1ZZ2A

Two classes of p38alpha map kinase inhibitors having a common diphenylether core but exhibiting divergent binding modes
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
337
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Two classes of p38alpha MAP kinase inhibitors having a common diphenylether core but exhibiting divergent binding modes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 337
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zz2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zz2A01
2C3IB 2H96A 2PVRA 2O65A 2XIRA 5AR3A 3NUUA 3WZEA 3F82A 4WSQA 2PVYA 3F5XA 3G51A 3IQ7A 2C6KA 4PL4A 2VRXA 4FZ7A 3N4TA 2CMWA 2FA2A 3F5UA 5GHVA 5H9BA 4PTGA 5FBNC 2C47A 4BGQA 4XJ0A 2PUNA 3WYYA 1W0XC 2ZJWA 4L3LA 4XMOA 3FZ1A 3CQEA 2PVJA 3NW6A 3PVWA 3OY3A 4L67A 5EHOA 4FV6A 3W1FA 2SRCA 1ZRZA 4R6VA 2BR1A 4WIHA 5EYKA 3BWJA 1BI8A 4GFGA 2XP2A 4BKJA 2QOFA 3PJ8A 4C3PA 4LQMA 1W98A 2J51A 2ITOA 5JZNA 4PMPA 3LXNA 3QQJA 3G6GA 5E8UA 5B2LA 3U4WA 4B4LA 3G90X 4DH3A 5CSPA 2JDOA 3FMDA 1TKIA 4H1MA 2CLQA 1O6YA 4OTQA 4JIAA 2B4SB 4FR4A 3G6HA 2BDFA 3LFQA 1U54A 4FKJA 2IW8A 5ACKA 3DKOA 3PXYA 3VBYA 3AC5A 3P23A 2IPXA 5E91A 1P4OA 3PG3A 4I4EA 2OXXA 5TOZA 4XS2A 5J9LA 4UV0A 3DAJA 5K4JA 3KRLA 1VEBA 5JGAA 4EKKA 4BI2A 4FICA 4JI9A 2BDWA 1ZAOA 4O7ZA 3RJCA 3PSDA 4ARKA 2F4JA 4AS0A 5DFPA 4AP7A 4HZRA 4L44A 3VUTA 4AA0A 3NVKI 3QKKA 4F9AA 3KXHA 3OT8A 4F9CA 4UXQA 3QLGA 1NT2A 3R9RA 4B99A 4L53A 5DIAA 3QZFA 1J1BA 3TV7A 2O3PA 3F2NA 1YI4A 4TTHB 3W10A 3GFEA 4RGJA 2JDVA 5HVJA 5DG5A 3VW6A 5IA4A 3L9LA 4IWOA 4RA4A 3PPKA 4ZJVA 5EM5A 1PXPA 3HMPA 3I7BA 4NSTA 3MVLA 3C5UA 4NK9A 3UVPA 2HAKA 2YJSA 3QCYA 4EZ5A 2JKOA 4RC4A 3ZC6A 1M17A 2WNTA 4H1JA 4FKWA 4RFYA 4X2NA 2VTRA 4WA9A 3BGQA 3CD3A 3DXQA 3DV3A 4MTAA 4D4SA 4PMMA 4G5PA 5F20A 2XCHA 4YLLA 4TPTA 4EOLA 3KN5A 1R78A 2WKMA 2C6TA 2XNOA 4RZWA 3RCJA 4FV9A 4BCFA 3O8PA 4YPSA 4BGGA 4F0IA 3MFTA 3TV4A 4IBMA 1YI3A 3P0MA 4S32A 3FMEA 3G15A 4OTWA 3R9HA 3L1SA 3S4QA 5ITAA 3MTLA 4O2ZA 5M55A 1S9IA 2DWBA 5LOHA 1IRKA 4Z55A 4BBFA 2XS0A 1WBVA 2V0DA 3HRBA 4NM0A 5I9ZA 3NW5A 1U4DA 4BIEA 1XO2B 2QOBA 3NNXA 5ICPA 2PVKA 3UOLA 2XK6A 1ZYJA 2JIUA 2WU7A 4M84A 3WBLA 4C35A 4BCNA 3GQIA 4IVBA 3JS2A 2ZB1A 1YQJA 3O50A 3F7WA 2PHKA 3DCVA 4KSQA 4QMZA 3JYAA 3SHEA 5EQPA 1FMKA 3NCGA 3C13A 3TNQB 3HDNA 2QC6A 3E7VA 2JDRA 2BFXA 4JG8A 3VUGA 5IQBA 4GUEA 4MXOA 5M4FA 1Q61A 3A8XA 4G31A 4Y85A 2WQNA 3O23A 2RG6A 4FKTA 4Y46A 4U8ZA 1E9HA 5CF8A 3RTPA 4FTUA 3RPRA 2EVAA 2C0TA 2UW3A 4X2GA 3TJDA 4DEEA 4IB1A 2UZWE 3V5QA 2B1PA 4APCA 2JC6A 5HORA 3U54A 4H3BA 3VJOA 2QODA 2GNHA 4AU8A 5F95A 4ALUA 3S2PA 3ATTA 3EQBA 4NYEA 2B0QA 2YISA 5AP0A 4Z3VA 2EXCX 4TN6A 1IA9A 3I0QA 3IDCA 3KREA 2FSMX 3U6JA 2CKQA 2I1MA 1ND4A 2VWWA 2WOTA 3QRJA 4YZBA 5KMKA 3SW4A 4EHZA 3DS6A 3R22A 3QTXA 4GU6A 3GU8A 4I6QA 1O6LA 4FSZA 2C30A 4IB5A 4PV0A 2RKUA 5DEWA 3W18A 3IW7A 3PJ1A 5M56A 4Y83A 2BAQA 1RDQE 1WZYA 2C3JA 2ITPA 2VGPA 2W96B 4PQNA 4U43A 4ZXTA 2WMUA 2XKEA 3BIZA 5CTPA 3KK8A 5LMKC 2ERZE 3PE2A 4G3EA 5F1ZA 3CP9A 4XG3A 3PY3A 3JR1A 2HY81 4YHTA 3DLZA 4WD5A 3RNIA 4WBBB 4EHGA 2XNMA 1REJA 5CANA 1UNLA 2WU6A 4AZSA 5LXMA 3EQFA 1OBGA 3VRZA 3OZ6A 5I9XA 3P4KA 5D12A 3ZOSA 3RK9A 2UW8A 2GHLA 2WQEA 2VTSA 4FNYA 5AP4A 1WBSA 5IEVA 3T3UA 2C5VA 5CVFA 4AWIA 4M0YA 3ID6C 4YZ9A 1TVOA 4EKLA 1UU7A 1ZZ2A 2AC5A 3KXGA 4ZSEA 5AV2A 3NZ0A 2R0UA 1JSUA 3F3ZA 5C9CA 3SRVA 4BGHA 4WUNA 4UN0C 3OWLA 2Z7QA 3ET7A 5LJJA 2OFVA 4A4XA 4L3JA 4U40A 2QHNA 2R3IA 4DFYA 1L8TA 1XWSA 3OMVA 5FTQA 4NW6A 4DEBA 2YA9A 5AA8A 3TKHA 2DQ7X 3BBTB 4I0TA 3UIXA 4EWQA 3TN8A 2XH5A 3POOA 4YC8A 5KBQA 4K2RA 4KBCA 4QMVA 1JKKA 2QONA 1OIRA 3Q60A 5M07A 3H3CA 1XJDA 3MPMA 3FLZA 4PX6A 5DOSA 3ZLSA 3COIA 4U41A 3DXPA 1BI7A 5E1EA 4QMUA 3ZCLA 4RWKA 2XB7A 3PXKA 3KRWA 5DN3A 4TT7A 1FVRA 3OS3A 4LUEA 2F57A 4V01A 2C0OA 3V5WA 4KSPA 2XK4A 4LOQA 4AFEA 2JIIA 4XYFA 4DYMA 3ANRA 3ZEPA 4F70A 3QUDA 4O7RA 3CBLA 3U55A 2V55A 3GGFA 3QZHA 1XBCA 4R7HA 4MBLA 3AC2A 4OUCA 4PP7A 5AM7A 3OOGA 3DAKA 3TUDA 2BKZA 1ATPE 3NMUF 4E5WA 1Y8GA 3BYSA 1ZYDA 3PPJA 5AV0A 3C51A 3Q9ZA 1BX6A 4I22A 4O7SA 3A4OX 2QOQA 3LMIA 3DFCB 4TY1A 4C4GA 4JOAA 1H08A 3C50A 3RALA 3TKIA 4YTHA 1IAHA 1YVJA 4QMPA 5FTOA 3L9PA 2PUIA 1OL7A 3NGAA 2UW7A 2EXEA 4PP9A 3I6UA 5CSVA 5CZIA 4AQCA 2YWVA 4O84A 5JKGA 3S0OA 2Y9QA 5BNJA 1H25A 1I09A 3DB8A 1FVTA 1H1WA 3A61A 2PPQA 4M12A 2OZAA 4QTDA 4EOSA 5TE0A 2KTYA 4D9TA 4D4VA 4XRJA 5EDRA 4AW5A 2XRWA 3FXWA 2VO6A 3KY2A 3V5JA 1G3NA 1QPJA 1F3MC 2C5NA 4DC2A 3ZMMA 4ALWA 5KHXA 4IEBA 4QNAA 4CTBA 3DY7A 4FTTA 4O82A 2H6DA 1PY5A 4MYGA 4KB8A 3HA8A 3QRTA 4XP2A 1Q8UA 4DBXA 4ANQA 3FHRA 3PVUA 3KF7A 4YJOA 3U9CA 4EH5A 2W05A 3O8TA 4RWJA 2DYLA 3GCSA 3P7CA 3V3VA 1NY3A 3DFAA 4D2VA 4BCQA 2YIXA 3BRBA 4ZJIA 2NO3A 2JBOA 1UKHA 2R3OA 2XRUA 4AT4A 3LPBA 5JFWA 1A48A 1GNGA 4R5SA 3K3JA 4DEDA 4NTSA 2PYWA 4FKLA 3QD0A 4J97A 2PE1A 3G0EA 4K1BA 4QO9A 3RNYA 3QQLA 4I24A 1U5QA 3WZJA 3I60A 3QRKA 4BI0A 1NVQA 4F6WA 4KIKB 2JFMA 4FSTA 4F6SA 1Y8YA 3Q2JA 3ALOA 4FA2A 2XJ1A 4FKUA 2WEVA 3WF6A 4A06A 1TQMA 2VX1A 3EB0A 3PJCA 2YM5A 1J7IA 1WMKA 2O8YA 2XVDA 3CIKA 2GFCA 4GYIA 4HYIA 4EHVA 3QALE 3C4XA 2X6EA 3JY9A 2O0UA 3QTIA 4ZMFA 3NDMA 4F6UA 2JAVA 3CTQA 4CKRA 4C02A 3F7ZA 2I0HA 5F94A 3DZOA 4FMQA 4ITJA 3FUPA 4BYIA 5DR6A 2UZEA 3AC4A 5AIRA 4IAYA 4O21A 4NL0A 4DITA 4Q5EA 4KABA 4RPVA 3MSSA 5A6NA 4O0SA 1OUYA 3FL4A 2XM9A 3NPCA 4I0RA 2ONLA 2V62A 3HGKA 3VS1A 4V0GA 3PLSA 4RIWB 3CTHA 5AV3A 4AGWA 4JJRA 1OB3A 3DQXA 4LRJA 4CLJA 4K6ZA 3ANQA 2BAJA 2WQBA 1JBPE 4BCJA 3B2TA 5HVYA 3O8UA 4E4NA 4GFMA 2GMXA 4CT1A 3BE2A 4FT5A 4NFMA 4EH6A 2W7XA 2ZV2A 3FY2A 3KXXA 5IA3A 2GS6A 3TNHA 4XV9A 2OJIA 5HNIX 5FD2A 3PG1A 4U45A 4FSUA 3LFBA 5J9ZA 3VC4A 4DBNA 3LCOA 2J0KA 3D7TA 1O6KA 4EORA 4CFMA 1K3AA 1KE9A 3I6WA 1H4LA 2FSOX 4D2SA 3E8NA 5E4HA 2X9FA 4HGTA 4FTRA 4IFGA 4U42A 5EOBA 5BVOA 4I6BA 2VTHA 4F99A 2JKKA 1B6CB 5HIBA 3HKOA 4IWDA 4EH7A 2YM4A 3MH3A 4YNOA 3EFKA 3L8XA 2GHMA 4IWQA 1PXJA 3MGYA 4J52A 2BCJA 4OAUC 3D83A 3QKMA 3D7ZA 5I4NA 3GB2A 1XBAA 4XV3A 4XP3A 3OROA 3DK7A 2PZIA 3BHTA 4HCTA 4CFXA 3VHKA 4PUZA 3MY5A 4PL5A 3W8LA 4DEHA 4BDDA 4DA5A 3SKCA 3PP1A 3TKUA 4G17A 5L8LA 4ACGA 5LARA 5M4IA 5DT3A 1MRVA 2YDJA 3HP2A 4Z7GA 4JX3A 5CSWA 4IC8A 4ANLA 3QRIA 5JQ8A 2WTKB 2HWPA 5JFXA 4E5BA 3GXLA 3QUPA 3PY0A 1W7HA 4RMZA 5LMAA 2XYNA 4AUAA 2PVHA 3QC9A 1P5EA 1ZOHA 5GZAA 4DN5A 3DT1A 4TWPA 3C4WA 4YGAA 3QD2B 3RCDA 3MWUA 2X0GA 3PZHA 3WZUA 2GNIA 1U59A 3EKNA 3V51A 5AIKA 4S2ZA 4YHJA 2HZIA 4MVFA 4O7VA 4EOOA 4YJQA 3R0TA 4S33A 3HRCA 4WRSA 5CU2A 4ACDA 2QR7A 4XG4A 1ZYCA 3CPBA 2Y6MA 4XG2A 4FNZA 4FKSA 3ZS5A 3OTUA 4CXAA 2QOHA 1STCE 2QU5A 2YM7A 4FTOA 4O86A 3U8WA 3GI3A 3OWPA 1YDTE 5FEEA 5J9YA 2ITXA 2W17A 3S3IA 5J7BA 3BHYA 4WRGA 3LCTA 4S31A 2YABA 3MA6A 2ZDTA 3ORKA 4MBIA 2ESMA 4FI1A 4A07A 2VV9A 3UDBA 5HG8A 1NVRA 3MB7A 3Q9XA 4LM5A 4YJTA 4BKYA 3F66A 2YIQA 4U3ZA 3UOKA 3GT8A 5FXQA 3SX9A 4U97A 5AR8A 4G9CA 1YW2A 4HOKA 4EOQA 5I0BA 3GCQA 1VYZA 4QMOA 3TTIA 4LRMA 4LOOA 4ANSA 1JKLA 3W2RA 1QPEA 3IS5A 1ZLTA 5EW9A 1JAMA 4FIHA 4J99A 3SDJA 5F9EA 2JDSA 3ZUVA 3ZM9A 3IW8A 4NZWB 4KKGA 3U51A 5AX9A 2C6EA 3GCPA 4MXYA 4JDIA 2UZUE 3B2WA 5HQ0A 4E8AA 5EYCA 4J71A 4HJOA 5J95A 5T68A 1G5SA 2XIXA 3EYGA 4ZEGA 4DEAA 4FEVA 3VUDA 4GIIA 5D10A 4G3CA 3NYNA 5GJDA 3RPOA 2W99B 4M3QA 4FOCA 5ETFA 4OT6A 5AP1A 5HX6A 4MCVA 5IUGA 4FG7A 1URCA 3DNEA 2W1FA 1OITA 1H07A 3IW4A 4C57A 4IB0A 3NUSA 2NRUA 1Q99A 2PMLX 4KINA 4MNEA 4TNBA 5C8MA 2YERA 4XOYA 4XOZA 4DH7A 4FF8A 2R3RA 4X2KA 4YBKA 3FZPA 3M1SA 3VF9A 2HW7A 3ULZA 4CD0A 2WZJA 1OL2A 2XKDA 4F9WA 3DTWA 4O0RA 2C4GA 3NYVA 2R3KA 3DNDA 4XLIA 1F0QA 4JDKA 5IA2A 5FXRA 4JQ7A 2QOLA 2V22A 4FG9A 5CI7A 1LEWA 3TTJA 2B54A 2BIYA 3BU6A 4TWNA 2PULA 2ITQA 4FVRA 4PDPA 1OIQA 1SZMA 3QQGA 1JKTA 4X3JA 5L8KA 5BQ0A 2B55A 4ZSGA 3R9NA 1KOAA 2W1EA 4FVPA 4WG3A 2ZMDA 1ZZLA 4ZY4A 3HECA 3Q9YA 5TKDA 1R0PA 5KUPA 4WUAA 3P5KA 4DFUA 2VWZA 1OL1A 1KE8A 1LEZA 1NXKA 5J7HA 3F61A 2UW5A 5ANKA 5HNGA 2Q0BA 2YCSA 5J79A 4NU1A 3E93A 3OTVA 3R28A 3AD5A 3DK6A 2AYPA 3EHAA 5G6VA 4IACA 4Y95A 1V1KA 2CGXA 4WG4A 4D0WA 4FYOA 3LQ3A 5GINE 1SMHA 2EXMA 3Q6UA 4OTFA 1U5RA 5E8ZA 2QURA 2VTAA 1H01A 3V6SA 1GAGA 4DG2E 4F7SA 1RE8A 4CCUA 5IQDA 4HGEA 4P2KA 3G9NA 5A4QA 4YJVA 3OUNB 4KBAA 4PMTA 1FBNA 2BZKB 3BGZA 3W2SA 3KCKA 4HNIA 3D2KA 4H3PA 2E9PA 3AMAA 2V7OA 3EQPA 3O7LB 4FV4A 4OTPA 4BF2A 3CY2A 1U46A 2VWBA 2C6MA 5I3OA 1UWHA 4QMLA 2Y4IC 5FWKK 4JBPA 4KUJA 4OGRA 4L8MA 4YC3A 3BGPA 5IG1A 5K4IA 2I6LA 2R0IA 5LCJA 4C4HA 3BE9A 3COHA 3LJ0A 4Y72A 2ITNA 5FXSA 3U6IA 4F09A 2R3PA 3P9JA 3T3VA 3KC3A 3A4PA 4C38A 1LPUA 3FLSA 4I94A 4MXAA 5EK7A 2PZ5A 4R1VA 2PMOX 2PMNX 2F2UA 2OJFE 5C03A 3Q96A 4NJDA 2JEDA 3EN9A 2IW9A 2P3GX 3R7YA 5IU2A 3PDTA 1F5QA 5AUVA 3VF8A 3UNJA 5BVFA 2NNWB 3DJ6A 3FMJA 4NH1A 2CCHA 2X4ZA 3FMNA 5KE0A 3IKAA 2Y8OA 4CFNA 4I5MA 3CGFA 3WF7A 2YM6A 4KRCA 3DPKA 3N51A 1WVYA 4I5CA 5HVKA 3ZFYA 4FKGA 4R7IA 1GIHA 4F0GA 5EYMA 4DTBA 3QWKA 4NIFA 5IQGA 3WF9A 4XX9A 3Q4CA 5AAGA 3ZDIA 2X8EA 3ORXA 4RJ4A 2UW6A 1H1RA 2CHLA 2PZPA 4OR5A 5EH0A 3UVQA 4OAVB 3TT0A 5KX8A 1O9UA 3E92A 4U7ZA 2R7IA 5HBJA 3UQGA 1OZ1A 3FWQA 1IG1A 2IVTA 2Y6OA 4M69A 5TT7A 3RP9A 3TEIA 3E64A 4K8AA 3UPZA 3ORTA 4JNWA 4ZSLA 3WILA 3E3PA 3ACJA 4IZYA 4X21A 4E7WA 4ZTNA 2R9SA 2IO6A 3FL5A 4YNEA 4ZTSA 4Q5HA 4L46A 1K2PA 4TKSA 3EQIA 5ANEA 4FV3A 4I92A 4ENYA 5AP3A 3UQFA 4FYNA 1PYEA 4PPBA 3PXFA 1Q5KA 4KKEA 4Y5QA 4GG5A 4DF3A 4OLIA 5A4EA 3II5A 2VTJA 3E8EA 2XM8A 4H39A 2AUHA 3HL7A 5ETAA 5AJQA 3FPMA 3UNKA 4EK6A 4QT1A 4TL0A 1OIUA 4E20A 3OFMA 4E6CA 1Q8YA 3I5ZA 4B6LA 1XH8A 2KULA 4ITIA 2BRBA 3QX2A 4I93A 4YC6A 4WG5A 5EW3A 3UIMA 3ZLYA 4EZ7A 1J3HA 5FDXA 5LVPA 2W1ZA 4EK3A 4ZSAA 4P5ZA 3T9IA 2J2IB 2JFLA 3PFQA 4HVDA 3OWKA 3ZXTA 4YMJA 2WIPA 5IH4A 4GT5A 3ZTXA 2X39A 3H4JA 1VJYA 4LGDA 4RIYA 5KMMA 4WSYA 5AADA 5DR9A 3UODA 4BZOA 4D1SA 3R30A 4J95A 2P4IA 5E8TA 4C2WA 3LFEA 5DA3A 1GZ8A 2P2HA 2CPKE 5CQUA 3ZBXA 3RHKA 2PY3A 3HUBA 4A4OA 1Y57A 2XA4A 3KULA 4FIFA 4MEDA 4APPA 5HESA 2OJGA 2ZM4A 3AG9A 3OC1A 2HENA 1WBWA 3PA3A 1GOLA 3Q53A 5DEYA 3OCGA 2I0EA 3EQDA 5AAEA 5IQFA 3L8PA 1GZKA 1W8CA 2VO7A 1ZYLA 4D2WA 4YU2A 3LCSA 3OBJA 3LIJA 1W82A 5BMMA 4DG3E 3TI1A 2OIQA 3V6RA 1IASA 3KL8A 3UBDA 3C4FA 5ANGA 3S95A 3QWJA 3AOXA 5EKOA 3UYSA 3FYKX 3H9OA 1HOWA 2OXDA 4FV0A 4PNIA 3RI1A 3KMMA 2YLFA 4EOJA 2BRMA 2PE0A 1A06A 3GCVA 2JBPA 2WAJA 3EQCA 3ORIA 5FRIA 4RVTA 3PIZA 3WF8A 1BL7A 2W4KA 3FHIA 3SD0A 3HNGA 3GOKA 5H2UA 4DGNA 4JT3A 4ZZNA 2VWXA 1VR2A 4CYJA 4C0TA 5CEOA 1QPCA 3DAEA 5ETCA 5EQEA 3ENHA 3VUIA 3LFDA 3LZBA 3R00A 3QYWA 1CKJA 1Z5MA 2JGZA 5AP7A 3ZC5A 4GIHA 1RJBA 4YZDA 1GZNA 2ERKA 3GBZA 3DOGA 4GVAA 1KUTA 5M08A 3FI8A 5AP2A 4JRVA 3FMHA 3LOKA 3DKGA 3LFCA 5DHJA 4D5KA 3AQVA 3FV8A 4WT6A 3R83A 4IX5A 4RG0A 4JG6A 3MPAA 1Q62A 2HZ4A 3ZLWA 3D9VA 4I5HA 3TACA 3UOJA 1XBBA 3UZTA 4P7EA 5B2MA 5CF6A 1OIYA 3P79A 4QQ5A 4ZIMA 4WNKA 2QO2A 4BDEA 2WOUA 4O96A 2OI4X 3BPRA 4Y5HA 2OXYA 4EEVA 3EN5A 3MBLA 3Q4UA 2IZSA 3REPA 4IADA 4LYNA 1J7LA 4DFLA 4RA5A 4RX8A 5KNJA 1IAJA 3BHUA 1GIIA 3K5UA 3OY1A 4NUSA 2PL0A 5LVMA 3PYYA 3LFAA 3QXOA 3RAHA 1JNKA 3TDWA 5T3QA 2IVVA 3ZXZA 4BWPA 4YSJA 2R3JA 2W1CA 3GC8A 3RM7A 4BYJA 4R1YA 4M7IA 3GC9A 4X3FC 3SRVB 4XG7A 3KF4A 4MAOA 3AGMA 1YOMA 4DT9A 2WTWA 4F9YA 3FI2A 3PJ3A 2QD9A 4JRNA 4PMSA 4YJPA 3VS5A 4BDGA 1J91A 4BDFA 2X2MA 4AW0A 5KCVA 4F64A 1XH5A 4R7BA 3CJGA 3MPTA 4FSRA 3U87A 4OTGA 5FP5A 2X2LA 4I20A 4O27B 4M14A 3JUHA 3F88A 5GNKA 4YJNA 2XNNA 4G3DA 4MBJA 5GJFA 4FC0A 2QNJA 4O7TA 3RAIA 4ORKA 4YO6A 2ITTA 1ZMUA 4EBVA 2XIKA 3E88A 5JRSA 4PRJA 3EN6A 4FEWA 4CGAA 3KQ7A 4NJ3A 4IAZA 2PK9A 2J4ZA 4MQ1A 3R01A 2CNUA 2BALA 3FLWA 4J96A 2FVDA 2WMBA 4IM0A 4LL5A 4TWOA 4XRLA 4MF0A 5DRBA 5HGIA 5BYZA 1BUHA 4BZNA 3I5NA 3C7QA 5BPYA 2NPQA 4RJ5A 2GFSA 4FODA 3BQCA 2F7XE 2P0CA 4BCPA 5A4TA 3UIUA 2C1BA 4C8BA 2AC3A 2R64A 2O2UA 3KK9A 3WARA 2UW4A 3RVGA 2PVFA 2J0LA 4K18A 4K33A 5ANOA 3UOHA 1R0EA 3UZPA 4OBPA 4CMTA 2OH0E 2W1DA 3BEAA 3QL8A 4IAFA 4U81A 3TUBA 1CTPE 3ITZA 4QMMA 1VZOA 2OJ9A 4W8EA 5JZJA 2ONLC 2ITVA 5L6PA 2PMIA 1DI8A 3EOCA 2UV2A 3LXLA 4NT4A 1KE6A 2UUEA 2WMAA 4FIJA 4XG9A 5HI2A 4C4JA 4XH6A 2WQOA 4MD8E 1PJKA 5E8VA 2XNEA 3UC3A 2IJMA 2QLUA 5DE2A 2OU7A 1FQ1B 4GMYA 4QP6A 3G9LX 2VTPA 2OZAB 3PUPA 5HBEA 4CZUA 4UWYA 4B8LA 2BILB 4GK4A 3MV5A 3QTRA 5A9UA 5L2WA 2RFSA 5CT7A 2YAAA 3MVHA 4BDIA 1PMUA 5JQ5A 5K3YA 2W1IA 2ZOQA 4RX7A 5ETIA 3W16A 4O83A 3CSVA 5AFVA 5BYLA 2GPHA 3TJCA 4FEXA 4R3PA 1ZYSA 4WNMA 5HD4A 1RQQA 4FTMA 5FP6A 1EH4A 3UG2A 3V04A 3NUNA 2F2CB 3QD3A 2HELA 4B0GA 4CFVA 5HTBA 2BUJA 3C0IA 4JAIA 4UY9A 5JN2A 3JY0A 4A4LA 1H28A 3VBWA 4RVKA 2V5QA 3R7VA 2A27A 4ANBA 4F1OA 1LUFA 5HG7A 4F9BA 3FMKA 4IDTA 5DT0A 5CF5A 3S1HA 3DGKA 4FVQA 3D0EA 2E9UA 4I6FA 2ETKA 5JGDA 4WNOA 4P90A 5I9UA 4U44A 4JAJA 4HYUA 5KZIA 3OHTA 4QMQA 2H8HA 3TZMA 4IAKA 2YHVA 2BRHA 4D2RA 3RGFA 2XKFA 5BUIA 2FUMA 5FGKA 2BRGA 3UYTA 4FTLA 5GIOE 3SQQA 1LR4A 4FSQA 3H9RA 2CKPA 4L68A 2O64A 4UZDA 3IDBA 4RBLA 1R39A 4AZWA 2PVMA 2PVNA 5IA0A 3PA5A 4DGMA 2YAKA 3ETAA 2YLEA 4QPAA 4YJRA 2VTIA 5C4LA 4RJ7A 4FIEA 5C8NA 4LL0A 5AEPA 2OICA 5TR6A 1XHAA 3OXIA 5CT0A 3UO6A 4C36A 3VS7A 3KXNA 1JKSA 5M57A 2Z60A 1MRYA 4FZDB 4UWBA 3DDPA 4ZAUA 1JVPP 2BFYA 3DDQA 3W55A 4W8DA 3RM6A 4EWHA 5AUTA 4AOTA 4USEA 4AG8A 3FZRA 4FL2A 5HE2A 3SV0A 4A9UA 3FJQE 1CMKE 3D2IA 1ZOGA 1SNXA 4Q9ZA 4M8TA 3CC6A 5CF4A 2PZYA 3LQ5A 1H27A 4UB7A 2OG8A 2UZNA 3D94A 3Q2MA 1TQIA 2QLQA 2P55A 4R77A 3EWHA 4AW2A 5KKRC 5L6WL 5CVHA 2HYYA 4C34A 4X3FA 4BDCA 3NNWA 1ZOEA 1PXKA 4QP7A 4X6QC 4F7JA 4J8MA 1YWVA 4DCEA 3QF9A 5IDPA 2W1HA 4IVCA 2W9ZB 3HP5A 1JLUE 4RIOA 3R9OA 4O7NA 3NIEA 1WFCA 2BTSA 3ORPA 2BTRA 4L42A 5CALA 4W9XA 2WMRA 4TXCA 4FEQA 4QRCA 2G1TA 5DPVA 1Z57A 3NX8A 4G2FA 4BC6A 2I40A 2R3LA 3KCFA 4QP4A 4V05A 4LUDA 2ITYA 4L9IA 3V5TA 4CCBA 4N70A 3FLNC 4ZOGA 2X4FA 2PU8A 4IXPA 4KS7A 3DJ7A 1OVEA 3RMFA 5CAOA 4G3FA 3A99A 4JBVA 4JS8A 4I1ZA 3ORMA 4PTCA 4ZLYA 5IQIA 2I0VA 3LFFA 4M13A 4QP2A 4PPAA 2XIYA 3HYHA 5DGZA 5IA1A 4MXZA 3RK5A 4QD6A 4M15A 4NM7A 4E4LA 3GVUA 2VTLA 2CKEA 5I9WA 1Y91A 2X2KA 5J5SA 3QHWA 4NWMA 1G8SA 1YWRA 2IG7A 3CE3A 3F3TA 5FQDC 3RAWA 2EU9A 5CSXA 4CFUA 3Q9WA 4GEOA 3FQSA 4FK3A 4USFA 3UJGA 1PXOA 1DM2A 4QYHA 4PWNA 5FBOA 1NVSA 4CQGA 2CNVA 1M2PA 2Z7LA 5JRQA 4JDHA 5A3XA 4P4CA 4FV1A 4XBRA 1LP4A 4FKOA 1YHSA 4BCMA 1OECA 3O96A 4IHPA 3IG7A 3OWJA 3FSFA 5E8XA 3WIGA 4RLLA 3A2CA 1P14A 1UVRA 4IAIA 2GU8A 5E1SA 3FBVA 5H8GA 4CTCA 4DAWA 5HLWA 3FYJX 4AE9A 4BDHA 4D4RA 4NEUA 3SG8A 3GQLA 3WE4A 4YR8A 4R3CA 2R3HA 2BPMA 2C3KA 4C58A 1YHVA 2J0MB 3AT4A 2A2AA 4JR3A 1FGKA 1H1PA 4XHKB 4XG6A 4EH9A 3F69A 4N6YA 4DEIA 5IKWA 4IX3A 4AOJA 2VTMA 4F1TA 2YCQA 4FV7A 3AC3A 3NYXA 2JDTA 2XK9A 2UVZA 4OTDA 4RVLA 1PXLA 4HYHA 4JQ8A 3CQUA 2C6LA 4ZP5A 4E6AA 3TM0A 2QHMA 2EB3A 3W2PA 4O7WA 4YPDA 5E7RA 3ZO4A 4C4EA 5A14A 5IH5A 3E63A 4BDAA 3DKFA 4NTTA 2VTQA 3GC7A 2X9EA 3I1AA 2JLDA 3I79A 5CEIA 1M52A 3ORLA 3PSCA 3IOPA 3MY1A 5KZ0A 2R3GA 4EH3A 2OGVA 4YTCA 5K0KA 2BKKA 2HW6A 3QGYA 3LCKA 2OKRA 3R8PA 5AP5A 2ZV7A 2OIDA 3TNWA 4WO5A 5BUEA 5I3RA 4HGLA 3R7OA 3OOMA 4EH2A 4FX3A 3DBQA 2GNJA 4PDOA 4RWLA 3BBWA 5J8IA 3HMIA 1BKXA 1FVVA 2GS2A 2WHBA 4EYMA 4QMWA 5A46A 2VTNA 4OT5A 4GVJA 4JL9A 3POZA 3PRIA 3W2OA 1MP8A 1MQ4A 4IZ7A 4ZS4A 3HMMA 2PSQA 5M4UA 3E5AA 2UZVA 5EOLA 3R7EA 4MXCA 2PVLA 4E5AX 3DZQA 3Q3BA 4IVDA 3MFUA 1GZOA 2XMYA 2UZLA 1OM1A 2HZ0A 3OCTA 4ASDA 1Q24A 2WD1A 3NIZA 4BDBA 1V0OA 2QOCA 3O7LD 4FG8A 4RX9A 1APME 2ZM3A 4UMRA 3FE3A 5L2TA 4CFFA 1OKYA 3FQHA 3OW3A 1XQZA 1UNGA 3BYMA 4L3PA 4RRVA 4ZLZA 2PTKA 4CKIA 4I5PA 1Y6BA 2G15A 5CS6A 5HCXA 4EJ7A 4XLVA 3JPVA 3DK3A 4LGHA 4MNEB 5DMZA 4YURA 3U6HA 4NCTC 4RIWA 4J98A 3ZRKA 5AUUA 3CEKA 3AC1A 2C5YA 1HCLA 3IECA 4QMXA 3W2CA 2ZDUA 4FL1A 4D28A 3DBCA 4M0ZA 3F6XA 2HWOA 3FPQA 1WBPA 4II5A 5E9EA 3ZO2A 2RFDA 2R3MA 3OCBA 1OL6A 4F63A 2R7BA 2WMVA 1YHWA 2X8DA 2OF4A 3Q52A 3ZUUA 3BLQA 4RJ8A 4EL9A 4Z16A 2VNYA 4FGRA 5AM6A 2ITWA 4AW1A 4AT3A 4GJ3A 5CXHA 2W5BA 3QBNA 4AX8A 3BCEA 2VWVA 3N4VA 3MYGA 4S34A 5EDPA 2BROA 1YRPA 4HNFA 4PDYA 3CR0A 2WMWA 4IJ9A 4ANOA 4BTMA 2WEIA 3PP0A 1KOBA 4MNFA 3H10A 3QYZA 3BEGA 4ASXA 4ZMEA 3C0HA 4MD9E 5ANDA 1H24A 3LLAA 5J1WA 2WTJA 5EHLA 5IPJA 2WELA 4D2PA 1Q41A 1BMKA 4E93A 2EUFB 2R5TA 4LV8A 5AX3A 4EH8A 5BMSA 4FTCA 1QCFA 3KN6A 5B7VA 2XNBA 4G5JA 4TWCA 1XKKA 5CNNA 3LXKA 4YHFA 3MVMA 3M2WA 4BI1A 2GTMA 3R8UA 4QMNA 3UQCA 2B9JA 3PZEA 3E7OA 4J8NA 4BVUA 1PMEA 5HKMA 4IW0A 3THBA 4HZSA 4CYIA 3OCSA 3FQEA 3G2FA 5I5ZA 2XK3A 2WQMA 2XNPA 3ELJA 3GU6A 4J7BA 5HO7A 4QYYA 3TXOA 5HBHA 5KMIA 3WYXA 1WCCA 3OD6X 5GZ8A 2Y7JA 3QCSA 2E9OA 3BHHA 1OBDA 2LGCA 1DAYA 2IWIA 5FEDA 2JKMA 2UZTA 2QO7A 1UA2A 3DA6A 4EOIA 2JAMA 5IZFA 1ZXEA 2GQRA 5AUXA 1CKIA 4BDJA 5DYJA 4N6ZA 1ZMWA 2YCRA 4QTAA 5A4LA 3VIDA 4EI4A 1PRYA 1UV5A 4QMSA 5EG3A 3NYOA 4L6QA 4HVGA 2BAKA 4JVGA 5CAVA 5D7VA 2GNGA 3KEXA 4G34A 3SXSA 2FGIA 3UP7A 1DI9A 2R3FA 5ACBC 4ZTMA 3COKA 3KRRA 4DEGA 3LFSA 4U0IA 2VTOA 3OG7A 4UWCA 2FH9A 3MA3A 3ODYX 3TG1A 2FSTX 3VBQA 4FOBA 1PHKA 3TV6A 4DFBA 2YWPA 2YN8A 3BKBA 4FSMA 3KRXA 3QX4A 2NP8A 4LFIA 4NIFB 5JSMA 4FTKA 4GUBA 5EI2A 4OBQA 1B39A 4ZTLA 5CEPA 5HTIA 4AE6A 1YDSE 5CY3A 3KRJA 3K3IA 5BVWA 5L4QA 4UEUA 1ZY5A 2Z8CA 2PWLA 2X7GA 3NNUA 3W8QA 4BHZA 4EQMA 4I3ZA 3V5LA 5EKNA 3FZOA 3GOPA 1QL6A 2YITA 3AT2A 3LVPA 3P7BA 4M69B 2CGVA 4E4XA 2QOOA 2B9FA 4GK2A 1PKDA 5IISA 5L6OA 2ETRA 4O7YA 5M44A 2F9GA 3C1XA 5CI6A 4AN2A 3EQRA 3CTJA 4H3QA 3QQKA 4IM2A 2C3LA 3VS2A 2XIZA 3VUKA 5LWMA 3LE6A 5IDNA 4K77A 3UMWA 4AACA 5AWMA 3R8ZA 4CMOA 5LVNA 5KBRA 4FEUA 1REKA 2X81A 3HUCA 5CAUA 1UWJA 2VX0A 2A1AB 3KMWA 3QCQA 4A9TA 4BWXA 3MESA 4E3CA 2E9VA 4DLJA 5CAPA 4IC7A 4M68A 3CJFA 5C26A 4BBMA 2ETMA 4DLIA 3MTFA 3LM0A 3A60A 3QUEA 2I0YA 4BFMA 3NUXA 4FV8A 3VUHA 3MVJA 3L8SA 4OBOA 3TCPA 4BWKA 4EK4A 3TIYA 3NEWA 4CEGA 2J9MA 4PY1A 3OEFX 3FC1X 4O1OA 4FTJA 4QMTA 4O38A 3QFVA 4D0XA 3L9MA 1XH7A 3VJNA 4BDKA 4FIIA 4D4YA 5FEQA 1P4FA 4B9DA 2BVAA 4IAAA 5CU6A 4NCTA 5CSHA 2YDIA 4CKJA 2NRYA 4IH8A 4GG7A 5IQAA 1R1WA 2GTNA 2QI8A 3FI3A 5HG5A 2CGWA 4U79A 4NM5A 4WKQA 5IQEA 3RZBA 3OP5A 4RFMA 3C0GA 4AN3A 3BU3A 4DH1A 3H30A 3LKMA 2XK7A 4ID7A 4F0FA 3HV6A 3VWAA 4DTAA 2J0IA 5CAQA 1U54B 5K5NA 3PIXA 1GIJA 5IEYA 4OW8A 2VU3A 3PXQA 3E8DA 3FZTA 4K0YA 4ZJJA 4EJNA 4C3RA 4TYHA 4CZTA 4L01A 4BL1A 5LCKA 4IWPA 3BHVA 3BLRA 3HX4A 4H05A 5EYDA 5DT4A 4QQCA 4ZTRA 4ZY5A 1Q8TA 5HLNA 1PKGA 3FY0A 3QU0A 4ALVA 4BCGA 4BTFA 3D14A 3EZRA 3GNIB 4Y73A 4DGLC 4F65A 2YJRA 3KVWA 2VN9A 3ZM4A 1H8FA 3RWPA 3QC4A 1SYKA 2CLXA 3HZTA 4GU9A 4I21A 5AUZA 4F7LA 3PLAE 3F2RA 4RJ3A 2ZAZA 3BU5A 4RIXA 2WMQA 3HV7A 1V0PA 3RPSA 1V0BA 4AAAA 4DH5A 3E87A 4FL3A 2VNWA 5HOAA 4Z9LA 4FV5A 4TRLA 4PPCA 2VO3A 4UZHA 2EB2A 2BZHB 5K5XA 3BELA 1YDRE 2YIRA 2GDOA 5HCYA 4ASZA 3BI6A 1OPLA 2VO0A 5FM2A 3ORNA 3A7FA 3KU2A 4MKCA 3V8SA 3LFNA 4XBUA 5BVEA 2JD5A 4P5QA 4FBXA 1UU9A 4FSYA 4W9WA 4ZZOA 4JR7A 2ITUA 1MQBA 5FM3A 3ZH8A 2CDZA 5J87A 3FXZA 4X2FA 4IJPA 2ZV9A 3ZFXA 3ODZX 3CLYA 3Q32A 4HVHA 3RWQA 4OTHA 2CN8A 1WAKA 1ZWSA 4AN9A 4PNKA 3A7GA 1PXIA 5FDPA 1SVEA 3QTZA 3NUPA 1ZMVA 1L3RE 4FT7A 4KWPA 2BDJA 3MH1A 3NR9A 2YM8A 5CU0A 4WBOA 4BR3A 2W1GA 3ZHPC 3R9DA 3EJ1A 3ZYAA 1M7NA 1PF8A 4LI5A 3SG9A 3ZBFA 5C8KA 3EL7A 4CSVA 4FTQA 4Q9SA 1KV2A 4YO4A 5LMBA 3D15A 1MUOA 2ZM1A 3AMYA 2XBJA 3UIBA 4L45A 3MB6A 5D9HA 1SNUA 1AGWA 3NUYA 2J50A 4KBKA 4TW9A 5E8YA 4LV5A 1ZARA 4KIOA 2HCKA 4X7QA 2QR8A 1H1SA 3EFJA 3BZ3A 3G5DA 3O17A 2BZIB 3ZSGA 4D1ZA 4AA5A 1CKPA 5J5TA 1ZY4A 1KSWA 2WMSA 2XBAA 3OUKA 4DG0E 3QTSA 3MH0A 2VAGA 1CSNA 3BLHA 3F3WA 4XNEA 3WZKA 3R1QA 1XR1A 3EN4A 3FAAA 4O6LA 3EZVA 4W4XA 4D2TA 3VBVA 4CQEA 5JT2A 3IGGA 3DU8A 3I81A 3DBFA 4QP8A 4IB3A 4IVAA 4UYNA 4DH8A 1FINA 2UVXA 3D5UA 3QLFA 2RFNA 5KO1A 2B7AA 2YDKA 4IFCA 3LW0A 4JIKA 4NM3A 5HG9A 3TIZA 4O6EA 4DHFA 5BVNA 3F3UA 4ZS0A 3VBTA 4ACCA 4UMQA 3V8WA 5AV1A 2OIBA 3A7HA 3RK7A 4L7SA 3M11A 5K0XA 5HIDA 3CD8A 3TNPC 4A9SA 3BWFA 4BY9E 3N9XA 2WTCA 4K11A 5H8BA 4GT4A 4LOPA 5ANJA 3SC1A 4MD7E 2A19B 2Y4PA 1DS5A 4UBAA 3PXRA 3UTOA 1OI9A 5HCZA 5CXZA 2X6DA 1S9JA 2UZBA 2XJ2A 4G1WA 3OBGA 4JBOA 5HIEA 4O0YA 4YZNA 2W06A 4Q2AA 2OLCA 2F7EE 3E8CA 3HEGA 4DFNA 2B53A 3VN9A 5M51A 4RQVA 3PA4A 3I0OA 4C4IA 2W5AA 2C6IA 3U4UA 5AV4A 5L2IA 2OFUA 4FKPA 4BKZA 3QGWA 4KIQA 5CU4A 2GNFA 1CDKA 3IO7A 3DJ5A 4I4FA 3QD4A 4IANA 1NA7A 4FT3A 4G16A 3LCDA 2OW3A 5HICA 1YWNA 3NAXA 1GY3A 3F3VA 3MI9A 4IX6A 4QYFA 5GJGA 4EK5A 3R1SA 5IH6A 3PE1A 4EZ3A 3NLBA 3LMGA 4GJ2A 4L00A 3TNIA 2FB8A 3R1NA 3IPHA 4CT2A 3H0YA 2BZJA 2RFEA 1H0VA 3PJ2A 4O0WA 3WIKA 4QPSA 4AGCA 5FUTA 5CASA 2X7FA 4GFOA 2O63A 4FT0A 4I6HA 4HVSA 3N4UA 3W33A 3WE8A 1Q3WA 1TQPA 3H9FA 3HV5A 3EFLA 3BYOA 4RLKA 3KB7A 3VS4A 5GIPE 5CYIA 2XCKA 2CCIA 2UVYA 4HCUA 4BTJA 3PTGA 5IEXA 4DT8A 2XF0A 3ENMA 4QP9A 3GC0A 2G2HA 2OSCA 1OKVA 2ZYBA 4QMYA 3SOCA 4MH7A 5G1XA 1RW8A 4E1ZA 4XP0A 3SA0A 4MF1A 3QA0A 3PIYA 2UW0A 2WPAA 5EFQA 1UNHA 2RIOA 1UU8A 4DFXE 2BIKB 2OWBA 1BL6A 1GJOA 3FI4A 2UW9A 4CMUA 3M42A 5FTGA 3ROYA 2G2IA 3T8OA 4L43A 4QYEA 5B0XA 4AZEA 3ORZA 4YLJA 5AR7A 4YLKA 4ANNA 3NW7A 2QCSA 3CQWA 2J90A 3COMA 3UGCA 4PDSA 4U6RA 4FV2A 5AP6A 3VNTA 5C4KA 2FO0A 4U80A 3TL8A 3TDVA 5DBXA 4S30A 4GV1A 3O2MA 3NRMA 3L8VA 3IOKA 4E26A 5M53A 3F5GA 4J53A 3V8TA 5EHYA 4I41A 3D5XA 2WMXA 2LAVA 3P08A 3VVHA 4AGDA 1OMWA 4D58A 5HHWA 4CRLA 2ZV8A 2RGPA 3ZONA 3BV2A 4HVIA 4BHNA 4M67A 2WGJA 4CFWA 4QP1A 4RX5A 4X3FB 4AFJA 1Q97A 4IDVA 3PVGA 4RFZA 2IVSA 1PYXA 3BV3A 5IMEA 3LM5A 3FEGA 3HMNA 3R02A 1JPAA 2YIYA 4KAOA 3ZSIA 4QQTA 4GKHA 5KMJA 3B8QA 2WIHA 5TF9A 4IZ5A 1KV1A 3IK3A 4XCUA 3VO3A 3ZDUA 5IMXA 1AD5A 2XK8A 3FLQA 3AC8A 5AA9A 3SXFA 5B2KA 4R78A 3C4CA 3OXTA 4RQKA 4ERWA 3LLTA 2YM3A 4C2VA 3R1YA 2XKCA 3C9WA 5KMLA 4KA3A 3VS3A 3BYUA 4HPUE 1B38A 2XNGA 2A4LA 3RZFA 3TUCA 4BCKA 3OF0A 4I0SA 3UO5A 4E6DA 2J5EA 1MRUA 4C61A 2QO9A 2ZB0A 2C6DA 2OZOA 2PUUA 2EWAA 2W4OA 2B52A 4M66A 3R7GA 2OO8X 4G6NA 4QQJA 5HD7A 3R8MA 3WZDA 4IX4A 1WVXA 1Z9XA 3ZU7A 3R6XA 4BRXA 1KWPA 4MQ2A 3R04A 2JIVA 3FZSA 3KMUA 3A7IA 4MHAA 4AZTA 4BN1A 4YJSA 3V01A 4O91A 4BCOA 1OPJA 4CG9A 2HY0A 3K54A 3QAME 3QQUA 4JXFA 4D5HA 2C0IA 4FUYA 2BHHA 5FG8A 5L3AA 4L52A 4MWIA 4UMUA 2H9VA 4ASEA 5TO8A 4GKIA 4FKIA 3QTQA 4O0VA 4V0GB 4ZZMA 4UMPA 4RSSA 1PMNA 5KMNA 1UU3A 3ZZEA 3OEZA 4ZTQA 3DBEA 4QYGA 4CV8A 4MK0A 4AOIA 3IDPA 4HGSA 1OKZA 3MN3A 4GCJA 3OVVA 3DQWA 3GFWA 3F5PA 1FGIA 1J7UA 5A6OA 4EUTA 5DH3A 3FSKA 3R21A 1VYWA 3EIDA 3R8VA 4C62A 4G6OA 4BB4A 3D5WA 4E73A 3RAKA 1M2RA 2GSFA 4NFNA 3UVRA 3DBDA 5HE3A 2DUVA 3RINA 4QTCA 2ZVAA 3D7TB 3TZ7A 3GP0A 5BVKA 1W84A 5HU3A 3I4BA 2GHGA 3H0ZA 3E3BX 4BBEA 2ZMCA 3RHXA 4CV9A 4ERKA 4YBJA 3P78A 4R5YA 4EONA 2PUPA 1X8BA 5HEZA 4I23A 3G0FA 4KKHA 3V5PA 1QMZA 3AGLA 4EOKA 3ACKA 2J6MA 5HO6A 5LQFA 4HW7A 4EC8A 4D1XA 4GYGA 5CNOA 3E62A 4EOMA 3QA8A 4W4WA 1OPKA 2B9IA 3LAUA 4G9RA 4TYEA 2F7ZE 1URWA 3B8RA 2UZOA 4PTEA 2Z7SA 4OTRA 4QPMA 4CG8A 4QTBA 4IIRA 3D5VA 5M4CA 3EFWA 2B9HA 1M2QA 2BRNA 2UZDA 3ZO1A 4FE2A 3MY0A 3FC2A 1Q8WA 2YIWA 1WBOA 3RPYA 3ZSHA 4GL9A 4GRBA 5AR2A 3ZUTA 3CS9A 1AQ1A 2G2FA 4JX7A 3R63A 3MIYA 4LGGA 3TZ8A 3IW5A 2CJMA 2DS1A 3L9NA 4E4MA 4MXXA 3SW7A 4DE4A 4U5JA 4ACMA 4L7FA 1XH6A 2QKRA 3ERKA 3PWYA 4ENXA 3VUMA 2I7QA 1YXVA 2WTVA 4PL3A 2VWUA 4CRSA 4UALA 1A9UA 4BTKA 4ANMA 3QKLA 4ONAA 1T45A 2OBJA 4DTKA 4O22A 3UO4A 5BVDA 2WTKC 3KXZA 3R7UA 4DGGA 4QP3A 2H34A 3OW4A 4FNXA 4O0UA 4TZRA 4UXLA 5D7AA 4NKSA 4G6LA 3HRFA 3RPVA 2C69A 4FTIA 4ACHA 4DGOA 3HAVA 2IZRA 3FDNA 3GEQA 4O2PA 4UX9A 5LMKA 4WOVA 3R2YA 4CVAA 5L2SA 2Q83A 2OJJA 2X1NA 2WB8A 5AUYA 3K5VA 2ACXA 5K9IA 3QQHA 5CQWA 2R4BA 2YZAA 3P7AA 3ATSA 4O0XA 5KKRB 2RF9A 2VZ6A 2GQGA 3WI6A 5E8WA 5DVRA 4YP8A 3U9NA 4F7NA 5HX8A 3GCUA 3CY3A 3FXXA 2OF2A 2Z02A 4K9YA 2J0JA 4GS6A 2YZLA 3MIAA 3NVMB 3PSBA 4X0MA 1CM8A 4IM3A 2X8IA 3QRUA 3GU4A 1W83A 2QOKA 3IW6A 4UMTA 5H3QA 5AMNA 4C59A 3PRFA 4JDJA 5BYYA 3VRYA 5JH6A 4FKVA 1UKIA 3OT3A 4LMNA 3NWWA 3ZO3A 5F4NA 5ANIA 4O81A 1OUKA 1WBTA 2CKOA 1JSVA 4ITHA 4FKQA 3TWJA 5T6KA 2XEYA 2QKWB 3JXWA 4C7TA 3OXZA 1YXXA 3QZIA 4Y8DA 3JVSA 3UP2A 3KVXA 4CLIA 2O5KA 4CNHA 4J1RA 3KGAA 3NAYA 4KIPA 3JVRA 5KHWA 4FSNA 3LJ1A 4JG7A 3EYHA 2HZNA 4KIKA 1PXNA 4JLCA 4WHZA 2QQ7A 2C5XA 4KD1A 2CSNA 2XJ0A 4FT9A 5IUIA 4AGUA 5JMSA 2HXLA 3EL8A 1KE7A 5AAFA 5D41A 3NS9A 3VAPA 4BIDA 3LXPA 2VD5A 4RC2A 2E9NA 4N57A 1JWHA 2Y0AA 3NSZA 5EW8A 1XH9A 3NUAA 1H26A 4XV1A 4DFZE 4BICA 3VS0A 2CNQA 4NW5A 4WNPA 2OK1A 5CENA 5D11A 3ZRLA 2QG7A 5EI6A 1SM2A 4R8QA 3DB6A 2GS7A 3EMGA 4V04A 2VX3A 3KFAA 3DXNA 4FZ6A 3UMXA 4BCIA 3EH9A 3SXRA 2P33A 2QG5A 2V7AA 2VTTA 3DTCA 4RVMA 3C4EA 3VHEA 2HK5A 1I44A 3I7CA 4KNBA 5D1JA 1K9AA 4GT3A 3EQGA 3CXWA 3HV4A 3D4QA 5JK3A 3ALNA 3UG1A 5IQHA 4E6QA 1Y6AA 3SOAA 4AZVA 4FSWA 2IW6A 3EQHA 2CGUA 3PVBA 4GH2A 2WMTA 1YXTA 2FSLX 2Z7RA 1M14A 3BQRA 3F2AA 3G33A 4FNWA 5HE0A 3AMBA 4JQEA 3QQFA 4TYGA 5IUHA 2QVSE 2W0JA 3A7JA 2QOIA 3R73A 4FKRA 3EKKA 4YJUA 4O0TA 3MFRA 2REIA 1PMVA 2W4JA 4U3YA 1KE5A 3UZRA 5EM7A 4B7TA 4XEYA 3ROCA 3IONA 3FMLA 5EI8A 4TNDA 5M06A 2HOGA 2J7TA 2BMCA 4IQ6A 3QTWA 5EM8A 4KS8A 3MDYA 4B8MA 4DCAA 5IF1A 2F49A 3T9TA 1H1QA 4G3GA 1IA8A 2WXVA 3TZ9A 2W9FB 3C5IA 3AD4A 4X6RA 3A62A 3Q6WA 2JKQA 2VWYA 4FZFB 1HCKA 1OKWA 4BCHA 4PF4A 5AR5A 3ZEWA 4FZAB 1H00A 4AF3A 1OGUA 1FPUA 3O71A 4YZCA 5JEBA 4FK6A 4EOPA 2P2IA 2YFXA 4KRDA 2OH4A 5E90A 4RJ6A 4H36A 3QCXA 1PXMA 4NKAA 4AZFA 1YXUA 4XV2A 4W4YA 4TYJA 4UYAA 4CZYB 4GSBA 4QNYA 3C4ZA 5EM6A 2X7OA 5L2QA 3ULIA 3P86A 3PPZA 5H8EA 4EQUA 4AT5A 4YZMA 3GU7A 3MS9A 3VW8A 1P2AA 3RKBA 2R3QA 5HU9A 2QU6A 3R71A 4AA4A 3GU5A 4AXAA 1NW1A 2Z2WA 4DINA 2ITZA 5GZ9A 4QTEA 3BX5A 5EDQA 5C27A 3LQ8A 3QHRA 2HXQA 3HAMA 5HNBA 4EH4A 5JFSA 3WF5A 3NNVA 1SVHA 4RZVA 1YXSA 2C5OA 4C37A 4GW8A 1H0WA 5BUJA 1PW2A 4IE9A 5HZNA 2YEXA 1IR3A 4F08A 2CN5A 4LMUA 1M7QA 4ZSJA 2G01A 5CEKA 5HTCA 4TYHB 1JOWB 5I9VA 3SAYA 4U9AA 4MWHA 4D55A 3MW1A 5CWZA 3W2QA 4RT7A 4C33A 4YTFA 5LVOA 3P1AA 3HLLA 3CCNA 5AR4A 3BYVA 5C1QB 2J5FA 4N4SA 5FLFA 2IZTA 2R3NA 4H58A 5J1VA 5DLSA 2IVUA 3SLSA 4YSMA 3O51A 2YCFA 3A8WA 2PE2A 3FMMA 4FIGA 4F4PA 4Z7HA 5E8SA 4ZY6A 5I9YA 5CZHA 5DR2A 5IA5A 1YOJA 2E2BA 4BIBA 4EYJA 1SVGA 1YKRA 2R2PA 2IN6A 1JQHA 4RIXB 3VQHA 3F9NA 4R3RA 1YI6A 1T46A 2IZUA 5CU3A 5A54A 2RSVA 5HO8A 2FYSA 3HDMA 3QXPA 5LVLA 2RG5A 3VULA 4USDA 4C3FA 5JFVA 3LMHA 2A0CX 3CGOA 5CEMA 3FKOA 2GQSA 2GNLA 3Q04A 3W32A 3ZRMA 4HCVA 4BZDA 3NCZA 4TYIA 3CPCA 4D9UA 5CVGA 2JITA 3HVCA 3VS6A 4YUQA 1OL5A 3CKWA 3FKNA 3IGOA 4EC9A 3WOWA 3DLSA 4XG8A 3SVVA 3QTUA 4IMYA 4RIYB 5EQYA 5CEQA 5JGBA 5HLPA 3FLYA 5C01A 5BX0A 3GUBA 1FOTA 5DNRA 4EHEA 3AXWA 5M09A 1XH4A 1R3CA 4EBWA 4O7LA 3Q4ZA 4JBQA 4MX9A 3KULB 3UE4A 4A9YA 5IQCA 2WTIA 1Q4LA 3LHJA 2GCDA 2Q0NA 3O0GA 2XEZA 1QPDA 3PY1A 5A4CA 2HIWA 3HV3A 3R7IA 4IZAA 1FMOE 3ZLXA 4OTIA 2VWIA 2WFYA 4X2JA 3ZFMA 4LG4A 1BLXA 1YOLA 2XUUA 3DKCA 1BYGA 5LWNA 3K2LA 3Q5ZA 4HPTE 3EN7A 5DI1A 1ERKA 3RBWA 1Q3DA 4A7CA 3AT3A 4EQCA 2G9XA 2PZRA 1WVWA 2VGOA 4FUXA 1J1CA 4FGBA 1G8AA 5E92A 4RC3A 2WO6A 3S00A 2RL5A 3R2BA 3PXZA 4EK8A 3SGCA 3PWDA 3KA0A 3CKXA 4M97A 5CX9A 4C4FA 3R8LA 3MJ1A 1Q8ZA 2YACA 3FKLA 1JSTA 4LRKA 3UNZA 1DAWA 4ZTHA 5AUWA 2WTDA 3LJ2A 4RWIA 3UC4A 4ZLOA 5CLPA 1WBNA 4FTNA 2W5HA 3MJ2A 2VUWA 4O1PA 5KMOA 3ZZWA 3Q5IA 4EUUA 4F1MA 2BHEA 3KXMA 2XZSA 1E1XA 4N0SA 4QOXA 3HA6A 4YTIA 3UPXA 2C1AA 5L8JA 3KKVA 4GK3A 4FTAA 4HYSA 3VBXA 4A9RA 1E1VA 1IEPA 3AD6A 4XUFA 3Q4TA 3QZGA 3HMOA 5DRDA 2Y4IB 3MH2A 4W4VA 3GENA 2C68A 5HE1A 5DWRA 3VQUA 4ZK5A 2C6OA 3MFSA 2XYUA
chains in the Genus database with same CATH superfamily
2C3IB 2H96A 2PVRA 2O65A 2XIRA 5AR3A 3NUUA 3WZEA 2AQXA 3F82A 3O5AA 4WSQA 2PVYA 3F5XA 3G51A 3IQ7A 2C6KA 4PL4A 2VRXA 4FZ7A 3N4TA 2CMWA 2FA2A 3F5UA 5GHVA 5H9BA 4PTGA 5FBNC 2C47A 4BGQA 4XJ0A 2PUNA 3WYYA 1W0XC 2ZJWA 4L3LA 4XMOA 3FZ1A 3CQEA 2PVJA 3NW6A 3PVWA 3OY3A 4L67A 5EHOA 4FV6A 3W1FA 2SRCA 1ZRZA 4R6VA 2BR1A 4WIHA 5EYKA 3BWJA 1BI8A 4GFGA 2XP2A 4BKJA 2QOFA 3PJ8A 4C3PA 4LQMA 1W98A 2J51A 2ITOA 5JZNA 4PMPA 3LXNA 3QQJA 3G6GA 5E8UA 5B2LA 3U4WA 4B4LA 3G90X 4DH3A 5CSPA 2JDOA 3FMDA 1TKIA 4H1MA 2CLQA 1O6YA 4OTQA 4JIAA 2B4SB 4FR4A 3G6HA 2BDFA 3LFQA 1U54A 4FKJA 2IW8A 5ACKA 3DKOA 3PXYA 3VBYA 3AC5A 3P23A 2IPXA 5E91A 1P4OA 3PG3A 4I4EA 2OXXA 5TOZA 4XS2A 5J9LA 4UV0A 3DAJA 5K4JA 3KRLA 1VEBA 5JGAA 4EKKA 4BI2A 4FICA 4JI9A 2BDWA 1ZAOA 4O7ZA 3RJCA 3PSDA 4ARKA 2F4JA 4AS0A 5DFPA 4AP7A 4HZRA 4L44A 3VUTA 4AA0A 3NVKI 3QKKA 4F9AA 3KXHA 3OT8A 4F9CA 1ST4A 4UXQA 3QLGA 1NT2A 3R9RA 4B99A 4L53A 5DIAA 3QZFA 1J1BA 3TV7A 2O3PA 3F2NA 1YI4A 4TTHB 3W10A 3GFEA 4RGJA 2JDVA 5HVJA 5DG5A 3VW6A 5IA4A 3L9LA 4IWOA 4RA4A 3PPKA 4ZJVA 5EM5A 1PXPA 3HMPA 3I7BA 4NSTA 3MVLA 3C5UA 4NK9A 3UVPA 2HAKA 2YJSA 3QCYA 4EZ5A 2JKOA 4RC4A 3ZC6A 1M17A 2WNTA 4H1JA 4FKWA 4RFYA 4X2NA 2VTRA 4WA9A 3BGQA 3CD3A 3DXQA 3DV3A 4MTAA 4D4SA 4PMMA 4G5PA 5F20A 2XCHA 4YLLA 4TPTA 4EOLA 3KN5A 1R78A 2WKMA 2C6TA 2XNOA 4RZWA 3RCJA 4FV9A 4BCFA 3O8PA 4YPSA 4BGGA 4F0IA 3MFTA 3TV4A 4IBMA 1YI3A 3P0MA 4S32A 3FMEA 3G15A 4OTWA 3R9HA 3L1SA 3S4QA 5ITAA 3MTLA 4O2ZA 5M55A 1S9IA 2DWBA 5LOHA 1IRKA 4Z55A 4BBFA 2XS0A 1WBVA 2V0DA 3HRBA 4NM0A 5I9ZA 3NW5A 1U4DA 4BIEA 1XO2B 2QOBA 3NNXA 5ICPA 2PVKA 3UOLA 2XK6A 1ZYJA 2JIUA 2WU7A 4M84A 3WBLA 4C35A 4BCNA 3GQIA 4IVBA 3JS2A 2ZB1A 1YQJA 3O50A 3F7WA 2PHKA 3DCVA 4KSQA 4QMZA 3JYAA 3SHEA 5EQPA 1FMKA 3NCGA 3C13A 3TNQB 3HDNA 2QC6A 3E7VA 2JDRA 2BFXA 4JG8A 3VUGA 5IQBA 4GUEA 4MXOA 5M4FA 1Q61A 3A8XA 4G31A 4Y85A 2WQNA 3O23A 2RG6A 4FKTA 4Y46A 4U8ZA 1E9HA 5CF8A 4AXFA 3RTPA 4FTUA 3RPRA 2EVAA 2C0TA 2UW3A 4X2GA 3TJDA 4DEEA 4IB1A 2UZWE 3V5QA 2B1PA 4APCA 2JC6A 5HORA 3U54A 4H3BA 3VJOA 2QODA 2GNHA 4AU8A 5F95A 4ALUA 3S2PA 3ATTA 3EQBA 3BL9A 4NYEA 2B0QA 2YISA 5AP0A 4Z3VA 2EXCX 4TN6A 1IA9A 3I0QA 3IDCA 3KREA 2FSMX 3U6JA 2CKQA 2I1MA 1ND4A 2VWWA 2WOTA 3QRJA 4YZBA 5KMKA 3SW4A 4EHZA 3DS6A 3R22A 4BJJB 3QTXA 4GU6A 3GU8A 4I6QA 1O6LA 4FSZA 2C30A 4IB5A 4PV0A 2RKUA 5DEWA 3W18A 3IW7A 3PJ1A 5M56A 4Y83A 2BAQA 1RDQE 1WZYA 2C3JA 2ITPA 2VGPA 2W96B 4PQNA 4U43A 4ZXTA 2WMUA 2XKEA 3BIZA 5CTPA 3KK8A 5LMKC 2ERZE 3PE2A 4G3EA 5F1ZA 3CP9A 4XG3A 3PY3A 3JR1A 2HY81 4YHTA 3DLZA 4WD5A 3RNIA 4WBBB 4EHGA 2XNMA 1REJA 5CANA 1UNLA 2WU6A 4AZSA 5LXMA 3EQFA 1OBGA 3VRZA 3OZ6A 5I9XA 3P4KA 5D12A 3ZOSA 3RK9A 2UW8A 2GHLA 2WQEA 2VTSA 4FNYA 5AP4A 1WBSA 5IEVA 3T3UA 2C5VA 5CVFA 4AWIA 4M0YA 3ID6C 4YZ9A 1TVOA 4EKLA 1UU7A 1ZZ2A 2AC5A 2X0OA 3KXGA 4ZSEA 3NZ0A 2R0UA 1JSUA 3F3ZA 5AV2A 5C9CA 3SRVA 4WUNA 4BGHA 4UN0C 3OWLA 2Z7QA 3ET7A 5LJJA 2OFVA 4A4XA 4L3JA 4U40A 2QHNA 2R3IA 4O4BB 4DFYA 1XWSA 3OMVA 5FTQA 1L8TA 4NW6A 3PFYA 4DEBA 2YA9A 5AA8A 3TKHA 2DQ7X 3BBTB 4I0TA 3UIXA 4EWQA 3TN8A 2XH5A 3POOA 4YC8A 5KBQA 4K2RA 4KBCA 4QMVA 1JKKA 2QONA 1OIRA 3Q60A 5M07A 3H3CA 1XJDA 3MPMA 3FLZA 4PX6A 5DOSA 3ZLSA 3COIA 4U41A 3DXPA 1BI7A 5E1EA 4QMUA 3ZCLA 4RWKA 2XB7A 3PXKA 3KRWA 5DN3A 4TT7A 1FVRA 3OS3A 4LUEA 2F57A 4V01A 2C0OA 3V5WA 4KSPA 2XK4A 4LOQA 4AFEA 2JIIA 4XYFA 4DYMA 3ANRA 3ZEPA 4F70A 3QUDA 4O7RA 3CBLA 3U55A 2V55A 3GGFA 3QZHA 1XBCA 4R7HA 4MBLA 3AC2A 4OUCA 4PP7A 5AM7A 3OOGA 3DAKA 3TUDA 2BKZA 1ATPE 3NMUF 4E5WA 1Y8GA 3BYSA 1ZYDA 3PPJA 5AV0A 3C51A 3Q9ZA 1BX6A 4I22A 4O7SA 3A4OX 2QOQA 3LMIA 3DFCB 4TY1A 4C4GA 4JOAA 1H08A 3C50A 3RALA 3TKIA 4YTHA 1IAHA 1YVJA 4QMPA 5FTOA 3L9PA 2PUIA 1OL7A 3NGAA 2UW7A 2EXEA 4PP9A 3I6UA 5CSVA 5CZIA 4AQCA 3ML1A 2YWVA 4O84A 5JKGA 3S0OA 2Y9QA 5BNJA 1H25A 1I09A 3DB8A 1FVTA 1H1WA 3A61A 2PPQA 4M12A 2OZAA 4QTDA 4EOSA 5TE0A 2KTYA 4D9TA 4D4VA 4XRJA 5EDRA 4AW5A 2XRWA 3FXWA 2VO6A 3KY2A 3V5JA 1G3NA 1QPJA 1F3MC 2C5NA 4DC2A 3ZMMA 4ALWA 5KHXA 4IEBA 4QNAA 4CTBA 3DY7A 4FTTA 4O82A 2H6DA 1PY5A 4MYGA 4KB8A 3HA8A 3QRTA 4XP2A 1Q8UA 4DBXA 4ANQA 3FHRA 3PVUA 3KF7A 4YJOA 3U9CA 4EH5A 3AKLA 2W05A 3O8TA 4RWJA 2DYLA 3GCSA 3P7CA 3V3VA 1NY3A 3DFAA 4D2VA 4BCQA 2YIXA 3BRBA 4ZJIA 2NO3A 2JBOA 1UKHA 2R3OA 2XRUA 4AT4A 3LPBA 5JFWA 1A48A 4DDIA 1GNGA 4R5SA 3K3JA 4DEDA 4NTSA 2PYWA 4FKLA 3QD0A 4J97A 2PE1A 3G0EA 4K1BA 4QO9A 3RNYA 3QQLA 4I24A 1U5QA 3WZJA 3I60A 3QRKA 4BI0A 1NVQA 4F6WA 4KIKB 2JFMA 4FSTA 4F6SA 1Y8YA 1W2DA 3Q2JA 3ALOA 4FA2A 2XJ1A 4FKUA 2WEVA 3WF6A 4A06A 1TQMA 2VX1A 3EB0A 3PJCA 2YM5A 1J7IA 1WMKA 2O8YA 2XVDA 3CIKA 2GFCA 4GYIA 4HYIA 4EHVA 3QALE 3C4XA 2X6EA 3JY9A 2O0UA 3QTIA 4ZMFA 3NDMA 4F6UA 2JAVA 3CTQA 4CKRA 4C02A 3F7ZA 2I0HA 5F94A 1ST0A 3DZOA 4FMQA 4ITJA 1W2CA 3FUPA 4BYIA 5DR6A 2UZEA 3AC4A 5AIRA 4IAYA 4O21A 4NL0A 4DITA 4Q5EA 4KABA 4RPVA 3MSSA 5A6NA 4O0SA 1OUYA 3FL4A 2XM9A 3NPCA 4I0RA 2ONLA 2V62A 3HGKA 3VS1A 4V0GA 3PLSA 4RIWB 3CTHA 5AV3A 4AGWA 4JJRA 1OB3A 3DQXA 4LRJA 4CLJA 4K6ZA 3ANQA 2BAJA 2WQBA 1JBPE 4BCJA 3B2TA 5HVYA 3O8UA 4E4NA 4GFMA 2GMXA 4CT1A 3BE2A 4FT5A 4NFMA 4EH6A 2W7XA 2ZV2A 3FY2A 3KXXA 5IA3A 2GS6A 3TNHA 4XV9A 2OJIA 5HNIX 5FD2A 3PG1A 4U45A 4FSUA 3LFBA 5J9ZA 3VC4A 4JMQA 4DBNA 3LCOA 2J0KA 3D7TA 1O6KA 4EORA 4CFMA 1K3AA 1KE9A 3I6WA 1H4LA 2FSOX 4D2SA 3E8NA 5E4HA 2X9FA 4HGTA 4FTRA 4IFGA 4U42A 5EOBA 5BVOA 3W0QA 4I6BA 2VTHA 4F99A 2JKKA 1B6CB 5HIBA 3HKOA 4IWDA 4EH7A 4O4EA 2YM4A 3MH3A 4YNOA 3EFKA 3L8XA 2GHMA 4IWQA 1PXJA 3MGYA 4J52A 2BCJA 4OAUC 3D83A 3QKMA 3D7ZA 5I4NA 3GB2A 1XBAA 4XV3A 4XP3A 3OROA 3DK7A 2PZIA 3BHTA 4HCTA 4CFXA 3VHKA 3W0PA 4PUZA 3MY5A 4PL5A 3W8LA 4DEHA 4BDDA 4DA5A 3SKCA 3PP1A 3TKUA 4G17A 5L8LA 4ACGA 5LARA 5M4IA 5DT3A 1MRVA 2YDJA 3HP2A 4Z7GA 4JX3A 5CSWA 4IC8A 4ANLA 3QRIA 5JQ8A 2WTKB 2HWPA 5JFXA 4E5BA 3GXLA 3QUPA 3PY0A 1W7HA 4RMZA 5LMAA 2XYNA 4AUAA 2PVHA 3QC9A 1P5EA 1ZOHA 5GZAA 4DN5A 3DT1A 4TWPA 3C4WA 4YGAA 3QD2B 3RCDA 3MWUA 2X0GA 3PZHA 3WZUA 2GNIA 1U59A 3EKNA 3V51A 5AIKA 4S2ZA 4YHJA 2HZIA 4MVFA 4O7VA 4EOOA 4YJQA 3R0TA 4S33A 3HRCA 4WRSA 5CU2A 4ACDA 2QR7A 4XG4A 1ZYCA 3CPBA 2Y6MA 4XG2A 4FNZA 4FKSA 3ZS5A 3OTUA 4CXAA 2QOHA 1STCE 2QU5A 2YM7A 4FTOA 4O86A 3U8WA 3GI3A 3OWPA 1YDTE 5FEEA 5J9YA 2ITXA 2W17A 3S3IA 5J7BA 3BHYA 4WRGA 3LCTA 4S31A 2YABA 3MA6A 2ZDTA 3ORKA 4MBIA 2ESMA 4FI1A 4A07A 2VV9A 3UDBA 5HG8A 4MUQA 1NVRA 3MB7A 3Q9XA 4LM5A 4YJTA 4BKYA 3F66A 2YIQA 4U3ZA 3UOKA 3GT8A 5FXQA 3SX9A 4U97A 5AR8A 4G9CA 1YW2A 4HOKA 4EOQA 5I0BA 3GCQA 1VYZA 4QMOA 3TTIA 4LRMA 4LOOA 4ANSA 1JKLA 3W2RA 1QPEA 3IS5A 1ZLTA 5EW9A 1JAMA 4FIHA 4J99A 3SDJA 5F9EA 2JDSA 3ZUVA 3ZM9A 3IW8A 4NZWB 4KKGA 3U51A 5AX9A 2C6EA 3GCPA 4MXYA 4JDIA 2UZUE 3B2WA 5HQ0A 4E8AA 5EYCA 4J71A 4HJOA 5J95A 5T68A 1G5SA 2XIXA 3EYGA 4ZEGA 4DEAA 4FEVA 3VUDA 4GIIA 5D10A 4G3CA 3NYNA 5GJDA 3RPOA 2W99B 4M3QA 4FOCA 5ETFA 4OT6A 5AP1A 5HX6A 4MCVA 5IUGA 4FG7A 1URCA 3DNEA 2W1FA 1OITA 1H07A 3IW4A 4C57A 4IB0A 3NUSA 2NRUA 1Q99A 2PMLX 4QDEA 4KINA 4MNEA 4TNBA 5C8MA 2YERA 4XOYA 4XOZA 4DH7A 4FF8A 2R3RA 4X2KA 4YBKA 3FZPA 3M1SA 3VF9A 2HW7A 3ULZA 4CD0A 2WZJA 1OL2A 2XKDA 4F9WA 3DTWA 4O0RA 2C4GA 3NYVA 2R3KA 3DNDA 4XLIA 1F0QA 4JDKA 5IA2A 5FXRA 4JQ7A 2QOLA 2V22A 4O4DA 4FG9A 5CI7A 1LEWA 3TTJA 2B54A 2BIYA 3BU6A 4TWNA 2PULA 2ITQA 4FVRA 4PDPA 1OIQA 1SZMA 3QQGA 1JKTA 4X3JA 5L8KA 5BQ0A 2B55A 4ZSGA 3R9NA 1KOAA 2W1EA 4FVPA 4WG3A 2ZMDA 1ZZLA 4ZY4A 3HECA 3Q9YA 5TKDA 1R0PA 5KUPA 4WUAA 3P5KA 4DFUA 2VWZA 1OL1A 1KE8A 1LEZA 1NXKA 5J7HA 3F61A 2UW5A 5ANKA 5HNGA 2Q0BA 2YCSA 5J79A 4NU1A 3E93A 3OTVA 3R28A 3AD5A 3DK6A 2AYPA 3EHAA 5G6VA 4IACA 4Y95A 1V1KA 2CGXA 4WG4A 4D0WA 4FYOA 2XAOA 3LQ3A 1SMHA 2ZFYA 2EXMA 3Q6UA 4OTFA 1U5RA 5E8ZA 2QURA 2VTAA 1H01A 3V6SA 1GAGA 4DG2E 4F7SA 1RE8A 4CCUA 5IQDA 4HGEA 4P2KA 3G9NA 5A4QA 4YJVA 3OUNB 4KBAA 4PMTA 1FBNA 2BZKB 2AEGA 3BGZA 3W2SA 3KCKA 4HNIA 3D2KA 4H3PA 2E9PA 3AMAA 2V7OA 3EQPA 3O7LB 4FV4A 4OTPA 4BF2A 3UDZA 3CY2A 1U46A 2VWBA 2C6MA 5I3OA 1UWHA 4QMLA 2Y4IC 5FWKK 4JBPA 4KUJA 4OGRA 4L8MA 4YC3A 3BGPA 5IG1A 5K4IA 2I6LA 2R0IA 5LCJA 4C4HA 3BE9A 3COHA 3LJ0A 4Y72A 2ITNA 5FXSA 3U6IA 4F09A 2R3PA 3P9JA 3T3VA 3KC3A 3A4PA 4C38A 1LPUA 3FLSA 4I94A 4MXAA 5EK7A 2PZ5A 4R1VA 2PMOX 2PMNX 2F2UA 2OJFE 5C03A 3Q96A 4NJDA 2JEDA 3EN9A 2IW9A 2P3GX 3R7YA 5IU2A 3PDTA 1F5QA 5AUVA 3VF8A 3UNJA 5BVFA 2NNWB 3DJ6A 3FMJA 4NH1A 2CCHA 2X4ZA 3FMNA 5KE0A 3IKAA 2Y8OA 4CFNA 4I5MA 3CGFA 3WF7A 2YM6A 4KRCA 3DPKA 3N51A 1WVYA 4I5CA 5HVKA 3ZFYA 4FKGA 4R7IA 1GIHA 4F0GA 5EYMA 4DTBA 3QWKA 4NIFA 5IQGA 3WF9A 4XX9A 3Q4CA 5AAGA 3ZDIA 2X8EA 3ORXA 4RJ4A 2UW6A 1H1RA 2CHLA 2PZPA 4OR5A 5EH0A 3UVQA 4OAVB 3TT0A 5KX8A 1O9UA 3E92A 4U7ZA 2R7IA 5HBJA 2X0QA 3UQGA 1OZ1A 3FWQA 1IG1A 2IVTA 2Y6OA 4M69A 5TT7A 3RP9A 3TEIA 3E64A 4K8AA 3UPZA 3ORTA 4JNWA 4ZSLA 3WILA 3E3PA 3ACJA 4IZYA 4X21A 4E7WA 4ZTNA 2R9SA 2IO6A 3FL5A 4YNEA 4ZTSA 4Q5HA 4L46A 1K2PA 4TKSA 3EQIA 5ANEA 4FV3A 4I92A 4ENYA 5AP3A 3UQFA 4FYNA 1PYEA 4PPBA 3PXFA 1Q5KA 4KKEA 4Y5QA 4GG5A 3W0RA 4OLIA 5A4EA 3II5A 2VTJA 3E8EA 4DF3A 2XM8A 4H39A 2AUHA 3HL7A 5ETAA 5AJQA 3FPMA 3UNKA 4EK6A 4QT1A 4TL0A 1OIUA 4E20A 3OFMA 4E6CA 1Q8YA 3I5ZA 4B6LA 1XH8A 2KULA 4ITIA 2BRBA 3QX2A 4I93A 4YC6A 4WG5A 5EW3A 3UIMA 3ZLYA 3VONA 4EZ7A 1J3HA 5FDXA 5LVPA 2W1ZA 4EK3A 4ZSAA 4P5ZA 3T9IA 2J2IB 2JFLA 3PFQA 4HVDA 3OWKA 3ZXTA 4YMJA 2WIPA 5IH4A 4GT5A 3ZTXA 2X39A 3H4JA 1VJYA 4LGDA 4RIYA 5KMMA 4WSYA 5AADA 5DR9A 3UODA 4BZOA 4D1SA 3R30A 4J95A 2P4IA 5E8TA 4C2WA 3LFEA 5DA3A 1GZ8A 2P2HA 2CPKE 5CQUA 3ZBXA 3RHKA 2PY3A 3HUBA 4A4OA 1Y57A 2XA4A 3KULA 4FIFA 4MEDA 4APPA 4QEBA 2IEWA 2OJGA 2ZM4A 3AG9A 3OC1A 5HESA 2HENA 1WBWA 3PA3A 1GOLA 3Q53A 5DEYA 3OCGA 2I0EA 3EQDA 5AAEA 5IQFA 3L8PA 1GZKA 1W8CA 2VO7A 1ZYLA 4D2WA 4YU2A 5BV3A 3LCSA 3OBJA 3LIJA 1W82A 5BMMA 4DG3E 3TI1A 2OIQA 3V6RA 1IASA 3KL8A 3UBDA 3C4FA 5ANGA 3S95A 3QWJA 3AOXA 5EKOA 3UYSA 3FYKX 3H9OA 1HOWA 2OXDA 4FV0A 4PNIA 3RI1A 3KMMA 2YLFA 4EOJA 2BRMA 2PE0A 1A06A 3GCVA 2JBPA 2WAJA 3EQCA 3ORIA 5FRIA 4RVTA 3PIZA 3WF8A 1BL7A 2W4KA 3FHIA 3SD0A 3HNGA 3GOKA 5H2UA 4DGNA 4JT3A 4ZZNA 2VWXA 1VR2A 4CYJA 4C0TA 5CEOA 1QPCA 3DAEA 5ETCA 5EQEA 3ENHA 3VUIA 3LFDA 3LZBA 3R00A 3QYWA 1CKJA 1Z5MA 2JGZA 5AP7A 4AXEA 3ZC5A 4GIHA 1RJBA 4YZDA 1GZNA 2ERKA 3GBZA 3DOGA 4GVAA 1KUTA 5M08A 3FI8A 5AP2A 4JRVA 3FMHA 3LOKA 3DKGA 3LFCA 5DHJA 4D5KA 3AQVA 3FV8A 4WT6A 3R83A 4IX5A 4RG0A 4JG6A 3MPAA 1Q62A 2HZ4A 3ZLWA 3D9VA 4I5HA 3TACA 3UOJA 1XBBA 3UZTA 4P7EA 5B2MA 5CF6A 1OIYA 3P79A 4QQ5A 4ZIMA 4WNKA 2QO2A 4BDEA 2WOUA 4O96A 2OI4X 3BPRA 4Y5HA 2OXYA 4EEVA 3EN5A 3MBLA 3Q4UA 2IZSA 4F78A 3REPA 4IADA 4LYNA 1J7LA 3W0SA 4DFLA 4RA5A 4RX8A 5KNJA 2IF8A 1IAJA 3TMOA 3BHUA 1GIIA 3K5UA 3OY1A 4NUSA 2PL0A 5LVMA 3PYYA 3LFAA 3QXOA 3RAHA 1JNKA 3TDWA 5T3QA 2IVVA 3ZXZA 4BWPA 4YSJA 2R3JA 2W1CA 3GC8A 3RM7A 4BYJA 4R1YA 4M7IA 3GC9A 4X3FC 3SRVB 4XG7A 3KF4A 4MAOA 3AGMA 1YOMA 4DT9A 2WTWA 4F9YA 3FI2A 3PJ3A 2QD9A 4JRNA 4PMSA 4YJPA 3VS5A 4BDGA 1J91A 4BDFA 2X2MA 4AW0A 5KCVA 4F64A 1XH5A 4R7BA 3CJGA 3MPTA 4FSRA 3U87A 4OTGA 5FP5A 2X2LA 4I20A 4O27B 4M14A 3JUHA 3F88A 5GNKA 4YJNA 2XNNA 4G3DA 4MBJA 5GJFA 4FC0A 2QNJA 4O7TA 3RAIA 4ORKA 4YO6A 2ITTA 1ZMUA 4EBVA 2XIKA 3E88A 5JRSA 4PRJA 3EN6A 4FEWA 4CGAA 3KQ7A 4NJ3A 4IAZA 2PK9A 2J4ZA 4MQ1A 3R01A 2CNUA 2BALA 3FLWA 4J96A 2FVDA 2WMBA 1W2FA 4IM0A 4LL5A 4TWOA 4MF0A 4XRLA 5DRBA 5HGIA 5BYZA 1BUHA 4BZNA 3I5NA 3C7QA 5BPYA 2NPQA 4RJ5A 2GFSA 4FODA 3BQCA 2F7XE 2P0CA 4BCPA 5A4TA 3UIUA 2C1BA 4C8BA 2AC3A 2R64A 2O2UA 3KK9A 3WARA 2UW4A 3RVGA 2PVFA 2J0LA 4K18A 4K33A 5ANOA 3UOHA 1R0EA 3UZPA 4OBPA 4CMTA 2OH0E 2W1DA 3BEAA 3QL8A 2X0PA 4IAFA 4U81A 1CTPE 3ITZA 4QMMA 1VZOA 2OJ9A 4W8EA 5JZJA 2ONLC 2ITVA 5L6PA 2PMIA 1DI8A 3EOCA 2UV2A 3LXLA 4NT4A 1KE6A 2UUEA 2WMAA 4FIJA 4XG9A 5HI2A 4C4JA 4XH6A 2WQOA 4MD8E 1PJKA 5E8VA 2XNEA 3UC3A 2IJMA 2QLUA 5DE2A 2OU7A 1FQ1B 4AAYA 4GMYA 4QP6A 3G9LX 2VTPA 2OZAB 3PUPA 5HBEA 4CZUA 4UWYA 4B8LA 2BILB 4GK4A 3MV5A 3QTRA 5A9UA 5L2WA 2RFSA 5CT7A 2YAAA 3MVHA 4BDIA 1PMUA 5JQ5A 5K3YA 2W1IA 2ZOQA 4RX7A 5ETIA 3W16A 4O83A 3CSVA 5AFVA 5BYLA 2GPHA 3TJCA 4FEXA 4R3PA 1ZYSA 4WNMA 5HD4A 1RQQA 4FTMA 5FP6A 1EH4A 3UG2A 3V04A 3NUNA 2F2CB 3QD3A 2HELA 4B0GA 4CFVA 5HTBA 2BUJA 3C0IA 4JAIA 4UY9A 5JN2A 3JY0A 4A4LA 1H28A 3VBWA 4RVKA 2V5QA 3R7VA 2A27A 4ANBA 4F1OA 1LUFA 5HG7A 4F9BA 3FMKA 4IDTA 5DT0A 5CF5A 3S1HA 3DGKA 4FVQA 3D0EA 4O4FA 2E9UA 4I6FA 2ETKA 5JGDA 4WNOA 4P90A 5I9UA 4U44A 4JAJA 4HYUA 5KZIA 3OHTA 4QMQA 2H8HA 3TZMA 4IAKA 2YHVA 2BRHA 4D2RA 3RGFA 2XKFA 5BUIA 2FUMA 5FGKA 2BRGA 3UYTA 4FTLA 3BL7A 5GIOE 3SQQA 1LR4A 4FSQA 3H9RA 2CKPA 4L68A 2O64A 4UZDA 3IDBA 4RBLA 1R39A 4AZWA 2PVMA 2PVNA 5IA0A 3PA5A 4DGMA 2YAKA 3ETAA 2YLEA 4QPAA 4YJRA 2VTIA 5C4LA 4RJ7A 4FIEA 4I6LA 5C8NA 4LL0A 5AEPA 2OICA 5TR6A 1XHAA 3OXIA 5CT0A 3UO6A 4C36A 3VS7A 3KXNA 1JKSA 5M57A 2Z60A 1MRYA 4FZDB 4UWBA 3DDPA 4ZAUA 2NYAA 1JVPP 2BFYA 3DDQA 3W55A 4W8DA 3RM6A 4EWHA 5AUTA 4AOTA 4USEA 4AG8A 3FZRA 4FL2A 5HE2A 3SV0A 4A9UA 3FJQE 1CMKE 3D2IA 1ZOGA 1SNXA 4Q9ZA 4M8TA 3CC6A 5CF4A 2PZYA 3LQ5A 1H27A 4UB7A 2OG8A 2UZNA 3D94A 3Q2MA 1TQIA 2QLQA 2P55A 4R77A 3EWHA 4AW2A 3P5JC 5KKRC 5L6WL 5CVHA 2HYYA 4C34A 4X3FA 4BDCA 3NNWA 1ZOEA 1PXKA 4QP7A 4X6QC 4F7JA 4J8MA 1YWVA 4DCEA 3QF9A 5IDPA 2W1HA 4IVCA 2W9ZB 3HP5A 1JLUE 4RIOA 3R9OA 1XMMA 4O7NA 3NIEA 1WFCA 2BTSA 3ORPA 2BTRA 4L42A 5CALA 4W9XA 2WMRA 4TXCA 4FEQA 4QRCA 2G1TA 5DPVA 1Z57A 3NX8A 4G2FA 4BC6A 2I40A 2R3LA 3KCFA 4QP4A 4V05A 4LUDA 2ITYA 4L9IA 3V5TA 4CCBA 4N70A 3FLNC 4ZOGA 2X4FA 2PU8A 4IXPA 4KS7A 3DJ7A 1OVEA 3RMFA 5CAOA 4G3FA 3A99A 4JBVA 4JS8A 4I1ZA 3ORMA 4PTCA 4ZLYA 5IQIA 2I0VA 3LFFA 4M13A 4QP2A 4PPAA 2XIYA 3HYHA 5DGZA 5IA1A 4MXZA 3RK5A 4QD6A 4M15A 4NM7A 4E4LA 3GVUA 2VTLA 2CKEA 5I9WA 1Y91A 2X2KA 5J5SA 3QHWA 4NWMA 1G8SA 1YWRA 2IG7A 3CE3A 3F3TA 5FQDC 3RAWA 4AXCA 2EU9A 5CSXA 4CFUA 3Q9WA 4GEOA 3FQSA 4FK3A 4USFA 3UJGA 1PXOA 1DM2A 4QYHA 4PWNA