCA 4O6EA 4YZMA 3G9LX 3DKFA 4DG0E 4ANNA 3OWLA 3VF9A 2XJ2A 4RJ8A 4DEAA 4O0TA 5IA1A 2A4LA 3K54A 3MVLA 4TPTA 4I5CA 2WU6A 3PRFA 4FC0A 4OTPA 4PV0A 3EFJA 4YBKA 5GJGA 2VO7A 4KSPA 5ETAA 4D1SA 5LVMA 2VZ6A 3LXNA 1BI8A 4CV9A 4IVAA 1H25A 4DH1A 4U45A 5KBQA 1YOJA 4FZ6A 2PYWA 4ZSAA 3R73A 5DA3A 5HVKA 4JI9A 2W5BA 3VIDA 2WO6A 2JDRA 4DH8A 4RQKA 1OL1A 2JIVA 5C4LA 3COIA 4AX8A 2Z02A 4KBCA 2HY81 4JQ8A 3DBQA 4AA0A 2QR8A 3TI1A 4Z7HA 4WG4A 5DI1A 3R1QA 4O7ZA 5J5SA 1ZWSA 2NPQA 2JFMA 1UNHA 4J97A 3O51A 3FQHA 2C68A 3RJCA 4KIQA 1P5EA 5DEYA 3K3IA 5J1WA 2ACXA 4QYYA 1PW2A 1VYZA 4M3QA 5CAPA 5IQAA 4FTNA 3KGAA 2B0QA 4JDIA 1OL6A 5IQEA 3Q96A 5EW8A 4HJOA 4GV1A 5EYKA 2PUIA 3VNTA 5J7HA 2QOBA 2W1FA 4IZYA 5AP0A 3D9VA 3B2TA 4BKZA 1J7UA 3I60A 3BU5A 5KMOA 2OFVA 4OGRA 5DRDA 3NW5A 1YI3A 3DNEA 4TWNA 2H6DA 4E5AX 3T3UA 4XBRA 4NEUA 3VS0A 2ITVA 4L68A 4U43A 3PSCA 3V5WA 2QOLA 3Q6WA 4BDJA 1F5QA 3PLAE 2ITZA 4QMUA 4CMTA 4BTMA 3QC4A 4FL3A 4XH6A 5HD4A 4NL0A 1NY3A 2VWWA 4FT9A 4QP3A 5EM7A 1XH4A 2GFCA 4RC3A 1FOTA 3EFWA 3OC1A 4MBIA 3VUMA 3OOGA 3HVCA 1OI9A 1Q41A 5CU3A 3RPYA 5A6OA 3AOXA 3HMNA 3R9OA 4IACA 4NU1A 5ACKA 4F9YA 4QD6A 3LXPA 5J9YA 2JAVA 2UVXA 4AUAA 4CZUA 2WTWA 3VBTA 2WMQA 3W16A 4IJ9A 5DBXA 4LV5A 2X8EA 4EHZA 5IEYA 3FKOA 4JBPA 3I6WA 3R1YA 4XRJA 2IZTA 1URCA 4BGQA 3ATSA 4AS0A 4YZBA 3IECA 4I0RA 1SMHA 4CFFA 1Q8WA 1T46A 2IN6A 4GJ2A 4I5MA 4RVMA 5AV2A 5ANOA 4NTSA 5M07A 2W4JA 3VS4A 4FV2A 4UXQA 2Y4IB 3E62A 2ITOA 3RPOA 3PXZA 4A9UA 4M14A 4EBWA 5D7VA 4EQCA 4O82A 4FMQA 4PF4A 4OTHA 5L3AA 5CSWA 3HV7A 2OJIA 4JBQA 4TWOA 1DAWA 4WSYA 3UVRA 3K3JA 2PSQA 4WRSA 5H3QA 4HVHA 5E8WA 5D12A 2PY3A 2X39A 3NS9A 3KEXA 3POOA 4LMNA 4X2KA 4IFGA 4RG0A 5HIDA 3VS7A 5CXZA 3FEGA 1PXMA 3KCKA 3CTQA 4LGGA 3ZFXA 3ZRKA 5EYMA 3PY3A 5M53A 2O8YA 4YTFA 3F3WA 4MNFA 4DBXA 4W8EA 3F2AA 2EUFB 4P5ZA 3R02A 4ITIA 4Q2AA 2UZEA 1Y91A 3BBTB 3HMOA 1OBGA 4AA4A 3R00A 4F65A 3RGFA 4XP2A 2CMWA 4LL0A 4AU8A 2IPXA 1OPKA 2HENA 4QQJA 4AGCA 3E8NA 5CWZA 4FSYA 2ZM4A 3ZYAA 2IZSA 3C13A 4WUNA 3R8VA 5ANKA 2JBOA 5E1EA 3VQUA 2OICA 1H1QA 2R3LA 3O8TA 3OCGA 4FVPA 4UBAA 5AMNA 4JRVA 3UZPA 5TE0A 4GG5A 4XG4A 4MXZA 2OJFE 4HNFA 5IUGA 3N4VA 4O7YA 4J8MA 2EXMA 2GMXA 2PZPA 3OD6X 2JDOA 2ZMDA 1O9UA 1M7QA 2R3RA 5CANA 4ZEGA 2YM4A 3ELJA 2P3GX 2PZIA 3IDBA 1TQPA 4FTQA 3W55A 4LUDA 4D9TA 1TQMA 3G15A 3HKOA 3PSBA 4X3FB 4N70A 4YJSA 5KMIA 3IW8A 4I6QA 4FL2A 5C8NA 3DS6A 5M51A 4OUCA 2PWLA 4U0IA 2YCFA 2JLDA 4KB8A 3RCDA 2BZJA 3D14A 3ORNA 4Z3VA 4RVLA 3EN7A 2EXEA 4J99A 1MRUA 3FQEA 3GOKA 3MIAA 4S33A 3SD0A 5I9VA 4FKVA 1IAHA 3KVWA 2CGVA 2UUEA 5HICA 5DH3A 2YCSA 3HA6A 1WZYA 1G5SA 5DPVA 4FT3A 4HPTE 3TKHA 4BWXA 4CTCA 4EOLA 3ANQA 1AQ1A 3L1SA 2R3HA 4HVSA 3S2PA 2VX0A 5EM5A 4DINA 5HE0A 4LMUA 3BU6A 4U97A 3DNDA 2C5VA 3VS1A 3MGYA 5CU0A 4AN2A 4XLIA 4A4XA 4L53A 4DC2A 1WBSA 4I23A 1OL7A 3I7CA 4KNBA 2QHNA 1L8TA 3MH3A 1IEPA 3P7AA 4GG7A 4D2VA 1U59A 3CR0A 5BVEA 5CZIA 4AE6A 5G6VA 3R9DA 3HV4A 3ORZA 5JQ5A 2OWBA 3SW7A 2WMWA 2FSMX 3R8LA 5CSHA 5KZ0A 3A62A 4I24A 3PDTA 1VEBA 1CKJA 4MH7A 3BHVA 5HX8A 2V7AA 5HNGA 5AUTA 5ETFA 2RSVA 5ANDA 3V5LA 4H39A 2J5FA 2YAAA 5AIRA 1XWSA 2IG7A 1YDTE 5CI7A 3GFEA 3MPMA 2WIPA 3LFQA 2BRNA 2UZWE 1YWNA 2CKEA 3HRCA 4IVDA 3S00A 2RFEA 3MA3A 5A46A 1S9JA 4IVBA 3NYOA 5AV1A 4Z7GA 3M2WA 3S3IA 3A8WA 3P23A 3R2YA 3HNGA 3PA5A 3P78A 5EM8A 3BWJA 3NNUA 3F2RA 3QU0A 4MK0A 4XMOA 2OXXA 4UEUA 5AP4A 3MB7A 3QRJA 1NVSA 2XKFA 4M0ZA 3NR9A 4EKKA 2C6OA 3DBEA 4OBOA 1YHVA 4ZJVA 5M4IA 1GJOA 2F57A 2G15A 1RJBA 3NDMA 3ZDUA 4BBMA 2BCJA 4ZIMA 3UNZA 4AZVA 4NIFA 4PTEA 3CLYA 4P5QA 3CCNA 3KXHA 3LJ1A 4I3ZA 4EHGA 4AFJA 1KV2A 1B39A 1ZARA 3CKWA 2W1IA 4MQ2A 3O0GA 3FDNA 5CEPA 1XJDA 4JG7A 3ZDIA 5A4LA 3KXXA 3OP5A 4RT7A 3ROCA 3P08A 3D5VA 3EN6A 5DR9A 4F9AA 5BVDA 3PUPA 2UZOA 5CT7A 3RP9A 4V04A 3BQRA 3E93A 2IVSA 4GU6A 4BCKA 3GEQA 2PE2A 4RIXB 4LRKA 3QBNA 5K5XA 2OSCA 4U42A 4EK4A 4BR3A 2HK5A 1XH9A 5FDPA 3QCSA 3NNVA 4L01A 5CXHA 2ZVAA 3NSZA 4IADA 1VR2A 4AQCA 5HNIX 1U4DA 1JSVA 2BKZA 3OXIA 4Z16A 5KKRB 3BE2A 2OJ9A 3NEWA 4D28A 4YZCA 1LEZA 2OBJA 4JG6A 1Y8YA 5DE2A 3C50A 4ARKA 4AZEA 4CNHA 3PE1A 4WSQA 4LRJA 3U87A 5HO7A 5FBNC 2PVYA 2ITPA 4TZRA 2WIHA 3HA8A 1IAJA 3BZ3A 3FMJA 5M4FA 3AC3A 2GHGA 3OOMA 3VJOA 4EQUA 4ZZOA 3FY0A 3I6UA 4AZSA 3DZQA 5HO8A 2VO0A 4MXCA 4EOMA 3E88A 2OFUA 4CKIA 4DCEA 2PVNA 3BHHA 3CEKA 2QC6A 5DT4A 2WQMA 2I40A 4J1RA 2QOOA 2YM6A 4FSZA 4KRDA 5HLPA 2P33A 3TUBA 2VGPA 1JKTA 3PA4A 1JKLA 4RC4A 1Q8TA 1XR1A 3QUPA 4BTKA 5BVOA 4EOKA 4QP4A 5LVOA 3QUEA 2YJSA 4HPUE 4WNMA 3WIGA 2Q0BA 4CT2A 3QTZA 4DEGA 4EKLA 2NNWB 2XNNA 3E8DA 2J50A 4GYIA 2QLQA 2XBAA 1KE9A 3BLHA 4IAFA 3LAUA 5ETIA 3COMA 4F9BA 3W18A 2EB3A 4BI1A 3K5VA 1A06A 1PKDA 1CTPE 4DF3A 4EL9A 3ZBFA 4NJDA 4XV3A 5K3YA 4PL4A 5IU2A 4QMTA 3DXNA 1PYEA 3JS2A 3JVSA 3VQHA 3UOJA 3Q9ZA 5K9IA 5I3OA 2YZLA 4X6RA 4A07A 2BTSA 2YIYA 1OUKA 5AV3A 5E8XA 3KA0A 5E7RA 1A48A 5E8ZA 1MRVA 1M2RA 4Y5QA 1EH4A 3A2CA 3C4WA 4E4MA 2G01A 2GNIA 3FMDA 4OT6A 3THBA 3KREA 4DYMA 2JKMA 3QRUA 3DDQA 3Q4TA 1WVXA 4MWIA 2JGZA 3DU8A 2C5NA 4IAAA 4X2JA 3FXWA 2CGWA 4MBJA 4XJ0A 5DOSA 5M06A 4O0XA 3FLNC 4NSTA 3R7VA 2WTKB 2ZB0A 5DIAA 3RM6A 4U44A 3F5XA 3PZEA 4U3ZA 4U40A 3F5UA 4FSQA 4KD1A 3ZXZA 5FXQA 3Q3BA 3WZKA 2X9EA 3D7TB 4W4XA 4GCJA 3EQIA 1OKWA 2PMOX 4IJPA 4TTHB 2C5OA 4C0TA 3A4PA 2XNPA 2PVMA 3OS3A 4I4EA 4RGJA 4J7BA 3KRRA 5D9HA 5K0KA 4F63A 2YWPA 4XUFA 1OITA 2GTMA 4NKAA 3NVMB 4G3GA 4RVTA 3F9NA 3HDMA 4FF8A 4A4OA 3MS9A 3DFCB 3CPCA 2QVSE 4BYJA 4D1ZA 2GPHA 4ZMEA 2X1NA 5IEXA 5AUYA 3VBQA 3NUSA 4LQMA 3PVUA 1PY5A 4XOZA 4QPAA 2I0VA 4PX6A 5FWKK 1KE7A 3COKA 4UWYA 3ORTA 4K0YA 4FG9A 4NZWB 2R3NA 5D11A 2ETMA 4BBEA 1UKHA 5IDNA 2C47A 3H0ZA 3SQQA 2BRBA 4NM5A 4Y72A 5KX8A 2O63A 2R3QA 2RKUA 4O2ZA 3ZH8A 3R1NA 3HGKA 1X8BA 5F94A 2X7FA 4DGMA 1XH7A 3BYMA 4L3LA 2XK9A 3OROA 4AACA 2BAJA 4GK2A 3UG1A 3F82A 5D1JA 3E3PA 2IVVA 3CGFA 4EHEA 1PYXA 4LGHA 3G90X 3FMLA 2BHHA 2R7BA 2XRWA 3F7ZA 2XK3A 2F2UA 4IDVA 4UWCA 1XBAA 2XZSA 4L9IA 3CE3A 1MRYA 4N4SA 4LOQA 3UPXA 3QYZA 1PXPA 3NAXA 2OJGA 5CAOA 2FYSA 5KUPA 1H01A 2JKOA 4EYMA 5I0BA 5M4UA 3ZONA 2W7XA 1OL5A 3HRBA 5IUIA 3BHYA 2P4IA 1RE8A 5DGZA 2C0IA 3ORLA 2VWZA 4O84A 5IQDA 5DR2A 2WD1A 2BFXA 4BHZA 4EONA 4GT4A 3CQWA 3HV5A 3VAPA 4EZ7A 5LMBA 4O1PA 4X3FC 5JFWA 1OMWA 3QYWA 5FRIA 4MXYA 3UE4A 4M84A 5D7AA 1UNGA 2JKKA 1K9AA 2HCKA 4FZFB 4TYEA 3ETAA 4WKQA 4ZSGA 4EUTA 3NIEA 4EHVA 3QX2A 4BI2A 2QOFA 4O22A 3U4WA 1Y6AA 4HOKA 3MPTA 1YW2A 5CEOA 4RJ6A 1OZ1A 1Q97A 1G8SA 2WNTA 1Z9XA 4GT3A 4IE9A 5DYJA 2CGUA 2B7AA 3CY3A 4B8LA 5IKWA 4PDYA 4AW5A 1R78A 5AM7A 4EH2A 3QZHA 3DBCA 4PTGA 3R22A 3OG7A 4PDSA 3OVVA 1FMOE 5EOLA 3SRVA 3BPRA 3PPKA 4G17A 5DR6A 4BC6A 3Q04A 4GFGA 2VTSA 3QQKA 1GZKA 2ERZE 4BCPA 3VUDA 4EH4A 4ZS0A 2BPMA 2JDTA 2FA2A 4L7FA 4DITA 3D4QA 5EI6A 2YDJA 5HO6A 4AT4A 4O21A 3F3ZA 1M17A 2X6DA 3AGMA 1PHKA 5AP3A 4CQGA 3L8VA 3ULZA 5A54A 4KWPA 3L9LA 4LOPA 2DUVA 2WMXA 3KKVA 4ZP5A 5BVFA 4OBQA 2BDJA 3L8XA 2JITA 3RINA 4BKJA 2CCHA 5CAVA 1J7IA 3C1XA 4Y8DA 5JFVA 2YIWA 3ODYX 3VUHA 3GCQA 3PIYA 4ORKA 3D7ZA 3NGAA 3W2RA 5H2UA 3R83A 5BYLA 4D2RA 3OT8A 5HBEA 1ZZ2A 2RF9A 2WEVA 5HI2A 2C5YA 3B8RA 3AD5A 4NT4A 4OTRA 1JNKA 4CLJA 5ETCA 3LFBA 4NK9A 3W1FA 4EJ7A 2O2UA 3KC3A 3BIZA 3E64A 2F49A 4FV5A 2O65A 2VX3A 3F3UA 4BTJA 5CSVA 5E8TA 1YRPA 4QNYA 3U6IA 4DH5A 5EQEA 3C0GA 3GU5A 4IX4A 5L2IA 4E6QA 4C4EA 3WILA 5IH6A 1R39A 4TN6A 4L00A 5JGDA 1H0WA 2XIKA 2WMSA 4MNEB 4KSQA 4GUEA 2C6IA 1YQJA 4FKLA 5JRQA 4F7SA 5AP6A 1UVRA 4GYGA 3ATTA 1JBPE 4X7QA 5AUXA 3UIUA 2P2HA 2YIQA 5B2MA 5BVNA 2PUPA 4AN9A 3CD3A 4FR4A 5L8KA 4GMYA 4MVFA 4ANOA 3UOKA 4BI0A 1IR3A 4RIOA 3QX4A 2YDKA 2W1ZA 2YACA 4AOIA 5HBJA 4TKSA 4I5HA 5HE1A 3BELA 2CPKE 3FL5A 1GIIA 3OTVA 4O7TA 4BIBA 3CQEA 3AMBA 4JAIA 4JOAA 4RVKA 3EZVA 4JX7A 2WPAA 4RX7A 4AFEA 2PTKA 4ZMFA 4LG4A 2W4KA 4FT0A 3DDPA 3O50A 3H3CA 2VWXA 1WBNA 5TF9A 5E91A 2I6LA 3FZTA 4KIKB 2VTRA 4FKIA 3EIDA 4FSNA 3EKKA 2C4GA 3FPQA 3FAAA 1ZOHA 3GGFA 4IW0A 3V5JA 5H8EA 4FTOA 2ZV8A 1VZOA 1ZXEA 1JOWB 2YDIA 3VBXA 4BDHA 4PL5A 2FGIA 2ONLC 4CFMA 2JAMA 4D2PA 4E73A 4AGWA 4X2FA 3MI9A 4XBUA 2A2AA 1V0OA 3C4CA 3ENMA 3O8UA 4JAJA 3DKOA 3ZUUA 3IQ7A 3P79A 5T6KA 2PMNX 5KBRA 3TNHA 3IONA 4N6YA 1Q8YA 5KKRC 3V8TA 4FEUA 3IOPA 3DKGA 4NFNA 4I5PA 1SYKA 5IA3A 1B38A 3DK7A 4APCA 3QTWA 4V01A 2GQRA 3EJ1A 4MD8E 5CALA 2WXVA 3V5PA 4UZHA 2Z7LA 1YWRA 2H8HA 4FEQA 1PXNA 3NYVA 4RZVA 5EH0A 4ANSA 3U55A 4Y83A 5BNJA 4BDAA 3OT3A 3GENA 2FB8A 4DLIA 5KHWA 3BGQA 4KKEA 2LAVA 2W06A 2VTQA 5A4EA 3EYHA 3A7JA 3LCOA 1Q4LA 3MV5A 3NIZA 1YOMA 3PWDA 3LCTA 2ERKA 1YI4A 1Z57A 2NP8A 3LFNA 4FK6A 4WOVA 3VVHA 4PMPA 3G0EA 2BUJA 2UW7A 3IG7A 1G8AA 1WVYA 4O0UA 4PTCA 3KXGA 4BYIA 1UWHA 4FZ7A 4QYEA 3VJNA 5FUTA 3EFKA 1DAYA 4AOJA 5JZNA 2QG5A 5HE2A 4H58A 1WVWA 4W4YA 4C7TA 3OZ6A 2PVJA 3ZZEA 2UW0A 2XIXA 4AGDA 2IZUA 3PZHA 4U79A 3I5ZA 3IPHA 3NMUF 1F3MC 3RK5A 3LCDA 3R8ZA 5CAQA 4X3FA 4R3RA 4Q5EA 4QP9A 3NUPA 3MESA 3QLFA 4H3PA 1JLUE 2OF4A 4FV1A 4IX5A 5LVPA 5BX0A 3GCVA 2Y6MA 3FZRA 4BRXA 2C1BA 4UALA 2YLEA 2BFYA 3LFAA 3MFSA 3F88A 3H9FA 4GH2A 3OCSA 3FLSA 3ZM9A 5IA4A 5JFSA 4F08A 3D94A 4FYNA 2O64A 2VWYA 1ATPE 4XP3A 4AW2A 3Q6UA 4Y46A 4QP2A 4F7NA 2YM8A 5GIOE 2JIIA 1KUTA 3LMHA 3LQ8A 2WTKC 4TL0A 4FTUA 5M56A 4DFUA 2AC5A 4C4FA 5TR6A 1FVVA 1NVQA 4ALWA 4CFNA 4FG7A 1H1WA 3PWYA 3TKIA 3WYXA 3Q9WA 2QURA 3UZTA 3E8CA 2IO6A 4PDOA 3ZUTA 3RZBA 5LMAA 4AOTA 4IC8A 2Y0AA 3RNYA 3LFCA 5AFVA 2C6MA 3O23A 3QCYA 4CYIA 3IOKA 3KULB 2BRGA 1FGIA 3E87A 1XH6A 1ZRZA 3ULIA 4MXOA 3FMEA 4IZ7A 1U5QA 4C57A 2ETRA 5TOZA 3Q4ZA 4FTJA 3F2NA 4P90A 4UYNA 1U54B 4BICA 5CU4A 5ITAA 4CG8A 1Q8UA 2VTAA 4GIIA 5ACBC 5JRSA 3OWKA 1KOAA 1RQQA 1UA2A 2W1DA 3SXSA 4BDDA 4J96A 4N57A 4AN3A 2ZMCA 2HYYA 3BHTA 5EDQA 3R1SA 4F6UA 1E1XA 4RJ5A 4K6ZA 2WELA 4FL1A 3R7EA 3HL7A 2CHLA 3ZEPA 5IQCA 4HYIA 4IIRA 2CSNA 4ACCA 4CRSA 4QO9A 2C1AA 4MHAA 4ZTQA 2R7IA 4H1MA 3PVGA 5E92A 5BYZA 5EHOA 4F70A 3E92A 5C27A 1CKPA 2PE0A 5J9LA 1PXOA 3DQWA 2OH0E 3FMNA 1PKGA 4UB7A 4PDPA 4YO4A 3ZRMA 3BYVA 3QD2B 4RIYB 3CTHA 5C9CA 3D5XA 4YJTA 3UC3A 1AD5A 4IFCA 4CEGA 4E3CA 3JUHA 4DEIA 2UW9A 4FNYA 3A4OX 3VBWA 3ZEWA 4ENYA 4EZ3A 3JVRA 1JKKA 3POZA 3PXYA 3TL8A 3MTFA 4FTCA 3VS3A 2CKPA 3GC9A 4TYGA 1H4LA 3DAEA 2XIYA 4QYHA 4C4IA 1W84A 3DTWA 4YSJA 3Q2JA 5EG3A 4HVDA 4J52A 4B9DA 4D55A 3OXTA 2VNYA 3G0FA 5EDRA 3BV2A 3C0HA 2BTRA 5GNKA 1YXVA 4AF3A 4BCFA 3UTOA 2UZVA 4G6OA 4RJ3A 3QZIA 3VN9A 4ZZMA 5M57A 5HG8A 4DTAA 1LR4A 3NPCA 5JQ8A 3BKBA 4I92A 2PE1A 4C38A 4YNEA 2WOUA 3KMWA 3LQ5A 5F4NA 4C02A 2VV9A 2XP2A 4FV8A 1R1WA 3IS5A 3UIBA 4UWBA 1XBCA 4LOOA 4YUQA 2Z7RA 3SG8A 3O8PA 2XKDA 3U54A 4XYFA 2OG8A 3NZ0A 5CLPA 3MFUA 3FWQA 3N9XA 3PG1A 2W0JA 4LV8A 5AM6A 4NYEA 4ZTMA 5KNJA 4DE4A 3R28A 2UVYA 2ETKA 3ORXA 4M13A 1UU8A 4ERWA 5J9ZA 5EYDA 1WBOA 4PNIA 4O0SA 4WRGA 2R4BA 4F64A 4WUAA 4U80A 3ZRLA 2QNJA 3C7QA 4RZWA 4EK8A 3Q52A 3HLLA 2YCQA 3CTJA 3PPZA 5KMMA 3AGLA 2ITUA 4BCGA 4WBBB 4I94A 4E20A 5E8UA 1GIHA 3UYTA 3TDVA 4C2WA 3VBYA 4USDA 2VTTA 1OPJA 2WTCA 3QAME 2JD5A 5LVLA 1URWA 3H10A 3LM5A 4HVIA 2IJMA 3FBVA 3HECA 3B8QA 2Y9QA 3FC1X 4LYNA 4EORA 3NVKI 2GS6A 3WARA 2HZ4A 3UOLA 4W4WA 4EOSA 4U41A 4X2GA 5FQDC 4ALVA 3P86A 1M2PA 3WZDA 2R3IA 3FY2A 2G2IA 3OHTA 3PTGA 3WF6A 1DI9A 1OUYA 4JDJA 3KF4A 4EUUA 5AAEA 4CG9A 4CMOA 3CPBA 4EH9A 1WBTA 4BCHA 3SA0A 4MAOA 4EK6A 2BAKA 2JFLA 2HWPA 4FKSA 4JIAA 4YSMA 5HTCA 2J51A 3E3BX 4M8TA 4FKJA 2CN5A 2XKCA 4FKTA 4GVAA 4I0SA 1H1PA 2Q0NA 3NNWA 4ASXA 3ZUVA 4YURA 3FMMA 2VN9A 3F3VA 3G33A 3PJ2A 2QKRA 3QUDA 4NW5A 4QPMA 3ZSHA 4AZTA 2H9VA 5LOHA 3UP7A 5JGBA 2LGCA 3EFLA 3R30A 3WF7A 1XQZA 4HYHA 4I41A 3RHXA 1Y57A 1JSUA 3EQPA 2C3JA 4FA2A 3UIMA 5EYCA 1HCLA 3RM7A 4DFNA 4R8QA 5AA8A 3N4UA 4BIDA 2XJ0A 3IDPA 3EB0A 4QYGA 2XH5A 2G9XA 3W2PA 4ZJIA 2BAQA 2QOCA 2WMUA 3PIZA 4ZTNA 3KRJA 4EH5A 3FSKA 5K4IA 4IM2A 5E9EA 4NM7A 2UZLA 4G3FA 3PE2A 2E2BA 2J7TA 3EN4A 2H34A 3DB6A 2VNWA 3I1AA 4LL5A 2XYUA 5CVFA 3WE8A 4R77A 3OEFX 3I5NA 2QOIA 2W96B 4EC8A 2WTVA 2ZV9A 3EQCA 2X8DA 4IWPA 2A19B 4C59A 1IRKA 2IW8A 4BCNA 3D7TA 3KMUA 4GIHA 3FQSA 4KUJA 2X7GA 1UU9A 2XEZA 4GSBA 3PXKA 4FIGA 3DY7A 4KINA 2XCKA 4K18A 4MX9A 3OW4A 4QMWA 3KCFA 4RA5A 5J5TA 3QGYA 4ZJJA 2W5HA 5HZNA 4EC9A 3W33A 2BDWA 2PVFA 4P4CA 2PVHA 4EJNA 1R0EA 3EWHA 3QXOA 2CJMA 2X9FA 4IDTA 5CAUA 5JKGA 1YWVA 4J53A 3AXWA 3IO7A 4FSMA 4QT1A 4YZ9A 5EKOA 3WYYA 5JSMA 4O7SA 3LFDA 1SVGA 5B2KA 4DAWA 3VHEA 1KWPA 2W4OA 2C3KA 3PVBA 1ZYDA 1Q8ZA 3EYGA 4ITJA 4X2NA 3PJCA 4ACHA 3BYOA 3R8UA 4GJ3A 2HXLA 2EU9A 4FOCA 2NRUA 4QMLA 4A9SA 3R04A 5H8GA 3BYSA 5K4JA 5AUVA 3F7WA 5CU6A 5HTIA 2HAKA 3DJ6A 3FKNA 5JEBA 2I7QA 5DNRA 1DS5A 5E4HA 5AUUA 5IUHA 2WAJA 5BQ0A 4ALUA 3LVPA 1H8FA 1H0VA 2YIXA 2B52A 5BVWA 3QFVA 4RLLA 3ANRA 3QCXA 2J0KA 3OY3A 3QRIA 5A4QA 3TNQB 2GS2A 2GU8A 3P5KA 5L6WL 4B8MA 3KY2A 2HY0A 5F1ZA 4X3JA 5HCZA 1M52A 3KRWA 2YITA 3TT0A 5BUJA 5DRBA 2JKQA 3MFRA 1SM2A 2OGVA 3MIYA 5CNOA 4QMVA 4OTDA 3S95A 1YVJA 5BVKA 4IB0A 4BWPA 4U6RA 5I5ZA 5GHVA 5CENA 1OB3A 4AGUA 4I22A 3FZSA 4MKCA 2UZBA 1FINA 2QCSA 3CGOA 5CEKA 4ZS4A 3M42A 4ZLYA 4O0RA 4KABA 3RPRA 2PK9A 4MYGA 3WZEA 4TWPA 4YC6A 3D5WA 4MD7E 3RCJA 3FLQA 3GU6A 5HVJA 4WHZA 3V3VA 4QTDA 4O7LA 4G5JA 4D9UA 3QRKA 4E4NA 2E9NA 3QD0A 3UP2A 4XG2A 4DG2E 4XCUA 2X7OA 4UMTA 4IXPA 1PRYA 5AEPA 3L9PA 4HGSA 4QTEA 5ICPA 4O86A 3BV3A 1FVRA 3TJDA 4U9AA 3WF5A 1K2PA 1ZMUA 2XM9A 4PL3A 4BDFA 4G31A 1YHSA 1OPLA 4HYSA 3PLSA 2OW3A 2R3JA 1RDQE 5HLWA 3TUCA 3BYUA 4KS7A 4QP1A 5HIEA 3GC7A 5AP1A 1W7HA 3HP5A 4MTAA 5J8IA 3ZLSA 3KN6A 3QC9A 1Q61A 2J4ZA 4QMYA 3OW3A 4PPAA 4BKYA 4QOXA 1K3AA 3PJ3A 1P2AA 3C5IA 2OZAB 5FTOA 1QPCA 2XUUA 3KU2A 1XBBA 3MVJA 1SNXA 3D2KA 4ANQA 4D2SA 3ZC6A 4OTIA 3UJGA 5FD2A 3HYHA 4YTIA 4ANBA 4X21A 3U8WA 3QALE 3LE6A 1QPEA 1J1CA 3E63A 2XNOA 3LXLA 2C6KA 2R3GA 4L8MA 4X0MA 5FP5A 1SVHA 3L9MA 3JY9A 4PP9A 4QMSA 4RLKA 4FUYA 3HEGA 4K77A 4OLIA 3TEIA 4PPBA 2OIDA 3LIJA 5B0XA 5J1VA 3G9NA 2ZB1A 3N51A 5EDPA 4K33A 4FI1A 3MY5A 5I3RA 2CNVA 3F6XA 3G6HA 3CD8A 3KK9A 4ID7A 5HCXA 3JYAA 2CLXA 3BGPA 4U8ZA 4ZY6A 2VRXA 1PMUA 3ZXTA 3W2OA 3F3TA 5CT0A 3R8PA 3A7HA 4IX6A 4FEXA 2OXDA 2UW8A 2W9FB 2VTHA 3FUPA 5M4CA 2XNMA 3C9WA 2GQSA 5AX3A 3R7UA 3DLSA 3TWJA 4YJVA 4PMTA 2ZYBA 4KBAA 3EQGA 3KFAA 3MY0A 3NW7A 5CQWA 4A06A 5KMNA 3UQCA 2Z2WA 4MNEA 4FTLA 3ROYA 4PP7A 1PMVA 4TNBA 2RIOA 4FV4A 3ZOSA 2JC6A 4F6WA 2Y4IC 4WNPA 4CFVA 4R1VA 2Y7JA 2FSTX 5IQFA 2YWVA 2A1AB 5DHJA 2FSLX 3NYXA 3Q2MA 4PY1A 4RFYA 5T3QA 1Y6BA 3TZ9A 4A7CA 5JFXA 5LWMA 4FIHA 2B9FA 3BCEA 3RI1A 3SKCA 4ZSEA 3VUKA 4C61A 1PXLA 2FSOX 2XK6A 4BN1A 5A4TA 3P0MA 4DCAA 3R7GA 5B2LA 4E26A 4EWQA 4EYJA 2FVDA 2BROA 2A27A 4IAYA 3MY1A 3EMGA 3SOCA 5AUZA 3DOGA 4KIKA 1NVRA 3ZLWA 2C5XA 3QXPA 4FV7A 4YPSA 1WBWA 5HVYA 3UPZA 1JKSA 4F1MA 5ANJA 3S4QA 3E7OA 4YLLA 2QONA 3WZUA 2J0JA 4NIFB 4BF2A 4F0GA 3F66A 4GUBA 4XG6A 3MN3A 3VC4A 4C33A 1ZYJA 4BZNA 5EHYA 5BPYA 5HU3A 4EOPA 4ZTSA 5BMMA 4ZOGA 1WCCA 1LEWA 3ITZA 3UMWA 4BDGA 4RWIA 1V0BA 4L52A 2BMCA 4M7IA 3UQGA 2XNGA 4IZ5A 3QQHA 4YTCA 3EKNA 2ZAZA 4QYFA 3DXPA 3UBDA 5DWRA 2RFSA 2OIBA 4NKSA 5CNNA 3BLRA 2WTIA 5FBOA 1YI6A 4PWNA 4U81A 4RX5A 3KMMA 2OIQA 3FL4A 4O27B 2C3IB 3KB7A 2AUHA 5IEVA 4USFA 4DGLC 1H24A 1LUFA 2GDOA 3BE9A 2FO0A 3UODA 2VTPA 4O0WA 2GNFA 4M69B 4MF0A 2J2IB 4IB3A 5D41A 5KO1A 4B99A 3W10A 3ZO1A 1OIYA 2UZTA 3GU8A 4ASZA 2V62A 4HNIA 5A4CA 4YGAA 4O1OA 3C4ZA 3KXZA 3O7LD 5TO8A 4LRMA 3GNIB 3M1SA 4GEOA 4I0TA 4HZRA 3ZZWA 4G1WA 1W98A 4FZDB 4JDHA 5CX9A 2XEYA 3CSVA 4A9RA 2CCIA 2F7ZE 4O0VA 4YC3A 3JPVA 1ZZLA 4FZAB 4CSVA 3Q53A 5F20A 2O3PA 3QWJA 3MW1A 1RW8A 2QODA 4N6ZA 1OKYA 3UC4A 4EWHA 4ZZNA 2W17A 4AAAA 4UMRA 4QQCA 4FOBA 5KE0A 3ZSIA 5GZ8A 1GZ8A 2WOTA 4D2TA 5A9UA 2WKMA 3DAJA 5IISA 1I44A 2V22A 4TY1A 5E8SA 4TRLA 3ZHPC 3MJ2A 4FVRA 4RRVA 4RX8A 4S31A 4D4SA 5K0XA 2J0MB 2YLFA 5IQGA 3F69A 3UYSA 4FGRA 2X2LA 4HW7A 1BMKA 1KE5A 2I0HA 3CKXA 4N0SA 4EEVA 4F1TA 4K11A 4C4HA 3TNWA 3OUNB 2E9VA 4D1XA 2VTOA 1JAMA 1XKKA 4XG9A 3FSFA 2WTJA 1Q99A 5DT0A 3RNIA 5JMSA 3AD6A 4XV1A 2C6DA 5BYYA 3PJ8A 3BEGA 4LFIA 5CI6A 2VU3A 2Y4PA 3GCUA 3RMFA 4O91A 4FG8A 2XIRA 3AG9A 2V5QA 5CF4A 3QQUA 5I9WA 5L2WA 4JNWA 2QG7A 3BRBA 3QRTA 4YP8A 2BRMA 5J87A 2E9PA 2OXYA 3PY1A 3QLGA 3RKBA 2RG6A 4FK3A 4IVCA 4F09A 4KBKA 5AP5A 1DI8A 4OAVB 5EK7A 2XNBA 2AYPA 3I0OA 1E9HA 4UV0A 3CBLA 5FG8A 4E8AA 2WMRA 3KL8A 3WBLA 4YJPA 3FE3A 5AP7A 4ZTHA 4C37A 2VO3A 2X0GA 3NRMA 5FXSA 4S34A 4OTFA 4TYHB 4CV8A 4ACMA 2CDZA 2PZYA 2RFNA 3OUKA 4JBVA 4TT7A 2ITNA 1PXJA 2V7OA 3Q5IA 3MFTA 4GKHA 5CU2A 3U4UA 4CGAA 3KULA 4EOIA 5CF5A 3RK9A 1UKIA 2X81A 4H05A 4I21A 5M55A 4IAZA 4NTTA 4ANLA 4M68A 2G2HA 3FYJX 4ZK5A 4L45A 4TYIA 4DBNA 3ORMA 4L44A 3ORPA 3G2FA 4IC7A 3SDJA 5JGAA 1NW1A 4NFMA 5FXRA 2EXCX 1KE6A 3R7YA 3QKMA 3GP0A 5LVNA 2PPQA 1PF8A 1APME 2C0OA 4QMQA 2Y6OA 4HCUA 4MXAA 4PRJA 5C03A 3RPSA 4A4LA 4DH3A 3A60A 4Z55A 1OKVA 1ZOGA 3FZ1A
chains in the Genus database with same CATH superfamily
1ZLTA 4E1ZA 5BUEA 4UX9A 4WBOA 3U51A 1H08A 2GNGA 2QOKA 3FI2A 3NUUA 2QKWB 3PP0A 5LJJA 3S1HA 2XB7A 4AWIA 4D4VA 2WQOA 4JG8A 4V0GB 2ESMA 3QWKA 2F9GA 1FBNA 3P7BA 3HUBA 3KN5A 3KF7A 1J91A 4JR7A 5HE3A 5KZIA 2QOHA 2WZJA 4RFMA 4UYAA 4ZLZA 4S30A 1G3NA 3Q9XA 1SNUA 4CKRA 1YXUA 4RX9A 3FLZA 3TV6A 1YOLA 3ZO4A 2P0CA 2PVRA 3R71A 4GRBA 5EKNA 5HLNA 4FT5A 1ZY4A 4BDEA 3I0QA 4Q5HA 2J9MA 3UOHA 5IH5A 4FEVA 3MWUA 3O5AA 3DFAA 4IEBA 4ZTRA 3ALOA 2WB8A 4U7ZA 5HG9A 4GW8A 3IW6A 5HEZA 2IZRA 3V51A 2CLQA 3F61A 2VWIA 1PXKA 1QL6A 3MVMA 4FJVA 2WFYA 3AT4A 3GBZA 4D0WA 4KRCA 4ASDA 4IAKA 3TM0A 5F9EA 3H30A 5HX6A 4HCVA 3K5UA 4M0YA 4Q9SA 4RJ7A 4E5WA 3AMAA 1IA9A 2BR1A 4PPCA 3UNKA 5HD7A 3P9JA 4TNDA 3UG2A 3ZO3A 4TWCA 1R3CA 4AA5A 4PMMA 3IKAA 4J71A 2OF2A 3NLBA 3SC1A 1GZNA 3BHUA 3PXQA 3GCSA 1QCFA 4ITHA 3SXRA 2AQXA 3AC5A 1W82A 3TZMA 2VTLA 3IK3A 4BVUA 3SG9A 2RGPA 3TKUA 5IF1A 4P2KA 5HGIA 3A61A 1G8JA 1M7NA 4U3YA 3BL7A 1BI7A 4YLJA 3BEAA 3GT8A 2GFSA 2IVTA 2ZM1A 3QCQA 2REIA 4FKOA 2PL0A 4B7TA 4CTBA 5HG5A 3NNXA 5HHWA 3TV4A 3EN9A 4YJRA 4FKWA 1CMKE 2R3FA 5CY3A 3DV3A 3FHIA 4Y95A 2CN8A 2KULA 2X4FA 4K2RA 3V04A 3W2SA 2GS7A 3EQRA 3UO4A 4GKIA 3HV6A 3QTXA 4AP7A 4CZTA 4AG8A 4DT9A 1W8CA 2UVZA 3EL7A 3IDCA 3QHWA 5AR2A 4JX3A 3QZGA 5AR3A 5KCVA 4AXDA 3R0TA 3QHRA 3O17A 2BKKA 3UO5A 3PRIA 2A0CX 1YKRA 3EZRA 3UNJA 3NFFB 4KIOA 2YABA 1YXTA 4L43A 3DA6A 4FKPA 4O2PA 3TTIA 5C01A 4GS6A 1IA8A 2YZAA 3CP9A 3HMPA 5H8BA 2J6MA 4DFYA 1KE8A 4BZDA 2XJ1A 2CKQA 5C4KA 5DLSA 3R8MA 4F1OA 3OWJA 4HCTA 4FKUA 5IG1A 2XK4A 3R63A 3SGCA 2OH4A 5LMKC 4ZSJA 1TKIA 3FXZA 2X8IA 3PJ1A 3RHKA 3LLTA 3LCKA 4F6SA 3AD4A 1ZYSA 2C6TA 2PMIA 2XYNA 4IBMA 3SOAA 1BKXA 1OKZA 4CD0A 3PPJA 3H9OA 4I4FA 3ZCLA 4L6QA 3FV8A 3FYKX 3GVUA 3T9TA 4L67A 1UWJA 4YZDA 2VD5A 4DFXE 4QMPA 3NAYA 4GFOA 4QMZA 4WG3A 4M12A 3DXQA 3RAHA 3PXRA 3AC2A 4FIEA 2E9OA 3ZMMA 3HDNA 2HZIA 2DYLA 3BBWA 1QMZA 4L3JA 2VUWA 4ENXA 4MF1A 1H07A 3MH2A 4D4YA 3U6JA 3MH0A 3W0PA 2F7EE 4WNKA 4O7VA 3QQJA 4C34A 1O6KA 3Q60A 4YO6A 2B1PA 3C0IA 4HZSA 3RBWA 2R9SA 4IHPA 4OW8A 3DJ7A 4MD9E 3R01A 4G9CA 5J79A 3LKMA 3FJQE 4C3PA 3LFFA 5I9XA 4DA5A 3IGOA 4FV3A 4KS8A 3RZFA 3Q4CA 1U46A 1ERKA 2PULA 1ST4A 3HAMA 2JEDA 4II5A 3QTQA 1SZMA 3V6RA 3A7FA 1MQ4A 4BGHA 2CNQA 3C5UA 3DZOA 2YISA 3R21A 4RMZA 4S32A 3PXFA 2I0EA 4IZAA 3CJFA 5AV0A 3WE4A 4YHTA 4M97A 3C4EA 5L8LA 4FKQA 5IQBA 5LQFA 4H3QA 5FGKA 5HNBA 5IMXA 4JR3A 3P7CA 3QGWA 3W32A 3FI8A 4XP0A 2X4ZA 5AADA 2KTYA 2VX1A 4QMOA 4UY9A 3UDBA 2ITTA 5FDXA 4DEEA 3FZOA 5L6OA 3QTSA 4IB5A 3LCSA 1FMKA 5HORA 2VTIA 4JLCA 3QKKA 4FYOA 4B4LA 1ZYCA 2QHMA 4UMUA 4O81A 5DG5A 1REJA 3OTUA 1BYGA 1M2QA 2C6EA 5JH6A 3ERKA 3BX5A 3DKCA 3WF8A 2WMBA 4QP7A 4EK5A 4O7RA 3EL8A 1BX6A 2DQ7X 5GJFA 3TIZA 4J8NA 4CLIA 2EWAA 1JSTA 4RIWB 3VBVA 4DTBA 3GXLA 4J95A 4HVGA 5JZJA 5DFPA 2X6EA 5IQHA 4O96A 5EW3A 5LWNA 3LMIA 2ONLA 4RIXA 2R0UA 5GINE 5I9UA 4UZDA 4FTRA 2VAGA 4FV6A 4YBJA 3VHKA 1OL2A 2NO3A 5HU9A 5CEQA 4HGTA 4CVAA 1P14A 3AMYA 3CJGA 2X2KA 4IM3A 4ONAA 3U9CA 1GNGA 2UW6A 4ZY5A 4FSTA 5CF6A 2B54A 5AAGA 2PZRA 3QQLA 4FODA 2IWIA 2VO6A 5A14A 2C0TA 4QRCA 4AT5A 3AKLA 4APPA 4ANMA 2GHLA 3GQIA 2HW6A 3MB6A 3D2IA 4JQ7A 3FZPA 3GU4A 5EI2A 3VRYA 3E5AA 3UZRA 2GHMA 2WU7A 3D83A 4R6VA 4XS2A 3ZLYA 4E6DA 3BWFA 4IWQA 3RTPA 1J1BA 3RPVA 2YCRA 4AW0A 4BCIA 5FM2A 4QTAA 3MA6A 5LARA 4XV2A 2R3OA 4XG3A 4YMJA 4RWJA 1V0PA 3NWWA 2R0IA 3RAWA 3IW4A 2B9JA 2DS1A 3FXXA 1IG1A 2O5KA 1KV1A 3HMIA 5IPJA 5LCJA 4HYUA 5A6NA 5HQ0A 4DHFA 4PUZA 4M15A 3HV3A 1JVPP 3VUTA 3W2CA 4Y73A 2BDFA 2EB2A 3RWPA 5C8KA 4WA9A 3OCBA 2ZDUA 1R0PA 4EH6A 4AZWA 1ZAOA 4U5JA 3MDYA 3VULA 1CM8A 2P55A 3G5DA 2HW7A 3FI3A 3AT3A 3VWAA 1XH8A 2I1MA 3QD4A 2IW9A 3T8OA 4ACGA 2UZNA 1OGUA 2YM3A 3UVQA 2F4JA 2WGJA 2C3LA 4BL1A 3O2MA 4K1BA 3WZJA 2BVAA 4FT7A 4YZNA 4WT6A 4PNKA 1YXSA 3UVPA 1IASA 3SX9A 4AXFA 4C35A 4M67A 3HRFA 4ASEA 3A7IA 5K5NA 3L8SA 3U9NA 2C30A 2BZHB 5IA0A 2YJRA 4C3RA 3NX8A 2OZAA 2XRUA 3FLWA 2WQEA 3II5A 2F7XE 5AUWA 2J90A 3T3VA 2OZOA 3EQHA 3PIXA 1HCKA 3UMXA 1Z5MA 4Z9LA 4EH7A 3EN5A 4BFMA 2YAKA 3GCPA 1GIJA 4XOYA 3CQUA 5AV4A 3BGZA 3CY2A 3FI4A 5CVGA 4FICA 2RFDA 5D10A 2W1CA 2XBJA 3TIYA 4K8AA 1U5RA 4ERKA 3UO6A 4JIKA 5HTBA 4UN0C 3C4XA 1MUOA 2WQNA 4ZXTA 3LW0A 4RA4A 4LUEA 4NCTC 4JDKA 4EOJA 4ZLOA 3EQDA 3OY1A 4DEHA 3GU7A 3TZ8A 4A9YA 3MJ1A 3O7LB 2BZKB 4IWOA 5CQUA 5JT2A 4CFUA 3TNIA 4AW1A 1JQHA 4USEA 3SAYA 5LMKA 4R7BA 1H1RA 4XG8A 1H00A 3ENHA 3V5QA 4E5BA 1FGKA 2Q83A 3HAVA 3F5PA 3LFSA 4JRNA 3ZFMA 4JBOA 2VTJA 3HP2A 4DH7A 3LM0A 4DFBA 1V1KA 2E9UA 5FP6A 4YHFA 2VWBA 4QP6A 1STCE 4JS8A 4W8DA 5AR8A 3V6SA 4YR8A 5IMEA 4CRLA 4DLJA 4DGOA 3WF9A 2W05A 4ZSLA 4FNWA 3D15A 2FUMA 5EW9A 3ACKA 3AC1A 3NW6A 4YJNA 5AIKA 3D0EA 5FEQA 3SVVA 3TG1A 4YHJA 2ZV7A 4L42A 2WHBA 2QU6A 4FIFA 1Q3DA 4NH1A 3TXOA 2J5EA 3BU3A 1T45A 1OIQA 4GL9A 4EH8A 2ZDTA 4R5YA 3C4FA 2YM7A 3G6GA 2Z7QA 4UMPA 5IDPA 3CIKA 3GC0A 3ODZX 4TW9A 4V05A 5CTPA 4CFWA 2I0YA 2XS0A 3ORIA 4OAUC 4EQMA 2YA9A 3MYGA 4MBLA 3PP1A 4J98A 3RAIA 3V8WA 4EOQA 3GFWA 4WO5A 4O38A 3BQCA 4QMMA 2GNHA 5FLFA 2QOQA 2B55A 2G2FA 5KMLA 1I09A 2DWBA 2Z60A 4EK3A 2BIKB 2VWVA 5AJQA 2GSFA 4OR5A 2BIYA 2QO2A 3VW8A 2QI8A 1KOBA 2J0LA 4JT3A 5LCKA 4Q9ZA 3ZLXA 4BJJA 2V0DA 2EVAA 2W1EA 2HIWA 5TT7A 2BZIB 3VO3A 4OTGA 3WI6A 5GIPE 4KKHA 1ND4A 4FKGA 2WTDA 5L6PA 2B4SB 3L9NA 4QTCA 2PMLX 3RWQA 4BCJA 1BUHA 3EQFA 2A98A 1PJKA 4MCVA 3AT2A 4GK3A 4R3CA 4RJ4A 4FKRA 5EHLA 2JDSA 4CYJA 2HZ0A 4JVGA 3VRZA 4GU9A 3BLQA 3GOPA 5BMSA 2WEIA 2B53A 3ALNA 4YLKA 3EH9A 3KIOC 5IA2A 2VTNA 4FNXA 2ZFYA 3KXMA 3HMMA 4M69A 2IW6A 4DGGA 2JBPA 3TN8A 4FTTA 3VS6A 2UV2A 3W8LA 4L3PA 1O6LA 4G3CA 5CYIA 4C62A 4FBXA 3V5TA 3VUIA 4AXAA 3AC8A 4B6LA 1H28A 3DK6A 4CZYB 3TMOA 4G34A 2CKOA 2HZNA 3T9IA 2YERA 1JPAA 4UXLA 1W2CA 5E8VA 2HWOA 1OBDA 3IW5A 2P2IA 4DFZE 4O83A 5J95A 2AC3A 4DN5A 4AE9A 2ITYA 4O0YA 5L8JA 5I9ZA 3NUYA 3KXNA 2BRHA 3Q4UA 4F4PA 3NCGA 4EZ5A 1Q62A 5CF8A 2GNLA 1A9UA 1PMNA 3DCVA 3IW7A 1YXXA 4OBPA 2W9ZB 3V01A 4W4VA 2W99B 5IA5A 1MQBA 3LJ2A 4H36A 3SW4A 3LJ0A 1ZMVA 3MH1A 4KA3A 3ZU7A 2NRYA 3JXWA 3EQBA 4XV9A 2R2PA 5C26A 2PVLA 3GI3A 3R9HA 5HG7A 1SVEA 2VGOA 2GNJA 3DB8A 2GCDA 3JY0A 5KMKA 4S2ZA 1MP8A 3OFMA 5DVRA 2V55A 5GZ9A 4E6CA 3WIKA 2H96A 2XKEA 4R7HA 4RC2A 5FEDA 1UV5A 1LPUA 4D2WA 4XG7A 5AR7A 3SLSA 4FIJA 4FTIA 2WMTA 5C1QB 4F7JA 4BDBA 5G1XA 1CKIA 1PXIA 3A8XA 3QZFA 4IH8A 4C3FA 3L8PA 5F95A 4RPVA 4I93A 4A9TA 2ZJWA 4RBLA 4BCQA 3ZFYA 5BUIA 1KSWA 4K9YA 4R78A 3GC8A 4R3PA 3FMKA 3VUGA 4D5HA 1REKA 3MBLA 5CASA 1YHWA 3H9RA 3NCZA 1GZOA 1XH5A 4L46A 3LPBA 5A3XA 2OU7A 3AC4A 2QLUA 2OK1A 3P4KA 1FQ1B 2CNUA 4G6NA 3RVGA 1W2DA 3LMGA 1WBPA 4FVQA 1O6YA 4KIPA 4BBFA 4YPDA 4QPSA 4R1YA 3V8SA 5AR5A 3W2QA 3S0OA 4NUSA 3PA3A 4PMSA 4TYHA 3DBDA 3GUBA 4RFZA 4GT5A 4Y85A 4EBVA 3GB2A 4BHNA 4ACDA 3LLAA 3MTLA 2Z8CA 3TCPA 3VONA 4FX3A 3OBGA 4MQ1A 3JR1A 3FPMA 3TNPC 4BZOA 3FKLA 3QL8A 4C8BA 3U6HA 4YJUA 4FEWA 2OKRA 3P1AA 1VJYA 4XX9A 2IVUA 2CGXA 4NCTA 4ZTLA 3DAKA 4F9WA 3QA0A 1OIUA 3FMHA 4FTKA 3NUXA 1QPDA 5LXMA 2YN8A 3RK7A 4RWKA 4TYJA 4BTFA 3TUDA 4BWKA 2W5AA 3QD3A 4D58A 4G2FA 5EQPA 5EOBA 4DEDA 3DGKA 1VYWA 2B9IA 4DGNA 5AX9A 5FM3A 4CQEA 3UGCA 3A7GA 4D0XA 2YFXA 4BY9E 4BGGA 1B6CB 1OM1A 3QF9A 4OTQA 3QTUA 3TTJA 5FTGA 4V0GA 4CKJA 1BL7A 4NM3A 4DTKA 3ID6C 3PG3A 4FGBA 5GZAA 3OCTA 3AQVA 3TDWA 2J0IA 1XHAA 2ZV2A 1QPJA 1UU3A 2O0UA 2XA4A 1UNLA 4EH3A 4FNZA 2ZOQA 3DK3A 2BALA 4I20A 3R9RA 5DN3A 4B0GA 4QQ5A 4DDGA 4G6LA 2QQ7A 3R9NA 1YDSE 3EHAA 4LM5A 3Q32A 3MPAA 3PSDA 4W9WA 4JJRA 4WNOA 4CCBA 5AR4A 4EOOA 2R64A 4IAIA 2HXQA 4C2VA 4DG3E 4WIHA 4QMXA 5L2QA 2FH9A 4C58A 2VWUA 4CMUA 3HUCA 2XF0A 4YTHA 2XK7A 2XVDA 3QA8A 3C51A 2X2MA 3ZBXA 5E90A 3LZBA 4YC8A 4OTWA 3DBFA 3TJCA 3HX4A 5T68A 3PFQA 2GQGA 3R7IA 3R6XA 1P4OA 3ZC5A 3TACA 5EM6A 3KVXA 1BL6A 2W1GA 1NXKA 4G5PA 4BIEA 4QDVA 2UW4A 4I6FA 1CDKA 3B2WA 4IWDA 3MVHA 5AA9A 1GAGA 2UW3A 4E6AA 3KRLA 4BDCA 2IEWA 2RG5A 4H1JA 4O7NA 1XMLA 5CSXA 3VS5A 2R3KA 1NA7A 3E7VA 1L3RE 4W9XA 5CS6A 4O7WA 5M08A 3KQ7A 5EI8A 3OXZA 4GK4A 2R5TA 4ZY4A 2QD9A 3O96A 1P4FA 1XO2B 3HZTA 3OWPA 3CS9A 3UQFA 3ET7A 4IB1A 1Q3WA 2R3MA 4QEBA 1PMEA 5EFQA 1OECA 4GFMA 4GVJA 4FTMA 3CC6A 4JL9A 5HIBA 2XNEA 5DT3A 3R2BA 4R7IA 1JWHA 3DT1A 5HCYA 3RALA 5E1SA 3E8EA 3QKLA 5I4NA 1J3HA 4E4XA 4IQ6A 2XM8A 5H9BA 3M11A 1TVOA 2JIUA 5DEWA 4BDKA 2OLCA 1ZYLA 2ITWA 1M14A 1WMKA 1DM2A 2C6LA 1GY3A 1HOWA 3FLYA 2F2CB 3OF0A 1LP4A 3H0YA 1WAKA 3VF8A 4YU2A 4IM0A 1GOLA 4MEDA 4H3BA 2PVKA 3FHRA 4QP8A 4BCOA 1ZOEA 3GQLA 4DFLA 3ORKA 4KAOA 2GTNA 4DT8A 3D5UA 4BDIA 3K2LA 1Q5KA 2VTMA 3ZO2A 4F0IA 1H1SA 3VW6A 2XMYA 5CZHA 4KKGA 5HESA 1UU7A 3PY0A 5IZFA 4MUQA 1FVTA 3I7BA 3O71A 2HELA 4P7EA 5ANEA 1ZMWA 4I6BA 3Q9YA 2ITQA 2YHVA 4D4RA 2PHKA 1CSNA 5CSPA 2QO7A 3ZM4A 3KK8A 2OO8X 4Y5HA 2XK8A 4HGEA 3ZTXA 3NYNA 4NWMA 4C4GA 3G51A 4JXFA 4UMQA 3BL9A 5HBHA 4E4LA 5IQIA 1U54A 3DLZA 1J7LA 5B7VA 2WQBA 4NW6A 5L2SA 2OI4X 4FV9A 3TV7A 3LOKA 5GJDA 3OMVA 5ANIA 4BCMA 3R7OA 5C8MA 4LGDA 1ZY5A 4JQEA 3WOWA 5JK3A 2BILB 4IANA 2AEGA 5CVHA 3PVWA 4NM0A 2Y8OA 3CXWA 4FV0A 5FTQA 3DJ5A 4FSUA 3A99A 3I79A 2PZ5A 4F99A 4E93A 2PU8A 4E7WA 3LHJA 4PQNA 2HOGA 4G3EA 5HKMA 2C69A 4WD5A 5CEIA 4AZFA 5TKDA 3NUNA 4DEBA 4RSSA 4LI5A 3NUAA 2QO9A 4IX3A 3COHA 4HGLA 4RIYA 3SXFA 4R5SA 1WBVA 5AWMA 2QU5A 3ACJA 4G16A 4O6LA 4CT1A 2WMAA 2PUNA 2B9HA 3LXKA 4FE2A 3N4TA 5E8YA 4XLVA 1AGWA 4FIIA 2Z7SA 3ZSGA 1Q24A 4QMNA 5IH4A 4CXAA 4QNAA 5J7BA 1W83A 3DPKA 4TXCA 2UZDA 4FUXA 3REPA 4C4JA 4RWLA 2YEXA 2SRCA 4L7SA 3VS2A 4CCUA 5KMJA 2R3PA 2BHEA 3QTIA 4G9RA 3BI6A 4X6QC 3SHEA 2ZM3A 5ANGA 2G1TA 3I81A 4FSRA 4RIWA 1H27A 2OJJA 2WMVA 4YJOA 4YNOA 1BLXA 4I1ZA 3UIXA 4AXEA 3Q5ZA 4IMYA 4G3DA 5I9YA 4BB4A 4QQTA 1W0XC 3LQ3A 3OEZA 2XIZA 1F0QA 3QQGA 2UZUE 4XHKB 4MWHA 3TZ7A 3H4JA 3I4BA 1E1VA 4RQVA 1OVEA 1TQIA 2ITXA 4NJ3A 5M44A 4F9CA 4F0FA 3W8QA 5L4QA 4MXXA 4XNEA 2YIRA 4AT3A 1H26A 1Y8GA 4XRLA 5CEMA 2JDVA 3MSSA 4QTBA 3FC2A 4I6HA 5AAFA 3DTCA 3EOCA 4YJQA 1OIRA 4F7LA 5EQYA 3F5GA 5FEEA 1S9IA 4D5KA 2PUUA 2W1HA 2QR7A 3LFEA 4EI4A 4XEYA 4C36A 5L2TA 5JN2A 1YDRE 2RL5A 5KHXA 1FPUA 1NT2A 3QTRA 3PYYA 5M09A 3OBJA 4FSWA 2UW5A 3RAKA 4ZAUA 3QQFA 2YM5A 4WG5A 3KRXA 5HOAA 4M66A 4CFXA 3SV0A 4FTAA 3DQXA 4OT5A 3ZS5A 2XCHA 3SRVB 3IGGA 5AP2A 5DMZA 1WFCA 4O6EA 4YZMA 3G9LX 3DKFA 4DG0E 4ANNA 3OWLA 3VF9A 2XJ2A 4RJ8A 1TFFA 4DEAA 4O0TA 5IA1A 2A4LA 3W0RA 3K54A 3MVLA 4TPTA 4I5CA 2WU6A 3PRFA 4FC0A 4OTPA 4PV0A 3EFJA 4YBKA 5GJGA 2VO7A 4KSPA 5ETAA 4D1SA 5LVMA 2VZ6A 3LXNA 1BI8A 4CV9A 4IVAA 1H25A 4DH1A 4U45A 5KBQA 1YOJA 4FZ6A 2PYWA 4ZSAA 3R73A 5DA3A 5HVKA 4JI9A 2W5BA 3VIDA 2WO6A 2JDRA 4DH8A 4RQKA 1OL1A 2JIVA 5C4LA 3COIA 4AX8A 2Z02A 4KBCA 2HY81 4JQ8A 3DBQA 4AA0A 2QR8A 3TI1A 4Z7HA 4WG4A 5DI1A 3R1QA 4O7ZA 5J5SA 1ZWSA 2NPQA 2JFMA 1UNHA 4J97A 3O51A 3FQHA 2C68A 3RJCA 4KIQA 1P5EA 5DEYA 3K3IA 5J1WA 2ACXA 4QYYA 1PW2A 1VYZA 4M3QA 5CAPA 5IQAA 4FTNA 3KGAA 2B0QA 4JDIA 1OL6A 5IQEA 3Q96A 2X0PA 4HJOA 4GV1A 5EW8A 5EYKA 2PUIA 3VNTA 5J7HA 2QOBA 2W1FA 4IZYA 5AP0A 3D9VA 3B2TA 4BKZA 1J7UA 3I60A 3BU5A 5KMOA 2OFVA 4OGRA 5DRDA 3NW5A 1YI3A 3DNEA 4TWNA 2H6DA 4E5AX 3T3UA 4XBRA 4NEUA 3VS0A 2ITVA 4L68A 4U43A 3PSCA 3V5WA 2QOLA 3Q6WA 4BDJA 1F5QA 3PLAE 2ITZA 4QMUA 4CMTA 4BTMA 3QC4A 4FL3A 4XH6A 5HD4A 2X0QA 4NL0A 1NY3A 4DHZA 2VWWA 4FT9A 4QP3A 5EM7A 1XH4A 2GFCA 4RC3A 1FOTA 3EFWA 3OC1A 4MBIA 3VUMA 3OOGA 3HVCA 1OI9A 1Q41A 5CU3A 3RPYA 5A6OA 3AOXA 3HMNA 3R9OA 4IACA 4NU1A 5ACKA 4F9YA 4QD6A 3LXPA 5J9YA 2JAVA 2UVXA 4AUAA 4CZUA 2WTWA 3VBTA 2WMQA 3W16A 4IJ9A 5DBXA 4LV5A 2X8EA 4EHZA 5IEYA 3FKOA 4JBPA 3I6WA 3R1YA 4XRJA 2IZTA 1URCA 4BGQA 3ATSA 4AS0A 4YZBA 3IECA 4I0RA 1SMHA 4CFFA 1Q8WA 1T46A 2IN6A 4GJ2A 4I5MA 4RVMA 5AV2A 5ANOA 4NTSA 5M07A 2W4JA 3VS4A 4FV2A 4UXQA 2Y4IB 3NFGB 3E62A 2ITOA 3RPOA 3PXZA 4A9UA 4M14A 4EBWA 5D7VA 4EQCA 4O82A 4FMQA 4PF4A 4OTHA 5L3AA 5CSWA 3HV7A 2OJIA 4JBQA 4TWOA 1DAWA 4WSYA 3UVRA 3K3JA 2PSQA 4WRSA 5H3QA 4HVHA 5E8WA 5D12A 2PY3A 2X39A 3NS9A 3KEXA 3POOA 4LMNA 4X2KA 4IFGA 4RG0A 5HIDA 3VS7A 5CXZA 3FEGA 1PXMA 3KCKA 3CTQA 4LGGA 3ZFXA 3ZRKA 5EYMA 3PY3A 5M53A 2O8YA 4YTFA 3F3WA 4MNFA 4DBXA 4W8EA 3F2AA 2EUFB 4P5ZA 3R02A 4ITIA 4Q2AA 2UZEA 1Y91A 3BBTB 3HMOA 1OBGA 4AA4A 3R00A 4F65A 3RGFA 4XP2A 2CMWA 4LL0A 4AU8A 2IPXA 1OPKA 2HENA 4QQJA 4AGCA 3E8NA 5CWZA 4FSYA 2ZM4A 3ZYAA 2IZSA 3C13A 4WUNA 3R8VA 5ANKA 2JBOA 5E1EA 3VQUA 2OICA 1H1QA 2R3LA 3O8TA 3OCGA 4FVPA 4UBAA 5AMNA 4JRVA 3UZPA 5TE0A 4GG5A 4XG4A 4MXZA 2OJFE 4HNFA 5IUGA 3N4VA 4O7YA 4J8MA 2EXMA 2GMXA 2PZPA 3OD6X 2JDOA 2ZMDA 1O9UA 1M7QA 2R3RA 5CANA 4ZEGA 2YM4A 3ELJA 2P3GX 2PZIA 3IDBA 1TQPA 4FTQA 3W55A 4LUDA 4D9TA 1TQMA 3G15A 3HKOA 3PSBA 4X3FB 4N70A 4YJSA 5KMIA 3IW8A 4I6QA 4FL2A 5C8NA 3DS6A 5M51A 4OUCA 2PWLA 4U0IA 2YCFA 2JLDA 4KB8A 3RCDA 2BZJA 3D14A 3ORNA 4Z3VA 4RVLA 3EN7A 2EXEA 4J99A 1MRUA 3FQEA 3GOKA 3MIAA 4S33A 3SD0A 5I9VA 4FKVA 1IAHA 3KVWA 2CGVA 2UUEA 5HICA 5DH3A 1OGYA 2YCSA 3HA6A 1WZYA 1G5SA 5DPVA 3PUFC 4FT3A 4HPTE 3TKHA 4BWXA 4CTCA 4EOLA 3ANQA 1AQ1A 3L1SA 2R3HA 4HVSA 3S2PA 2VX0A 5EM5A 4DINA 5HE0A 4LMUA 3BU6A 4U97A 3DNDA 2C5VA 3VS1A 3MGYA 5CU0A 4AN2A 4XLIA 4A4XA 4L53A 4DC2A 1WBSA 4I23A 1OL7A 3I7CA 4KNBA 2QHNA 1L8TA 3MH3A 1IEPA 3P7AA 4GG7A 4D2VA 1U59A 3CR0A 5BVEA 5CZIA 4AE6A 5G6VA 3R9DA 3HV4A 3ORZA 5JQ5A 2OWBA 3SW7A 2WMWA 2FSMX 3R8LA 5CSHA 5KZ0A 3A62A 4I24A 3PDTA 1VEBA 3PFYA 1CKJA 4MH7A 3BHVA 5HX8A 2V7AA 5HNGA 5AUTA 5ETFA 2RSVA 5ANDA 3V5LA 4H39A 2J5FA 2YAAA 5AIRA 1XWSA 2IG7A 1YDTE 5CI7A 3GFEA 3MPMA 2WIPA 3LFQA 2BRNA 2UZWE 1YWNA 2CKEA 3HRCA 4IVDA 3S00A 2RFEA 3MA3A 5A46A 1S9JA 4IVBA 3NYOA 5AV1A 4Z7GA 3M2WA 3S3IA 4AAYA 3A8WA 3P23A 3R2YA 3HNGA 3PA5A 3P78A 5EM8A 3BWJA 3NNUA 3F2RA 3QU0A 4MK0A 4XMOA 2OXXA 4UEUA 5AP4A 3MB7A 3QRJA 1NVSA 2XKFA 4M0ZA 3NR9A 4EKKA 2C6OA 3DBEA 4OBOA 1YHVA 4ZJVA 5M4IA 1GJOA 2F57A 2G15A 1RJBA 3NDMA 3ZDUA 4BBMA 2BCJA 4ZIMA 3UNZA 4AZVA 3W0NA 4NIFA 3UDTA 4PTEA 3CLYA 4P5QA 4FRFA 3CCNA 3KXHA 3LJ1A 4I3ZA 4EHGA 4AFJA 1KV2A 1B39A 1ZARA 3CKWA 2W1IA 4MQ2A 3O0GA 3FDNA 5CEPA 1XJDA 4JG7A