1ZZ2A

Two classes of p38alpha map kinase inhibitors having a common diphenylether core but exhibiting divergent binding modes
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
337
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Two classes of p38alpha MAP kinase inhibitors having a common diphenylether core but exhibiting divergent binding modes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 337
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zz2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zz2A01
2YHVA 3EFJA 5LMKC 3ZTXA 3SVVA 2JC6A 4LL5A 2CN8A 5FBOA 3QQGA 3ZC6A 4G3CA 4M12A 5ETCA 5GJGA 3SG8A 2W05A 3DCVA 4I5HA 1MQ4A 3WF6A 4ACCA 2B53A 1IA8A 4GT5A 4J1RA 2UW4A 2F2CB 2CKEA 3M2WA 4KIKA 4LGGA 3V6RA 5CI7A 5TT7A 1XH7A 2ITNA 3EL8A 5HG7A 1W0XC 2VTLA 3PE1A 4FKPA 3PXYA 4AT5A 3DK7A 4WNOA 5AR4A 2IVTA 4S32A 2XK9A 3T9TA 4KA3A 4GT4A 4O7ZA 3ZS5A 4AX8A 1ZARA 3A7FA 2PUNA 3U87A 5D1JA 2GQRA 4FL3A 3UC4A 4NKSA 3ZBFA 3K2LA 4IAAA 4BWXA 1H1SA 1LPUA 3C4XA 1WVYA 4OUCA 5DPVA 4ZZNA 3Q2MA 4I4FA 3CCNA 2P33A 4KNBA 4A9UA 4XBRA 4G34A 4RRVA 3BWFA 3BI6A 1DI8A 2H8HA 2WZJA 3D7ZA 3HL7A 5EOLA 3LAUA 4QTCA 4H1JA 2PTKA 5AUTA 2WO6A 2XIRA 2GNFA 4JG8A 4BFMA 1UU7A 5CEKA 4FTUA 3EIDA 3ENHA 4FX3A 2J2IB 3OXZA 2CCIA 3Q04A 3QD2B 4HCVA 4U80A 5AR8A 5BX0A 4YBJA 4NIFB 3QZHA 4J98A 3OWPA 4R7IA 3RBWA 2C6TA 2VTNA 3M42A 5JRQA 2Y4IB 5HICA 1BKXA 4FT5A 4NM0A 1DI9A 3DKGA 2KULA 4YLKA 5KMMA 2GTMA 2J0MB 5BVOA 2R3JA 1YHVA 4FZAB 1Q62A 4I6BA 3PIZA 4HCUA 4QTDA 1IASA 1TKIA 1ZOEA 3LMIA 3A8WA 4DEHA 4XHKB 3CKWA 3QWKA 1BMKA 2NRUA 4GJ3A 1FINA 5M44A 4YTHA 2CSNA 2R4BA 4FGBA 2G9XA 3QU0A 5M4IA 1E9HA 1ZYDA 2VO3A 3BU3A 3FYKX 5A4TA 4YURA 4M84A 1V0OA 4C34A 2Z8CA 4F7JA 2OSCA 3DBQA 1YWRA 2OFUA 3W2QA 2V7AA 2PVRA 3ZRLA 4EBVA 2GFSA 4F70A 2XF0A 3KFAA 2XYNA 3JXWA 4C57A 2GS6A 3NUXA 3R7EA 3A99A 1S9IA 5FRIA 4D2RA 2BTSA 5IF1A 2B1PA 1CKJA 5HIDA 2HXLA 1REJA 3THBA 3VS3A 3AQVA 2HOGA 4Q5HA 5D7AA 3KK8A 3ORNA 2OXYA 5F95A 3FXZA 4OR5A 3GFEA 2X4ZA 3NW6A 1TQIA 3GQLA 4DG3E 3FMMA 3P9JA 2IZUA 3PRIA 3ZHPC 4IZAA 5HG5A 5K0KA 2YM6A 4JR3A 5AJQA 5A46A 4AN3A 4IVDA 2XBJA 5AX9A 1B6CB 4FTNA 3AG9A 4BBFA 3NNXA 3D4QA 4BDIA 5HVJA 3ZCLA 2YLEA 1BI8A 4C3RA 3GC7A 2QCSA 3IDBA 4MBJA 1OZ1A 3D15A 4FSUA 2ZMCA 4AA4A 1P4OA 4L68A 1ZZLA 3PWYA 1YXTA 2ITXA 3DY7A 3KMWA 5EH0A 4RIWB 3TIYA 4CCUA 4X2FA 3CQWA 4EQCA 3LOKA 5E92A 2PVJA 4A06A 2YIQA 5LXMA 5EM5A 4QPSA 4FIEA 1YXVA 2XK4A 2WTCA 5EW8A 4MBIA 4NM3A 4BZDA 5KHWA 4IFCA 1WBSA 5CU2A 3W2CA 5CAQA 3CXWA 3QFVA 1BL7A 5CU4A 3PXQA 4C2VA 2AC5A 4RX8A 4YZBA 5CF4A 5EHLA 4YGAA 3KL8A 4O91A 4AFJA 4CXAA 4FEVA 3E8NA 4FIIA 2GU8A 5AR5A 4B99A 4PNIA 2XKFA 4O38A 3R9OA 5BYYA 3UIBA 4TYGA 2VNWA 1XBCA 3EB0A 5D10A 4FUYA 5A9UA 4E20A 4BCKA 4G6OA 4EK6A 3FE3A 3O17A 1LUFA 2R3NA 3BHTA 3LM5A 2UZWE 3FZPA 1OB3A 4LV8A 4QMWA 4YZ9A 1SM2A 3CGFA 3OY3A 4QP9A 3SGCA 4DBXA 4WG5A 3FQHA 5DYJA 4BI1A 4AN9A 2PVYA 2XCKA 2AUHA 4U42A 4UMTA 5AFVA 3PYYA 5D11A 3D5XA 2PHKA 3KRRA 3NCZA 4U97A 4BHNA 4CFNA 5CXHA 4WSYA 2HZ4A 5CAUA 3P4KA 4R7HA 3EYHA 2WQOA 4G3DA 3UMXA 5ANIA 3BE2A 5CX9A 5HE1A 3U6HA 2WKMA 4U41A 3AC2A 3Q3BA 4PF4A 5HNGA 3U9CA 4NUSA 2XIKA 4FNWA 2BAKA 5HD4A 4ALWA 4O84A 2X0GA 2G01A 3PJ1A 4QMXA 3ZXTA 4Z9LA 2IZSA 3BYUA 3KXNA 4GW8A 4KRCA 3FI8A 2C1AA 2PU8A 3R8UA 3LLAA 4YJTA 3GCVA 3UVQA 5CTPA 4CFMA 5BVNA 3LCDA 5EM6A 5BVEA 1NVSA 4HYHA 3Q4ZA 4BYIA 4UYNA 5DR9A 3GBZA 3U8WA 1RJBA 1XBBA 4NFMA 3DLSA 4ONAA 1WBNA 3RP9A 5TE0A 1KV2A 5EDRA 3V01A 4O0XA 5HE0A 2HXQA 3IONA 2JITA 1K3AA 3R7GA 5AV4A 3FPMA 4I0RA 3PVWA 1OKWA 3ZZWA 1PXMA 3QRIA 4RGJA 4CGAA 3PPZA 3F7ZA 4AS0A 4EZ3A 4OTHA 4IWQA 4OW8A 5ETIA 4PX6A 4FVPA 3ELJA 3DBFA 4JNWA 3WZJA 5KMNA 3IGOA 2O8YA 5C1QB 2E9NA 4K0YA 4FV8A 4D58A 5C8KA 1MQBA 3V5TA 2WQBA 2XIYA 4CSVA 3R8PA 4DFNA 4A7CA 4QPAA 4EJ7A 3BYOA 4FNZA 2BALA 4IAKA 4XOZA 3LMHA 2RG5A 3P79A 1STCE 4IAYA 2YZAA 3O8PA 2IN6A 3OTVA 4K6ZA 4RA4A 1ZMUA 4FF8A 5CVFA 4RWIA 3QZIA 2GHLA 4DN5A 1IR3A 1PW2A 3QBNA 3ATTA 3FMNA 5EQEA 2PZIA 2OZAB 4M3QA 2GHGA 4NH1A 4TYEA 5TKDA 3RHXA 4FTAA 2YAAA 3F2RA 5AADA 3Q53A 4GUBA 4FSQA 3V5PA 4TL0A 5GIPE 4IH8A 3KQ7A 4OTGA 5AUVA 3TCPA 1CSNA 2C30A 4M14A 3TN8A 3B2TA 1PMNA 2IJMA 3OROA 4FKJA 4AQCA 4P5QA 3EN5A 5L3AA 3LIJA 2Z02A 3VULA 4UALA 5A54A 4V05A 2NRYA 3DXNA 4B8LA 4G3EA 3EQHA 1GNGA 5JKGA 4BRXA 1YKRA 1PXJA 3L8XA 1Q99A 2B7AA 2VWYA 3ALNA 2OJGA 3QXPA 4FZ7A 5CAPA 3EWHA 4M97A 2X8DA 2ACXA 3R30A 1JSVA 2YN8A 3A4OX 4JBQA 3IKAA 4ANSA 4IWPA 3WIGA 5H3QA 4OAVB 2C69A 3CKXA 3QTWA 4YNEA 3VVHA 3UGCA 1VYWA 3GI3A 4ZTQA 4DGNA 3F5GA 1K9AA 4WNKA 2XNOA 4DEDA 3QQUA 4QMOA 2X8EA 4C8BA 5CAVA 4MQ2A 1KE6A 4JG6A 4NW6A 4J52A 5CT7A 5HIBA 4RJ6A 5HZNA 4F09A 2UZOA 4ACHA 2CKPA 4GMYA 4L52A 4AACA 1UU9A 4Z55A 4FKSA 2PUIA 2Z60A 4QOXA 1DAYA 3OCGA 4J99A 2F7EE 5HCYA 4FUXA 4NZWB 2QOIA 3OWJA 3RAHA 4AE6A 5KBQA 4XG7A 4BBEA 4EOOA 3E62A 3POZA 2UW9A 5GZAA 5TR6A 4BWPA 3ZLWA 4I4EA 4BTFA 1H00A 3NNWA 4YJUA 1OVEA 5JGAA 3DAEA 1UV5A 3I4BA 4TYHA 4YNOA 2WAJA 3FI4A 4MXXA 3ORMA 4IIRA 1H28A 2W1GA 2WTJA 3WBLA 4DFYA 2OU7A 4HZRA 3PA4A 4X3FC 5DI1A 4AW5A 4BGGA 3UZTA 5AV0A 4EOQA 3I6UA 3N9XA 4D1ZA 3NR9A 4FIGA 2X8IA 3TV6A 4WSQA 5CEIA 3ZLXA 4JIKA 4ASZA 2R3LA 4O1PA 2XK8A 3LVPA 5FP6A 1ZAOA 4I5PA 4L3LA 4QNYA 4X3FB 3MVHA 2ONLA 3CC6A 4G5PA 3G6HA 3HRFA 3CPBA 3MFTA 3R1QA 4FT0A 2GTNA 2QOFA 2R3MA 3FMLA 5FUTA 4I23A 3AC5A 4WNPA 4YO6A 2C6MA 4EHEA 4MCVA 2OIBA 4ZOGA 2P2HA 4JX7A 4QMUA 4B4LA 4DH3A 2ITVA 3U4WA 5L8JA 3HV3A 4IDVA 2GMXA 4FK3A 3S2PA 4BDKA 5LVOA 2C6EA 4RIXB 3UQFA 4D5HA 5BVFA 2YABA 3FV8A 3RAKA 2V5QA 2NPQA 1A06A 3MY0A 4GK2A 3UJGA 4EC9A 2R3KA 5L4QA 2W5BA 3KXGA 4FT9A 4IM3A 3NNVA 4GG5A 4QMSA 4HVHA 3K3JA 3ENMA 4Q2AA 4TYIA 5F20A 1E1VA 1ZMWA 2Z7RA 2YJSA 2WTWA 3ANQA 4EK5A 5HLNA 2XM9A 5M4FA 2E9UA 2WQMA 5E8TA 4JI9A 1XH6A 2HIWA 4M66A 3GCQA 3UC3A 4DFZE 3VBTA 1Q97A 4X6RA 5J5SA 4G9RA 2I0HA 3IECA 5JZNA 2OZOA 3HMNA 3PG3A 2WMQA 2B52A 1X8BA 4GFOA 4IAFA 3MVJA 3FLNC 1YVJA 3O51A 3QHRA 3R63A 5CSPA 3S0OA 2G15A 5G6VA 4F9YA 3NMUF 3PTGA 4YJOA 3WZKA 5A6OA 3UG1A 4YZDA 4FSRA 2J0KA 1W7HA 4JR7A 4NU1A 4FTIA 4KWPA 3EQDA 3OBGA 3IW5A 3H4JA 3U55A 2UZVA 3VBYA 4BIBA 3NX8A 4ID7A 5AAGA 5JGDA 3IGGA 3JUHA 3COIA 3F3WA 3VIDA 2J9MA 4FKTA 4CG8A 3E3PA 5GJDA 4BL1A 4IFGA 1URCA 1WVXA 4BDCA 3V04A 2HAKA 4XV1A 5CI6A 2FYSA 4YP8A 2UW8A 4ZJVA 3G15A 5IQHA 3P5KA 4FIHA 4OT5A 4ZTHA 4HNFA 4QO9A 3HRBA 3PG1A 4BGQA 4DC2A 3G9LX 4K11A 2ZVAA 4NCTA 4DH8A 4JJRA 5E8VA 3UZRA 4LGHA 3C7QA 2YFXA 1OPKA 2VAGA 4H3PA 5ANGA 3V6SA 3G0EA 2VO0A 4ZZOA 4IB3A 2V0DA 1SVHA 3ORIA 4LQMA 4I6QA 3AT4A 5DIAA 4O0RA 5HO6A 5EKNA 1OKZA 4OT6A 3C4FA 5IQGA 2YISA 5CU0A 3Q5ZA 4BCMA 1Z9XA 2HCKA 3O71A 2OBJA 3MH3A 2O63A 2PVMA 4GIHA 4ARKA 4JQ7A 2PMLX 3DXQA 3SG9A 4JAIA 4FR4A 4IZ5A 3LCOA 3TXOA 1H4LA 1EH4A 4GKIA 2QKRA 3A60A 5DEYA 2W1IA 1ZOHA 3KA0A 1XWSA 4CNHA 3QTIA 2DQ7X 4G3FA 4NM5A 4U9AA 5BMMA 4EH4A 3TM0A 4S34A 4XV2A 4QYHA 3MI9A 3I7BA 2YM3A 4CZYB 3L9LA 3BE9A 3DDQA 2YZLA 4CMTA 2FVDA 3E63A 3PY3A 3LXPA 3F3ZA 4RQKA 2C3JA 3NUNA 4AOJA 1J7IA 3D14A 4V01A 3Q4CA 2WMSA 3LQ5A 4X2KA 2REIA 3KVWA 2YIWA 3AC1A 3UMWA 4E7WA 1BX6A 3PJCA 2G1TA 5EW9A 3W18A 3E8CA 2RFNA 3NWWA 2UW7A 4CT2A 1VR2A 3HAMA 4FSWA 1XJDA 3RZFA 3P1AA 1H27A 3QL8A 3KCKA 2BFXA 3RWPA 3ZUUA 2XEZA 4AZSA 3PIXA 5CASA 1QPEA 4FKOA 1FOTA 4DHFA 4HVSA 4CCBA 2FB8A 2A4LA 1OL6A 3NIEA 4FV5A 4D2PA 5IA1A 4BDDA 4XJ0A 3ZC5A 2W96B 3G51A 3MDYA 5IDPA 2CGVA 4R3CA 3RPYA 4GFMA 3GU8A 5TOZA 3PP0A 5HO7A 5FM3A 1NT2A 3N4TA 3BYMA 5EDQA 2VWBA 3EN4A 5DOSA 3O23A 1PYEA 3KVXA 4DCAA 4IB0A 3SKCA 5HVYA 4CZUA 1OITA 3DDPA 3D5VA 2PZPA 3FC1X 3MIAA 4WG3A 1KE5A 3VBXA 5GINE 2W7XA 3O8TA 2ZV9A 5J8IA 2C5VA 3UOHA 4EH9A 1U5QA 2G2HA 2ITUA 1OL5A 3FKNA 4JS8A 5D41A 3GU4A 4UWBA 1R1WA 4QMVA 4PMTA 2ZB0A 4ZJJA 2GQSA 3DJ7A 3Q2JA 4QMTA 3DNDA 5AV2A 1NVQA 2QHMA 4XG6A 4DLIA 3K5VA 4XUFA 3ZO3A 3ROYA 2ERZE 3EKNA 3I6WA 4UY9A 1DS5A 4OTFA 4BCIA 3BYVA 2VWXA 3LE6A 2BPMA 2ETMA 4JBPA 1YWVA 3R1NA 3L8SA 2WOUA 2G2FA 3HMPA 5FXQA 4E6AA 4MAOA 4O2PA 3PLSA 4ERWA 2VTRA 4FKUA 4YLJA 1W83A 1KE9A 2JKKA 4IX5A 2X9FA 4FV1A 5EYDA 4JLCA 3SQQA 5M08A 4TNBA 3S4QA 2VTAA 4L3JA 1H01A 2YLFA 1R39A 2QG5A 5T3QA 2JDRA 2QODA 3EH9A 3ORPA 3Q9ZA 2CCHA 4NEUA 3UNJA 4EI4A 4CFVA 3QXOA 4FEQA 4PPAA 4XBUA 4K8AA 1GZNA 4RJ8A 2BZIB 4RWKA 5CNOA 5JSMA 3MA3A 3IDPA 3F3TA 5ANJA 4DG0E 3R6XA 2PMIA 4LFIA 3F6XA 4MX9A 4FG7A 3FHRA 3IW4A 3NAXA 3DBCA 2YM8A 2FUMA 3PZHA 2JDVA 5F4NA 2QC6A 4M69A 2QR8A 2R3QA 4ZAUA 4FZ6A 5HTBA 3FMKA 5IQEA 2PE2A 4ZLZA 3P23A 4DG2E 1JKSA 4EKLA 3Q32A 4WG4A 4X7QA 3TJCA 5M4UA 3EQPA 3FMJA 3NEWA 4WHZA 5CXZA 1Q3WA 5JK3A 1L3RE 4GK4A 4LRKA 4D0XA 4DCEA 3HUCA 4KKGA 4S30A 4IM2A 4XLVA 5HEZA 3BV3A 2PE1A 4HCTA 5CLPA 5DT0A 1ZLTA 5GZ9A 4BDFA 3LXKA 2CGWA 3NUYA 4LYNA 4AG8A 2J5FA 3NUSA 3S95A 3AGLA 4BTMA 1JSTA 2YDJA 5M55A 4F1TA 5IQDA 3MVLA 2WOTA 3EHAA 1ZOGA 2I7QA 4C2WA 3A7HA 3P0MA 4EBWA 2PVNA 3CR0A 3VNTA 5BVWA 5E8UA 4AFEA 5HTIA 4MD8E 3SXSA 3GU5A 4KSPA 4CT1A 4DEBA 5IDNA 3OBJA 1PF8A 4RIYA 3W2OA 2E2BA 2ZAZA 5FLFA 2DYLA 3G90X 3DA6A 3QTQA 4GT3A 1Y91A 2UUEA 2ETKA 3FL5A 2ITOA 3C4EA 3PY0A 5I9WA 5IA5A 1OUYA 3PJ3A 2GS2A 3R01A 4RC2A 3FLYA 4RZWA 2F57A 4YJQA 5LCKA 3UVPA 2XJ2A 3HV5A 5ANEA 4QPMA 1BI7A 1P4FA 2R3PA 3FLWA 2EB3A 4K9YA 2GNIA 1HOWA 4L67A 4QMZA 3UPZA 2B9FA 2DUVA 1NW1A 2CKOA 2R3IA 5CS6A 3MBLA 4K33A 3LFAA 4O96A 4R8QA 3R8ZA 4C33A 4WT6A 2BRHA 5C8NA 5HLWA 1A9UA 3TZ9A 3E93A 1FVVA 2C0IA 4FT7A 4U6RA 1V0PA 5CSXA 2YIXA 4EUTA 2YWPA 3C9WA 4P5ZA 3FZRA 4ITIA 4O7TA 4MF1A 2WQNA 2XEYA 2QD9A 4BDHA 3MY5A 2OICA 3ACJA 2XK6A 3QKMA 5GJFA 4O7RA 4CMUA 3BU5A 4GH2A 4DEEA 3D7TA 1VZOA 2X9EA 3AD4A 1IG1A 3GQIA 3NS9A 3Q6WA 4IZYA 4UWYA 5CF5A 5IPJA 2YEXA 4I5CA 4NSTA 3R7UA 3LPBA 3AXWA 2B4SB 1YXUA 2NO3A 2OF2A 2OJFE 4HPUE 4IJ9A 3T8OA 4E5WA 3RNYA 4CRLA 2GNGA 3PSDA 5CQWA 3BQCA 2C6OA 4ANQA 1ZMVA 2YERA 1WBWA 3ZEWA 5FP5A 1CTPE 2I0YA 3QD3A 4TTHB 3D94A 3V5WA 5GIOE 3QCQA 4J71A 2XS0A 3ALOA 3TV4A 4RIOA 3MW1A 1HCKA 1AGWA 1WBOA 3MA6A 3ZLSA 1GAGA 2UZDA 4EWHA 2R0IA 1FMOE 2Y4PA 3V51A 3QTXA 2PULA 2C6LA 5H8GA 1WAKA 3QRUA 4DF3A 1XO2B 2BMCA 3E87A 3IQ7A 2ZV7A 4O0TA 4QP4A 4WRSA 5IISA 5J1WA 4IBMA 4GKHA 2R5TA 3SXRA 1JNKA 2OIQA 3NCGA 3R1SA 4Y83A 5AUYA 4R3PA 5H9BA 2DS1A 2X4FA 5FD2A 4S31A 4WRGA 4C59A 2AC3A 3T9IA 2RF9A 5T68A 2WXVA 2JD5A 4XOYA 1OL2A 4NKAA 2CJMA 1UNLA 4XYFA 3VHEA 1BUHA 1Q41A 3TUCA 2QQ7A 4IHPA 2QOKA 1AQ1A 5DWRA 1J91A 1YXXA 3REPA 4HZSA 1Y6BA 2CNQA 4YMJA 2QHNA 2A27A 4GUEA 3R2BA 1UA2A 2X6DA 3C5UA 2EXMA 5CF8A 4A9TA 3ZM9A 2Y9QA 4RJ5A 2FA2A 3QKKA 3WYXA 4QTBA 1G8AA 4DH7A 4I93A 3LMGA 2HW6A 1F0QA 4FSMA 1PKGA 4U40A 1Z5MA 5DEWA 2XBAA 4YZCA 3ROCA 3BRBA 1BLXA 4G3GA 5CVGA 3UZPA 3TG1A 3ZMMA 2XK3A 1DM2A 2WIPA 3ZOSA 1XBAA 1WMKA 1XHAA 2WEIA 3W10A 5KMIA 3Q5IA 1WZYA 3LFFA 4NJ3A 2A2AA 4O22A 2JDSA 3RK7A 2JDOA 2O0UA 3P7BA 2QU6A 3ZFMA 1J7UA 5CY3A 4LRJA 3V5JA 1LR4A 4H58A 2W17A 3SRVA 4FV4A 4LMUA 3KF7A 5CT0A 1Q3DA 5E8ZA 5BVKA 4EKKA 3CTHA 1UKIA 4UMPA 2X7FA 4N0SA 3SW4A 4LGDA 4GU6A 3QX4A 2Y6MA 2CLQA 3LFNA 4TN6A 4GIIA 5DA3A 4IEBA 4UXLA 4EJNA 3QRJA 4O0SA 4CZTA 2WMTA 4OBQA 3W32A 3CQUA 3EKKA 3G5DA 3GGFA 3WI6A 5JFWA 2XM8A 3ORKA 3C0HA 1SVEA 3DS6A 3FUPA 2BHEA 4V0GA 1YOLA 3UOLA 1PYXA 5ICPA 4FV2A 3BYSA 3QUEA 3LLTA 3RHKA 1FMKA 1PJKA 2XNNA 4RT7A 2C6IA 5AUZA 4D2VA 1OBGA 2PMNX 5IA2A 2RIOA 5AP5A 3TTIA 2FSLX 5JFSA 4F63A 3MJ1A 4FL1A 1PXOA 4GS6A 4FVRA 3JYAA 4ZSAA 4QQCA 4UXQA 3I7CA 4YZNA 4BN1A 4XV9A 3MY1A 2E9PA 4GCJA 3FZSA 4MK0A 2YDIA 2VTQA 4N70A 3G9NA 4I94A 2QO2A 1AD5A 5CZIA 2EUFB 5HHWA 5AAEA 4O7YA 3LXNA 4ASEA 2OJ9A 4ANNA 2BRMA 5CNNA 4CV8A 3R02A 1JPAA 2F49A 4NWMA 4ASXA 4BCHA 4APCA 5LMBA 1PMVA 3KEXA 2R3FA 4MVFA 2PZ5A 3PPKA 3UO4A 1OIRA 2J6MA 2H34A 1JKKA 2QLUA 3FXXA 1GJOA 4RFZA 2XCHA 3Q6UA 3ID6C 4PY1A 5AMNA 4HGEA 4Y73A 2WTKC 4IANA 1G5SA 4FBXA 3CPCA 5AP6A 3BGQA 3MPTA 4K18A 3UNKA 3EZRA 2OGVA 3OCSA 3P08A 5M06A 4YJVA 5LMKA 3GC0A 3U6JA 3DKCA 3QRTA 3I5ZA 4NTSA 3WE4A 2R3RA 4R78A 3VAPA 4XG4A 2WTKB 1QL6A 4C37A 4FV6A 4O6LA 3FLZA 4HGSA 3PFQA 1WBVA 2XNMA 3JS2A 3MB7A 4LOOA 5K4JA 3FMHA 3PY1A 2C5YA 2VWIA 2XA4A 4YSMA 5KMJA 2W5HA 5AUWA 4CFWA 2R2PA 2RFEA 5IKWA 4C61A 2HK5A 2YAKA 4RJ3A 2F9GA 2IWIA 3ZU7A 1ZYCA 2QOBA 4K1BA 4NM7A 2XJ1A 4M0ZA 2CHLA 3LFBA 1SVGA 4L53A 4OTQA 1KE8A 2FSMX 3WARA 1Y8YA 5EYMA 1H08A 1Z57A 3F3UA 3WF7A 4D9TA 5E8XA 4GSBA 4BYJA 5A4LA 4ZTSA 4CTCA 1OBDA 3PSCA 5EI6A 4TYHB 3ZONA 5EM8A 4BC6A 2OXDA 3V3VA 5LARA 4EZ7A 4FOCA 4NK9A 2WMRA 3IOPA 4EZ5A 2SRCA 4C38A 4HNIA 4NIFA 2EVAA 3VBWA 2GFCA 3QX2A 5CZHA 3FQEA 1T45A 4QRCA 2ONLC 3OCTA 4QTAA 3UPXA 3V5LA 4C4JA 1JSUA 1YWNA 3C5IA 3D5UA 2EB2A 4X21A 4FTJA 2NNWB 3ERKA 3S3IA 3H3CA 5J5TA 3U9NA 4MXOA 5CALA 4H39A 3W2RA 5EYCA 3VS4A 3SOCA 5JEBA 3FL4A 3POOA 4EEVA 2VTHA 1HCLA 5J9LA 2J5EA 1FVTA 3W16A 3NVMB 4BKJA 3R9RA 2ITTA 3ZRMA 3RGFA 4HYIA 4CG9A 2FH9A 3RPSA 4EYJA 2B0QA 3QTUA 3B2WA 4O0WA 5M57A 1H26A 4KS8A 1FVRA 3GT8A 3ZSHA 2QO7A 5AP1A 3VBQA 2WU6A 1F3MC 2RFDA 2C3IB 5IZFA 4ZJIA 4AOIA 1J1CA 4PPBA 3LCTA 4PL5A 3C1XA 1OIQA 2BCJA 2YM5A 3FKLA 3OMVA 4BCFA 4ZY5A 3SXFA 3PP1A 4AZWA 2WFYA 5B0XA 4G31A 1LEZA 3WZEA 2X39A 1FQ1B 2P3GX 3KCFA 1U54B 3QD0A 3GOKA 1OMWA 4UX9A 1OI9A 5M09A 5EK7A 4XLIA 4BZNA 5AA9A 5L8LA 3RI1A 4GK3A 2WEVA 5EDPA 3SC1A 3AC4A 4L7SA 3I5NA 4UMQA 4FEWA 2XZSA 2YM4A 2JFLA 4EOLA 5BVDA 1V0BA 2W1CA 4ZMEA 5BPYA 5HCXA 2DWBA 4CKIA 4JQEA 2HZ0A 2J51A 3CLYA 4IX3A 2HYYA 5JZJA 1KV1A 3KXMA 5JFVA 1ZZ2A 4WO5A 4YUQA 3Q9XA 2CGUA 3OUKA 3KF4A 3G6GA 4RIWA 5L2IA 1O6YA 3Q52A 4FV9A 4WOVA 4G9CA 4V04A 3O7LD 5AR3A 4MXCA 3RZBA 5HU3A 3NW7A 5DRDA 4CKRA 4BDEA 3DKOA 1PHKA 3QHWA 4KB8A 4S2ZA 2VWUA 4FOBA 4DGGA 4O1OA 2C3LA 3IK3A 5L2QA 3R7YA 2HZNA 5AWMA 2V22A 3F82A 2BKKA 4RX9A 2W9FB 5BUIA 2ITWA 1WCCA 3TNPC 3M1SA 1Q61A 2JIVA 2UZTA 4A9RA 4AZFA 3KY2A 1DAWA 2HY81 3PRFA 3D5WA 4YHJA 4R5SA 2PY3A 2WGJA 1XH9A 5EQYA 3SD0A 4BCJA 3AOXA 4AP7A 3BEAA 5CWZA 3G0FA 3R7OA 2JBOA 4E4XA 2YWVA 5AA8A 3BEGA 2OFVA 4HOKA 2Q0NA 1H24A 3OW3A 4E5BA 2PUPA 2WHBA 2XIXA 4PTGA 4YTIA 4XX9A 5IH6A 5LWMA 1UNGA 3PJ2A 4DFXE 1U4DA 3C13A 4JBOA 3RK5A 3QA0A 4FI1A 3ZZEA 4BCGA 3BHVA 4LRMA 5E8WA 3RM6A 3UODA 2HW7A 3CD8A 3F2AA 4PUZA 4W8EA 3AT3A 4A9SA 3R71A 5C8MA 1VYZA 5E1SA 3RAWA 1SNXA 4EYMA 5IA4A 2VTSA 3ZO1A 3GFWA 4HPTE 2H9VA 3BGZA 5K9IA 3P78A 4DGLC 3S1HA 3GNIB 2EXEA 4L8MA 3UNZA 1VJYA 1Q8UA 1P5EA 2WELA 3Q4UA 5DR6A 3LKMA 2GQGA 4J8MA 4TW9A 3O50A 2ZYBA 5AV1A 3QQHA 4U5JA 4YC8A 4C58A 1B39A 1B38A 2X2LA 3QF9A 4AGWA 4EH8A 2IW9A 3BELA 3DBEA 3FHIA 4OAUC 4GEOA 4NL0A 4C36A 4KRDA 3PXRA 4BCNA 2VWZA 3FZTA 3QLGA 4C4EA 2P2IA 4YTCA 3DJ5A 2ZOQA 4WUNA 3F5UA 4OTIA 4Y5HA 2I0EA 1TVOA 3NZ0A 4OTPA 5IQBA 1O6KA 4C02A 3GXLA 4W4YA 1UNHA 5AP2A 3CS9A 3NAYA 3KXHA 3E3BX 3QKLA 4X6QC 4EK8A 5JMSA 1KWPA 3QAME 4P4CA 3TZ8A 4EH7A 4EOKA 5L8KA 2OI4X 3R8MA 4DGMA 1G3NA 4MXAA 4WA9A 5HG8A 1XH4A 5CU3A 4BTKA 4IDTA 5BYLA 2RFSA 3D83A 4F9WA 3ZBXA 3KMUA 3QC9A 4QYGA 3A2CA 4EOPA 1OGUA 5FG8A 2R3OA 4UZHA 3TUBA 5IQAA 3LQ3A 3OCBA 4QP3A 1M2PA 3TEIA 2VTJA 2Z2WA 3BIZA 4GYGA 3VQUA 5AM6A 2WNTA 3IS5A 5AAFA 5HD7A 3PDTA 3HP5A 1OECA 4GV1A 4JDHA 4N4SA 1H1RA 3AD5A 2OZAA 4O2ZA 3SOAA 5A4CA 4F7LA 4X0MA 4IQ6A 4CFXA 5FBNC 4Q9SA 3SHEA 2ZM3A 3FDNA 4PWNA 3E88A 3VUKA 4MTAA 5DVRA 1UWHA 3AMYA 3RCJA 4R6VA 3VUMA 4PMPA 3NIZA 5JH6A 3IO7A 2BAJA 3R9NA 2RKUA 4CLIA 5AP4A 2PZYA 4EONA 2XH5A 4F99A 5EI8A 5FTQA 3RMFA 5J1VA 3W33A 3BBWA 3HECA 5DGZA 4AZTA 1T46A 3VQHA 4E5AX 3VS2A 3ET7A 3DZOA 1MUOA 5DT4A 4R7BA 4F08A 5I9ZA 1MP8A 4FV7A 4IX6A 4YJSA 4I92A 4E73A 2EWAA 2R7BA 3WF9A 1SYKA 2VWVA 3HKOA 4FSYA 4IVBA 2BZHB 2XNGA 4ZSLA 3WILA 4Z3VA 2WMVA 3LZBA 4YHFA 4E93A 4IAIA 1PMEA 2OG8A 2O2UA 3RKBA 4BI2A 2W1DA 4TKSA 2NP8A 4FV3A 4YBKA 3CBLA 1W8CA 2ETRA 3FPQA 1H25A 2E9OA 4QTEA 4LUEA 4DT9A 5H8EA 5M07A 2R7IA 4F6SA 2QONA 3KULB 3OXIA 5DFPA 3LFQA 5I3RA 4EK4A 1H8FA 2VWWA 4ZSGA 4Y95A 5DNRA 1ZYSA 2C6DA 3CP9A 4QYYA 1TQMA 2VU3A 3N4VA 3CE3A 5I3OA 3ATSA 4RFMA 4EOSA 1UU8A 5I9XA 4BDBA 2C5NA 2GSFA 4D4RA 1UU3A 4PRJA 3VBVA 3DNEA 3EQIA 5BUEA 4FTRA 1CKPA 2O64A 3OEZA 4RMZA 5H2UA 4ENYA 3GCUA 4HVDA 2WIHA 3A7JA 1OUKA 3IOKA 5DT3A 4DGOA 2Q0BA 3R2YA 3NVKI 3HP2A 4O7NA 4R77A 3UG2A 4MHAA 4KABA 2YCRA 2O3PA 3EMGA 4U79A 4X3FA 4C62A 4F1MA 2PUUA 2O65A 3TL8A 3VHKA 2YIYA 3KC3A 3AMAA 4AUAA 1G8SA 3BHYA 4LV5A 2PPQA 2UW0A 3BCEA 4Y72A 3DJ6A 4UN0C 2GHMA 3QUPA 4RVTA 1YDTE 3FLSA 5HNIX 4BCQA 5BMSA 3UYSA 1LEWA 3W2PA 4G1WA 4RIXA 3K5UA 2VTMA 4MNEB 4PTEA 4LL0A 3L8VA 4FVQA 3MFUA 5FEEA 3OG7A 4LOPA 4MD9E 3WZUA 2GNHA 3DFAA 4FSZA 3CEKA 3MB6A 5IQFA 5HE2A 4H3QA 4A4XA 4DYMA 5BUJA 3KN5A 2CNUA 5JFXA 3DK6A 4DH5A 2YA9A 3K54A 4IC8A 3F66A 2Z7LA 4ACDA 4O7SA 4KIKB 1GZKA 2JLDA 3W2SA 5LVMA 5AR2A 5IU2A 1ZY5A 3DU8A 3MFSA 2JKQA 3Q96A 2I0VA 3QD4A 4RVLA 5JQ5A 2W06A 3DKFA 5KX8A 3BBTB 4QD6A 4W4XA 3EQRA 3UIMA 4BZOA 4OTWA 3AD6A 4F9CA 2B54A 4HW7A 5DG5A 5HI2A 3QQJA 3JPVA 4FC0A 3RPOA 4DEAA 4DEGA 2VX1A 2VD5A 3TTJA 3TIZA 2UZUE 3HVCA 5E7RA 5BNJA 3PXFA 2VV9A 2GDOA 3TI1A 2QOOA 3VN9A 4BHZA 3ORTA 3T3VA 4Y5QA 4UMUA 2PK9A 1VEBA 2VO6A 2XKEA 4I6FA 4C4GA 5FXRA 1YI4A 4E26A 2QU5A 4MD7E 3HMIA 4MNFA 4PPCA 4D1SA 3HAVA 4KBAA 4DFUA 2YJRA 1RE8A 4IVAA 4F9BA 4TWOA 4FKGA 4N6ZA 3NDMA 4O21A 2JIUA 3UVRA 5E90A 2CN5A 5CQUA 3H30A 4FEXA 1ATPE 4TRLA 4JVGA 3MPMA 4DA5A 2XYUA 3R8VA 2ZJWA 5I5ZA 4F1OA 4AZVA 4CTBA 2A19B 3TZ7A 3HMOA 3CSVA 4AGDA 2QI8A 4YU2A 3KK9A 2PWLA 4D55A 3JVRA 3F3VA 3BKBA 3MPAA 5IMXA 3ZFYA 1OL1A 3HV6A 5F1ZA 4JQ8A 4ZY4A 4FK6A 4KIOA 4E3CA 2PSQA 1JVPP 1QPDA 3DFCB 4W9XA 3W8LA 1H1PA 4KKEA 3MYGA 3A4PA 2XNPA 2WPAA 3VS6A 4MWIA 2UW6A 3EQCA 4H05A 4O7VA 4PQNA 5HORA 5KKRC 4PDYA 2PVLA 3W8QA 3OW4A 4DFLA 5AM7A 4EH3A 1CKIA 3GB2A 1H1WA 4JRNA 4C35A 2OLCA 2GPHA 2BIKB 3L9PA 5KZ0A 4FGRA 1PXPA 2ZMDA 4D4SA 3R21A 2JDTA 4RC4A 1JWHA 4E6QA 4UEUA 5HBJA 4NTTA 3TWJA 2JKOA 3II5A 1ZY4A 3LFCA 5KKRB 4EH2A 5HVKA 3ZDIA 3PE2A 4EQMA 2BVAA 4DT8A 4F0IA 1GOLA 4DFBA 3NW5A 3FZ1A 3PIYA 2IVSA 2BAQA 4JXFA 3E64A 3C0GA 3HDNA 2WMBA 3BHHA 3GC9A 3HV4A 4WNMA 4QMLA 2LAVA 3FSFA 4WUAA 3VRZA 3ZSIA 5M53A 3HRCA 4FSTA 2J4ZA 2C47A 3PA3A 4LM5A 5L6WL 3FJQE 4IWDA 4CLJA 4L44A 3BLRA 1YHSA 4Q9ZA 3PZEA 2X2MA 4EOIA 5KUPA 3FAAA 3UBDA 5I9UA 4TY1A 5IH4A 4O27B 4EC8A 4I22A 3FQSA 4B9DA 3UQGA 2W4OA 4I0TA 5CEOA 4RJ7A 3MN3A 4CYIA 3O96A 3VUIA 4KIQA 4ZEGA 4EH5A 3R9DA 4RX7A 4GRBA 4H36A 3HLLA 3VUHA 5CEPA 2YIRA 4FKVA 3EFLA 1M52A 5AP0A 1J7LA 5G1XA 2C0OA 4K77A 4DTAA 3UP2A 3GEQA 4DE4A 5LMAA 3P7CA 2BIYA 3OC1A 5IEXA 3CY2A 3QA8A 3A8XA 2W9ZB 3U6IA 3TACA 3K3IA 5M51A 1YOMA 5KE0A 5KBRA 4M8TA 2UZLA 4D28A 4FYNA 3SLSA 3I79A 3OY1A 4E8AA 4F7SA 2GCDA 5LQFA 1FPUA 4ZY6A 4BIEA 4ZTMA 5JQ8A 4YPSA 2QO9A 4PTCA 4KBKA 2JFMA 2VNYA 3V8TA 3ZO2A 4AGCA 3F9NA 1MRVA 5LVPA 4J96A 2P4IA 5CSVA 3WYYA 2YCQA 2X2KA 4AOTA 4F64A 4O86A 4X2JA 1XH5A 2LGCA 4MH7A 4RLLA 5FQDC 1CMKE 4YC3A 5AEPA 1GY3A 3C4CA 4GG7A 3RALA 2PVKA 4I3ZA 3UQCA 5HKMA 4DTBA 2ZM1A 1PY5A 1Q4LA 1R0EA 3MFRA 2OO8X 3D9VA 3O0GA 4XRJA 4PMSA 4QMYA 3VWAA 3O7LB 3LFDA 4AXAA 1V1KA 5AP7A 5CF6A 3SX9A 2BROA 4J53A 3A7IA 3BGPA 4IJPA 3OT8A 5FWKK 4TPTA 2QURA 4XNEA 3VRYA 2VX3A 4BWKA 2ZV8A 3EN9A 2XJ0A 3VC4A 1OPLA 3QTZA 2XB7A 3IW8A 4GJ2A 4QYEA 5F94A 1L8TA 3NUPA 4D2SA 3FI2A 3QYWA 2CKQA 2HZIA 2QOCA 4YC6A 3DTCA 3Q9WA 5LCJA 5LVNA 2IPXA 4AA5A 1GIIA 2BUJA 4MF0A 2UVZA 5B2KA 4NW5A 4O0UA 2BDFA 2Y4IC 4U43A 4NYEA 5KMKA 4TWPA 5FDPA 3GU6A 1UVRA 5TF9A 2QOLA 5BQ0A 5HU9A 2PMOX 2PVFA 4XS2A 3DB6A 1JKTA 1NY3A 4I21A 4XH6A 2QNJA 3AT2A 1KUTA 1FGKA 1YOJA 2UW3A 4ZXTA 4CKJA 2C6KA 3VS0A 3SAYA 1GIHA 4RA5A 1GIJA 1MRYA 2VTIA 3E92A 3F69A 2GNJA 3OOGA 4L7FA 4MWHA 5J7BA 5DN3A 1M7NA 4ITHA 4HGLA 3FSKA 4WKQA 5EI2A 4IB5A 2Z7SA 3RVGA 4QP2A 5L2SA 2BILB 3GVUA 5ACKA 5B2LA 3FWQA 4FEUA 4C4FA 1WFCA 2IW6A 3QCXA 4RBLA 2UW5A 3HX4A 4HVGA 4TZRA 3JVSA 4ALUA 4RWJA 5ACBC 5CYIA 5IUIA 4F7NA 4ANBA 3UO6A 4U81A 4IC7A 1OM1A 4UZDA 2I1MA 2UZNA 5AIKA 4FTMA 4XP0A 5C27A 4UMRA 5A6NA 5DR2A 5J7HA 5KMLA 4M68A 4AW0A 5KNJA 4GU9A 4DEIA 2OH0E 4USEA 1JAMA 3R00A 1IAHA 5JRSA 5K5NA 4GYIA 4L00A 2W1FA 4J7BA 3WF5A 3OFMA 1R0PA 5KHXA 4IADA 1KOBA 4JOAA 4BBMA 5K0XA 2W4KA 5IEYA 4CQEA 2ZDUA 3DB8A 3ZUVA 2WU7A 5KZIA 4G5JA 4W4VA 3EQFA 4IWOA 4PMMA 5HQ0A 3ITZA 5CVHA 3GCSA 3RPRA 4ZK5A 1Q24A 3VF8A 5DLSA 4ACMA 2EXCX 5EOBA 4TNDA 3B8RA 3TT0A 1PKDA 4BCPA 5B7VA 5LWNA 4BDGA 2HENA 5ETAA 5L6OA 5DMZA 3I0OA 1U59A 3KRJA 5M56A 3ORZA 3OT3A 4B8MA 1O6LA 1U46A 2C3KA 4D0WA 4E6CA 5L2TA 2ITPA 2ITQA 2OWBA 5T6KA 3E8DA 4FZDB 1H0WA 3BV2A 4LG4A 5C26A 1J3HA 1Y8GA 3VF9A 4YO4A 4CD0A 4YJRA 4FMQA 2BFYA 2VGPA 3LHJA 2P0CA 4EHZA 3VW8A 3R7IA 4OTDA 2V55A 4X2NA 4ZZMA 3HZTA 5FXSA 1A48A 3RPVA 1OKVA 2OF4A 4ORKA 4MXZA 3Q60A 5FTOA 1ERKA 4CEGA 4QNAA 2UV2A 3LJ0A 3KGAA 2Y7JA 4FSNA 4OGRA 2FGIA 3MGYA 3R1YA 5EHOA 4G17A 2C5XA 3KRLA 4AZEA 3JR1A 1Q5KA 3D2KA 3QGYA 3QZFA 4U7ZA 2A0CX 4UWCA 1W98A 4A4LA 4C4HA 3QRKA 3EYGA 1ZYLA 4E4MA 3MJ2A 4BGHA 2XP2A 3NYOA 3FMEA 3BU6A 4W9WA 5E1EA 2C1BA 4YJPA 3NPCA 4ZSJA 4ZSEA 3TZMA 3LJ1A 4BICA 5FGKA 4YZMA 4EOMA 4JL9A 3KB7A 1KOAA 1P14A 4TYJA 5E91A 3TJDA 4YJNA 2Z7QA 4QP1A 4R1YA 2P55A 3VS5A 2F7XE 2YCSA 4L42A 2AYPA 3QUDA 1XH8A 2JEDA 3PXZA 3QZGA 3AGMA 4J97A 1APME 2FSTX 3ODYX 4TXCA 2R9SA 5ANOA 5C9CA 4BCOA 4PP9A 5GNKA 4I41A 5CANA 4B6LA 1R3CA 4FT3A 3I1AA 3PJ8A 3QYZA 2VN9A 3R0TA 4C3PA 4AN2A 2XKCA 2F4JA 4H1MA 4CMOA 4D5KA 5IA3A 2WQEA 2A1AB 2X6EA 2W0JA 4ZMFA 2CMWA 4O81A 4AWIA 3CTQA 2YITA 1M17A 4ALVA 3L9MA 3TKUA 1OIYA 5J95A 3KRXA 2X1NA 5L6PA 3C4ZA 3V8WA 3DK3A 4DINA 4FIFA 5D9HA 1JLUE 2JAMA 3L1SA 5E4HA 4AF3A 3MWUA 4PNKA 1YI6A 5DBXA 5K5XA 3ZH8A 1Q8WA 2WMAA 3FC2A 3Q9YA 3SV0A 4RFYA 5DHJA 3HMMA 2C5OA 3N4UA 3UE4A 4AW1A 3C0IA 3GOPA 3QQFA 3ZM4A 3KU2A 3PSBA 3HNGA 4XMOA 3RK9A 4WIHA 4E1ZA 5IMEA 3MH1A 2J0LA 3MS9A 4OTRA 4FODA 4BKZA 4CV9A 3KRWA 4ASDA 2YCFA 4FTCA 4RC3A 4RPVA 5DRBA 2J7TA 4I20A 4B0GA 3AMBA 2IO6A 1P2AA 2WMXA 3TNIA 3PLAE 1F5QA 4FG8A 4GL9A 4ERKA 1OL7A 1RQQA 1U5RA 3MH0A 3OXTA 3TKIA 4G2FA 3FLQA 4QQTA 3O2MA 3EN7A 4L9IA 2PYWA 2J0IA 5E8SA 1W82A 2O5KA 3L9NA 3LCKA 3H9OA 3VJOA 5HTCA 1PXLA 4PV0A 3ZO4A 2I40A 3PA5A 3MH2A 5M4CA 1PRYA 4K2RA 5A4QA 4U45A 4J8NA 3WZDA 3GU7A 4PP7A 2PZRA 4L6QA 5FTGA 5EYKA 5E9EA 4P2KA 3UYTA 3GENA 2W1ZA 2XVDA 4NCTC 3BPRA 2QLQA 4DITA 2B55A 5EM7A 4FIJA 3WOWA 3E8EA 3FZOA 3OS3A 3KXZA 2CDZA 4I0SA 4TWCA 3COKA 4A4OA 2CLXA 4E4LA 3FKOA 3DAJA 4H3BA 4C7TA 1PMUA 5J9YA 1ZXEA 3OHTA 3NUAA 2ESMA 4ACGA 4ANOA 3R73A 5HIEA 5IG1A 1QCFA 2XNBA 4F9AA 2UZBA 1NXKA 3G33A 1UWJA 3MTFA 5EW3A 5J87A 3UIUA 3VO3A 4D4YA 4ITJA 3GP0A 4EK3A 5IUHA 4FYOA 3DQXA 4FNYA 1W84A 1Q8ZA 4EUUA 2CNVA 1REKA 2QR7A 3FY2A 1I44A 3BX5A 4II5A 4F4PA 3OWKA 3L8PA 2IG7A 3Q4TA 5HNBA 4O7WA 4FL2A 3VUDA 1PXIA 5K3YA 3OF0A 4BVUA 2C68A 2GS7A 1IRKA 3PWDA 1E1XA 1IA9A 3H0YA 3OTUA 2JAVA 3HDMA 5E8YA 4RX5A 3RTPA 2V7OA 4F0FA 3LFEA 4EOJA 1YHWA 3M11A 3ANRA 2R3GA 2WMWA 4NJDA 4XRLA 4KIPA 5IQCA 4L3PA 2RG6A 2RL5A 5FDXA 3WIKA 3IW7A 4J95A 4BDAA 2VUWA 4Z16A 3JY9A 1XR1A 4FZFB 3R28A 3A62A 4RQVA 3RM7A 3PPJA 2OK1A 2XIZA 2UZEA 4U0IA 2X7GA 3NYNA 1YDSE 2R64A 2BTRA 2XRUA 5AP3A 1GZOA 4LOQA 4APPA 2Q83A 4M15A 2EU9A 3P86A 4B7TA 4ANLA 4X2GA 5FEDA 3DV3A 5HOAA 4MKCA 3MIYA 4ZLYA 2WMUA 3A7GA 4KAOA 5HBHA 4YR8A 4YSJA 4JX3A 5JN2A 3ACKA 4BKYA 3QQKA 4CRSA 2JGZA 4UYAA 2VGOA 3TKHA 3VJNA 3GC8A 2H96A 4XG2A 5F9EA 5I4NA 4O82A 3AC3A 3MESA 1RDQE 3MTLA 2JKMA 3QCYA 3QC4A 4HYUA 5D7VA 5CSWA 4C4IA 4DH1A 2ZM4A 3BZ3A 4TT7A 5CAOA 2J0JA 2V62A 4MEDA 3R9HA 3D2IA 5IEVA 2XUUA 1SNUA 4ZTNA 3TUDA 3FMDA 3NYXA 5KMOA 3EOCA 4GFGA 4GVJA 4I5MA 3CJGA 2IW8A 3CTJA 4GVAA 3H9FA 3OVVA 4MQ1A 5EQPA 5I9YA 4HVIA 4OBOA 4FV0A 1XQZA 3TNHA 1QPJA 4F0GA 3VW6A 1SZMA 3D0EA 4ZP5A 2X81A 3C4WA 4AU8A 4ENXA 1MRUA 5CEMA 2UVXA 1XKKA 3EQBA 4XP3A 4KS7A 3LJ2A 4PDSA 2W1EA 5DE2A 3UIXA 1Q8YA 5A4EA 4QP7A 3W1FA 3WF8A 2BRNA 4RVMA 4QMQA 2OJIA 2OW3A 3MV5A 4LUDA 4Y85A 5FEQA 4NFNA 2QKWB 2XK7A 2QG7A 3DQWA 3HEGA 2W99B 2VTTA 4BB4A 3SW7A 4XV3A 2C0TA 4EL9A 4EHGA 2OH4A 3OWLA 5AV3A 3U54A 3LM0A 4PDPA 4Z7HA 4WBOA 2WD1A 2F2UA 3PUPA 2CGXA 4Y8DA 2ZV2A 4RJ4A 2JIIA 3HUBA 1IEPA 1U54A 2YDKA 4O6EA 4S33A 4WBBB 4QT1A 1NA7A 3LQ8A 3EL7A 4I6HA 4G16A 5HX6A 2XMYA 3FEGA 1K2PA 4CFUA 3DAKA 3HGKA 4KINA 4U3ZA 2PVHA 5AUUA 3ODZX 4FKWA 3F88A 4FKIA 4U8ZA 1YQJA 4EQUA 1RW8A 2C4GA 3CD3A 5IA0A 2BKZA 2X7OA 4IACA 5EG3A 2J50A 1I09A 4FTQA 2R0UA 3E7OA 5IQIA 1ZYJA 4KKHA 2OIDA 5LVLA 4QMNA 4L43A 2IZTA 4RLKA 4FNXA 3KN6A 4XG9A 3UTOA 4O0YA 4ZLOA 4PL3A 5EKOA 3E7VA 4RZVA 3F5PA 3LFSA 4A9YA 4N6YA 4G6LA 2VO7A 3COMA 1OIUA 2ITZA 4XEYA 4F6WA 2E9VA 4IMYA 2BHHA 3C51A 3NSZA 3RAIA 4MYGA 4LMNA 1SMHA 2B9HA 1TQPA 4XG3A 3ZXZA 3DTWA 4BF2A 1BYGA 4M69B 4P7EA 4CVAA 4ZS4A 3CJFA 3IW6A 4M13A 3TDVA 4DLJA 1M2RA 3GCPA 1M2QA 4BR3A 4HGTA 2F7ZE 4KUJA 3VUGA 3QLFA 4FTLA 3WE8A 4JT3A 4AAAA 2G2IA 4E6DA 1CM8A 2YM7A 4EWQA 1YRPA 3C50A 5JT2A 4IX4A 2KTYA 1JQHA 5ANKA 2BRGA 4BIDA 2Y6OA 3FXWA 3B8QA 3UDBA 3EN6A 4AE9A 5C4KA 2QVSE 4IM0A 4JIAA 4DTKA 3FYJX 4QMMA 4L45A 3U51A 3E5AA 3ORXA 3VS1A 3S00A 4USFA 3OP5A 2PE0A 4G6NA 1Y57A 3DLZA 3G2FA 1Q8TA 4R1VA 3V5QA 4FTOA 3RCDA 3NUUA 3GUBA 4HJOA 1JOWB 3EFWA 3ZFXA 3OD6X 2ZDTA 3DGKA 4Y46A 3COHA 5H8BA 4DAWA 4D1XA 2IZRA 1ND4A 4RIYB 2Y8OA 5CSHA 5EFQA 1YDRE 3F2NA 3RWQA 2HWOA 2WTVA 5HE3A 1KSWA 4AW2A 3MSSA 2R3HA 5TO8A 3KKVA 4WD5A 2RGPA 3FI3A 1OKYA 5HO8A 5K4IA 2CPKE 3VUTA 3EFKA 3ZLYA 2J90A 5JGBA 4QP8A 5HX8A 2VZ6A 4OBPA 2XKDA 4JDIA 1ZWSA 3IPHA 5A14A 3HA6A 1UKHA 5GHVA 4QP6A 3FBVA 4M67A 3DBDA 3EQGA 2PL0A 4RWLA 3IG7A 3R04A 3BHUA 1ZRZA 3UOJA 4FKLA 4KBCA 3OOMA 4P90A 5ETFA 4BTJA 4IB1A 2VTPA 1Y6AA 4JDJA 5HCZA 5HGIA 5C4LA 3TNWA 3UP7A 2I6LA 4ZS0A 4YHTA 4IAZA 4IW0A 3ZDUA 4ZTRA 3MVMA 4L01A 3KXXA 3D7TB 3TDWA 1WBTA 2W4JA 4FTKA 4M0YA 3NLBA 4W4WA 2W1HA 5D12A 5LOHA 3ZUTA 5IH5A 1FBNA 4BY9E 3KREA 4RSSA 3CIKA 3BQRA 5KO1A 4UBAA 4O7LA 3KMMA 1O9UA 3DPKA 4OLIA 3NYVA 3CGOA 3F7WA 4FTTA 4YTFA 4R5YA 3R7VA 3O8UA 2BDWA 5AR7A 1YXSA 2B9JA 3IDCA 5CU6A 3LCSA 4U3YA 3R83A 4E4NA 1JBPE 1PXNA 3QTRA 4I1ZA 1KE7A 2ITYA 2W5AA 3DOGA 4FKRA 4C3FA 4PDOA 3R22A 2RSVA 5B2MA 5C01A 2HWPA 5C03A 4AT4A 5I9VA 4F65A 3U4UA 3BLHA 2FSOX 1QPCA 3LW0A 3LXLA 3ULZA 2GNLA 1CDKA 4DBNA 2QOQA 4ZTLA 3RJCA 4MXYA 1OPJA 1LP4A 3FY0A 2OJJA 1J1BA 4D2TA 4YLLA 3HYHA 4JAJA 4UB7A 5GZ8A 4D2WA 3DXPA 4RG0A 3V8SA 5AUXA 3ZRKA 4FG9A 4IZ7A 4D4VA 2IVUA 4CFFA 2BRBA 4QQJA 5DH3A 3QTSA 1WVWA 1H1QA 4XCUA 1WBPA 5J9ZA 4BDJA 3OEFX 5HBEA 4FICA 3ETAA 3R8LA 3HV7A 1JKLA 4QYFA 3H9RA 1M14A 1BL6A 3PVGA 4XG8A 4D9UA 2ZB1A 4C0TA 4ANMA 3NGAA 2OXXA 4XP2A 5AIRA 4L46A 1IAJA 3CQEA 3SDJA 4JDKA 4Q5EA 4I24A 4O0VA 3W55A 4USDA 4AGUA 4LI5A 3QQLA 5AX3A 2XRWA 3QCSA 3N51A 5EHYA 4UV0A 2XNEA 4MBLA 1R78A 2BR1A 3QALE 2OKRA 2WTIA 4KD1A 4EHVA 5KCVA 4N57A 3F5XA 4Z7GA 4JG7A 3JY0A 3F61A 5ITAA 3HA8A 5ANDA 4QMPA 3KULA 3QGWA 4JRVA 3RNIA 4FA2A 4CQGA 2YACA 2VX0A 2IVVA 1PXKA 4ZIMA 3SRVB 1URWA 3DZQA 4M7IA 3P7AA 3UO5A 2JBPA 4QQ5A 3PXKA 3TNQB 1H07A 5I0BA 1GZ8A 5BYZA 4F6UA 3I60A 3UOKA 4NT4A 3T3UA 5IUGA 2BDJA 5HESA 1NVRA 1H0VA 2HELA 4JBVA 4U44A 4IE9A 2QOHA 2UVYA 4V0GB 4X3JA 5LJJA 4FE2A 1YI3A 3BWJA 3PVUA 4TWNA 4HYSA 3NRMA 5L2WA 4IXPA 3TV7A 5HLPA 2HY0A 5CEQA 2ERKA 2VTOA 4W8DA 3ZEPA 4CYJA 4A07A 5J79A 3PVBA 4KSQA 3ZSGA 2H6DA 3NNUA 3OUNB 3DT1A 4BI0A 5HG9A 3H10A 3QWJA 3CY3A 3SA0A 5FM2A 2B9IA 4IVCA 3I0QA 3ZYAA 3EZVA 3VS7A 4O83A 3A61A 2WB8A 3ORLA 1QMZA 3AC8A 2FO0A 2VRXA 2WTDA 3H0ZA 3RINA 4AA0A 4FKQA 4EORA 2Y0AA 3EJ1A 1M7QA 1FGIA 2BZKB 5A3XA 5CENA 3BLQA 3OZ6A 4RVKA 4MNEA 2BZJA 3I81A 4EH6A 3ULIA 4AT3A 4R3RA 1S9JA 4YPDA 4PL4A 1YW2A
chains in the Genus database with same CATH superfamily
2YHVA 3EFJA 5LMKC 3ZTXA 3SVVA 2JC6A 4LL5A 2CN8A 5FBOA 3QQGA 3ZC6A 4G3CA 4M12A 5ETCA 5BV3A 5GJGA 3SG8A 2W05A 3DCVA 4I5HA 1MQ4A 3WF6A 4ACCA 2B53A 1IA8A 4GT5A 4J1RA 2UW4A 2F2CB 2CKEA 3M2WA 4KIKA 4LGGA 3V6RA 5CI7A 5TT7A 1XH7A 2ITNA 3EL8A 5HG7A 1W0XC 2VTLA 3PE1A 4FKPA 3PXYA 4AT5A 3DK7A 4WNOA 5AR4A 2IVTA 4S32A 2XK9A 3T9TA 4KA3A 4GT4A 4O7ZA 3ZS5A 4AX8A 1ZARA 3A7FA 2PUNA 3U87A 5D1JA 2GQRA 4FL3A 3UC4A 4NKSA 3ZBFA 3K2LA 4IAAA 4BWXA 1H1SA 1LPUA 3C4XA 1WVYA 4OUCA 5DPVA 4ZZNA 3Q2MA 4I4FA 3CCNA 2P33A 4KNBA 4A9UA 4XBRA 4G34A 4RRVA 3BWFA 3BI6A 1DI8A 2H8HA 2WZJA 3D7ZA 3HL7A 5EOLA 3LAUA 4QTCA 4H1JA 2PTKA 5AUTA 2WO6A 2XIRA 2GNFA 4JG8A 4BFMA 1UU7A 5CEKA 4FTUA 3EIDA 3ENHA 4FX3A 2J2IB 3OXZA 2CCIA 3Q04A 3QD2B 4HCVA 4U80A 5AR8A 4I6LA 5BX0A 4YBJA 4NIFB 3QZHA 4J98A 3OWPA 4R7IA 3RBWA 2C6TA 2VTNA 3M42A 5JRQA 2Y4IB 5HICA 1BKXA 4FT5A 4NM0A 1DI9A 3DKGA 2KULA 4YLKA 5KMMA 2GTMA 2J0MB 5BVOA 2R3JA 1YHVA 4FZAB 1Q62A 4I6BA 3PIZA 4HCUA 4QTDA 1IASA 1TKIA 1ZOEA 3LMIA 3A8WA 4DEHA 4XHKB 3CKWA 3QWKA 1BMKA 2NRUA 4GJ3A 1FINA 5M44A 4YTHA 2CSNA 2R4BA 4FGBA 2G9XA 3QU0A 5M4IA 1E9HA 1ZYDA 2VO3A 3BU3A 3FYKX 5A4TA 4YURA 1XMLA 4M84A 1V0OA 4C34A 2Z8CA 4JMQA 4F7JA 2OSCA 4AXDA 3DBQA 1YWRA 2OFUA 4DHJA 3W2QA 2V7AA 2PVRA 3ZRLA 4EBVA 2GFSA 4F70A 2XF0A 3KFAA 2XYNA 3JXWA 4C57A 2GS6A 3NUXA 3R7EA 3A99A 1S9IA 5FRIA 4D2RA 2BTSA 5IF1A 2B1PA 1CKJA 5HIDA 2HXLA 1REJA 3THBA 3VS3A 3AQVA 2HOGA 4Q5HA 5D7AA 3KK8A 3ORNA 2OXYA 5F95A 3FXZA 4OR5A 3GFEA 2X4ZA 3NW6A 1TQIA 3GQLA 4DG3E 3FMMA 3P9JA 2IZUA 3PRIA 3ZHPC 4IZAA 5HG5A 5K0KA 2YM6A 4JR3A 5AJQA 5A46A 4AN3A 4IVDA 2XBJA 5AX9A 1B6CB 4FTNA 3AG9A 4BBFA 3NNXA 3D4QA 4BDIA 5HVJA 3ZCLA 2YLEA 1BI8A 4C3RA 3GC7A 2QCSA 3IDBA 4MBJA 1OZ1A 3D15A 4FSUA 2ZMCA 4AA4A 1P4OA 4L68A 1ZZLA 2ZFYA 3PWYA 1YXTA 2ITXA 3DY7A 3KMWA 5EH0A 4RIWB 3TIYA 4CCUA 4X2FA 3CQWA 4EQCA 3LOKA 5E92A 2PVJA 4A06A 2YIQA 5LXMA 5EM5A 4QPSA 4FIEA 1YXVA 2XK4A 2WTCA 5EW8A 4MBIA 4NM3A 4BZDA 5KHWA 4IFCA 1WBSA 5CU2A 3AKLA 2X0QA 3W2CA 5CAQA 3CXWA 3QFVA 1BL7A 5CU4A 3PXQA 4C2VA 2AC5A 4RX8A 4YZBA 5CF4A 5EHLA 4YGAA 3KL8A 4O91A 4AFJA 4CXAA 4FEVA 3E8NA 4FIIA 2GU8A 5AR5A 4B99A 4PNIA 2XKFA 4O38A 3R9OA 5BYYA 3UIBA 4TYGA 4BJJB 2VNWA 1XBCA 3EB0A 5D10A 4FUYA 5A9UA 4E20A 4BCKA 4G6OA 4EK6A 3FE3A 3O17A 1LUFA 2R3NA 3BHTA 3LM5A 2UZWE 3FZPA 1OB3A 4LV8A 4QMWA 4YZ9A 1SM2A 3CGFA 3OY3A 4QP9A 3SGCA 4DBXA 4WG5A 3FQHA 5DYJA 4BI1A 4AN9A 2PVYA 2XCKA 2AUHA 4U42A 4UMTA 5AFVA 3PYYA 5D11A 3D5XA 2PHKA 3KRRA 3NCZA 4U97A 4BHNA 4CFNA 5CXHA 4WSYA 2HZ4A 5CAUA 3P4KA 4R7HA 3EYHA 2WQOA 4G3DA 3UMXA 5ANIA 3BE2A 5CX9A 5HE1A 3U6HA 2WKMA 4U41A 3AC2A 3Q3BA 4PF4A 5HNGA 3U9CA 4NUSA 2XIKA 4FNWA 2BAKA 5HD4A 4ALWA 4O84A 2X0GA 2G01A 3PJ1A 4QMXA 3ZXTA 4Z9LA 2IZSA 3BYUA 3KXNA 4GW8A 4KRCA 3FI8A 2C1AA 2PU8A 3R8UA 3LLAA 4YJTA 3GCVA 3UVQA 5CTPA 4CFMA 5BVNA 3LCDA 5EM6A 5BVEA 1NVSA 4HYHA 3Q4ZA 4BYIA 4UYNA 5DR9A 3GBZA 3U8WA 1RJBA 1XBBA 4NFMA 3DLSA 4ONAA 1WBNA 3RP9A 5TE0A 1KV2A 5EDRA 2A98A 3V01A 4O0XA 5HE0A 2HXQA 3IONA 2JITA 1K3AA 3R7GA 5AV4A 3FPMA 4I0RA 3PVWA 1OKWA 3ZZWA 1PXMA 3QRIA 4RGJA 4CGAA 3PPZA 3F7ZA 4AS0A 4EZ3A 4OTHA 4IWQA 4OW8A 5ETIA 4PX6A 4FVPA 3ELJA 3DBFA 4JNWA 3WZJA 5KMNA 3IGOA 2O8YA 5C1QB 2E9NA 4K0YA 4FV8A 4D58A 5C8KA 1MQBA 3V5TA 2WQBA 2XIYA 4CSVA 3R8PA 4DFNA 4A7CA 4QPAA 4EJ7A 3BYOA 4FNZA 2BALA 4IAKA 4XOZA 3LMHA 2RG5A 3P79A 1STCE 4IAYA 2YZAA 3O8PA 2IN6A 3OTVA 4K6ZA 4RA4A 1ZMUA 4FF8A 5CVFA 4RWIA 3QZIA 2GHLA 4DN5A 1IR3A 1PW2A 3QBNA 3ATTA 3FMNA 5EQEA 2PZIA 2OZAB 4M3QA 2GHGA 4NH1A 4TYEA 5TKDA 3RHXA 4FTAA 2YAAA 3F2RA 5AADA 3Q53A 4GUBA 4FSQA 3V5PA 4TL0A 5GIPE 4IH8A 3KQ7A 4OTGA 5AUVA 3TCPA 1CSNA 2C30A 4M14A 3TN8A 3B2TA 1PMNA 2IJMA 3OROA 4FKJA 4AQCA 4P5QA 3EN5A 5L3AA 3LIJA 2Z02A 3VULA 4UALA 5A54A 4V05A 2NRYA 3DXNA 4B8LA 4G3EA 3EQHA 1GNGA 5JKGA 4BRXA 1YKRA 1PXJA 3L8XA 1Q99A 2B7AA 2VWYA 3ALNA 2OJGA 3QXPA 4FZ7A 5CAPA 3EWHA 4M97A 2X8DA 2ACXA 3R30A 1JSVA 2YN8A 3A4OX 4JBQA 3IKAA 4ANSA 4IWPA 3WIGA 5H3QA 4OAVB 2C69A 3CKXA 3QTWA 4YNEA 3VVHA 3UGCA 1VYWA 3GI3A 4ZTQA 4DGNA 3F5GA 1K9AA 4WNKA 2XNOA 4DEDA 3QQUA 4QMOA 2X8EA 4C8BA 5CAVA 4MQ2A 1KE6A 4JG6A 4NW6A 4J52A 5CT7A 5HIBA 4RJ6A 5HZNA 4F09A 2UZOA 4ACHA 2CKPA 4GMYA 4L52A 4AACA 1UU9A 4Z55A 4FKSA 2PUIA 2Z60A 4QOXA 1DAYA 3OCGA 4J99A 2F7EE 5HCYA 4FUXA 4NZWB 2QOIA 3OWJA 3RAHA 4AE6A 5KBQA 4XG7A 4BBEA 4EOOA 3E62A 3POZA 2UW9A 5GZAA 5TR6A 4BWPA 3ZLWA 4I4EA 4BTFA 1H00A 3NNWA 4YJUA 1OVEA 5JGAA 3DAEA 1UV5A 3I4BA 4TYHA 4YNOA 2WAJA 3FI4A 4MXXA 3ORMA 4IIRA 1H28A 2W1GA 2WTJA 3WBLA 4DFYA 2OU7A 4HZRA 3PA4A 4X3FC 5DI1A 4AW5A 4BGGA 3UZTA 5AV0A 4EOQA 3I6UA 3N9XA 4D1ZA 3NR9A 4FIGA 2X8IA 3TV6A 4WSQA 5CEIA 3ZLXA 4JIKA 4ASZA 2R3LA 4O1PA 2XK8A 3LVPA 5FP6A 1ZAOA 4I5PA 4L3LA 4QNYA 4X3FB 3MVHA 2ONLA 3CC6A 4G5PA 3G6HA 3HRFA 3CPBA 3MFTA 3R1QA 4FT0A 2GTNA 2QOFA 2R3MA 3FMLA 5FUTA 4I23A 3AC5A 4WNPA 4YO6A 2C6MA 4EHEA 4MCVA 2OIBA 4ZOGA 2P2HA 4JX7A 4QMUA 4B4LA 4DH3A 1XMMA 2ITVA 3U4WA 5L8JA 3HV3A 4IDVA 2GMXA 4FK3A 3S2PA 4BDKA 5LVOA 2C6EA 4RIXB 3UQFA 4D5HA 5BVFA 2YABA 3FV8A 3RAKA 2V5QA 2NPQA 1A06A 3MY0A 4GK2A 3UJGA 4EC9A 3KIOC 2R3KA 5L4QA 2W5BA 3KXGA 4FT9A 4IM3A 3NNVA 4GG5A 4QMSA 4HVHA 3K3JA 3ENMA 4Q2AA 4TYIA 5F20A 1E1VA 1ZMWA 2Z7RA 2YJSA 2WTWA 3ANQA 4EK5A 5HLNA 2XM9A 5M4FA 2E9UA 2WQMA 5E8TA 4JI9A 1XH6A 2HIWA 4M66A 3GCQA 3UC3A 4DFZE 3VBTA 1Q97A 4X6RA 5J5SA 4G9RA 2I0HA 3IECA 5JZNA 2OZOA 3HMNA 3PG3A 2WMQA 2B52A 1X8BA 4GFOA 4IAFA 3MVJA 3FLNC 1YVJA 3O51A 3QHRA 3R63A 5CSPA 3S0OA 2G15A 5G6VA 4F9YA 3NMUF 3PTGA 4YJOA 3WZKA 5A6OA 3W0RA 3UG1A 4YZDA 4FSRA 2J0KA 1W7HA 4JR7A 4NU1A 4FTIA 4KWPA 3EQDA 3OBGA 3IW5A 3H4JA 3U55A 2UZVA 3VBYA 4BIBA 3NX8A 4ID7A 5AAGA 5JGDA 3IGGA 3JUHA 3COIA 3F3WA 4O4DA 2J9MA 3VIDA 4FKTA 4CG8A 3E3PA 5GJDA 4BL1A 4IFGA 1URCA 1WVXA 4BDCA 3V04A 2HAKA 4XV1A 5CI6A 2FYSA 4YP8A 2UW8A 4ZJVA 3G15A 5IQHA 3P5KA 4FIHA 4OT5A 4ZTHA 4HNFA 4QO9A 3HRBA 3PG1A 4BGQA 4DC2A 3G9LX 4K11A 2ZVAA 4NCTA 4DH8A 4JJRA 5E8VA 3UZRA 4LGHA 3C7QA 2YFXA 1OPKA 2VAGA 4H3PA 5ANGA 3V6SA 3G0EA 2VO0A 4ZZOA 4IB3A 2V0DA 1SVHA 3ORIA 4LQMA 4I6QA 3AT4A 5DIAA 4O0RA 5HO6A 5EKNA 1OKZA 4OT6A 3C4FA 5IQGA 2YISA 5CU0A 3Q5ZA 4BCMA 1Z9XA 2HCKA 3O71A 2OBJA 3MH3A 2O63A 2PVMA 4GIHA 4ARKA 4JQ7A 2PMLX 3DXQA 3SG9A 4JAIA 4FR4A 4IZ5A 3LCOA 3TXOA 1H4LA 1EH4A 4GKIA 2QKRA 3A60A 5DEYA 2W1IA 1ZOHA 3KA0A 1XWSA 4CNHA 3QTIA 2DQ7X 4G3FA 4NM5A 4U9AA 5BMMA 4EH4A 3TM0A 4S34A 4XV2A 4QYHA 3MI9A 3I7BA 2YM3A 4CZYB 2IF8A 3L9LA 3BE9A 3DDQA 2YZLA 4CMTA 2FVDA 3E63A 3PY3A 3LXPA 3F3ZA 4RQKA 2C3JA 3NUNA 4AOJA 1J7IA 3D14A 4V01A 3Q4CA 2WMSA 3LQ5A 4X2KA 2REIA 3KVWA 2YIWA 3AC1A 3UMWA 4E7WA 1BX6A 3PJCA 2G1TA 5EW9A 3W18A 3E8CA 2RFNA 3NWWA 2UW7A 4CT2A 1VR2A 3HAMA 4FSWA 1XJDA 3RZFA 3P1AA 1H27A 3QL8A 3KCKA 2BFXA 3RWPA 3ZUUA 2XEZA 4AZSA 3PIXA 5CASA 1QPEA 4FKOA 1FOTA 4DHFA 4HVSA 4CCBA 2FB8A 4AXCA 2A4LA 1OL6A 3NIEA 4FV5A 4D2PA 5IA1A 4BDDA 4XJ0A 3ZC5A 2W96B 3G51A 3MDYA 5IDPA 3TYKA 2CGVA 4R3CA 3RPYA 4GFMA 3GU8A 5TOZA 3PP0A 5HO7A 5FM3A 1NT2A 3N4TA 3BYMA 5EDQA 2VWBA 3EN4A 5DOSA 3O23A 1PYEA 1W2FA 3KVXA 4DCAA 4IB0A 3SKCA 5HVYA 4CZUA 1OITA 3DDPA 3D5VA 2PZPA 3FC1X 3MIAA 4WG3A 1KE5A 3VBXA 3PUFC 5GINE 2W7XA 3O8TA 2ZV9A 5J8IA 2C5VA 3UOHA 4EH9A 2AQXA 1U5QA 2G2HA 2ITUA 1ST4A 1OL5A 3FKNA 4JS8A 5D41A 3GU4A 4UWBA 1R1WA 4QMVA 4PMTA 2ZB0A 4ZJJA 2GQSA 3DJ7A 3Q2JA 4QMTA 3DNDA 5AV2A 1NVQA 2QHMA 4XG6A 4DLIA 3K5VA 4XUFA 3ZO3A 3ROYA 2ERZE 3EKNA 3I6WA 4UY9A 1DS5A 4OTFA 4BCIA 3BYVA 2VWXA 3LE6A 2BPMA 2ETMA 4JBPA 1YWVA 3R1NA 3L8SA 2WOUA 2G2FA 3HMPA 5FXQA 4E6AA 4MAOA 4O2PA 3PLSA 4ERWA 2VTRA 4FKUA 4YLJA 1W83A 1KE9A 2JKKA 4IX5A 2X9FA 4FV1A 5EYDA 4JLCA 3SQQA 5M08A 4TNBA 3S4QA 2VTAA 4L3JA 1H01A 2YLFA 1R39A 2QG5A 5T3QA 2JDRA 2QODA 3EH9A 3ORPA 3Q9ZA 2CCHA 4NEUA 3UNJA 4EI4A 4CFVA 3QXOA 4AAYA 4FEQA 4PPAA 4XBUA 4K8AA 1GZNA 4RJ8A 2BZIB 4RWKA 5CNOA 5JSMA 3MA3A 3IDPA 3F3TA 5ANJA 4DG0E 3R6XA 2PMIA 4LFIA 3F6XA 4MX9A 4FG7A 3FHRA 3IW4A 3NAXA 3DBCA 2YM8A 2FUMA 3PZHA 2JDVA 5F4NA 2QC6A 4M69A 2QR8A 2R3QA 4ZAUA 4FZ6A 5HTBA 3FMKA 5IQEA 2PE2A 4ZLZA 3P23A 4DG2E 1JKSA 4EKLA 3Q32A 4WG4A 4X7QA 3TJCA 5M4UA 3EQPA 3FMJA 3NEWA 4WHZA 5CXZA 1Q3WA 5JK3A 1L3RE 4GK4A 4LRKA 4D0XA 4DCEA 3HUCA 4KKGA 4S30A 4IM2A 4XLVA 5HEZA 3BV3A 2PE1A 4HCTA 5CLPA 5DT0A 1ZLTA 5GZ9A 4BDFA 3LXKA 2CGWA 3NUYA 4LYNA 4AG8A 2J5FA 3NUSA 3S95A 3AGLA 4BTMA 1JSTA 2YDJA 5M55A 4F1TA 5IQDA 3MVLA 2WOTA 3EHAA 1ZOGA 2I7QA 4C2WA 1W2DA 3A7HA 3P0MA 4EBWA 2PVNA 3CR0A 3VNTA 5BVWA 5E8UA 4AFEA 5HTIA 4MD8E 3SXSA 3GU5A 4KSPA 4CT1A 4DEBA 5IDNA 3OBJA 1PF8A 4RIYA 3W2OA 2E2BA 2ZAZA 5FLFA 2DYLA 3G90X 3DA6A 3QTQA 4GT3A 1Y91A 2UUEA 2ETKA 3FL5A 2ITOA 3C4EA 3PY0A 5I9WA 5IA5A 1OUYA 3PJ3A 2GS2A 3R01A 4RC2A 3FLYA 4RZWA 2F57A 4YJQA 5LCKA 4F78A 3UVPA 2XJ2A 3HV5A 5ANEA 4QPMA 1BI7A 1P4FA 2R3PA 3FLWA 2EB3A 4K9YA 2GNIA 1HOWA 4L67A 4O4CA 4QMZA 3UPZA 2B9FA 2DUVA 1NW1A 2CKOA 2R3IA 5CS6A 3MBLA 4K33A 3LFAA 4O96A 4R8QA 3R8ZA 4C33A 4WT6A 2BRHA 5C8NA 5HLWA 1A9UA 3TZ9A 3E93A 1FVVA 2C0IA 4FT7A 4U6RA 1V0PA 5CSXA 2YIXA 4EUTA 2YWPA 3C9WA 4P5ZA 3FZRA 4ITIA 4O7TA 4MF1A 2WQNA 2XEYA 2QD9A 4BDHA 3MY5A 2OICA 3ACJA 2XK6A 3QKMA 5GJFA 4O7RA 4CMUA 3BU5A 4GH2A 4DEEA 4AQKA 3D7TA 1VZOA 2X9EA 3AD4A 1IG1A 3GQIA 3NS9A 3Q6WA 4IZYA 4UWYA 5CF5A 5IPJA 2YEXA 4I5CA 4NSTA 3R7UA 3LPBA 3AXWA 2B4SB 1YXUA 2NO3A 2OF2A 2OJFE 4HPUE 4IJ9A 3T8OA 4E5WA 3RNYA 4CRLA 2GNGA 3PSDA 5CQWA 3BQCA 2C6OA 4ANQA 1ZMVA 2YERA 1WBWA 3ZEWA 5FP5A 1CTPE 2I0YA 3QD3A 4TTHB 3D94A 3V5WA 5GIOE 3QCQA 4J71A 2XS0A 3ALOA 3TV4A 4RIOA 3MW1A 1HCKA 1AGWA 1WBOA 3MA6A 3ZLSA 1GAGA 2UZDA 4EWHA 2R0IA 1FMOE 2Y4PA 3V51A 3QTXA 2PULA 2C6LA 5H8GA 1WAKA 3QRUA 4DF3A 1XO2B 2BMCA 3E87A 3IQ7A 2ZV7A 4O0TA 4QP4A 4WRSA 5IISA 5J1WA 4IBMA 4GKHA 2R5TA 3SXRA 1JNKA 2OIQA 3NCGA 3R1SA 4Y83A 5AUYA 4R3PA 5H9BA 2DS1A 2X4FA 5FD2A 4S31A 3TMOA 4WRGA 4C59A 2AC3A 3T9IA 2RF9A 5T68A 2WXVA 2JD5A 4XOYA 1OL2A 4NKAA 2CJMA 1UNLA 4XYFA 3VHEA 1BUHA 1Q41A 3TUCA 2QQ7A 4IHPA 2QOKA 1AQ1A 5DWRA 1J91A 1YXXA 3REPA 4HZSA 1Y6BA 2CNQA 4YMJA 2QHNA 2A27A 4GUEA 3R2BA 1UA2A 2X6DA 3C5UA 2EXMA 5CF8A 1G8JA 4A9TA 3ZM9A 2Y9QA 4RJ5A 2FA2A 3QKKA 3WYXA 4QTBA 1G8AA 3W0OA 4DH7A 4I93A 3LMGA 2HW6A 1F0QA 4FSMA 1PKGA 4U40A 1Z5MA 5DEWA 2XBAA 4YZCA 3ROCA 3BRBA 1BLXA 4G3GA 5CVGA 3UZPA 3TG1A 3ZMMA 2XK3A 1DM2A 2WIPA 3ZOSA 1XBAA 1WMKA 1XHAA 2WEIA 3W10A 5KMIA 3Q5IA 1WZYA 3LFFA 4NJ3A 2A2AA 4O22A 2JDSA 3RK7A 2JDOA 2O0UA 3P7BA 2QU6A 3ZFMA 1J7UA 5CY3A 4LRJA 3V5JA 1VLRA 1LR4A 4H58A 2W17A 3SRVA 4FV4A 4LMUA 3KF7A 5CT0A 1Q3DA 5E8ZA 5BVKA 4EKKA 1TZDA 3CTHA 3ML1A 1UKIA 4UMPA 2X7FA 4N0SA 3SW4A 4LGDA 4GU6A 3QX4A 2Y6MA 2CLQA 3LFNA 4TN6A 4GIIA 5DA3A 4IEBA 4UXLA 4EJNA 3QRJA 4O0SA 4CZTA 2WMTA 4OBQA 3W32A 3CQUA 3EKKA 3G5DA 3GGFA 3WI6A 5JFWA 3VONA 2XM8A 3ORKA 3C0HA 1SVEA 3DS6A 3FUPA 2BHEA 4V0GA 1YOLA 3UOLA 1PYXA 5ICPA 4FV2A 3BYSA 3QUEA 3LLTA 3RHKA 1FMKA 1PJKA 2XNNA 4RT7A 2C6IA 5AUZA 4D2VA 1OBGA 2PMNX 5IA2A 2RIOA 5AP5A 3TTIA 2FSLX 5JFSA 4F63A 3MJ1A 4FL1A 1PXOA 4GS6A 4FVRA 3JYAA 4ZSAA 4QQCA 4UXQA 1G8KA 3I7CA 4YZNA 4BN1A 4XV9A 3MY1A 2E9PA 4GCJA 3FZSA 4MK0A 2YDIA 2VTQA 4N70A 3G9NA 4I94A 2X0PA 2QO2A 1AD5A 5CZIA 2EUFB 5HHWA 5AAEA 4O7YA 3LXNA 4ASEA 2OJ9A 4ANNA 2NYAA 3UDZA 2BRMA 5CNNA 4CV8A 3R02A 1JPAA 2F49A 4NWMA 4ASXA 4BCHA 4APCA 5LMBA 1PMVA 3KEXA 2R3FA 4MVFA 2PZ5A 3PPKA 3UO4A 1OIRA 2J6MA 2H34A 1JKKA 2QLUA 3FXXA 1GJOA 4RFZA 2XCHA 3Q6UA 3ID6C 4PY1A 5AMNA 4HGEA 4Y73A 2WTKC 4IANA 1G5SA 4FBXA 3CPCA 5AP6A 3BGQA 3MPTA 4K18A 3UNKA 3EZRA 2OGVA 3OCSA 3P08A 5M06A 4YJVA 4O4FA 3GC0A 5LMKA 3U6JA 3DKCA 3QRTA 3I5ZA 4NTSA 3WE4A 2R3RA 1OGYA 4R78A 3VAPA 4XG4A 2WTKB 1QL6A 4C37A 4FV6A 4O6LA 3FLZA 4HGSA 3PFQA 1WBVA 2XNMA 3JS2A 3MB7A 4LOOA 5K4JA 3FMHA 3PY1A 2C5YA 2VWIA 2XA4A 4YSMA 5KMJA 2W5HA 5AUWA 4CFWA 2R2PA 2RFEA 5IKWA 4C61A 2HK5A 2YAKA 4RJ3A 2F9GA 3O5AA 2IWIA 3ZU7A 1ZYCA 2QOBA 4K1BA 4NM7A 2XJ1A 4M0ZA 2CHLA 3LFBA 1SVGA 4L53A 4OTQA 1KE8A 2FSMX 3WARA 3NFFB 1Y8YA 5EYMA 1H08A 1Z57A 3F3UA 3WF7A 4D9TA 5E8XA 4GSBA 4BYJA 5A4LA 4ZTSA 4CTCA 1OBDA 3PSCA 5EI6A 4TYHB 3ZONA 5EM8A 4BC6A 2OXDA 3V3VA 5LARA 4EZ7A 4FOCA 4NK9A 2WMRA 3IOPA 4EZ5A 2SRCA 4C38A 3W0PA 4HNIA 4NIFA 2EVAA 3NFGB 3VBWA 2GFCA 3QX2A 5CZHA 3FQEA 3UDSA 1T45A 4QRCA 2ONLC 3OCTA 4QTAA 3UPXA 3V5LA 4C4JA 4MUQA 1JSUA 1YWNA 3C5IA 3D5UA 2EB2A 4X21A 4FTJA 2NNWB 3ERKA 3S3IA 3H3CA 5J5TA 3U9NA 4MXOA 5CALA 4H39A 3W2RA 5EYCA 3VS4A 3SOCA 5JEBA 3FL4A 2IEWA 3POOA 4EEVA 2VTHA 1HCLA 5J9LA 2J5EA 1FVTA 3W16A 3NVMB 4BKJA 3R9RA 2ITTA 3ZRMA 3RGFA 4HYIA 4CG9A 2FH9A 3RPSA 4EYJA 2B0QA 3QTUA 3B2WA 4O0WA 5M57A 1H26A 4KS8A 1FVRA 3GT8A 3ZSHA 2QO7A 5AP1A 3VBQA 2WU6A 1F3MC 2RFDA 2C3IB 5IZFA 4ZJIA 4AOIA 1J1CA 4PPBA 3LCTA 4PL5A 3C1XA 1OIQA 2BCJA 2YM5A 3FKLA 3OMVA 4BCFA 4ZY5A 3SXFA 3PP1A 4AZWA 2WFYA 5B0XA 4G31A 1LEZA 3WZEA 2X39A 1FQ1B 2P3GX 3KCFA 1U54B 3QD0A 3GOKA 1OMWA 4UX9A 1OI9A 5M09A 5EK7A 4XLIA 4BZNA 5AA9A 5L8LA 3RI1A 4GK3A 2WEVA 5EDPA 3SC1A 3AC4A 4L7SA 3I5NA 4UMQA 4FEWA 2XZSA 2YM4A 2JFLA 4EOLA 5BVDA 1V0BA 2W1CA 4ZMEA 5BPYA 5HCXA 2DWBA 4CKIA 4JQEA 2HZ0A 2J51A 3CLYA 4AXEA 4IX3A 2HYYA 5JZJA 1KV1A 3KXMA 5JFVA 1ZZ2A 4WO5A 4YUQA 3Q9XA 2CGUA 3OUKA 3KF4A 3G6GA 4RIWA 5L2IA 1O6YA 3Q52A 4FV9A 4WOVA 4G9CA 4V04A 3O7LD 5AR3A 4MXCA 3RZBA 5HU3A 3NW7A 5DRDA 4CKRA 4BDEA 3DKOA 1PHKA 3QHWA 4KB8A 4S2ZA 2VWUA 4FOBA 4DGGA 4O1OA 2C3LA 3IK3A 5L2QA 3R7YA 2HZNA 5AWMA 2V22A 1TFFA 3F82A 2BKKA 4RX9A 2W9FB 5BUIA 2ITWA 1WCCA 3TNPC 3M1SA 1Q61A 2JIVA 4BJJA 2UZTA 4A9RA 4AZFA 3KY2A 1DAWA 2HY81 3PRFA 3D5WA 4YHJA 4R5SA 2PY3A 2WGJA 1XH9A 5EQYA 3SD0A 4BCJA 3AOXA 4AP7A 3BEAA 5CWZA 3G0FA 3R7OA 2JBOA 4E4XA 2YWVA 5AA8A 3BEGA 2OFVA 4HOKA 2Q0NA 1H24A 3OW3A 4E5BA 2PUPA 2WHBA 2XIXA 4PTGA 4YTIA 4XX9A 5IH6A 5LWMA 1UNGA 3PJ2A 4DFXE 1U4DA 3C13A 4JBOA 3RK5A 3QA0A 4FI1A 3ZZEA 4BCGA 3BHVA 4LRMA 5E8WA 3RM6A 3UODA 2HW7A 3CD8A 3F2AA 4PUZA 4W8EA 3AT3A 4A9SA 3R71A 5C8MA 1VYZA 5E1SA 3RAWA 1SNXA