2XYNA

Human abl2 in complex with aurora kinase inhibitor vx-680
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
266
structure length
264
Chain Sequence
KWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN KINASE ABL2
publication title Crystal Structures of Abl-Related Gene (Abl2) in Complex with Imatinib, Tozasertib (Vx-680), and a Type I Inhibitor of the Triazole Carbothioamide Class.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 264
sequence length 266
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xynA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xynA01
2C6IA 3IW8A 3ORZA 4WG5A 3RP9A 3NW5A 3SAYA 2W96B 4BZOA 4CT1A 3ZDIA 4BDFA 3ALOA 3C4ZA 3H30A 5AP2A 3D5XA 3N9XA 4I21A 4IZ5A 3AOXA 3MTFA 4IM0A 4I24A 4LV5A 4PTCA 1IG1A 3QGYA 2OXXA 4EUUA 3SX9A 4CG8A 4BWXA 3CJFA 3EMGA 3I1AA 5E90A 4NT4A 1BX6A 3ZOSA 4AZTA 2BTRA 5FWKK 4IB0A 4QYGA 5M4UA 3ACKA 3D0EA 4ZP5A 5BMSA 5EI2A 2B52A 4I23A 1BL6A 3UNJA 2PMOX 1NXKA 5HBEA 5TT7A 5HE3A 2NO3A 3S4QA 2XBJA 4C4GA 2PSQA 3BU5A 4IVBA 2OBJA 2Z8CA 4RIWB 3VULA 3E3PA 3PP0A 5CX9A 2W1IA 2PVHA 3QWKA 2CCHA 2ZDTA 4U0IA 3RNIA 3JY0A 1OL1A 4G3GA 3BRBA 3D5VA 4LRMA 3GENA 4U81A 5HKMA 1BUHA 3V5PA 4BDEA 3KULB 3R1QA 4EK3A 4O83A 1DM2A 4MKCA 5HG9A 4ASEA 2JDSA 4P90A 3OMVA 5FDXA 4ZJVA 5LXMA 4UMPA 3UZRA 3ZTXA 4MWHA 2WB8A 3VVHA 2C6KA 3Q9XA 3AC2A 5IA1A 3GT8A 4DN5A 3PVUA 2O64A 4D28A 1ZYLA 4GKHA 1FMKA 3BX5A 4RJ5A 3GOKA 3W2OA 3CTJA 2WTDA 4CG9A 4C61A 2C5OA 2QOFA 5AWMA 2C5YA 4GU9A 4M68A 4YLJA 3ODYX 4M69A 5M44A 2IVUA 4QTAA 4W8EA 4G6LA 1KOBA 1WBOA 2BTSA 3FY2A 4AS0A 4RQKA 5HCXA 3BYOA 1IAHA 2CNQA 3II5A 5AA9A 2E9VA 3WZKA 1RJBA 4B8MA 2X2KA 3GVUA 3Q32A 3MW1A 4E6QA 3CQUA 1JPAA 1PJKA 2CSNA 3BWFA 3P4KA 1ND4A 3UIUA 5J8IA 4FBXA 3QD4A 3NUSA 2YM4A 4J52A 4TYIA 2XM8A 5L2IA 3W55A 4FV3A 4NSTA 3TWJA 3F82A 5AUWA 4ZJIA 3LJ0A 4BI2A 5CAPA 2IG7A 2UVZA 4U7ZA 5LJJA 4ID7A 1G8SA 3MY1A 3LE6A 4DFYA 3E92A 3ZO4A 3LXLA 3JR1A 3F3WA 4RIYB 5EHYA 3LAUA 3CTQA 4EBWA 1UWHA 3K3JA 2OJ9A 3Q52A 4FT9A 4XHKB 4APPA 5HNIX 3RZBA 3VRYA 2VWVA 3DNEA 3DTWA 3KXHA 4FKLA 2HZ4A 5AP4A 4USDA 4RC4A 4O7WA 2HXQA 2QU6A 2ITYA 1PHKA 3G90X 2PVKA 1LR4A 3SC1A 2YM3A 4U79A 3NX8A 2XIKA 2Z60A 2VWZA 4NM7A 3KL8A 3T3VA 1KV1A 5BVFA 4AN3A 5C8KA 3VF8A 3OWLA 5DFPA 5KMLA 4DFLA 3QBNA 2QNJA 3FI2A 3ODZX 2C1AA 2C1BA 3PPKA 4L67A 2OI4X 3FKNA 5DA3A 5FM3A 5E8TA 2QONA 4APCA 4BWKA 3TUDA 4YURA 4B9DA 4ERKA 3LFAA 5T3QA 2XMYA 3T8OA 3F3TA 3VUMA 3CPCA 4EH8A 2W4OA 2WELA 4FKIA 4EOSA 4YU2A 5I4NA 3UE4A 4B4LA 4IJPA 4BVUA 3EJ1A 2R0UA 1ZZLA 4LUEA 3DAJA 3R1YA 4XG7A 1PXMA 3PIZA 4NYEA 4FSQA 5DT4A 3RAHA 3BI6A 5KO1A 2GQGA 3I60A 4YJVA 5ETAA 3V8TA 5HBJA 5J1WA 5J9ZA 1HOWA 4O27B 4WD5A 5HCYA 3VJOA 3R2BA 2W5AA 2PVRA 4G17A 3CD3A 1J1BA 4NZWB 4EHEA 3DBFA 2BAQA 2PVYA 4QYFA 2GU8A 4U8ZA 3OCSA 4QMUA 4N57A 3RAIA 3DXNA 3U4WA 2Y4IB 4PNKA 5A6OA 3LVPA 5JQ5A 1J7IA 2R7IA 5ICPA 2PU8A 3IONA 3MFUA 2KTYA 3GOPA 3U6IA 2ACXA 3R8VA 5DOSA 3UOKA 4C34A 4PWNA 5AM7A 5B2LA 5F9EA 3GBZA 3WF7A 1STCE 5CU0A 4S32A 4OTFA 3FV8A 4QTDA 5L2QA 4EH5A 4YMJA 5CEKA 2XYUA 4EC8A 1O6KA 2GNGA 4NUSA 3R28A 4L44A 3D7TB 3QLGA 1JKTA 4C35A 4PF4A 4FNZA 4Q2AA 4LL0A 3NUUA 2IO6A 4E5WA 3ZZEA 4DF3A 2O2UA 5EK7A 1M7QA 4U3YA 3TDVA 3KGAA 4RG0A 4YZCA 2ETRA 5A4QA 1YWNA 3FWQA 1B39A 3F5UA 3NCZA 4DLIA 2ZV7A 4F64A 4TN6A 3GFEA 4FKQA 4KABA 3G0EA 2VX3A 3C9WA 3R04A 3D7ZA 2C6OA 3TZ9A 2F7EE 2OW3A 2OZOA 4FSTA 5HO7A 3QGWA 2YCSA 2VX1A 3R00A 5CNOA 3QRTA 4UX9A 3F2NA 3HRCA 2RKUA 3W2PA 3A61A 4F6WA 3GCSA 3F2RA 3ROCA 3LW0A 4FEUA 5BQ0A 5FXRA 3DZQA 4IFCA 3G51A 3W16A 1R0PA 4L3JA 3R8ZA 2X1NA 4R8QA 2QOHA 1ZWSA 5HNBA 3AXWA 1CTPE 5BVWA 3VQHA 4FIJA 4AOTA 4AT3A 4F6SA 1YOMA 3NNVA 4QP1A 4NWMA 2OH0E 5AR8A 2FB8A 4QNAA 4I0TA 3ZSHA 3ZLYA 4J1RA 1LEZA 3LCOA 1UKHA 3Q96A 5CT7A 1RQQA 4I94A 2PPQA 2ITZA 3BHHA 3PJCA 4G6OA 2BRBA 4JBPA 3IPHA 3L8PA 5DHJA 3QTSA 1FGKA 3FQHA 3QTZA 4O81A 2QKWB 4FODA 1OL5A 4XJ0A 4XMOA 5AUZA 1Q24A 5D1JA 3RK7A 4OTWA 3K3IA 4NJDA 4W4XA 1YDSE 2QOLA 1HCKA 4AA4A 3W33A 4WRSA 3TV7A 4O7SA 1RW8A 4XG6A 4QMYA 4ZLZA 4NM5A 2AC5A 1GY3A 3PYYA 4M8TA 2E9OA 2XCHA 3ZU7A 1GZ8A 4JRVA 3FC2A 5M51A 1XH9A 5I9YA 4OR5A 1S9IA 4FC0A 5HO6A 3FQSA 5EH0A 2UW5A 2FSOX 1WZYA 4Y83A 3QF9A 3TKHA 4EOJA 5CAVA 3JXWA 3SLSA 1J7UA 3EYHA 3B8QA 1H0VA 4F9BA 2B9IA 4FTMA 5AAFA 3BQCA 2IVTA 2JIIA 5KE0A 3ZMMA 5IG1A 3EH9A 4U6RA 2BAKA 2W1HA 4HCTA 2PMLX 4I20A 3B2TA 3BLRA 2VTSA 4DE4A 4D2RA 4BBFA 3VW8A 2WTWA 3OWKA 2WMAA 2FGIA 4O0TA 3SDJA 4YZBA 3VS4A 5HX6A 5J9YA 3JVSA 2W7XA 3UGCA 3PWYA 2XP2A 4RJ3A 4DGMA 4PTGA 4I6FA 3Q6UA 4IWPA 5GZ9A 5HVJA 3MB7A 2ERKA 3OWPA 3R73A 5EDRA 2X81A 4I92A 3NAYA 4JDHA 3KFAA 2QOOA 4K1BA 5B2KA 4Q9SA 4FEXA 3A7GA 5DT3A 2C3JA 2GNHA 3FY0A 5AP6A 3UIBA 4QMNA 3A99A 3C5IA 2Y7JA 3CY3A 4EWHA 2QR7A 5A14A 3P5KA 4L00A 4V05A 2JGZA 3ATTA 1LUFA 5CF5A 2B1PA 1Y6BA 3KRWA 1JVPP 2WQNA 2OIDA 4L7SA 4BKZA 5KCVA 3TM0A 4W9XA 4GJ2A 5JFWA 3IW6A 2WQBA 4IB3A 4GRBA 4O91A 3PY0A 2VX0A 3DBDA 3V51A 4DFZE 4KIPA 2HCKA 1XH7A 5I9WA 4XV3A 3F7ZA 5AV3A 5CEQA 2R5TA 3Q4UA 5E8SA 5H8GA 3OUNB 1W83A 3D2IA 5BMMA 5CU6A 2ZMCA 3MVHA 2VD5A 3EWHA 3F3ZA 1PW2A 2I0YA 5C8NA 5F94A 4AGCA 5H2UA 3NSZA 1TKIA 4L9IA 4L3PA 4YUQA 3QXPA 2G2FA 2Y8OA 5FTGA 2A1AB 3PA5A 5B0XA 2DS1A 4IAYA 4O7VA 2F9GA 3NRMA 4F9CA 4K77A 3EQPA 2Z7QA 3PDTA 3UC3A 3TG1A 3DV3A 2UW4A 1GIHA 3PSDA 3RPRA 1XBBA 1YRPA 4G3CA 2J0LA 3U6JA 3ZLWA 5GJGA 1TQMA 2VTQA 4CKJA 5L6WL 4UBAA 4ZIMA 3FMDA 5DN3A 3ZLSA 1IA9A 1TQIA 4UXQA 3ENMA 1O9UA 2CGUA 5AADA 3EQHA 2UZLA 3IDCA 4TYGA 4FEWA 2W9ZB 5BVKA 4I5PA 4QP7A 1OMWA 2FA2A 4RSSA 4V0GB 5C1QB 4DGLC 5M56A 4FZFB 4EKLA 2WTKC 2ONLA 3R7EA 1J7LA 5HU3A 3N51A 4I5HA 4QMTA 1FBNA 4K6ZA 3KXNA 4D5KA 3FLWA 4DT8A 4IH8A 3ZFYA 4F08A 4FEVA 4FV5A 4IFGA 4IVAA 3V5JA 3EFKA 4EOOA 3EZVA 4DC2A 4CGAA 4CKRA 1F0QA 4FV9A 5HIEA 4H3BA 4TYHB 3DPKA 3K2LA 5FEQA 4D9TA 3HMMA 2BFXA 4FOBA 1H1QA 4HGTA 3G2FA 2HW7A 2J5FA 2PK9A 2OXYA 3FPMA 3EHAA 3JVRA 4PPBA 4QTBA 5GINE 1IA8A 4TNDA 5DR6A 2UW3A 3VWAA 4WUAA 4NIFB 5DI1A 4JG6A 2EXCX 5EHOA 4AZSA 4EH3A 3I6WA 1XH4A 2X2MA 3OUKA 3QTWA 4FUXA 3UODA 3EL8A 4ZTMA 1YXSA 2H8HA 2VWXA 3A2CA 5ANKA 4F1TA 4FVQA 4IZAA 2O65A 4JRNA 5LMKA 3TDWA 3NW7A 5HICA 3FE3A 2CMWA 4EC9A 5KKRC 4CLIA 3EOCA 1A9UA 2BIKB 2X9FA 2HZNA 3NLBA 4BTFA 4X2JA 1R1WA 1WBPA 4AOJA 4CV8A 5AFVA 4ENYA 2OSCA 4RX7A 3R7UA 2XNOA 5J9LA 2YHVA 3A60A 4GL9A 4O86A 3GU8A 3QQLA 3GQLA 5CSVA 4JX7A 3TZ8A 3U9CA 4BDKA 3OEFX 4HVIA 2JDRA 2WOTA 3ORXA 3P7CA 2XIZA 2WIPA 5ANEA 3IOKA 2HK5A 4XUFA 3V5LA 3TUBA 1IRKA 4KIKA 2CDZA 3KVXA 1PMNA 3F5PA 4BKJA 5FLFA 5J95A 4AAAA 5I9VA 5ACKA 2JITA 2UZWE 5HIBA 3QUPA 4RMZA 4O7LA 2GTNA 2YIRA 3NMUF 2ETKA 4I4FA 2EXMA 1R39A 2OJIA 4FKTA 2CPKE 4I41A 4UWBA 5CXZA 3SW7A 5CEPA 4IVDA 2PUIA 4R1YA 2PZRA 4AUAA 3FXZA 3ZH8A 4ANOA 5AA8A 3ZHPC 2W17A 4PMPA 3PVBA 5M06A 4L68A 1NVRA 4LL5A 4QMOA 5HG8A 5DE2A 4HZRA 2A4LA 5BVOA 2RFSA 3MH0A 3P23A 4YPSA 4FSUA 3QC9A 1IASA 3O51A 4ZSAA 5M08A 4MWIA 3GC0A 4NW6A 5CNNA 3TV6A 4C7TA 3HEGA 3G0FA 2XRUA 4YO6A 4FL1A 1FGIA 1KUTA 2UW6A 4Z7GA 4JIKA 4LM5A 5CALA 4DGGA 3NVMB 2C6LA 2C3KA 5DH3A 4R6VA 5CF8A 4E8AA 3MIAA 4YTFA 3H9RA 5AM6A 1XKKA 4CMUA 5JMSA 2GNJA 1U5RA 5JK3A 1P4OA 3DQWA 4WRGA 5IA0A 5M07A 2GHGA 1X8BA 4CT2A 2VUWA 2G01A 5E8XA 5F1ZA 1G8AA 3KRJA 2YN8A 4C4IA 4FV7A 5AR7A 3ZBXA 4F6UA 2X6DA 5L3AA 1VJYA 4MBIA 4EQUA 4B8LA 3LMHA 1Z5MA 3VBWA 4YBJA 2J9MA 2PMNX 3FLNC 4LGHA 2C5NA 2YIXA 3HUCA 3Q60A 2GQRA 5CEIA 3R2YA 3GP0A 4X3FB 5A4TA 4UV0A 5IKWA 3HAMA 4HZSA 4D0WA 3S2PA 4MD7E 2ZB1A 4FV8A 4BDBA 2X8DA 4C4HA 4FKPA 2YERA 4BDIA 2KULA 4EH4A 3UYTA 3N4VA 3GFWA 2BHEA 1YI4A 3FMHA 3LCTA 3NYNA 1UV5A 4G9CA 3FZPA 5BUIA 1YOLA 1MUOA 5BUEA 2PVJA 1U5QA 4N4SA 4TT7A 4CFFA 4CYJA 4DBXA 2VAGA 4FTTA 4I22A 4MYGA 4FIIA 3K5UA 1P5EA 5DRDA 3VJNA 5CASA 2BPMA 4M0YA 3BCEA 1OB3A 3HECA 1PKDA 2CGWA 3PUPA 2H96A 2RG5A 2CJMA 2BKZA 4ZMFA 4GK3A 1WBSA 4IB5A 4WNKA 4XBRA 3HDMA 4FTOA 4YTHA 2CKQA 1YQJA 4NW5A 4NJ3A 3DJ6A 3EFJA 3NR9A 3SA0A 4NKAA 4MEDA 3BYUA 3OT3A 3V04A 2OFVA 2WAJA 3NW6A 4BYJA 3Q6WA 4G16A 3F61A 4QPMA 5I3OA 4CCUA 2JBPA 4JDJA 2CNUA 1NVSA 4UMQA 3R8UA 3ROYA 1WBVA 2UZEA 1UVRA 3QCQA 2WQOA 1YHSA 3LM5A 2GS2A 1FVTA 4K33A 2W99B 4RGJA 4JT3A 3PRIA 1XJDA 2O5KA 3ID6C 2YA9A 5IEYA 3E64A 3DS6A 3QUDA 3QLFA 2FH9A 5IDPA 4TWCA 2QI8A 4UALA 4A4XA 4ACGA 2W4JA 1YWVA 3IGGA 2WTKB 3NDMA 4C3PA 5E4HA 4M66A 3QA8A 3UZPA 4CQGA 5A4CA 4XG2A 4FKUA 1UNLA 1GIIA 3OOMA 4ZTQA 4TYEA 4DFNA 3REPA 1UKIA 3P7AA 3POOA 4FIEA 5CS6A 4I4EA 2J4ZA 2V55A 1G3NA 2W4KA 4LGGA 5JH6A 1U54A 3QUEA 4BCFA 4TKSA 2BIYA 3FL4A 4D1XA 2IWIA 2CGXA 4Y85A 4BY9E 4RWJA 4O0WA 1GIJA 3AMBA 4EZ5A 4D1SA 4WO5A 4M69B 4ZSGA 3VUKA 4CFUA 2F4JA 4CEGA 5KMJA 4EJNA 3ZO3A 1PF8A 2XM9A 4LG4A 3KREA 3A7FA 3RI1A 4R7BA 5C8MA 3QCSA 4YSMA 5I0BA 2FYSA 3F7WA 4BFMA 4ITHA 1PMUA 5E9EA 3QRUA 4MCVA 1KE9A 5L2SA 2VTNA 2GHLA 4A9SA 3Q9ZA 2Z02A 1OIRA 4FTCA 1YI3A 4BRXA 5KKRB 5C4KA 3HAVA 3UQFA 3POZA 4XCUA 2I1MA 3P86A 3C7QA 5L6OA 3A4PA 2VTPA 3KCFA 1U59A 5JGBA 2OICA 5HVKA 3CSVA 4FSMA 3Q3BA 2JLDA 3TZMA 1YDTE 5G6VA 3WBLA 4CVAA 1P14A 4ITIA 1VEBA 1O6LA 4F7LA 3PTGA 2H6DA 4QP4A 5CWZA 3L8XA 4GYIA 3HMOA 3NUXA 3O23A 1MRUA 3UP2A 4UN0C 5GIPE 4JLCA 3O8UA 3CC6A 4M84A 4FOCA 4AZEA 2NNWB 2EB2A 2Y4PA 3QD0A 4FG9A 3IG7A 4NTTA 4ZJJA 4ZOGA 3TTIA 3WOWA 2B54A 2BALA 4N6ZA 3G6GA 4AP7A 4BTKA 2C6EA 2XUUA 2YDJA 2F49A 2JDVA 3BE9A 2B55A 3C4XA 4ARKA 2WO6A 5KZIA 4GKIA 3LFFA 3OZ6A 5ANOA 1BKXA 3E62A 4S31A 4XP3A 5CVFA 4P5ZA 3ZFMA 4CFVA 2IW6A 2HYYA 3BKBA 4IX3A 2BDFA 4FICA 5HO8A 4DEDA 3SHEA 2GMXA 2BRNA 1OUYA 1ZYJA 4FTQA 3IKAA 4QTEA 2PULA 3U6HA 4FA2A 5TOZA 3R9NA 1QPJA 3CQEA 5AV1A 2VGOA 3R8PA 4HGLA 4ONAA 5JN2A 3WZJA 1VYZA 1PXPA 2XJ0A 4KSQA 3V6RA 4QP3A 2IZRA 3Q5ZA 1MQBA 3QKMA 5KBQA 2ETMA 4ASZA 4TNBA 3SKCA 4IVCA 3VHEA 4RLKA 1Q5KA 4U45A 1CKJA 5IUGA 1ZOHA 4YJOA 2YACA 2FSLX 4YLLA 4G1WA 3D94A 4FTNA 4ZSJA 4PDOA 4F4PA 5DR9A 5ANGA 4BCPA 4FF8A 4BCOA 5GJFA 3NNUA 2EU9A 3BELA 1XR1A 2P33A 4FIGA 2W1CA 5EM7A 4D2WA 1DI8A 4FGRA 5EYDA 2JAVA 3ZC6A 2ONLC 2W1FA 3H9FA 4DEEA 1YDRE 1ZAOA 4JJRA 4EK8A 3DXPA 2W05A 5D41A 3ZLXA 4M13A 3E8DA 4GK2A 4BZNA 2UW0A 3EQDA 5BVDA 1GZKA 3ZRKA 3ZO2A 3OY3A 3FDNA 5EOBA 2GTMA 3EIDA 4QQ5A 2BZKB 2WGJA 4QT1A 4YZMA 1SVGA 4HCVA 2PTKA 1B38A 4RFZA 3V5WA 3L9LA 1ZLTA 4IIRA 3QZIA 4NFNA 4WUNA 4WBOA 2QO7A 4BBEA 2IZUA 4O0UA 1XQZA 2Y6OA 2ZAZA 5J1VA 3C4EA 5A6NA 5JT2A 5EKNA 4IWOA 3COHA 5I9UA 4QMQA 1YXUA 2B4SB 3QAME 3NYXA 4HYUA 4KBCA 1RE8A 2VTTA 3VRZA 1E1XA 4I6HA 4BCGA 3IW5A 5AX3A 3EN7A 5EW8A 1EH4A 2C5VA 2CKEA 2GHMA 3MY0A 2QO9A 3GI3A 4OT5A 3UVQA 1OL6A 4O7NA 2WKMA 2F7XE 4ZTSA 3CKWA 1JQHA 3A7HA 3HUBA 4U5JA 4EKKA 5AEPA 2PUNA 4UEUA 5EQEA 5L6PA 3ZSIA 3LJ2A 4C59A 2UVXA 4CFWA 5IQBA 3RCDA 1MP8A 3UOLA 3ZXTA 3QYWA 3VAPA 5HCZA 3L1SA 4C4EA 2J5EA 2W9FB 5EW9A 2OLCA 2RGPA 5JFVA 4Q5EA 3RZFA 5C26A 3P1AA 4JNWA 2J0KA 4AQCA 2FSTX 3OC1A 4NEUA 2BVAA 4O1OA 5FGKA 2BZJA 2PE0A 2WIHA 2YZAA 3PXQA 4P4CA 3LLTA 5J7HA 3CS9A 4W4WA 2IVSA 4LFIA 3T9IA 2UZTA 3OHTA 5EI8A 3HRBA 4O21A 2BZIB 4BCQA 1RDQE 4HVGA 4XP2A 3FMJA 4FKJA 4ZY6A 4YLKA 4MX9A 3OROA 4D2TA 3HVCA 2CN8A 3G6HA 3QQUA 2HW6A 4PDPA 4AW1A 1BLXA 2VWYA 2JEDA 3EQFA 5FXSA 3NIZA 4GK4A 2YIQA 4IACA 4JDKA 4MK0A 4QNYA 4BDGA 3PY3A 4KUJA 3G15A 5GIOE 4AACA 5HOAA 3FBVA 3TIYA 4F9AA 2XK4A 1PKGA 3O0GA 3FZOA 4RZWA 3C4FA 4DTKA 1CDKA 5BUJA 2B0QA 4XV2A 4JBQA 2XIYA 5CQWA 4PMMA 4FT0A 4R77A 2CKPA 1NVQA 3VN9A 4HCUA 3MN3A 4FZAB 4BCJA 4DT9A 2W1GA 3AG9A 3OVVA 3VS3A 4QYHA 4L01A 4YGAA 4O0RA 2GNFA 5EYKA 4GVAA 2R3HA 3FUPA 1H26A 4L43A 4OT6A 3BHTA 2BFYA 3VBXA 3TNPC 3QWJA 4EHGA 3FHIA 5D7AA 2WOUA 1H1WA 5K0KA 2ZVAA 4G2FA 5HLWA 3KY2A 4FTAA 4MD8E 5EM8A 4BCHA 5A4LA 2WMSA 5CENA 4GJ3A 4HYHA 3MDYA 4C62A 4YSJA 4PTEA 4WBBB 4YJSA 2AYPA 4JX3A 3NVKI 2GCDA 2H9VA 3HYHA 5C01A 3DZOA 1GZOA 4A9TA 3MFRA 1SMHA 5HTBA 4X2NA 1JBPE 3LFNA 4YC3A 3COIA 3LFQA 4I1ZA 1XH6A 4QO9A 2Z2WA 3CE3A 3LFDA 4RPVA 3T3UA 3FZRA 2X39A 4ANBA 2BRMA 3KVWA 3OXZA 4E4NA 2VO0A 3HLLA 1K9AA 1Y8GA 3RKBA 3LCSA 2J51A 3CTHA 2XNBA 1LP4A 4YTCA 4F63A 4IANA 4DEHA 3OXTA 2YFXA 4MVFA 2XB7A 3FZTA 3SD0A 4AW2A 2YZLA 3BHUA 3DKGA 5LMAA 4F7NA 1IEPA 4AFJA 3CJGA 2ITTA 3FKLA 3GQIA 3PWDA 4Y5HA 2W5HA 4DINA 4BCNA 4N70A 4M7IA 3BIZA 2R4BA 1GJOA 2J2IB 2XZSA 3E93A 3S0OA 2OZAA 4PX6A 2I7QA 3R9RA 5E8VA 2PZPA 3MJ2A 3ZZWA 1BI8A 5CZIA 2XRWA 1Z57A 3DFCB 3VBYA 3O71A 2ITUA 4FT3A 4RC2A 3S00A 1QCFA 2EUFB 2UZBA 4MHAA 3ULZA 4Y5QA 2Q83A 4RRVA 5HTIA 4K11A 1ZRZA 2WMWA 3C1XA 4IWQA 2CHLA 5D12A 4BYIA 3MIYA 1KE8A 4DFXE 5AR2A 3LFCA 4C4JA 5HX8A 4PY1A 4KS8A 3MSSA 2YABA 5DG5A 3ORPA 4GFMA 4IE9A 2XNMA 5FQDC 3UMWA 5FG8A 2R3QA 3DBCA 4PV0A 1QL6A 1LEWA 3BHVA 4CZTA 4D9UA 5LVOA 2J50A 3CEKA 4BF2A 1URCA 3CQWA 4FK3A 3TKIA 4H1MA 5JGDA 4ZSLA 4OAVB 1LPUA 3OCTA 3QTRA 4R3RA 5CI6A 1I44A 4YZDA 4L42A 5HE1A 4IAZA 4AT4A 4BHZA 3FQEA 4K2RA 3D2KA 3WILA 2QG5A 4BGQA 3AMAA 2EVAA 3COMA 1J3HA 3CXWA 4E5AX 4V01A 3C0HA 2QLUA 3LQ5A 1OIYA 3AGMA 3VUDA 4CD0A 4EOPA 3RWQA 4EK6A 5AR5A 2VGPA 4JQEA 5JRQA 2R0IA 4KA3A 4F1OA 2X6EA 1ZY4A 3DKFA 4HGSA 3KRLA 2VO6A 3BHYA 2R3FA 2B9JA 2QQ7A 3JUHA 4B6LA 3FMLA 4DG3E 4JQ8A 2PYWA 3U8WA 2JAMA 4CTBA 1BMKA 4W4YA 2YM6A 3ZM9A 4BTJA 2C6MA 3MPMA 3QTIA 4DGNA 3F88A 2YLFA 3R0TA 4HNFA 4AWIA 5HG7A 4BKYA 2H34A 3M11A 4PL5A 4IDTA 3EB0A 3BLHA 1WBWA 3DKCA 3L9NA 1CKIA 2VO7A 3LQ3A 3FI4A 5EM5A 1NW1A 4PRJA 2ZM3A 5ANDA 4ZY4A 2REIA 1XBCA 4X3FC 2WMUA 4ACMA 4EI4A 5FDPA 3DJ7A 4M67A 5T68A 3QKLA 3TACA 3AT2A 4GIIA 3P9JA 4IDVA 4EH6A 3FSKA 4RVTA 2RFEA 4B99A 4O82A 5FUTA 2C3LA 3H0YA 4C36A 2VTHA 4AOIA 2UW8A 2QKRA 1SVHA 2PE2A 2WHBA 2G15A 5HORA 4RX9A 4ZZMA 4HVSA 3V01A 4U97A 3WYXA 3RALA 2OJJA 5JQ8A 1H25A 3NUNA 3DK6A 3L9MA 3UNKA 4GG5A 3UC4A 3A8XA 4EOLA 3PXKA 4C2WA 4ZSEA 4N6YA 3I5ZA 3UP7A 4FMQA 3FYKX 3WIKA 3LZBA 4MH7A 2XK6A 5FEDA 4EBVA 1U46A 1TVOA 3LXKA 2YCRA 3FI3A 3O8PA 3DAEA 4NKSA 5AX9A 4MD9E 4MF1A 3N4TA 2JKOA 1UNGA 3CIKA 5LMKC 4QMMA 4XNEA 4FG8A 1B6CB 4OW8A 5DEWA 4C3FA 2HOGA 2BRHA 2C0IA 3DB6A 3DNDA 2ZDUA 4ZTHA 4MXZA 3ZFXA 3ZRMA 4J98A 5A4EA 1Q41A 1SYKA 3B2WA 1YHVA 4M14A 4C37A 4LOQA 1XHAA 3L8SA 4HYIA 3BYMA 2QOCA 4KIQA 2WU7A 3RVGA 3UO6A 4DEIA 3L9PA 1YXTA 2X7GA 3BYSA 3QRIA 1PXNA 2YAAA 4YJRA 2RL5A 3CGOA 3D15A 5CU4A 5CI7A 3R83A 2WEVA 3EKKA 3OF0A 4AW0A 4UMRA 2O63A 4YBKA 2ITPA 3UOJA 2YM5A 3OCBA 2HZ0A 2WTJA 4L6QA 4YZNA 5E8YA 4DCEA 2I0VA 1WBNA 4QD6A 2VTJA 5IQDA 2CN5A 2WMRA 4UYAA 5FP6A 1R3CA 2P55A 3MS9A 5HD4A 1YOJA 1ZYCA 5AIKA 2QCSA 3AC4A 4WG4A 3H10A 1H28A 3ZDUA 3GNIB 3WF8A 1JKKA 3RM6A 3RPSA 5K4JA 4G3FA 2C0OA 4FIFA 2PWLA 3HA8A 4YJQA 4FKSA 2WFYA 4IB1A 4QOXA 2VZ6A 3GCPA 3LIJA 3ZUTA 3V6SA 1FVRA 4IJ9A 4Z55A 1WVXA 3FEGA 5AP0A 3GC9A 4QP8A 4IW0A 5FRIA 2PY3A 4R7HA 2XJ2A 1YW2A 4L45A 2YWVA 2B9FA 2R3GA 2W1ZA 4AU8A 4M3QA 4U41A 5E1SA 2X7OA 3IS5A 2XH5A 1JWHA 4CMTA 5JZNA 2ERZE 4MXOA 4DG2E 3I5NA 3FPQA 2WXVA 3FSFA 4NH1A 5BYLA 3IQ7A 5CVHA 2JKMA 3GU4A 1XBAA 1NY3A 2YJRA 4J96A 1KE7A 3IOPA 3PXRA 1YVJA 3D14A 4U40A 4L46A 5ANIA 3WIGA 4GS6A 4X2FA 1H07A 3AC3A 3ANRA 3EQRA 4IBMA 3UMXA 2ZJWA 3PG1A 4FVPA 1J91A 4ERWA 3QTUA 4JS8A 4S33A 4JIAA 3BZ3A 3ZXZA 4Q5HA 2B9HA 3RHKA 2ITWA 3Q9WA 3ZO1A 4OTPA 3BWJA 4PDYA 4XEYA 3RJCA 3ZBFA 2QLQA 2ESMA 3DJ5A 4XLIA 4JDIA 4E6CA 1OZ1A 1F5QA 2VV9A 4HYSA 3FJQE 4GUBA 1PRYA 4FG7A 3W8QA 2CNVA 4ZLOA 2HY81 4OLIA 4RT7A 1H01A 3ZEWA 3FMNA 1QMZA 3V5TA 5M4IA 4O0VA 2F7ZE 1MRVA 4MBLA 1DAWA 2CCIA 1UU7A 1ZARA 4W8DA 4ZK5A 4EORA 2JKKA 4OTGA 4XYFA 3IK3A 1UU8A 3NNWA 5FXQA 4C0TA 5CEOA 2IZTA 4RX5A 2BR1A 3ZM4A 3A7JA 4Y8DA 5TR6A 2YIYA 4E4LA 1F3MC 4AA5A 4KRCA 4LMUA 4BCMA 4BN1A 3HDNA 4FTKA 5EYMA 4USEA 3EQBA 4BBMA 5C9CA 2PVNA 1ERKA 3NGAA 5HGIA 4J53A 2OF2A 2IN6A 4ALVA 3MESA 1URWA 1K2PA 1SZMA 4A7CA 4AZVA 2JIVA 3HV3A 4WNMA 4FUYA 4JOAA 4AE6A 3VS6A 4EL9A 4G34A 2WPAA 4BIBA 3HV7A 3LCDA 4YJUA 4DTAA 1H8FA 3HGKA 3TZ7A 3UIXA 3WZDA 3VF9A 2X8IA 2Z7RA 4IWDA 2YDIA 1Q8WA 3JYAA 4FSYA 4IC8A 3QD3A 3DGKA 2XNPA 2G9XA 3NS9A 5AR4A 4U9AA 2XK7A 3WARA 4CRLA 2V5QA 2IVVA 2BAJA 3O2MA 3R30A 3OBJA 3TEIA 1U4DA 4EQMA 3EFWA 2YCQA 1U54B 1Q8YA 1XWSA 2XK9A 3I7BA 3KXMA 3B8RA 4FSRA 1YWRA 4BI1A 4D5HA 4OTQA 5ETCA 5H9BA 3TL8A 5IEVA 5LVNA 3KCKA 3DKOA 4QMZA 4F09A 4TYJA 3N4UA 3GEQA 3HX4A 2OG8A 3QQKA 2WD1A 4M0ZA 1FMOE 3H0ZA 3TI1A 5KMNA 4FTJA 4RFMA 2I6LA 3QQHA 3V5QA 4IHPA 4R7IA 4X2KA 4CSVA 2IZSA 1GOLA 4EZ3A 1OI9A 5AUVA 3E7OA 5CU3A 3BEGA 4YO4A 1REJA 3EYGA 5T6KA 4AN2A 2VO3A 5H3QA 5AUXA 3GC8A 3BLQA 3P0MA 1FINA 4U3ZA 2RFNA 3TTJA 4E4XA 1H1SA 3DOGA 3DLSA 4RC3A 4CZUA 1W8CA 4C4FA 3F6XA 5GJDA 3LFSA 3GB2A 4KBAA 1G5SA 3P78A 2C0TA 4BIDA 3LM0A 4QYEA 3RINA 3DDPA 3NPCA 4MXXA 1XH8A 5KHWA 4DH1A 5CF6A 2HWPA 2QODA 1P2AA 3E3BX 1IR3A 1YI6A 3NUYA 3W1FA 2ZOQA 1FQ1B 3OXIA 5IQAA 2JDOA 1PXOA 3IDBA 3F69A 3MYGA 5HI2A 2YJSA 3LQ8A 2ITVA 3MH2A 4JR3A 3DK3A 4U80A 3CKXA 2WMVA 4O7RA 3TN8A 2C3IB 1DS5A 1OKWA 2Q0NA 3Q4CA 3TXOA 5D10A 1ZYSA 3MGYA 4FNWA 4YHTA 4AE9A 1OM1A 1Q61A 2ZB0A 4PUZA 4DGOA 4CFXA 1Q8UA 2O8YA 2GNIA 4X6RA 1V0PA 1WFCA 5J79A 2XKCA 3E88A 2RSVA 5CZHA 1SVEA 4E73A 4RQVA 4KSPA 5IQGA 2PMIA 3ZSGA 1O6YA 3R22A 4AN9A 4MNEA 2Y9QA 4K0YA 3BU6A 1H0WA 4JI9A 3D83A 2UVYA 5AIRA 5L8JA 1M52A 2GS7A 2PL0A 2YITA 3PVWA 4FX3A 4W9WA 4X21A 3WF9A 2VTLA 2WMTA 5EHLA 3SG8A 5M55A 5DEYA 2XEZA 4QQTA 5I5ZA 4ANLA 5EQYA 4FV0A 3NZ0A 5A9UA 5L4QA 3FXWA 4LRKA 4O2ZA 2QD9A 1ZOEA 4FKVA 4QRCA 4GEOA 2Y6MA 3FYJX 4D4YA 5F20A 1OL2A 3R9HA 5CSXA 2YEXA 4UWCA 4YHFA 4TXCA 5EI6A 3VQUA 4D0XA 3I4BA 5D9HA 1OITA 3QALE 1DAYA 2VWUA 4N0SA 4RX8A 3Q2JA 5IF1A 2DWBA 5E8UA 1OKYA 5I9ZA 2R2PA 4A9YA 3PA4A 5IA3A 2UV2A 5HESA 3RNYA 2RIOA 3CP9A 3TJDA 5TE0A 3OP5A 4HW7A 4TRLA 3IGOA 1CM8A 2WTIA 3TNWA 1YKRA 2RF9A 5HG5A 2VWBA 4BB4A 4PNIA 2R9SA 3ORKA 3PRFA 4UMUA 3SGCA 3E8EA 2J0JA 4ANMA 4PP9A 1SNXA 1JOWB 1OKVA 1W0XC 1W82A 3AT4A 5HIDA 2IPXA 2QC6A 4G5JA 4WHZA 5IH4A 3PE2A 5JZJA 4PP7A 2I0EA 1NA7A 2UZNA 4MF0A 4CZYB 2A2AA 1H24A 2A27A 2GSFA 4JBVA 4ANNA 5HHWA 1H1RA 3OFMA 3PLSA 4YC6A 4BDJA 4XG4A 5E91A 3MI9A 4AFEA 3TJCA 2F57A 1IAJA 3FLZA 1H27A 4D55A 4J95A 3VS5A 2B53A 3ACJA 5E1EA 4D1ZA 3V3VA 2UUEA 4O6LA 4FTLA 4M15A 5AUTA 3AD5A 4IADA 4D58A 3PP1A 4O96A 4ZTNA 1H4LA 2VTRA 5HBHA 4MTAA 2X7FA 1M2QA 2Y0AA 3PLAE 5M09A 3WYYA 4IAAA 3I7CA 3C4WA 2R3NA 1AQ1A 3HL7A 3AGLA 3PG3A 3CD8A 1XO2B 3QX4A 3AC1A 4IM3A 4A07A 4DG0E 4H3QA 4UWYA 4S30A 2PUUA 4IQ6A 4DH5A 5IA4A 4EOMA 2VNYA 5IQFA 1ZXEA 4XG8A 5HE0A 3C5UA 3ORMA 2BZHB 2YWPA 4MXAA 2V7OA 4DH7A 5J87A 1WBTA 4BZDA 4GIHA 2YLEA 4OTDA 2LAVA 5EG3A 3E63A 2NRYA 3PJ1A 3KN6A 3VUTA 2IJMA 3SOAA 5HLPA 2DUVA 5LOHA 3A8WA 4O6EA 5FTQA 4WT6A 3GU6A 3IW4A 3VO3A 5DYJA 4EEVA 4ZXTA 3TV4A 3FL5A 4X7QA 3EN4A 4GU6A 4NM0A 2YDKA 3R01A 5BVNA 2OXDA 4AXAA 4TTHB 1S9JA 4K9YA 4GMYA 3R9DA 5K5NA 4R78A 4FV1A 2UW7A 4CQEA 3KF4A 4DITA 2R7BA 3UOHA 3U51A 3W8LA 5ETIA 4EYMA 3EFLA 1K3AA 1KWPA 3F5GA 3TIZA 2PZIA 3ORTA 5KZ0A 1ZMVA 1A06A 4DFBA 2I40A 3C13A 3GCVA 4QMLA 1PXJA 3E87A 4UY9A 4EOIA 3C51A 5ITAA 4PDSA 3R6XA 3EN5A 2CLXA 5AP1A 4E1ZA 4F0FA 3OW3A 2IW8A 3RAWA 4RIXA 5BYYA 4ZS4A 3VS1A 2W1DA 2QHNA 3SXSA 4BICA 4HOKA 3KXZA 2JD5A 1PYEA 2ITXA 3QRJA 3EKNA 4ALUA 3BGZA 5CTPA 3R9OA 3Q2MA 4H39A 4IC7A 3WF5A 5CSPA 2QOKA 3W2CA 4WKQA 2CGVA 3EL7A 4ANQA 5IQCA 3MB6A 4G6NA 4HVDA 3SXRA 3FMEA 3NWWA 1QPDA 3QCYA 4GG7A 3Q04A 4Y72A 4X6QC 2G2IA 4O84A 4Q9ZA 4TWPA 3RCJA 4CTCA 1M17A 4KBKA 4AA0A 2XEYA 2P4IA 3ET7A 3LXNA 3M42A 5CU2A 5EQPA 2OKRA 3NYVA 5E8WA 2ZMDA 4GFGA 2P2HA 3D9VA 4YHJA 3ZC5A 4ZZNA 3GU7A 4PMSA 1BL7A 4RWIA 3R1SA 2O3PA 3SXFA 2VN9A 2AUHA 5DR2A 4E93A 5M57A 4EK5A 2XKEA 3GU5A 2HIWA 4FL2A 4Z7HA 4F99A 3AD6A 2OGVA 3QL8A 5H8EA 4UZHA 5J5SA 3HV5A 4BCIA 5C4LA 4FTIA 4IEBA 1PXLA 1V0BA 3I0QA 4RJ4A 4XP0A 3QCXA 5F4NA 4CRSA 1Q97A 4V04A 5AV0A 3IDPA 1Q99A 1SNUA 3EQGA 3UZTA 4FIHA 4A4LA 5LMBA 1PXKA 2R3PA 5CANA 2NRUA 4E3CA 5KNJA 2GFCA 3LCKA 3S95A 4TWOA 5K4IA 3SRVA 4CXAA 4W4VA 2GPHA 1VYWA 2Z7LA 5G1XA 5JEBA 2F2UA 5CYIA 4BHNA 4E26A 5AAEA 1GZNA 3PY1A 5AAGA 2OZAB 3I79A 3UVRA 2YISA 2RFDA 2X0GA 1Q4LA 4C58A 4E7WA 4YJNA 4R1VA 2Q0BA 1OVEA 2AC3A 2C47A 4MNFA 5J7BA 2QOIA 4F0GA 3WZEA 2PVLA 4RA5A 2OF4A 4CNHA 3DT1A 3KQ7A 3F66A 3A62A 4ZS0A 3C0IA 4O22A 2XCKA 2QR8A 5A46A 2CKOA 3MA3A 4K18A 4AG8A 4QTCA 4G3DA 4A4OA 4FZDB 2VTIA 3HV4A 2VTOA 4C02A 4DBNA 4USFA 3UPXA 4NCTA 5CAQA 2WMBA 4I0SA 2VNWA 4AGDA 4CYIA 4EH7A 4KKHA 4RLLA 4YR8A 3UG1A 3ULIA 3AMYA 3AC5A 1OBDA 4ORKA 4XBUA 3NCGA 3DY7A 4O7YA 2GDOA 3CCNA 3EZRA 4EK4A 4JAIA 5FEEA 4J8MA 1JSTA 3AD4A 3W18A 5DPVA 2B7AA 3W10A 4QQCA 1Q3WA 3WE4A 2BCJA 3DQXA 4O1PA 3SQQA 1UNHA 4X0MA 5JGAA 3F5XA 3RHXA 3C50A 4FKOA 4GFOA 1OPLA 4M12A 4YC8A 4RIWA 4F7SA 5FD2A 2F2CB 2HENA 5HQ0A 3MPAA 5LQFA 3HNGA 3AT3A 2XJ1A 4JQ7A 3LLAA 3QXOA 5IZFA 2XNNA 3G33A 2E9NA 4PQNA 1W98A 1H00A 3KULA 2BRGA 3EQIA 4FEQA 4XRJA 5CAUA 4J7BA 3I81A 3QQJA 3RAKA 3MH1A 3KXGA 4XRLA 3PJ8A 2YCFA 2HELA 2HZIA 2PZYA 4OBOA 4EYJA 4H1JA 4O0YA 3DK7A 2QVSE 1E1VA 4AT5A 1YXVA 3NNXA 4LUDA 5GHVA 5IPJA 2JDTA 2NPQA 4GCJA 1BI7A 3C0GA 5HE2A 2ITNA 3OEZA 4DEAA 1HCLA 3E8NA 3HP5A 3MFTA 4FSNA 3DU8A 5D7VA 5KX8A 2R3RA 4IM2A 4ZEGA 1WVWA 4D4VA 2QG7A 4EONA 4FE2A 4JG8A 4WG3A 2C4GA 4RVLA 5HLNA 4EOQA 4IX5A 3PXYA 1V1KA 5AP3A 4ZTLA 3ZYAA 3KN5A 5IMXA 1Y57A 4NTSA 4F70A 1Q8ZA 2BROA 1W7HA 3D4QA 3L8VA 4LV8A 3K5VA 1Q3DA 4RVKA 3FHRA 3RGFA 4ZZOA 3KF7A 3PXZA 3SVVA 5JFXA 3VBQA 2ZV2A 1ZZ2A 3UO4A 4CV9A 5DWRA 3CR0A 2NP8A 2WQMA 1OL7A 3R7VA 5LVLA 4GT3A 3FAAA 3PPZA 4PL4A 5GNKA 2WEIA 4F9YA 3F9NA 3IO7A 3QX2A 3UQCA 4XG3A 3UBDA 4FYOA 5HVYA 4BL1A 2DYLA 4XOZA 3MVMA 2OU7A 3DTCA 4ACCA 4KKEA 3Q53A 4QMSA 4WIHA 5HEZA 1JKLA 3PZHA 4RIYA 4RFYA 1KE6A 3KRRA 4YJPA 4AGWA 4G31A 3R7GA 2HWOA 5AJQA 1Y91A 4XLVA 3QZFA 1UWJA 2XYNA 2WZJA 1JKSA 4YNOA 3RPOA 4F0IA 3O7LB 5KMKA 4KRDA 3VBTA 5L8LA 5TKDA 4QMVA 2WQEA 2EWAA 4E4MA 3RPVA 1JSUA 3KC3A 3P08A 4XG9A 4I6QA 4Z16A 5B7VA 3BYVA 5EOLA 5FP5A 2J7TA 3HA6A 3PZEA 3QTXA 4FK6A 1OBGA 4A9UA 4P2KA 4TPTA 3QKKA 5DLSA 1FVVA 2C68A 4J97A 4L52A 1CKPA 3Q4ZA 3FLYA 5K9IA 2R3JA 3FZ1A 5IH5A 4PL3A 3ERKA 4G3EA 2X9EA 4TL0A 5TO8A 3MH3A 3QQGA 4WSYA 5CY3A 4YP8A 4BGHA 5CF4A 4QP2A 5I9XA 5AMNA 3ORLA 5CQUA 5IQEA 3V8SA 4AX8A 4RIOA 3KK8A 1I09A 3RK5A 3QC4A 2XVDA 3MWUA 2P2IA 2OIQA 5CXHA 3U54A 3TT0A 4EH2A 1CSNA 1T45A 4ASDA 1QPCA 3PXFA 5EDQA 3UG2A 5J5TA 4JR7A 3ENHA 3OTVA 3PJ2A 2BILB 4NM3A 5ACBC 4HVHA 2XBAA 3LMGA 3LMIA 4HPTE 5HD7A 3DXQA 4II5A 2ZV8A 2YM8A 5E7RA 5IA5A 3CY2A 1KSWA 5AUUA 4H36A 4J99A 2WNTA 5K5XA 4NK9A 3DBEA 4IX4A 3E8CA 2OO8X 3SOCA 5LVMA 2QOBA 4QMWA 4UXLA 4NL0A 4QP6A 4GYGA 4I3ZA 3H3CA 5HNGA 4LQMA 3QD2B 4GSBA 3KMWA 3HKOA 3OBGA 4YTIA 1PYXA 3BU3A 2WMXA 4YNEA 4ASXA 5D11A 5BX0A 4GW8A 3RBWA 5M53A 2CLQA 2O0UA 2XS0A 3D7TA 3NUPA 5IEXA 4H05A 4UMTA 5M4FA 2A0CX 4FV2A 4IXPA 4X2GA 2X4ZA 2QHMA 2UZDA 1OIQA 1YXXA 3FXXA 1WVYA 3PIYA 3QA0A 2EXEA 5AR3A 4DLJA 4CFNA 3OOGA 5C27A 2FSMX 4B7TA 3ANQA 4LI5A 4DCAA 4BIEA 4TWNA 1WMKA 1FPUA 2VWWA 4FYNA 4UB7A 2I0HA 2WU6A 3VHKA 3VS7A 5IUIA 3O17A 4U43A 5LWMA 2ITQA 4KIKB 4X3JA 3H9OA 4XOYA 5K3YA 4MQ1A 4D2PA 4FTUA 4EQCA 3ETAA 4C2VA 5I3RA 4R5YA 2OIBA 3RK9A 3SV0A 1PY5A 4IAKA 2XNGA 3BBWA 4KNBA 5L2TA 2UZOA 2WMQA 1WCCA 4I6BA 4BWPA 3HP2A 4KD1A 1L8TA 5GZ8A 2V7AA 5GZAA 2PHKA 3LJ1A 3QZHA 3HRFA 3MA6A 3LFBA 4FT5A 2YIWA 3ITZA 2YAKA 4BC6A 5A3XA 1P4FA 4KS7A 3VW6A 3FMMA 4G5PA 4RJ6A 5LWNA 2GNLA 2R3IA 5DNRA 3T9TA 3UO5A 4C57A 3ALNA 4C3RA 1OPJA 4LRJA 4DEGA 3THBA 2XK3A 3SG9A 3UPZA 2A19B 4JXFA 4MAOA 3VS0A 3QQFA 5LCKA 4FTRA 4B0GA 1OKZA 3DFAA 4L8MA 3OW4A 4TW9A 3QHWA 4CCBA 3FLQA 4ZMEA 3TKUA 3ZCLA 2VWIA 3DCVA 2EB3A 3I0OA 5EM6A 3LXPA 2QU5A 5HU9A 4QQJA 3GCQA 3R8MA 4LYNA 4R5SA 3UIMA 3DDQA 3NYOA 4H58A 3LKMA 4JAJA 4QP9A 4UYNA 2Z7SA 3R02A 4O38A 5FBOA 4DA5A 5BVEA 4S34A 5JSMA 1OECA 1NT2A 4WA9A 5KUPA 2GS6A 4YPDA 4E20A 4D4SA 4OGRA 3CPBA 3BV2A 4AF3A 5CSWA 2BKKA 4FL3A 2C30A 3IECA 4G9RA 4FR4A 3ORNA 4C38A 3H4JA 2HY0A 3FZSA 4P7EA 3F3UA 3SW4A 3Q9YA 3JS2A 5AUYA 3ZRLA 3KMMA 5L2WA 1W84A 3ZEPA 4M97A 4FSWA 1H1PA 1ZMWA 3VUGA 4E6AA 4MXCA 1BYGA 2XA4A 1JAMA 3W2QA 1YHWA 5DMZA 1ZOGA 3PE1A 3OCGA 3TNHA 5IA2A 2XKDA 3AQVA 4Y46A 4DTBA 2OJFE 3MJ1A 3PPJA 4FV6A 3Q4TA 2W1EA 2DQ7X 2JBOA 4DEBA 1PMEA 4PMTA 2ZYBA 3QU0A 4WSQA 3E7VA 3F2AA 4RA4A 3MV5A 3OTUA 2JFMA 3OG7A 3COKA 4TY1A 1OIUA 3UTOA 2XNEA 1OUKA 2W06A 1SM2A 4RJ8A 4EZ7A 3D5WA 1UU9A 2XIXA 1ATPE 3KXXA 4MQ2A 5AP7A 5F95A 1MRYA 3R7OA 4FI1A 3TCPA 3TNQB 4CKIA 3PFQA 4XV1A 4F9WA 5IH6A 4E6DA 4DYMA 5IU2A 4JL9A 3BPRA 5LCJA 4RWLA 2VRXA 2G2HA 4EUTA 2XF0A 3W32A 3KB7A 3QRKA 1M2RA 4FNXA 5AV2A 4FKGA 5B2MA 4IAIA 4R3PA 3GCUA 4KIOA 4BDHA 4LOOA 5EW3A 4FKRA 4O0XA 5C03A 3BE2A 3MBLA 2P0CA 3UJGA 3GUBA 2WTCA 4O7TA 2PVMA 3PJ3A 2C6TA 2R3MA 4Y95A 4HJOA 3HZTA 3JPVA 4LMNA 1Y6AA 3DAKA 3ORIA 5FBNC 1PMVA 3DBQA 5FTOA 1JLUE 4MNEB 4U42A 3E5AA 4Y73A 2YM7A 4KB8A 2XKFA 1REKA 4R3CA 3ATSA 3G9LX 3D5UA 3TUCA 1ZY5A 4GT5A 1L3RE 2QOQA 5JKGA 5IMEA 5KMOA 4EJ7A 3VBVA 1Z9XA 3BGPA 4NCTC 4A9RA 4RVMA 3V8WA 4D4RA 5AV4A 1GAGA 4QPAA 2C69A 2JIUA 2VTAA 3G9NA 2QURA 4OUCA 3KEXA 3WZUA 2V62A 2R3OA 3UNZA 3ZS5A 3UDBA 1Q8TA 2JC6A 3BV3A 2XIRA 4I5CA 2UW9A 3GC7A 4AGUA 3EN9A 4F7JA 3R63A 5CLPA 4GVJA 4OTRA 5CEMA 4AZFA 4CLJA 4FKWA 3VC4A 3LOKA 3HMNA 3ELJA 3GXLA 5HZNA 1KE5A 5ETFA 2P3GX 3W2SA 5CAOA 5IISA 1M2PA 1VZOA 2UZVA 2BHHA 4QMPA 4XS2A 4DFUA 4J8NA 3RM7A 4KINA 4OTIA 4V0GA 1ZMUA 2G1TA 4HNIA 5EKOA 4FSZA 4ENXA 3R71A 4O7ZA 3BBTB 4RZVA 4GH2A 5IQHA 2HAKA 3PSBA 2OWBA 2FVDA 3LHJA 4BTMA 2X4FA 3O8TA 3NAXA 3NUAA 3F3VA 3VUIA 2E9PA 3DB8A 3FLSA 1APME 4ZTRA 1AD5A 4MBJA 4TYHA 3PIXA 1R78A 4DH8A 1TQPA 2C6DA 1ZYDA 4L3LA 4C8BA 4HPUE 4U44A 4F65A 3BGQA 2QO2A 1E9HA 3AC8A 3A7IA 3CGFA 3NEWA 4AZWA 4DAWA 4RBLA 2R3LA 3UVPA 2X2LA 3Q5IA 3OT8A 4ZAUA 4NFMA 5LVPA 2BDWA 4FVRA 2J0MB 2LGCA 5BNJA 4O2PA 1FOTA 3RMFA 3U9NA 2FUMA 4GUEA 3BQRA 3OS3A 4NIFA 3VUHA 4Z3VA 3O50A 5IUHA 4S2ZA 2X8EA 2ZV9A 3LPBA 3VS2A 3WF6A 4WOVA 2VU3A 3WE8A 1R0EA 1PXIA 4CMOA 3U55A 4XH6A 2V0DA 3C4CA 5H8BA 1KV2A 4JG7A 2PUPA 2FO0A 5LARA 1VR2A 4FV4A 5IDNA 4OBQA 3QYZA 3ZUVA 3HMIA 2JFLA 3U4UA 4KWPA 4QPSA 2J0IA 1MQ4A 1OPKA 5E92A 4EOKA 5KMIA 2PVFA 3MPTA 4MXYA 3K54A 4IMYA 4BCKA 2IW9A 4A06A 3EN6A 3MVLA 4WNOA 3FKOA 2R3KA 4D2VA 4YZ9A 1A48A 3EQCA 3GGFA 3KRXA 1UU3A 2PZ5A 4WNPA 3TNIA 4EWQA 4YJTA 3QFVA 4IX6A 4OBPA 1UA2A 2R64A 4EHZA 3VIDA 2JKQA 3P79A 1DI9A 3R7YA 5DIAA 2V22A 3BEAA 3RPYA 5DGZA 2WTVA 3UYSA 5EFQA 2RG6A 3CLYA 4O0SA 1V0OA 5CVGA 2GFSA 5E8ZA 4C33A 2E2BA 5KBRA 1H08A 3M2WA 4L53A 3M1SA 3KMUA 3OY1A 4LOPA 3JY9A 2C5XA 1JNKA 1XH5A 4RIXB 3UQGA 5DBXA 3MY5A 3MFSA 5IQIA 3G5DA 2BMCA 5AP5A 3KU2A 4GT4A 5BYZA 5TF9A 1GNGA 2ITOA 5KMMA 3ZUUA 4BDDA 2BDJA 2J6MA 3P7BA 4NU1A 3R1NA 4FNYA 4RJ7A 3R8LA 5JFSA 3IW7A 2ZM4A 4QYYA 1Q62A 3HMPA 4DHFA 4IZ7A 2J90A 2W5BA 4DH3A 3KK9A 3LFEA 3RWPA 3W2RA 4OAUC 5EDPA 5BPYA 4KAOA 1AGWA 5FM2A 2SRCA 4ITJA 4IZYA 3U87A 5K0XA 4BI0A 4EH9A 4LGDA 3QTQA 4L7FA 4ALWA 4I5MA 4BDAA 1T46A 4JBOA 4FT7A 3WI6A 1CMKE 4QMXA 2GQSA 5DRBA 4ZLYA 1J1CA 1M14A 3KA0A 4UZDA 5JRSA 5M4CA 4OTHA 4RWKA 1OGUA 2W0JA 4KKGA 2XK8A 5CSHA 2E9UA 4XV9A 3S3IA 2ZM1A 4CFMA 4HGEA 3O96A 2Y4IC 3R21A 5L8KA 3ZONA 3FMKA 4K8AA 4BDCA 3PA3A 2VTMA 3FC1X 4PPAA 2OK1A 3QZGA 5HTCA 3DLZA 4X3FA 1QPEA 5DT0A 3RTPA 3R7IA 5CT0A 4ACHA 4F1MA 3CBLA 5ANJA 4I93A 3FI8A 4I0RA 3MTLA 4PPCA 3SRVB 3PSCA 3A4OX 3OWJA 2PE1A 3NIEA 3MVJA 4IAFA 4TZRA 4FZ7A 2HXLA 3HV6A 4GV1A 3O7LD 1JSVA 1Y8YA 3KKVA 3QHRA 4Z9LA 2OH4A 3VNTA 5KHXA 2OFUA 4BR3A 4JVGA 4FGBA 4D2SA 4J71A 4ZY5A 5A54A 3PVGA 4P5QA 2BUJA 3I6UA 4ANSA 1M7NA 1WAKA 3OD6X 4E5BA 1KOAA 4ACDA 4H3PA 3DA6A 4XX9A 4BGGA 5DVRA 2UZUE 4FZ6A 4AW5A 3S1HA 5EYCA 2OJGA 4EHVA
chains in the Genus database with same CATH superfamily
2C6IA 3IW8A 3ORZA 4WG5A 3RP9A 3NW5A 3SAYA 2W96B 4BZOA 4CT1A 3ZDIA 4BDFA 3ALOA 3C4ZA 3H30A 5AP2A 3D5XA 3N9XA 4I21A 4IZ5A 3AOXA 3MTFA 4IM0A 4I24A 4LV5A 4PTCA 1IG1A 3QGYA 2OXXA 4EUUA 3SX9A 4CG8A 4BWXA 3CJFA 3EMGA 3I1AA 5E90A 4NT4A 1BX6A 3ZOSA 4AZTA 2BTRA 5FWKK 4IB0A 4QYGA 5M4UA 3ACKA 3D0EA 4ZP5A 5BMSA 5EI2A 2B52A 4I23A 1BL6A 3UNJA 2PMOX 1NXKA 5HBEA 5TT7A 5HE3A 2NO3A 3S4QA 2XBJA 4O4CA 4C4GA 2PSQA 3BU5A 4IVBA 2OBJA 2Z8CA 4RIWB 3VULA 3E3PA 3PP0A 5CX9A 2W1IA 2PVHA 3QWKA 2CCHA 2ZDTA 4U0IA 3RNIA 4QDEA 3JY0A 1OL1A 4G3GA 3BRBA 3D5VA 4LRMA 3GENA 4U81A 5HKMA 1BUHA 3V5PA 4BDEA 3KULB 3R1QA 4EK3A 4O83A 1DM2A 4MKCA 5HG9A 4ASEA 2JDSA 4P90A 3OMVA 5FDXA 4ZJVA 5LXMA 4UMPA 3UZRA 3ZTXA 4MWHA 2WB8A 3VVHA 4LV7A 2C6KA 3Q9XA 3AC2A 5IA1A 3GT8A 4DN5A 3PVUA 2O64A 4D28A 1ZYLA 4GKHA 1FMKA 3BX5A 4RJ5A 3GOKA 3W2OA 3CTJA 2WTDA 4CG9A 4C61A 2C5OA 2QOFA 5AWMA 2C5YA 4GU9A 4M68A 4YLJA 3ODYX 4M69A 5M44A 4BJJB 2IVUA 4QTAA 4W8EA 4G6LA 1KOBA 1WBOA 2BTSA 3FY2A 4AS0A 4RQKA 5HCXA 3BYOA 1IAHA 2CNQA 3II5A 5AA9A 2E9VA 3WZKA 1RJBA 4B8MA 2X2KA 3GVUA 3Q32A 3MW1A 4E6QA 3CQUA 1JPAA 1PJKA 2CSNA 3BWFA 3P4KA 1ND4A 3UIUA 5J8IA 2X0OA 4FBXA 3QD4A 3NUSA 2YM4A 4J52A 4TYIA 2XM8A 5L2IA 3W55A 4FV3A 4NSTA 3TWJA 3F82A 5AUWA 4ZJIA 3LJ0A 4BI2A 5CAPA 2IG7A 2UVZA 4U7ZA 5LJJA 4ID7A 1G8SA 3MY1A 3LE6A 4DFYA 3E92A 3ZO4A 3LXLA 3JR1A 3F3WA 4RIYB 5EHYA 3LAUA 3CTQA 4EBWA 1UWHA 3K3JA 2OJ9A 3Q52A 4FT9A 4XHKB 4APPA 5HNIX 3RZBA 3VRYA 2VWVA 3DNEA 3DTWA 3KXHA 4FKLA 2HZ4A 5AP4A 4USDA 4RC4A 4O7WA 2HXQA 2QU6A 2ITYA 1PHKA 3G90X 2PVKA 1LR4A 3SC1A 2YM3A 4U79A 3NX8A 2XIKA 2Z60A 2VWZA 4NM7A 3KL8A 3T3VA 1KV1A 5BVFA 4AN3A 5C8KA 3VF8A 3OWLA 5DFPA 5KMLA 4DFLA 3QBNA 2QNJA 3FI2A 3ODZX 2C1AA 2C1BA 3PPKA 4L67A 2OI4X 3FKNA 5DA3A 5FM3A 5E8TA 2QONA 4APCA 4BWKA 3TUDA 4YURA 4B9DA 4ERKA 3LFAA 5T3QA 2XMYA 3T8OA 3F3TA 3VUMA 3CPCA 4EH8A 2W4OA 2WELA 4FKIA 4EOSA 4YU2A 5I4NA 3UE4A 4B4LA 4IJPA 4BVUA 3EJ1A 2R0UA 1ZZLA 4LUEA 3DAJA 3R1YA 4XG7A 1PXMA 3PIZA 4NYEA 4FSQA 5DT4A 3RAHA 3BI6A 5KO1A 2GQGA 3I60A 4YJVA 5ETAA 3V8TA 5HBJA 5J1WA 5J9ZA 1HOWA 4O27B 4WD5A 5HCYA 3VJOA 3R2BA 2W5AA 2PVRA 4G17A 3CD3A 1J1BA 4NZWB 4EHEA 3DBFA 2BAQA 2PVYA 4QYFA 2GU8A 4U8ZA 3OCSA 4QMUA 4N57A 3RAIA 3DXNA 3U4WA 2Y4IB 4PNKA 5A6OA 3LVPA 5JQ5A 1J7IA 3AKLA 2R7IA 5ICPA 2PU8A 3IONA 3MFUA 2KTYA 1XMMA 3GOPA 3U6IA 2ACXA 3R8VA 5DOSA 3UOKA 4C34A 4PWNA 5AM7A 5B2LA 5F9EA 3GBZA 3WF7A 1STCE 5CU0A 4S32A 4OTFA 3FV8A 4QTDA 5L2QA 4EH5A 4YMJA 5CEKA 2XYUA 4EC8A 1O6KA 2GNGA 4NUSA 3R28A 4AQKA 4L44A 3D7TB 3QLGA 1JKTA 4C35A 4PF4A 4FNZA 4Q2AA 4LL0A 2XALA 3NUUA 2IO6A 4E5WA 1VLRA 3ZZEA 4DF3A 2O2UA 5EK7A 1M7QA 4U3YA 3TDVA 3KGAA 4RG0A 4YZCA 2ETRA 5A4QA 1YWNA 3FWQA 1B39A 3F5UA 3NCZA 4DLIA 2ZV7A 4F64A 4TN6A 3GFEA 4FKQA 4KABA 3G0EA 2VX3A 3C9WA 3R04A 3D7ZA 2C6OA 3TZ9A 2F7EE 2OW3A 2OZOA 4FSTA 5HO7A 3QGWA 2YCSA 2VX1A 3R00A 5CNOA 3QRTA 4UX9A 3F2NA 3HRCA 2RKUA 3W2PA 3A61A 4F6WA 3GCSA 3F2RA 3ROCA 3LW0A 4FEUA 5BQ0A 5FXRA 3DZQA 4IFCA 3G51A 3W16A 1R0PA 4L3JA 3R8ZA 2X1NA 4R8QA 2QOHA 1ZWSA 5HNBA 3AXWA 1CTPE 5BVWA 3VQHA 4FIJA 4AOTA 4AT3A 4F6SA 1YOMA 4DHIB 3NNVA 4QP1A 4NWMA 2OH0E 5AR8A 2FB8A 4QNAA 4I0TA 3ZSHA 3ZLYA 4J1RA 1LEZA 3LCOA 1UKHA 3Q96A 5CT7A 1RQQA 4I94A 2PPQA 2ITZA 3BHHA 3PJCA 4G6OA 2BRBA 4JBPA 3IPHA 3L8PA 5DHJA 3QTSA 1FGKA 3FQHA 3QTZA 4O81A 2QKWB 1W2DA 4FODA 1OL5A 4XJ0A 4XMOA 5AUZA 1Q24A 5D1JA 3RK7A 4OTWA 3K3IA 4NJDA 4W4XA 1YDSE 2QOLA 1HCKA 4AA4A 3W33A 4WRSA 4F78A 3TV7A 4O7SA 1RW8A 4XG6A 4QMYA 4ZLZA 4NM5A 2AC5A 1GY3A 3PYYA 4M8TA 2E9OA 2XCHA 3ZU7A 1GZ8A 4JRVA 3FC2A 5M51A 1XH9A 5I9YA 4OR5A 1S9IA 4FC0A 5HO6A 3FQSA 5EH0A 2UW5A 2FSOX 1WZYA 4Y83A 3QF9A 3TKHA 4EOJA 5CAVA 3JXWA 3SLSA 1J7UA 3EYHA 3B8QA 1H0VA 4F9BA 2B9IA 4FTMA 5AAFA 3BQCA 2IVTA 2JIIA 5KE0A 3ZMMA 5IG1A 3EH9A 4U6RA 2BAKA 2W1HA 4HCTA 2PMLX 4I20A 3B2TA 3BLRA 2VTSA 4DE4A 4D2RA 4BBFA 3VW8A 2WTWA 3OWKA 2WMAA 2FGIA 4O0TA 3SDJA 4YZBA 3VS4A 5HX6A 5J9YA 3JVSA 2W7XA 3UGCA 3PWYA 2XP2A 4RJ3A 4DGMA 4PTGA 4I6FA 3Q6UA 4IWPA 5GZ9A 5HVJA 3MB7A 2ERKA 3OWPA 3R73A 5EDRA 2X81A 4I92A 3NAYA 4JDHA 3KFAA 2QOOA 4K1BA 5B2KA 4Q9SA 4FEXA 3A7GA 5DT3A 2C3JA 2GNHA 3FY0A 5AP6A 3UIBA 4QMNA 3A99A 3C5IA 2Y7JA 3CY3A 4EWHA 2QR7A 5A14A 3P5KA 4L00A 4V05A 2JGZA 3ATTA 1LUFA 5CF5A 2B1PA 1Y6BA 3KRWA 1JVPP 2WQNA 2OIDA 4L7SA 4BKZA 5KCVA 3TM0A 4W9XA 4GJ2A 5JFWA 3IW6A 2WQBA 4IB3A 4GRBA 4O91A 3PY0A 2VX0A 3DBDA 3V51A 4DFZE 4KIPA 2HCKA 2A98A 1XH7A 5I9WA 4XV3A 3F7ZA 5AV3A 5CEQA 2R5TA 3Q4UA 5E8SA 5H8GA 3OUNB 1W83A 3D2IA 5BMMA 5CU6A 2ZMCA 3MVHA 2VD5A 3EWHA 3F3ZA 1PW2A 2I0YA 5C8NA 5F94A 4AGCA 5H2UA 3NSZA 1TKIA 4L9IA 4L3PA 2AQXA 3QXPA 2G2FA 2Y8OA 4YUQA 2A1AB 3PA5A 5FTGA 5B0XA 2DS1A 4IAYA 4O7VA 2F9GA 3NRMA 4F9CA 4K77A 3EQPA 2Z7QA 3PDTA 3UC3A 3TG1A 3DV3A 2UW4A 1GIHA 3PSDA 3RPRA 1XBBA 1YRPA 4G3CA 2J0LA 3U6JA 3ZLWA 5GJGA 1TQMA 2VTQA 4CKJA 5L6WL 4UBAA 4ZIMA 3FMDA 5DN3A 3ZLSA 1IA9A 1TQIA 4UXQA 3ENMA 1O9UA 2CGUA 5AADA 2ZFYA 3W0SA 3EQHA 2UZLA 3IDCA 4TYGA 1G8JA 4FEWA 2X0QA 2W9ZB 5BVKA 4I5PA 4QP7A 1OMWA 2FA2A 4RSSA 4V0GB 5C1QB 4DGLC 5M56A 4FZFB 4EKLA 2WTKC 2ONLA 3R7EA 1J7LA 5HU3A 3N51A 4I5HA 4QMTA 1FBNA 4K6ZA 3KXNA 4D5KA 3FLWA 4DT8A 4IH8A 3ZFYA 4F08A 4FEVA 4FV5A 4IFGA 4IVAA 3V5JA 3EFKA 4EOOA 3EZVA 4DC2A 4CGAA 4CKRA 1F0QA 4FV9A 5HIEA 4H3BA 4TYHB 3DPKA 3K2LA 5FEQA 4D9TA 3HMMA 2BFXA 4FOBA 1H1QA 4HGTA 3G2FA 2HW7A 2J5FA 2PK9A 2OXYA 3FPMA 3EHAA 3JVRA 4PPBA 4QTBA 5GINE 1IA8A 4TNDA 5DR6A 2UW3A 3VWAA 4WUAA 4NIFB 5DI1A 4JG6A 2EXCX 5EHOA 4AZSA 4EH3A 3I6WA 1XH4A 2X2MA 3OUKA 3QTWA 4FUXA 3UODA 3EL8A 4ZTMA 1YXSA 2H8HA 2VWXA 3A2CA 5ANKA 4F1TA 4FVQA 4IZAA 2O65A 4JRNA 5LMKA 3TDWA 3NW7A 5HICA 3FE3A 2CMWA 4EC9A 5KKRC 4AXEA 4CLIA 3EOCA 1A9UA 2BIKB 2X9FA 2HZNA 3NLBA 4BTFA 4X2JA 1R1WA 1WBPA 4AOJA 4CV8A 5AFVA 4ENYA 2OSCA 4RX7A 3R7UA 2XNOA 5J9LA 2YHVA 3A60A 4GL9A 4O86A 3GU8A 3QQLA 3GQLA 5CSVA 4JX7A 3TZ8A 3U9CA 4BDKA 3OEFX 4HVIA 2JDRA 2WOTA 3ORXA 3P7CA 3UDSA 2XIZA 2WIPA 5ANEA 3IOKA 2HK5A 4XUFA 3V5LA 3TUBA 1IRKA 4KIKA 2CDZA 3KVXA 1PMNA 3F5PA 4BKJA 5FLFA 5J95A 4AAAA 5I9VA 5ACKA 2JITA 2UZWE 5HIBA 3QUPA 4RMZA 1TFFA 2GTNA 4O7LA 2YIRA 3NMUF 2ETKA 2IF8A 4I4FA 2EXMA 1R39A 2OJIA 4FKTA 2CPKE 4I41A 4UWBA 5CXZA 3SW7A 5CEPA 4IVDA 2PUIA 4R1YA 2PZRA 4AUAA 3FXZA 3ZH8A 4ANOA 5AA8A 3ZHPC 2W17A 4PMPA 3PVBA 5M06A 4L68A 1NVRA 4LL5A 4QMOA 5HG8A 5DE2A 4HZRA 2A4LA 5BVOA 2RFSA 3MH0A 3P23A 4YPSA 4FSUA 3QC9A 1IASA 3O51A 4ZSAA 5M08A 4MWIA 3GC0A 4NW6A 5CNNA 3TV6A 4C7TA 3HEGA 3G0FA 2XRUA 4YO6A 4FL1A 1FGIA 1KUTA 2UW6A 4Z7GA 4JIKA 4LM5A 5CALA 4DGGA 4QEBA 3NVMB 2C6LA 2C3KA 5DH3A 4R6VA 5CF8A 4E8AA 3MIAA 4YTFA 3H9RA 5AM6A 1XKKA 4CMUA 5JMSA 2GNJA 1U5RA 5JK3A 1P4OA 3DQWA 4WRGA 5IA0A 5M07A 2GHGA 1X8BA 4CT2A 2VUWA 2G01A 5E8XA 5F1ZA 1G8AA 3KRJA 2YN8A 4C4IA 4FV7A 5AR7A 3ZBXA 4F6UA 2X6DA 5L3AA 1VJYA 4MBIA 4EQUA 4B8LA 3LMHA 1Z5MA 3VBWA 4YBJA 2J9MA 2PMNX 3FLNC 4LGHA 2C5NA 2YIXA 3HUCA 3Q60A 2GQRA 5CEIA 3R2YA 3GP0A 4X3FB 5A4TA 4UV0A 5IKWA 3HAMA 4HZSA 4D0WA 3S2PA 4MD7E 2ZB1A 4FV8A 4BDBA 2X8DA 4C4HA 4FKPA 2YERA 4BDIA 2KULA 4EH4A 3UYTA 3N4VA 3GFWA 2BHEA 1YI4A 3FMHA 3LCTA 3NYNA 1UV5A 4G9CA 3FZPA 5BUIA 1YOLA 1MUOA 5BUEA 2PVJA 1U5QA 4N4SA 3KIOC 4TT7A 4CFFA 4CYJA 4DBXA 2VAGA 4FTTA 4I22A 4MYGA 4FIIA 3K5UA 1P5EA 5DRDA 1ST0A 3VJNA 5CASA 2BPMA 4M0YA 3BCEA 1OB3A 3HECA 1PKDA 2CGWA 3PUPA 2H96A 2RG5A 2CJMA 2BKZA 4ZMFA 4GK3A 1WBSA 4IB5A 4WNKA 4XBRA 3HDMA 4FTOA 4YTHA 2CKQA 1YQJA 4NW5A 4NJ3A 3DJ6A 3EFJA 3NR9A 3SA0A 4NKAA 4MEDA 3BYUA 3OT3A 3V04A 2OFVA 2WAJA 3NW6A 4BYJA 3Q6WA 4G16A 3F61A 4QPMA 5I3OA 4CCUA 2JBPA 4JDJA 2CNUA 1NVSA 4UMQA 3R8UA 3ROYA 1WBVA 2UZEA 1UVRA 3QCQA 2WQOA 1YHSA 3LM5A 2GS2A 1FVTA 4K33A 2W99B 4RGJA 4JT3A 3PRIA 1XJDA 2O5KA 3ID6C 2YA9A 5IEYA 3E64A 3DS6A 3QUDA 3QLFA 2FH9A 5IDPA 4TWCA 2QI8A 4UALA 4A4XA 4ACGA 2W4JA 1YWVA 3IGGA 2WTKB 3NDMA 4C3PA 5E4HA 4M66A 3QA8A 3UZPA 4CQGA 5A4CA 4XG2A 4FKUA 1UNLA 1GIIA 3OOMA 4ZTQA 4TYEA 4DFNA 3REPA 1UKIA 3P7AA 3POOA 4FIEA 5CS6A 4BTKA 4I4EA 2J4ZA 2V55A 1G3NA 2W4KA 4LGGA 5JH6A 4FJVA 1U54A 3QUEA 4BCFA 4TKSA 2BIYA 3FL4A 4D1XA 2IWIA 2CGXA 4Y85A 4BY9E 4RWJA 4O0WA 1GIJA 3AMBA 4EZ5A 4D1SA 4WO5A 4M69B 3BL9A 4ZSGA 3VUKA 4CFUA 2F4JA 4CEGA 5KMJA 4EJNA 3ZO3A 1PF8A 2XM9A 4LG4A 3KREA 3A7FA 3RI1A 4R7BA 5C8MA 3QCSA 4YSMA 5I0BA 2FYSA 3F7WA 4BFMA 4ITHA 1PMUA 5E9EA 3QRUA 4MCVA 1KE9A 5L2SA 2VTNA 2GHLA 4A9SA 3Q9ZA 2Z02A 1OIRA 4FTCA 1YI3A 4BRXA 5KKRB 5C4KA 3HAVA 3UQFA 3POZA 4XCUA 2I1MA 3P86A 3C7QA 5L6OA 3A4PA 2VTPA 3KCFA 1U59A 5JGBA 2OICA 5HVKA 3CSVA 4FSMA 3Q3BA 2JLDA 3TZMA 1YDTE 5G6VA 3WBLA 4CVAA 1P14A 4ITIA 1VEBA 1O6LA 4F7LA 3PTGA 2H6DA 4QP4A 5CWZA 3L8XA 2NYAA 4GYIA 3HMOA 3NUXA 3O23A 1MRUA 3UP2A 4UN0C 5GIPE 4JLCA 3O8UA 3CC6A 4M84A 4FOCA 4AZEA 2NNWB 2EB2A 2Y4PA 3QD0A 4FG9A 3IG7A 4NTTA 4ZJJA 4ZOGA 3TTIA 3WOWA 2B54A 2BALA 4N6ZA 3G6GA 4O4BB 4AP7A 2C6EA 2XUUA 2YDJA 2F49A 2JDVA 3BE9A 2B55A 3C4XA 4ARKA 2WO6A 5KZIA 2XANA 4GKIA 3LFFA 3OZ6A 5ANOA 1BKXA 3E62A 4S31A 4XP3A 5CVFA 4P5ZA 3ZFMA 4CFVA 2IW6A 2HYYA 3BKBA 4IX3A 2BDFA 4FICA 5HO8A 4DEDA 3SHEA 2GMXA 2BRNA 1OUYA 1ZYJA 4FTQA 3IKAA 4QTEA 2PULA 3U6HA 4FA2A 5TOZA 3R9NA 1QPJA 3CQEA 5AV1A 2VGOA 3R8PA 3BLAA 4HGLA 4ONAA 5JN2A 3WZJA 1VYZA 1PXPA 2XJ0A 4KSQA 3V6RA 4QP3A 2IZRA 3Q5ZA 1MQBA 3QKMA 5KBQA 2ETMA 4ASZA 4TNBA 3SKCA 4IVCA 3VHEA 4RLKA 1Q5KA 4U45A 1CKJA 5IUGA 1ZOHA 4YJOA 2YACA 2FSLX 4YLLA 4G1WA 3D94A 4FTNA 4ZSJA 4PDOA 4F4PA 5DR9A 5ANGA 4BCPA 4FF8A 4BCOA 5GJFA 3NNUA 2EU9A 3BELA 1XR1A 2P33A 4FIGA 2W1CA 5EM7A 4D2WA 1DI8A 4FGRA 5EYDA 2JAVA 3ZC6A 2ONLC 2W1FA 3H9FA 4DEEA 1YDRE 1ZAOA 4JJRA 4EK8A 3DXPA 2W05A 5D41A 3ZLXA 4M13A 3E8DA 4GK2A 4BZNA 2UW0A 3EQDA 5BVDA 1GZKA 3ZRKA 3ZO2A 4DHZA 3OY3A 1XMLA 3FDNA 5EOBA 2GTMA 3EIDA 4QQ5A 2BZKB 2WGJA 4QT1A 4YZMA 1SVGA 4HCVA 2PTKA 1B38A 4RFZA 3V5WA 3L9LA 1ZLTA 4IIRA 3QZIA 4NFNA 4WUNA 4WBOA 2QO7A 4BBEA 2IZUA 4O0UA 1XQZA 2Y6OA 2ZAZA 5J1VA 3C4EA 5A6NA 5JT2A 5EKNA 4IWOA 3COHA 5I9UA 4QMQA 1YXUA 2B4SB 3QAME 3NYXA 4HYUA 4KBCA 1RE8A 2VTTA 3VRZA 1E1XA 4I6HA 4BCGA 3IW5A 3BL7A 5AX3A 3EN7A 5EW8A 1EH4A 2C5VA 2CKEA 2GHMA 3MY0A 2QO9A 3GI3A 4OT5A 3UVQA 1OL6A 4O7NA 2WKMA 2F7XE 4ZTSA 3CKWA 1JQHA 3A7HA 3HUBA 4U5JA 4EKKA 5AEPA 2PUNA 4UEUA 5EQEA 5L6PA 3ZSIA 3LJ2A 4C59A 2UVXA 4CFWA 5IQBA 3RCDA 1MP8A 3UOLA 3ZXTA 3QYWA 3VAPA 5HCZA 3L1SA 4C4EA 2J5EA 2W9FB 5EW9A 2OLCA 2RGPA 5JFVA 4Q5EA 3RZFA 5C26A 3P1AA 4JNWA 2J0KA 4AQCA 2FSTX 3OC1A 4NEUA 2BVAA 4O1OA 5FGKA 2BZJA 3W0PA 2PE0A 2WIHA 2YZAA 3PXQA 4P4CA 3LLTA 5J7HA 3CS9A 4W4WA 2IVSA 4LFIA 3T9IA 2UZTA 3OHTA 5EI8A 3HRBA 4O21A 2BZIB 4BCQA 1RDQE 4HVGA 4XP2A 3FMJA 4FKJA 4ZY6A 4YLKA 4MX9A 3OROA 4D2TA 3HVCA 2CN8A 3G6HA 3QQUA 2HW6A 4PDPA 4AW1A 1BLXA 2VWYA 2JEDA 3EQFA 5FXSA 3NIZA 4GK4A 2YIQA 4IACA 4JDKA 4MK0A 4QNYA 4BDGA 3PY3A 4KUJA 3G15A 5GIOE 4AACA 5HOAA 3FBVA 3TIYA 4F9AA 2XK4A 1PKGA 3O0GA 3FZOA 4RZWA 3C4FA 4DTKA 1CDKA 5BUJA 2B0QA 4XV2A 4JBQA 2XIYA 5CQWA 4PMMA 4FT0A 4R77A 2CKPA 1NVQA 3VN9A 4HCUA 3MN3A 4FZAB 4BCJA 4DT9A 2W1GA 3AG9A 3OVVA 3VS3A 4QYHA 4L01A 4YGAA 4O0RA 2GNFA 5EYKA 4GVAA 2R3HA 3FUPA 1H26A 4L43A 4OT6A 3BHTA 2BFYA 3VBXA 3TNPC 3QWJA 4EHGA 3FHIA 5D7AA 2WOUA 1H1WA 5K0KA 2ZVAA 4G2FA 5HLWA 3KY2A 4FTAA 4MD8E 5EM8A 4BCHA 3PUFC 5A4LA 2WMSA 5CENA 4GJ3A 4HYHA 1W2FA 3MDYA 4C62A 4YSJA 4PTEA 4WBBB 4YJSA 2AYPA 4JX3A 3NVKI 2GCDA 2H9VA 3HYHA 5C01A 3DZOA 1GZOA 4A9TA 3MFRA 1SMHA 5HTBA 4X2NA 1JBPE 3LFNA 4YC3A 3COIA 3LFQA 4I1ZA 1XH6A 4QO9A 2Z2WA 3CE3A 3LFDA 4RPVA 3T3UA 3FZRA 2X39A 4ANBA 2BRMA 3KVWA 3OXZA 4E4NA 2VO0A 3HLLA 1K9AA 1Y8GA 3RKBA 3LCSA 2J51A 3CTHA 4BJJA 2XNBA 1LP4A 4YTCA 4F63A 4IANA 4DEHA 3OXTA 2YFXA 4MVFA 2XB7A 3FZTA 3SD0A 4AW2A 2YZLA 3BHUA 3DKGA 5LMAA 4F7NA 1IEPA 4AFJA 3CJGA 2ITTA 3FKLA 3GQIA 3PWDA 4Y5HA 2W5HA 4DINA 4BCNA 4N70A 4M7IA 3BIZA 2R4BA 1GJOA 2J2IB 2XZSA 3E93A 3S0OA 2OZAA 4PX6A 2I7QA 3R9RA 5E8VA 2PZPA 3MJ2A 3ZZWA 1BI8A 5CZIA 2XRWA 1Z57A 3DFCB 3VBYA 3O71A 2ITUA 4FT3A 4RC2A 3S00A 1QCFA 2EUFB 2UZBA 4MHAA 3ULZA 4Y5QA 2Q83A 4RRVA 5HTIA 4K11A 1ZRZA 2WMWA 3C1XA 4IWQA 2CHLA 5D12A 4BYIA 3MIYA 1KE8A 4DFXE 5AR2A 3LFCA 4C4JA 5HX8A 4PY1A 4KS8A 3MSSA 2YABA 5DG5A 3ORPA 4GFMA 4IE9A 2XNMA 5FQDC 3UMWA 5FG8A 2R3QA 3DBCA 4PV0A 1QL6A 1LEWA 3BHVA 4CZTA 4D9UA 5LVOA 2J50A 3CEKA 4BF2A 1URCA 3CQWA 4FK3A 3TKIA 4H1MA 5JGDA 4ZSLA 4OAVB 1LPUA 3OCTA 3QTRA 4R3RA 5CI6A 1I44A 4YZDA 4L42A 5HE1A 4IAZA 4AT4A 4BHZA 3FQEA 4K2RA 3D2KA 3WILA 2QG5A 4BGQA 3AMAA 2EVAA 3COMA 1J3HA 3CXWA 4E5AX 4V01A 3C0HA 2QLUA 3LQ5A 1OIYA 3AGMA 3VUDA 4CD0A 4EOPA 2X0PA 3RWQA 4EK6A 5AR5A 2VGPA 4JQEA 5JRQA 2R0IA 4KA3A 4F1OA 2X6EA 1ZY4A 3DKFA 4HGSA 3KRLA 2VO6A 3BHYA 2R3FA 2B9JA 2QQ7A 3JUHA 4B6LA 3FMLA 4DG3E 4JQ8A 2PYWA 3U8WA 2JAMA 4CTBA 1BMKA 4W4YA 2YM6A 3ZM9A 4BTJA 2C6MA 4QDVA 3MPMA 3QTIA 4DGNA 3F88A 2YLFA 3R0TA 4HNFA 4AWIA 5HG7A 4BKYA 2H34A 3M11A 4PL5A 4IDTA 3EB0A 3BLHA 1WBWA 3DKCA 3L9NA 1CKIA 2VO7A 3LQ3A 3FI4A 5EM5A 1NW1A 4PRJA 2ZM3A 5ANDA 4ZY4A 2REIA 1XBCA 4X3FC 2WMUA 4ACMA 4EI4A 5FDPA 3DJ7A 4M67A 5T68A 3QKLA 3TACA 3AT2A 4GIIA 3P9JA 4IDVA 4EH6A 3FSKA 4RVTA 2RFEA 4B99A 4O82A 5FUTA 2C3LA 3H0YA 4C36A 2VTHA 4AOIA 2UW8A 2QKRA 1SVHA 2PE2A 2WHBA 2G15A 5HORA 4RX9A 4ZZMA 4HVSA 3V01A 4U97A 3WYXA 3RALA 2OJJA 5JQ8A 1H25A 3NUNA 3DK6A 3L9MA 3UNKA 4GG5A 4O4EA 3A8XA 3UC4A 4EOLA 3PXKA 4C2WA 4ZSEA 4N6YA 3I5ZA 3UP7A 4FMQA 3FYKX 3WIKA 3LZBA 4MH7A 2XK6A 5FEDA 4EBVA 1U46A 1TVOA 3LXKA 2YCRA 3FI3A 3O8PA 3DAEA 3NFGB 4NKSA 5AX9A 4MD9E 4MF1A 3N4TA 2JKOA 1UNGA 3CIKA 5LMKC 4QMMA 4XNEA 4FG8A 1B6CB 4OW8A 5DEWA 4C3FA 3AKKA 2HOGA 2BRHA 2C0IA 3DB6A 3DNDA 2ZDUA 4ZTHA 4MXZA 3ZFXA 3ZRMA 4J98A 5A4EA 1Q41A 1SYKA 3B2WA 1YHVA 4M14A 4C37A 4LOQA 1XHAA 3L8SA 4HYIA 3BYMA 2QOCA 4KIQA 2WU7A 3RVGA 3UO6A 4DEIA 3L9PA 1YXTA 2X7GA 3BYSA 3QRIA 1PXNA 2YAAA 4YJRA 2RL5A 3CGOA 3D15A 5CU4A 5CI7A 3R83A 2WEVA 3EKKA 3OF0A 4AW0A 4UMRA 2O63A 4YBKA 2ITPA 3UOJA 2YM5A 3OCBA 2HZ0A 2WTJA 4L6QA 4YZNA 5E8YA 4DCEA 2I0VA 1WBNA 4QD6A 2VTJA 5IQDA 2CN5A 2WMRA 4UYAA