1ZZ2A

Two classes of p38alpha map kinase inhibitors having a common diphenylether core but exhibiting divergent binding modes
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
337
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Two classes of p38alpha MAP kinase inhibitors having a common diphenylether core but exhibiting divergent binding modes.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 337
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zz2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zz2A01
3QA8A 1KUTA 3RPSA 4ZTQA 3AT4A 2PVHA 3Q6UA 5AV2A 4I6HA 1A06A 4DINA 3V01A 4AZEA 4L42A 4YTHA 2R3QA 3OMVA 4CFWA 3SKCA 3QGWA 2W1EA 4XOZA 3U9CA 2W1IA 3GU7A 3QD3A 3OY1A 2C0IA 1RE8A 3KN6A 3L8PA 4KS7A 4IHPA 4NL0A 3OCTA 3V8WA 3IW6A 3FKNA 3Q32A 4CNHA 4UALA 2AYPA 5AP4A 3FXZA 4BDCA 3PXRA 3AC4A 2X8DA 1YKRA 4XUFA 5AP0A 3FI3A 2J0LA 3MSSA 4C02A 4JDJA 1FGKA 1W83A 3R73A 2J5EA 3MFRA 3MS9A 3GCSA 3KC3A 4RIWA 5J79A 3G6HA 4QYGA 1PXMA 1UU3A 2HZNA 3AT2A 2P2IA 4EJ7A 5FG8A 2WQEA 2YACA 3SQQA 5AX3A 4BDIA 5EHYA 3SV0A 4MXOA 2BUJA 3GQIA 4BGQA 4Q2AA 2VWIA 4FL2A 4W4VA 3TJDA 4ZTSA 1PF8A 3E63A 1IG1A 3FMKA 1WZYA 3TTJA 5KO1A 3ZLSA 3UPZA 1YXVA 3LAUA 3UO5A 5EM6A 1Q99A 4OBQA 4FYNA 3E7OA 4EJNA 3ZSGA 1K3AA 3VW8A 5CASA 4O83A 4JVGA 4V0GB 4UEUA 2WQMA 3LHJA 2XNGA 3R9HA 4FEWA 4HYHA 3DJ6A 4NTTA 5DOSA 3LFDA 2W05A 5H3QA 4MNEA 2VX3A 4R3PA 4AGDA 2ZB1A 3W16A 4LG4A 4JBPA 4L8MA 2JKKA 4E8AA 5JRQA 2OZAA 5HO6A 4MTAA 2G2IA 5K3YA 4PMPA 3ATSA 4AA5A 4F7JA 5CAVA 5HIEA 5KUPA 3HVCA 3VS3A 5HVJA 1M2QA 4F7SA 5HIDA 2EB2A 3FI8A 5CF4A 5JGAA 5ICPA 5IH5A 4EI4A 2ITZA 5E9EA 3NNXA 2ZDUA 3D5UA 3BU5A 1BUHA 4MVFA 5C8NA 2XRWA 3L9MA 3I0OA 4GT4A 3BHTA 4B9DA 5KMJA 3FMMA 3ORXA 4E20A 5CU6A 2I40A 3FE3A 3ZFXA 5I4NA 4KKEA 1ZYSA 2RG6A 3FMJA 3QZIA 4OTWA 1YI6A 2ZVAA 4O27B 4JT3A 2XK3A 3EJ1A 3K54A 4L67A 4CRLA 3P1AA 4ZTMA 3N4TA 3C4XA 3E64A 3MA6A 4ONAA 4BYIA 5L2WA 2CNVA 2B54A 1J1BA 3HUBA 4F6WA 4ZLZA 4B8LA 4RRVA 1ZOHA 3QRTA 5LQFA 2QG5A 2QNJA 3SXRA 3Q53A 3QHRA 1H08A 4I22A 5HIBA 5KBRA 2XEZA 3DK7A 3C4EA 3VNTA 3U4WA 3EIDA 4L44A 3GCVA 2JDSA 3R7OA 3R30A 4A9UA 2VNWA 2OO8X 2V55A 5HE1A 3PWDA 5FDPA 1AQ1A 2B9HA 2O0UA 4H3PA 4FL1A 3KVWA 4IAIA 4TT7A 4FEVA 4GYIA 3LCTA 2OXDA 4D1SA 5KMIA 4F08A 1UKIA 2BTRA 2C6LA 4IB3A 2O2UA 1URCA 3AC8A 4FTJA 2XH5A 1XQZA 3BYOA 4FZAB 5J1WA 3LQ5A 3HL7A 3QYZA 2QOBA 5IUIA 4X2JA 2OSCA 3G90X 2GNFA 4DLIA 3LFQA 4TZRA 2XZSA 4G34A 4H3BA 4PX6A 4ZSLA 4AW2A 5HTIA 3MW1A 3UC4A 3RKBA 2XNNA 5LOHA 4C0TA 2A4LA 3OWPA 4O7TA 4FZFB 2KULA 5LARA 2IVTA 3Q96A 4HCVA 4S2ZA 1KE9A 2J0MB 3PA3A 4WG4A 3FBVA 1FPUA 2BAKA 4K2RA 1Q62A 3WF8A 4EH6A 3LPBA 2CKQA 3MTFA 3QBNA 2ERKA 3PPZA 3ZS5A 1JBPE 4ACCA 4F0FA 5KNJA 2PUIA 2BHEA 2XK8A 2XM8A 4I6QA 4PP9A 4EC9A 1GZNA 1NY3A 1XJDA 4PPCA 5HE3A 4A9RA 2XIYA 3WBLA 3LLTA 2QOCA 3QZFA 4YO6A 4DLJA 1M2PA 3HLLA 4GYGA 4K77A 5DN3A 3A7FA 3TV7A 2R5TA 4BY9E 4FKPA 2JLDA 2X2MA 3VUDA 2WNTA 1T45A 1YXUA 4YLLA 5CYIA 4EOMA 3N4UA 3CIKA 1RDQE 2Y4IC 1H07A 1W8CA 1H26A 4CCUA 5IF1A 2E2BA 3ZXZA 1ZY4A 1JVPP 4RZWA 2J51A 4XP0A 4C4GA 4ZY6A 3MFUA 2CCHA 3RJCA 2IVVA 4RJ4A 3FPQA 5HNGA 3VUHA 4AN2A 4V05A 2VWVA 3UPXA 4G16A 3FZPA 3I7CA 3NYOA 1OIQA 4GJ2A 4GVAA 4BIDA 3PPKA 4OT5A 4HPTE 4IW0A 4BDFA 4AAAA 3PYYA 2ITWA 3KL8A 3REPA 4JAJA 3OWLA 4PDOA 5AP1A 4BGGA 1PXIA 2YAKA 4QNYA 3ZLXA 2CN5A 4I1ZA 3S3IA 4FTKA 2HW6A 3I60A 5DR2A 3T9IA 3CGFA 3ALNA 2NPQA 5E8SA 2JD5A 4KKHA 3R9NA 4R5SA 4ZK5A 1REJA 2BPMA 4I5PA 2PHKA 3D5XA 2YWPA 2W1ZA 5L8JA 5EI8A 3UVQA 1XWSA 2NRUA 2F4JA 2NP8A 3BYMA 4IJ9A 4APPA 4CCBA 4AP7A 2YIRA 4A07A 2F7XE 1MRUA 4ZZOA 1VJYA 4J8MA 4XV2A 2ZJWA 3RGFA 4OTRA 4S33A 1JKLA 1Q3WA 3C5UA 4RJ7A 4MF1A 3AMYA 2PVJA 2SRCA 1W7HA 2W4JA 4FKLA 3HP2A 4BTMA 3A8WA 4MF0A 2OBJA 4FTUA 3ORLA 4U7ZA 3IW8A 2DWBA 5BVOA 3NUXA 5CNNA 3PVBA 5JFVA 3SG9A 2VO3A 2R9SA 3A2CA 4FT7A 2XK4A 3R7VA 2BRGA 1JKTA 3TWJA 5GZAA 4YHJA 2GQSA 4FX3A 2UW9A 2Y8OA 3QC9A 3R8MA 4EWQA 5HQ0A 4PDSA 5CXHA 2LGCA 1PHKA 2B7AA 3I5NA 3ITZA 2QKRA 1LUFA 3QALE 5AUXA 4DCEA 3CQUA 1SZMA 3P0MA 5IQFA 2E9OA 4L46A 4MXAA 3KGAA 4FT9A 3CJFA 1YRPA 2QODA 4UWCA 3D15A 3UP7A 4DEIA 4G2FA 2BDJA 3H30A 4EOKA 2DQ7X 1Q97A 3PRFA 4PDPA 4O86A 2UW3A 4XNEA 3VN9A 3VBTA 3QCYA 2WMBA 5AP7A 2UW5A 1B39A 3HEGA 3PVUA 1DI9A 3FI2A 3ZU7A 4FTRA 4EYJA 5FBOA 1LP4A 2C6KA 2XJ1A 2C4GA 2W7XA 4JRNA 3A7JA 4FVRA 3WF6A 2IG7A 3KF7A 1Z57A 3SHEA 4BYJA 2EUFB 4GFGA 3JS2A 2WTCA 3L9PA 4BCQA 3Q4TA 1DAYA 5BQ0A 4BCHA 2QONA 4ID7A 2C5OA 2YA9A 4IB1A 1LEWA 1Y8YA 4GU9A 4UYAA 4H39A 4RVTA 4AOTA 1OL7A 4AZWA 4BTFA 3RZBA 3TEIA 5HVKA 3UG1A 2QQ7A 3FPMA 3TKUA 3NAXA 3HMOA 2GNIA 5D9HA 3R9DA 4CQGA 4MCVA 5L6PA 5EYKA 3VQHA 4GUEA 1GY3A 3KRLA 2O5KA 4GKHA 2GU8A 4LMNA 4IH8A 2F2CB 5DRBA 5AUZA 2WTIA 3R02A 4NEUA 4AZTA 4K0YA 3EN5A 4Y5QA 4BL1A 4KIKA 4D9UA 4DEHA 3NUUA 3VQUA 4TL0A 4CT1A 4FIGA 5DPVA 4IB5A 1NA7A 3MFSA 4DE4A 5H2UA 2UVZA 4AUAA 3SXSA 3CEKA 3V04A 4C34A 4K11A 5CAOA 5E1EA 1WAKA 2EXEA 2OK1A 4NIFB 3D7TA 4QMTA 2QVSE 5CVFA 1CKPA 1BYGA 1CDKA 1PXPA 4QPAA 1UU7A 2QOHA 3RAWA 5LVNA 5EOLA 1ZYJA 3EN7A 4ORKA 1X8BA 3EQIA 4QMWA 4V04A 4ENXA 3PIXA 4U41A 4NWMA 2ITNA 2YIWA 4FV3A 3DKCA 3UOKA 3OXZA 4AA4A 2YM5A 5IH6A 3LMHA 4R78A 5ETIA 3VBYA 3RI1A 2UW4A 4QYEA 3KMUA 3FQHA 4HVGA 5EHOA 3GU6A 5IH4A 3BE2A 1Q3DA 4YTIA 3WE8A 4AGWA 3NW7A 4AE6A 1WBNA 4EH4A 3ZM4A 4DGMA 5M57A 4FIHA 4MKCA 4RC4A 4N70A 4KINA 4YC8A 4LI5A 3KY2A 2HK5A 1KWPA 3DY7A 4PUZA 1Q5KA 2J0JA 2JBOA 3TUCA 3OROA 5HVYA 3QZHA 4CSVA 1H1WA 3PG1A 3MA3A 2YM3A 1KE6A 4X2KA 5HLNA 5K4IA 2UW8A 2VTJA 3ET7A 4OTFA 4L3PA 5IZFA 4XS2A 4AXAA 4MXCA 3R9RA 4GIHA 2OWBA 3L8SA 4I3ZA 4GUBA 4BZNA 2CGWA 5E8TA 4Y95A 3DLZA 2C3LA 5BX0A 4RT7A 3OTVA 5CF8A 4G3DA 2OGVA 3H0ZA 5CEIA 4ASEA 4CYIA 4ZLOA 3CD8A 4U43A 3AG9A 3ZUTA 3ZSHA 2OXYA 4AX8A 4IWOA 4C61A 3RALA 2XJ2A 3KXHA 4DTBA 2BRMA 2JKMA 5EM5A 3BBTB 3NDMA 4LQMA 2GQGA 5F4NA 3PTGA 3D2KA 5EW8A 3MTLA 3N4VA 3NPCA 2WQOA 3ZC5A 1YXTA 3VJOA 5HLWA 4DBXA 2J9MA 4L43A 4IAFA 2HY0A 2WTJA 4KAOA 2F57A 3DJ5A 4QMVA 1Y8GA 2FSMX 4GK3A 4M12A 4YC3A 5K5NA 4MBJA 3KF4A 4FZ6A 1P4OA 2XCHA 4CG9A 2F7EE 2PVNA 3FMEA 3S4QA 3GFEA 3OT3A 2ITVA 2YCFA 4HGSA 4EONA 4EHZA 2XKEA 2VO6A 4U0IA 4XX9A 3ANQA 5AUWA 2I1MA 4EOOA 4F63A 4XJ0A 2W1FA 2CKPA 2JAVA 3ZO3A 4I0SA 2OJFE 3CTHA 4G6OA 3GOPA 1KE7A 1O6KA 3LM5A 3F5PA 3UOJA 5HBJA 4UN0C 2YITA 2Y6MA 3DXPA 1Y6BA 3ZOSA 3PJCA 5EFQA 1BLXA 3KMWA 5GHVA 3NUPA 5E4HA 2UVXA 4FIIA 3C9WA 1W0XC 2QLQA 4NJDA 4IM3A 4BVUA 1J7UA 2ITYA 3HV6A 4YC6A 3FJQE 2W0JA 5L2IA 4DEBA 4DFYA 4EORA 4F7NA 4F4PA 3AC2A 3QF9A 1ZOEA 1WBSA 3VAPA 3T3UA 4W9XA 4EKLA 3EL7A 2R3PA 3NWWA 2OU7A 2ITPA 2C5XA 3O96A 3A61A 4RX7A 4XRLA 4O22A 4X2FA 2VD5A 3SX9A 4I94A 3ZRKA 4LL0A 4U42A 3FKOA 4YJPA 2YDIA 4QP8A 3NAYA 4LUEA 3F5GA 4TYGA 5C4LA 5EI2A 3EWHA 1PYEA 4X3FA 4XG7A 3PVGA 5KZIA 2OF4A 4F9BA 1JPAA 4QMYA 4DT9A 5LWNA 5CU3A 2G01A 3LXLA 5ANJA 1MQBA 2QU5A 2W06A 2QHMA 4OTQA 4EZ7A 2VO0A 4CFNA 4YJNA 4CLJA 1OB3A 4O0SA 4W4WA 4WOVA 1YXSA 3F2RA 1GIHA 2VN9A 2R3KA 3GNIB 3ORKA 3TDWA 1BMKA 3VBXA 5CU0A 2UZWE 5GZ8A 1APME 5KZ0A 5HU3A 2W17A 3OT8A 4U6RA 4Y8DA 3LJ1A 3Q2MA 3TNPC 4QMSA 4QMOA 1AD5A 4BTJA 2VWXA 1F3MC 4G1WA 2FSLX 3UC3A 5K4JA 5J7HA 2QO7A 5HTBA 1Q8UA 4QO9A 4EH3A 3GU8A 4X0MA 5AV3A 3POZA 2JDRA 3FAAA 3F88A 4S32A 4BWPA 2Y7JA 2O64A 2JGZA 4FNYA 4A06A 3OOMA 3R2BA 3F3VA 2IVSA 3TNWA 3GGFA 3LFBA 5E90A 2R3FA 4AS0A 2PVMA 4K8AA 4ACHA 5JGDA 3DPKA 3T3VA 4O84A 1ERKA 4FICA 1M7NA 4FT3A 4LRKA 2VZ6A 4WSQA 1U54B 2R64A 3BU6A 3EQGA 3UGCA 4E4NA 4FVPA 3Q4ZA 3IW4A 3R8ZA 2PVRA 1JKSA 4WG3A 3RBWA 4ARKA 3QQHA 1NT2A 3EL8A 3L9LA 3MFTA 5A4CA 1JSUA 5DEWA 3QU0A 2YDJA 4KS8A 4O38A 5DEYA 4ZIMA 4NKAA 4TNDA 3S95A 5TOZA 5LVLA 4JG7A 3ZC6A 2BILB 2WFYA 3R7IA 2JFMA 4X3JA 4BGHA 4F9AA 1V0PA 2GHMA 4YSJA 4CFMA 3R01A 2VX0A 4FSMA 2W1HA 3C4WA 4JBVA 5J9YA 3CKWA 1OM1A 2Y9QA 3H0YA 3P79A 3QQKA 2HXQA 5BNJA 2V5QA 3VWAA 3HMMA 3NCZA 2WEVA 4BFMA 3VS6A 4ITHA 4CLIA 1J1CA 2QO2A 4IC7A 2IZSA 3ACJA 3G0EA 4RVLA 5EDRA 5HNBA 2ETKA 1H1PA 2H34A 5FWKK 4AGUA 4GEOA 4BZDA 2ITOA 3ZUUA 2YLFA 4A7CA 3TNHA 3RZFA 5K0XA 1YWNA 4XBUA 3S00A 2JKOA 3JVRA 4UZDA 3ROYA 3G33A 4H05A 3DK6A 3QQJA 2PSQA 3PDTA 4ZSEA 5CT0A 3GXLA 3OP5A 4LRMA 4DH3A 4ZJJA 3POOA 3RPOA 4HNFA 2WMWA 5CANA 1ND4A 2Z7QA 4JLCA 5DT0A 2X7OA 3MBLA 4QTDA 4K6ZA 3D7ZA 5L8LA 1GZKA 2X6EA 3BYSA 5A3XA 4NU1A 3HA8A 5E8XA 3NZ0A 4ZTNA 4FV2A 1YW2A 2YZAA 3QC4A 3QCSA 4UX9A 3NYXA 3QD2B 4FV0A 2E9UA 2FUMA 2WIHA 4GG5A 4QD6A 3QZGA 4J52A 4FSWA 3WZDA 3JPVA 2XNPA 1OIUA 1H00A 3ALOA 4QRCA 4AW0A 4GH2A 4HCUA 2WMTA 5IPJA 3BV2A 1UA2A 3FQSA 4C2VA 4CZTA 3A4PA 3HNGA 4RX8A 5H8EA 1UNHA 3ZEWA 4EWHA 3WI6A 3PXZA 2F7ZE 3ETAA 4V0GA 4NCTC 3G15A 1ZMUA 2UZEA 4KNBA 4C57A 5HEZA 1XR1A 4AW5A 3KA0A 4L52A 3PG3A 3BHHA 3OCBA 4I4EA 1NVQA 5CF6A 4M66A 3AQVA 3H9OA 2CJMA 2PL0A 4MEDA 4QTBA 4NW6A 2OH0E 4H1MA 4RJ3A 2ACXA 1E9HA 5DBXA 5ETAA 1OGUA 2CLQA 3HMPA 5GJGA 3VBWA 5HX6A 2Z60A 4G3CA 5CTPA 3I0QA 4E6DA 2WEIA 3ULIA 1PYXA 4PV0A 3P86A 3ZH8A 4B6LA 5BPYA 2I0VA 4D28A 2CDZA 4EHVA 3NR9A 2VNYA 1WVXA 3EZRA 4JDIA 5B0XA 3FHIA 1WVYA 4D2WA 1PMVA 2WTVA 3FMDA 3MVHA 1TQMA 3QLFA 5CSWA 2R0IA 3A4OX 3B2WA 1SM2A 4J96A 5C01A 3Q6WA 4ZP5A 3W2SA 4F09A 2C5YA 4PTEA 5ETFA 5EI6A 4AW1A 4E7WA 4DH7A 3GC8A 2B9JA 2GDOA 4QP3A 5I9XA 4FSTA 4FYOA 2ZB0A 5D7VA 3ZLWA 3E92A 2Z7LA 1OI9A 5H8BA 5AWMA 4HGLA 3Q4UA 4IAYA 4G6NA 4PMSA 4UBAA 4CFFA 2HOGA 2EU9A 4YPDA 4ANOA 3HP5A 3QTXA 4IQ6A 3FL5A 4KA3A 3BRBA 4FEQA 4E3CA 5CI7A 3OHTA 4WRGA 3D14A 3VULA 4V01A 3WYYA 2PULA 3G9NA 5BMMA 3UYTA 3E7VA 4ALUA 2B55A 3UQFA 3NYVA 4YU2A 5AUVA 2XNBA 3EOCA 4QPSA 2C6MA 2WO6A 3R1SA 1WBVA 5AIKA 3A7GA 3ORIA 4D5HA 5IA2A 4YHFA 1E1VA 2IZRA 4PPBA 4D2TA 2JAMA 1O6YA 4FEUA 3DKOA 2HZ4A 3F5UA 3JYAA 4RA5A 4TW9A 3Q3BA 4EOLA 4NTSA 3ERKA 3EYHA 2E9PA 3QAME 4UXQA 3V5TA 5JZJA 1L3RE 5A4EA 3IGOA 4FG8A 5EK7A 1CM8A 3O71A 3EFWA 3V6RA 2OICA 3LCKA 3QL8A 5CNOA 3QD0A 4TYHB 3CJGA 2EWAA 2O65A 2RSVA 3EN4A 1ZRZA 3NGAA 3TUBA 1SVHA 2WMRA 4C3PA 4MBLA 3IQ7A 3AC3A 3FSKA 4N4SA 4O1OA 4PMTA 4AE9A 4AFJA 2PVFA 3PJ8A 4M0ZA 5B2KA 4CFXA 3F2AA 3F6XA 1XBBA 3BU3A 4G5PA 3DBEA 3W55A 1YI4A 3E3PA 3FYJX 3MDYA 4IZ7A 4QQCA 4TYIA 4AT4A 1HOWA 4EH2A 4FV7A 4CT2A 2B4SB 1KSWA 2Q0BA 2OW3A 5LCKA 4GCJA 2JFLA 1TQPA 2WMUA 4IANA 1DS5A 4OT6A 2Y4IB 5AAEA 4S30A 3R1QA 4HW7A 1NVRA 1ZOGA 4NSTA 5EH0A 2R3HA 4Y73A 3ZTXA 4B99A 4QMMA 4EH7A 4FG7A 2QOFA 1MP8A 3I6UA 5E8VA 5I9YA 3OFMA 1DM2A 3V51A 1WBTA 3QXPA 3VF8A 4AT5A 3BLQA 5T6KA 3W8QA 4LMUA 4E93A 4D5KA 1W82A 4F1OA 5IUHA 2WU7A 4U81A 3HV5A 4UMQA 3GU4A 3LE6A 4BKZA 1XH7A 4JQ8A 4FKVA 4ACDA 4O0YA 2B9IA 2DUVA 5CQUA 4LGDA 4W4XA 4RIYB 3EH9A 4HYUA 3RPVA 4DGGA 4D2SA 3E8CA 2IVUA 3RNIA 5AA9A 1L8TA 4LFIA 4GFOA 2XK7A 4F7LA 1YOMA 3WF5A 2EB3A 2W5HA 3HUCA 5M4CA 4I0TA 1QCFA 4BDEA 1XBAA 4FKTA 4FSRA 3BHVA 1G3NA 4MWIA 4UWYA 1J7IA 2J5FA 4FTTA 4BDBA 5IEYA 3GQLA 5EW3A 3BEAA 5G1XA 3UNZA 2G2HA 2P33A 2OIBA 4FKGA 4IWQA 4EC8A 4WSYA 3FKLA 1PKDA 4QMUA 4LUDA 4AFEA 5IKWA 2JDTA 2PVLA 3HRBA 1FBNA 3GCQA 4OAVB 4R1VA 5HCYA 4GRBA 2XF0A 2ZMDA 1R78A 4O0WA 4O7YA 2P3GX 1UVRA 4C8BA 5HG5A 3B8QA 3LXPA 3FLNC 2NNWB 4KBAA 2VGPA 4R8QA 4RFZA 2VTMA 3EB0A 4FKWA 4EOIA 5B7VA 3ZRMA 3FZTA 4CV8A 5GIOE 1OL5A 4KRCA 3QQGA 1Z5MA 4IBMA 3RMFA 3CSVA 4Z55A 1Z9XA 3R1YA 4E5AX 4MD8E 2P55A 2X7FA 3GCPA 3QYWA 4BDAA 2AC3A 2R3IA 4CFUA 5M4UA 4QMLA 3BKBA 3CPBA 2UZOA 3QWJA 4JRVA 4PRJA 4DEGA 2P2HA 2QHNA 4NT4A 3RM7A 2XYNA 2XK6A 3O7LB 5AEPA 3VS5A 5M07A 4O96A 5FM2A 2I0HA 3AD5A 5L2QA 3P08A 3WZEA 3BQCA 5HD7A 3RK5A 1YQJA 4IZYA 4YJSA 4CTBA 4GIIA 1Q4LA 4FMQA 1IA8A 3PJ1A 1S9IA 4O0RA 4RIWB 4DH8A 3AGLA 4XP2A 2C6EA 3ORMA 3NUSA 1J7LA 4YJQA 2VTTA 1KV1A 4IWDA 5FP5A 3VUIA 2WKMA 2YJSA 4E4XA 2BRNA 2X7GA 4CZYB 5CAQA 1P14A 3OF0A 4GK4A 4ZSJA 1FGIA 4M69B 2VTRA 2YFXA 4O91A 3TIYA 4D4RA 1G5SA 1OPLA 3F82A 4DTKA 5LMKC 3HZTA 3LFFA 3KREA 4NM0A 2J6MA 3WE4A 5FXRA 4GSBA 1R0PA 4FF8A 3MY0A 2ERZE 4QPMA 4USEA 4X6QC 3CR0A 3CS9A 4CEGA 4ASDA 3NSZA 2W4OA 1YHWA 4QTEA 4YLKA 3LVPA 4UMTA 3LMIA 2OZAB 1Q8WA 3FC1X 2W4KA 2HYYA 3LIJA 4MAOA 4NIFA 4YLJA 2H9VA 3COHA 4YNEA 4D55A 4EZ3A 1VEBA 5AUYA 3BE9A 3C0IA 4YTCA 4F70A 1K2PA 3EZVA 3PY0A 5BUJA 3W10A 3ATTA 4FEXA 4BCFA 4YZDA 2CCIA 3H9FA 3MN3A 3E8DA 4JQ7A 5JEBA 4YP8A 3V8SA 4DN5A 3IGGA 5LVMA 4MYGA 2GS2A 4U9AA 5C03A 5I9ZA 3NUAA 2WTWA 5L2SA 2YM8A 3K2LA 4QP6A 2YM6A 4FTQA 1ZZLA 3ZDUA 3PZEA 4WHZA 4QNAA 2HXLA 4EZ5A 4QOXA 3ZBFA 3UQGA 3V6SA 4RC2A 2UZUE 5A9UA 4D1XA 4Q5EA 4XLVA 3RNYA 4UYNA 3T8OA 3FLYA 4DH1A 2X9FA 1H24A 5IG1A 1IR3A 5F20A 5JMSA 1PY5A 4IX6A 3II5A 3QUEA 3UMXA 2J4ZA 2VTHA 4CGAA 3QUPA 3WYXA 4D1ZA 5DR9A 3UIMA 3SGCA 2VTQA 1OIRA 2YABA 4DG2E 2VWYA 3D4QA 2F9GA 4IXPA 1IAHA 3RVGA 2FSTX 2XRUA 2HWPA 2OJJA 1OECA 4O0TA 4TXCA 3RCDA 4H1JA 3VF9A 5IA1A 3B2TA 3DQWA 4NJ3A 3CTQA 3W1FA 3NIZA 4D0WA 1ZYCA 2GHLA 3DK3A 1H0VA 3H3CA 3M42A 5D41A 4ERKA 5F94A 5L8KA 1HCKA 3W2PA 3MPMA 4DC2A 3KULB 5HORA 5LVOA 2AC5A 2PZIA 1FINA 4ERWA 3W33A 5J9ZA 1YI3A 4EQMA 3RP9A 4C3FA 1KOBA 1OMWA 2ZM4A 4FBXA 3EFJA 5HLPA 5BVFA 5EKOA 4MQ2A 2VO7A 3HAVA 1U5RA 1RW8A 3AC5A 4X7QA 4U8ZA 4YJTA 3GFWA 4IVBA 3NCGA 3UVPA 4GJ3A 4I5CA 5A4LA 3WF7A 1I09A 2R2PA 3BZ3A 2JKQA 4JG8A 4FTIA 4GK2A 1GNGA 3SC1A 1QPEA 3TZ8A 5CLPA 4FR4A 3KRJA 5HO7A 2R3JA 4X6RA 3QQUA 4MD7E 1IA9A 5C4KA 5FXSA 5DNRA 3LJ0A 5DIAA 5AX9A 3DB8A 5ANDA 4DFNA 5AV1A 4O81A 3QLGA 5AP6A 3FMLA 4LM5A 3K3IA 4OTGA 4Q5HA 5AR8A 4DH5A 4YO4A 3TKIA 3ZBXA 3OCGA 4FKJA 3G6GA 1W98A 4E4MA 3G0FA 1ZYDA 5I9UA 4APCA 2ZAZA 4IB0A 2GTNA 4EOJA 1XBCA 3THBA 4ZAUA 5K5XA 2PK9A 4BWKA 3TM0A 3S2PA 3ORZA 1M2RA 3ZMMA 4M7IA 2BVAA 2A0CX 5M56A 4OTHA 3FV8A 3UQCA 5JFSA 1Q61A 5KHWA 3CP9A 3EMGA 3SD0A 1PXLA 2PY3A 3O2MA 3W2QA 5HCZA 4YZ9A 3HV3A 2XVDA 3PJ2A 3OEFX 3B8RA 4Y46A 4YZBA 4HVDA 5CAUA 3DXNA 5FLFA 3DFAA 1H01A 2XB7A 2V0DA 4I4FA 4O6EA 4DBNA 3MJ2A 4MBIA 4YNOA 5DA3A 2YIYA 2R3RA 3UOHA 1P2AA 4F9WA 2XKDA 3KVXA 3FL4A 5I9WA 5HE0A 3TNIA 4AACA 1GIJA 2W9FB 4FIEA 4DYMA 3JR1A 4ZTLA 1MRYA 4F1MA 4U3ZA 5CY3A 3ROCA 1IAJA 3ODZX 3FY2A 4HPUE 3GCUA 5CEMA 3D2IA 3GC7A 1ZY5A 5IQGA 3O0GA 4JQEA 4TN6A 2ZM3A 3FZSA 4RLLA 3LM0A 2UW0A 2X0GA 4FNXA 3SAYA 3OBGA 4DEDA 4BDJA 4FNZA 4EQCA 5C26A 5ANKA 4WUAA 1MUOA 3DBDA 3PJ3A 3ULZA 4KRDA 4BWXA 2BRBA 4C36A 4LRJA 4ZMFA 2VTIA 2LAVA 2R3LA 3NEWA 5IDPA 3A99A 3R8PA 4XOYA 4I6BA 4ASXA 4O7VA 2V22A 5GINE 4W8EA 2YEXA 4G9CA 3MVLA 4IFCA 3E8NA 4TWPA 1PJKA 4XG4A 3OC1A 4QMXA 4U80A 1DAWA 4ZSAA 2XK9A 3NS9A 3MIYA 3RK9A 4JXFA 4PL5A 3EFKA 4PNIA 5CXZA 1J91A 2XM9A 4YZMA 4DHFA 3QKKA 4KIPA 4D2PA 4EHEA 3PP0A 4RJ6A 3QFVA 3GUBA 3R2YA 3BPRA 4MXYA 4EBVA 1NXKA 5T3QA 4YBJA 5ANEA 1U54A 3PXFA 4N57A 4HNIA 1ZWSA 3QTSA 4L7FA 4BI2A 4ZEGA 4O7LA 1UWJA 4LOOA 5EM7A 4D2RA 5L3AA 3UIUA 3WIGA 3N9XA 2WTKB 1JQHA 4F0IA 3C0GA 2OG8A 1O6LA 2YISA 4KIOA 3MH1A 5JH6A 2C6TA 3PZHA 3FUPA 4QQJA 2J0IA 4G17A 4L3LA 2VTPA 2Z7SA 2V7OA 3M11A 2OJIA 2VWWA 4C62A 5IQEA 4PWNA 5DGZA 2WMQA 5AV0A 2BTSA 3TV6A 5L2TA 2QOOA 4J95A 4RA4A 4XLIA 4M13A 1H27A 1VYZA 2PE0A 3I4BA 3BLRA 4I5HA 3OZ6A 4KIKB 5CVGA 4PDYA 4L68A 3F66A 4L45A 1PMEA 4ANSA 5AM7A 3IG7A 3L8XA 1H28A 4E4LA 2ZYBA 2BCJA 1PXKA 2CKOA 1OPKA 5M55A 2X4ZA 3BWFA 2XIXA 4WT6A 3LKMA 3HGKA 1OIYA 5IQIA 5JRSA 1XH8A 2BDFA 2VTSA 5EDQA 3E88A 3JY9A 3O8PA 3VBVA 4BDHA 4BCPA 4CMOA 5EKNA 3SG8A 4C4FA 4BDGA 5A6NA 3FWQA 2G15A 4JR3A 3LZBA 2GFCA 2RIOA 3NUNA 4P2KA 4F9CA 3R1NA 3UNJA 1SVGA 5F1ZA 3RAHA 4ALVA 5JQ8A 1R39A 4ZLYA 2OLCA 4ITIA 4IX3A 5AR2A 5FGKA 4ZTHA 4AZVA 5AAFA 4A9YA 1JAMA 4RX5A 4D2VA 2BAQA 3HMIA 4JI9A 1KE5A 2W96B 3MH2A 1UWHA 2PZPA 5I0BA 5EYDA 3HMNA 4IWPA 5DH3A 1VR2A 3GP0A 4BI0A 5K9IA 5T68A 4ZS4A 5AP2A 3IO7A 2RFDA 3A7IA 3KB7A 4QMPA 5B2MA 5LMBA 4IDTA 1UV5A 4HGEA 5J5TA 3DBQA 3QRKA 2R3OA 3KXXA 5IA3A 3GI3A 2C5VA 3TCPA 3ZO2A 4H36A 5DFPA 4OTIA 5A4QA 3JY0A 4PY1A 4CKJA 3VS4A 1J3HA 5HHWA 2OFUA 3I6WA 1JOWB 5L6OA 4ZJIA 3BX5A 5AP3A 1Q41A 4NFMA 5A46A 4JL9A 3DBCA 2HZIA 4DEEA 1KV2A 2YWVA 4C2WA 4BF2A 4YBKA 2EXCX 4EUTA 1QPJA 4FV6A 5DVRA 1PMNA 2J90A 3V3VA 4DTAA 1U46A 2VGOA 4OTDA 2NRYA 4P5ZA 1OUKA 4UXLA 4RGJA 4NYEA 5KMMA 5KMNA 3ZCLA 4RLKA 3VHKA 3DBFA 1WBPA 3PFQA 3C4FA 5JFWA 4OR5A 1B38A 2QURA 5HICA 4USFA 5M53A 4TRLA 4W4YA 1WMKA 3VS0A 4DGLC 4XMOA 2R3MA 2OXXA 4BN1A 2QOLA 3CQWA 4WO5A 3D0EA 5IISA 3R8VA 1R1WA 3WF9A 3UZTA 3VRZA 4C7TA 3PUPA 4D4VA 4K9YA 2HELA 5CEKA 3VS1A 4R7BA 5IQDA 1WCCA 4WNPA 4DA5A 2ZV7A 3OWJA 4NUSA 2UZLA 5C1QB 3PP1A 3F69A 2WTKC 5FBNC 3DKGA 1SYKA 2H96A 4FTCA 5KCVA 4XH6A 3EN6A 3PY1A 5BUIA 4DG3E 3O8UA 5IUGA 3DZOA 3EQFA 5D11A 4P7EA 3QQLA 3S0OA 3ORPA 4MNFA 4NKSA 4YHTA 3LFCA 5LJJA 3NNUA 3R7UA 1ATPE 3V5LA 2B1PA 4IVAA 4O2ZA 1JSVA 2C0TA 5BVWA 4N6ZA 2XA4A 4XG3A 2UUEA 3IDPA 4Z16A 3QGYA 1P4FA 2P4IA 3KRWA 3WARA 2GPHA 3SOAA 5FTGA 4GW8A 4FZ7A 5AADA 4ACGA 3OS3A 4H3QA 4N6YA 3P5KA 2PPQA 1H0WA 4BBEA 3EYGA 1ZYLA 4IAKA 5EHLA 5C27A 4PTGA 3W2CA 5IQBA 3NW5A 4FUYA 3RINA 3DTWA 5GZ9A 3ZZWA 4UWBA 5J8IA 3ZDIA 1Q8YA 3GENA 3QQFA 3O23A 4RIXB 4XV1A 5TR6A 1RQQA 3NNVA 4OGRA 2YDKA 2NO3A 4Y72A 5DI1A 3EQHA 2IN6A 4XG2A 3U6HA 1A48A 5AM6A 3P7BA 2VU3A 1OL2A 5E92A 4EOSA 5FTQA 3CY3A 5ANOA 5EQPA 3W8LA 1Y91A 3OXTA 3QWKA 2OFVA 3FY0A 4X21A 4CMTA 1O9UA 3DJ7A 4W9WA 2JIVA 4ZY4A 3NIEA 4JIAA 2UZDA 2YLEA 3DDPA 3JVSA 4JG6A 3TZMA 2XEYA 3BQRA 3DLSA 4P90A 5FEQA 3O51A 3P9JA 2HAKA 5AUUA 3RAKA 4M68A 4EKKA 3QX4A 2Q0NA 3UO6A 4E6AA 2C5NA 2JITA 4MXXA 3QRJA 4O7NA 5D10A 3HAMA 3KRXA 4JS8A 3E8EA 5A54A 3VUMA 3IW7A 3CQEA 3FZ1A 3SRVB 4X3FB 3ZO1A 2XYUA 3CTJA 4U97A 4IZAA 4LYNA 2JIUA 2X2KA 5CU2A 4ZTRA 4DFXE 2GTMA 3IS5A 4CYJA 3FC2A 4AF3A 3MB7A 3LFNA 4ZSGA 5HD4A 3NLBA 2HZ0A 4M15A 2I0YA 3H9RA 5IA0A 3PPJA 3R63A 1BL7A 2CKEA 5M51A 3SA0A 2B53A 2WD1A 3I81A 4ALWA 4DF3A 3HDMA 4IM2A 3R7EA 2ZM1A 4AA0A 1ZARA 1YDSE 3PXQA 2BZKB 5AP5A 3MYGA 3GOKA 5EYCA 3QRUA 4G3EA 4RIYA 2ETRA 1ZAOA 3LCOA 4FKSA 2CNUA 1CTPE 4QQ5A 4U5JA 4PP7A 3PSDA 4QMNA 3EQDA 2IO6A 4UV0A 4C33A 4J97A 3RHXA 5J5SA 3GC9A 2CGXA 4RZVA 2IJMA 5AR5A 5I9VA 4FIFA 4ANBA 2ZV9A 5HGIA 2UVYA 4B0GA 3ZM9A 4I24A 5IQCA 4II5A 4R6VA 3FDNA 4BCMA 5HU9A 5E1SA 2PMIA 2X8IA 2YM7A 4DFUA 3UTOA 3AD6A 3NNWA 4JOAA 3NX8A 3PXKA 3HX4A 3D5WA 3Q9ZA 1TVOA 2GNJA 2ITUA 5KKRC 2WQNA 1PKGA 4PNKA 2C3IB 2FVDA 4RWLA 3VJNA 3E87A 4D4SA 5IMXA 1FMOE 2W1GA 4JR7A 5ACBC 2BR1A 3FXXA 2BDWA 2YIQA 4WUNA 4IZ5A 3AC1A 4FA2A 3IONA 4E6QA 5F9EA 4NW5A 4YUQA 3KRRA 4C38A 3N51A 2B52A 4FODA 4L00A 4I41A 3R9OA 3F3ZA 5FEDA 5CSHA 4I93A 3BHYA 2Z02A 3Q5ZA 2GMXA 1M7QA 2OZOA 2R7IA 2ZMCA 2YN8A 4IACA 5CT7A 3E62A 3EFLA 1WVWA 4QP4A 3UE4A 4DITA 4GS6A 4ANLA 4F99A 1XH5A 2WHBA 3BWJA 3UOLA 2UZTA 2C6DA 2RL5A 2ZV8A 3GBZA 2W1CA 4BB4A 5LWMA 4TY1A 4KSQA 1OBGA 4IE9A 4A4OA 3EKKA 4HVIA 5BUEA 3KCKA 4USDA 3QKMA 4FSQA 4O0VA 5HCXA 3OUNB 2X4FA 4O21A 1H4LA 4F0GA 5HE2A 3LQ8A 3PWYA 5ACKA 4FTNA 4BIBA 3BLHA 5G6VA 3KCFA 3AD4A 3NRMA 3WZKA 3C4ZA 4YJOA 2UZBA 2C3KA 5C9CA 3DCVA 4FSYA 4EK4A 5FTOA 4IDVA 3Q04A 2GNGA 2GSFA 2VTAA 2C68A 3OD6X 4BHZA 4A9SA 1IEPA 3P23A 3LQ3A 1AGWA 2VTOA 3BEGA 5M06A 1LPUA 3CPCA 5IMEA 4C4IA 3HV7A 4E73A 2RGPA 4O7WA 2YCSA 3KN5A 5KE0A 3EQRA 4RQVA 3G5DA 3MH0A 4C37A 4IVDA 5FRIA 4DFLA 1SVEA 1M14A 1UNGA 3C51A 4FV5A 4ZMEA 3A7HA 2ESMA 4IX4A 3W2RA 4O7RA 4ANNA 4IX5A 4MXZA 1OUYA 2WPAA 4IJPA 4X3FC 4YZNA 5JQ5A 3Q52A 2XKFA 3NVMB 4TYJA 2ZOQA 4M69A 2H6DA 4KUJA 3UYSA 1Q8TA 3HECA 3OW3A 4KWPA 1OL1A 3KK8A 3OBJA 1OKZA 4S34A 4IC8A 4KABA 4L6QA 3MVMA 4J7BA 3V8TA 3IW5A 1FVRA 3KXZA 3IDBA 5E8ZA 2YAAA 3QUDA 2WELA 3A60A 4I6FA 3L8VA 1YDTE 3EKNA 4QP1A 2VTNA 1GZOA 2PWLA 3P4KA 4I23A 2A2AA 4HZSA 4CFVA 5M4FA 4ZZNA 2QLUA 2QO9A 4ANQA 5I3RA 3H4JA 3PIZA 2UV2A 4I20A 3RCJA 3UDBA 1Q24A 3PXYA 4D58A 2C30A 5GJDA 3ZRLA 4Z3VA 1BKXA 2XIRA 3WILA 1CMKE 3DT1A 3BV3A 2CSNA 4P5QA 4CV9A 3Q4CA 4FKRA 3RTPA 1VZOA 4ITJA 3NUYA 4FV8A 3F3WA 4LGGA 4QP9A 3W32A 2I7QA 4BDDA 4W8DA 4FSZA 3AMBA 1G8SA 1MQ4A 4GMYA 4ENYA 4R5YA 4QYFA 5HOAA 5JFXA 1OKYA 4BICA 5JGBA 5D7AA 1YWRA 3LLAA 4RPVA 4EH9A 1BL6A 1ZZ2A 3TACA 3TZ9A 5IQAA 2QOQA 3LCDA 4HVHA 3UNKA 1YVJA 3FQEA 5CX9A 3CE3A 3FLWA 4QP2A 3W18A 2PMNX 4Q9SA 1A9UA 1V0OA 4R7IA 1B6CB 1QPCA 3ZZEA 5FQDC 1JKKA 3D9VA 2OI4X 3MESA 3S1HA 2FA2A 2CGVA 5M44A 5DT3A 3DDQA 3KXGA 5LXMA 2Y0AA 3TI1A 3AGMA 3UMWA 3R21A 1U4DA 5BYZA 4YMJA 5LMAA 3RM6A 4FTAA 3P78A 2VWZA 3TNQB 5FP6A 4BDKA 4BRXA 5IEXA 5BVDA 1CSNA 4QT1A 3EQCA 5AFVA 4RFMA 4QMZA 3KULA 3FZOA 2G1TA 4FSNA 4C59A 3C7QA 4BC6A 3F9NA 3V5JA 2J0KA 3ZFYA 2GS6A 3PE2A 3G9LX 5C8MA 2CLXA 4WBOA 3MH3A 3HA6A 3MV5A 4LV8A 4YZCA 2Z2WA 3HYHA 4OBOA 2QG7A 3R7GA 4YGAA 4LOQA 3A8XA 2C0OA 4XYFA 4R77A 3Q9WA 3TN8A 3QTWA 4M84A 4LOPA 3FLQA 4XV9A 2DS1A 2FGIA 3WZJA 4WBBB 4BCJA 1VYWA 4IAAA 4JDHA 4AOJA 3MPAA 1JSTA 3DTCA 2FH9A 1CKIA 4FZDB 4E5WA 3M1SA 3ZO4A 2ONLC 3C1XA 5CI6A 5CENA 4D4YA 2W1DA 2JC6A 3IDCA 3GEQA 3KFAA 3U6JA 2QR8A 4WNKA 1QPDA 1PXNA 3VS7A 4BCKA 1PMUA 4C4JA 4C3RA 3R04A 4M8TA 4TWOA 3VUTA 5M08A 3FMHA 5AJQA 3O50A 3VUKA 3BBWA 4MHAA 4IVCA 3DNDA 3FZRA 4MNEB 2RFNA 2WMVA 4F64A 3CC6A 3RWPA 2B0QA 4DFBA 5FUTA 1GZ8A 2I0EA 3PA4A 4FSUA 4CD0A 5CSPA 4A4LA 4B8MA 2VRXA 2ETMA 4UZHA 2PZRA 3PA5A 1GIIA 2C47A 2V62A 3FXWA 1T46A 4WRSA 4Y5HA 5E8WA 3AXWA 1FVVA 3TT0A 3OOGA 2QU6A 2R3NA 2CMWA 2X1NA 4BCNA 2CN8A 3VIDA 3BCEA 1CKJA 2RKUA 2W5BA 2WMXA 2BKKA 5BMSA 3E93A 1F5QA 2R0UA 3QRIA 5HG8A 3D5VA 3UP2A 4B4LA 4BCOA 1JWHA 2F49A 4GFMA 1OKVA 2VAGA 4TYEA 2YZLA 3G2FA 1H25A 4WA9A 5IA5A 4J53A 4P4CA 4NM7A 5TO8A 2V7AA 4DCAA 2BROA 2XUUA 3DAKA 5JZNA 4M0YA 4E26A 5DYJA 3HV4A 4NFNA 2XIKA 4U45A 1LEZA 5JT2A 3UZRA 3OCSA 4B7TA 1W84A 3MY1A 3MVJA 3R8UA 2VWUA 4BI1A 4EK6A 5KX8A 3VBQA 1Y6AA 2BFXA 1QMZA 4FV1A 3JXWA 3ORNA 4I92A 1GAGA 5CALA 3ZYAA 3F7ZA 4HVSA 5CQWA 4BBMA 5HO8A 4N0SA 1V1KA 4ZOGA 5EQYA 3MPTA 2VTLA 5F95A 3ZUVA 4M3QA 5IQHA 4NH1A 4TWNA 4ANMA 4NM3A 4HOKA 3TIZA 3KKVA 2WOUA 1JNKA 5E8UA 2XP2A 3COIA 1XH4A 5CEOA 1BI7A 5I3OA 4HJOA 5HG7A 2BFYA 2BHHA 3ACKA 1SNUA 3E5AA 4IADA 4FC0A 4HYSA 4ACMA 2C3JA 4RVMA 4XG8A 2WGJA 4HYIA 5IEVA 4KSPA 5CVHA 3FMNA 5LVPA 1HCLA 2YERA 5HKMA 4AT3A 4ASZA 4E1ZA 2C6IA 1WBOA 4O7SA 5J9LA 1H1SA 1E1XA 5BYYA 4YSMA 4J8NA 3QTQA 5D12A 3OY3A 1NW1A 4RMZA 5HZNA 4C4HA 3Q9XA 1BI8A 2IZTA 3OUKA 3R28A 4PQNA 4Z9LA 4QQTA 2YHVA 4GV1A 5C8KA 4ZS0A 5HX8A 3AMAA 5DHJA 4LV5A 4EK8A 2IWIA 5A6OA 3TTIA 3DS6A 3K5UA 3CGOA 3KQ7A 5I5ZA 4EOQA 2WOTA 4XBRA 3CLYA 3GB2A 3I5ZA 2IW6A 1ZMWA 2PVYA 4GL9A 3H10A 3HRFA 4IMYA 1OVEA 3ZXTA 3QKLA 4AQCA 5TE0A 3MY5A 2ITXA 3G51A 4Y83A 4CRSA 3C50A 2VWBA 3JUHA 5TF9A 2GNHA 4JAIA 3CBLA 4FTMA 3DXQA 3BHUA 5IA4A 3UODA 4G31A 5CS6A 4RWJA 5AV4A 2I6LA 3R83A 5JSMA 4UMUA 2GQRA 2W9ZB 5DE2A 2YCRA 5L4QA 4XEYA 4EBWA 3LCSA 4K1BA 1PRYA 1M52A 4O6LA 4X2NA 1TKIA 5FEEA 2A1AB 2BZIB 2XMYA 3SLSA 3WOWA 4XCUA 2GNLA 2OKRA 2R4BA 4MQ1A 3BGQA 5EM8A 2WZJA 5BYLA 5CU4A 5BVKA 2UZVA 4YPSA 4FOBA 3R7YA 2O8YA 3QD4A 2IPXA 1ZMVA 2O63A 3SW4A 3PVWA 4EHGA 5HBHA 1UKHA 4LL5A 2X6DA 5DLSA 4J99A 2X2LA 3ANRA 3UZPA 4BBFA 4AWIA 3VC4A 2VX1A 1FQ1B 4MK0A 5EG3A 3V5PA 1REKA 1IRKA 3RWQA 1NVSA 4FTOA 1M17A 4ZY5A 5JK3A 3BGPA 2BRHA 3QTUA 2BZHB 5GNKA 3UIBA 4OTPA 3K3JA 1OZ1A 2XNEA 5D1JA 4XG9A 5HBEA 3GVUA 3MB6A 4JBOA 1STCE 2ZV2A 3OEZA 3QTIA 4JDKA 3BI6A 4NCTA 5IU2A 4J1RA 5CWZA 1H1RA 4M67A 3F3UA 3COMA 4RJ8A 3VRYA 4A4XA 4JX7A 4EL9A 5DWRA 4RJ5A 4U3YA 3U4UA 4AZSA 2OJGA 3LOKA 5FM3A 3TKHA 3ZHPC 3MJ1A 1I44A 1P5EA 4XV3A 4UB7A 3O8TA 4FK3A 3LFAA 4AU8A 1UU9A 4XRJA 1GJOA 4RVKA 3GT8A 5B2LA 2BKZA 4BR3A 5H9BA 3D94A 4FNWA 4PPAA 1SNXA 1YOJA 2HWOA 4MH7A 4WD5A 3W2OA 3SVVA 2PUUA 4G9RA 4OBPA 4XHKB 1XH9A 3AOXA 4QP7A 4RQKA 4BTKA 4FGBA 3CKXA 3IOKA 2VUWA 3O7LD 2A19B 2J2IB 2HENA 4K18A 3WZUA 4O0UA 4QTAA 5BVNA 5EOBA 4GKIA 2QCSA 3PLSA 1XHAA 3VS2A 5CF5A 2PZ5A 1YHSA 3HDNA 4C35A 3SOCA 2BIKB 5ITAA 3KU2A 4JBQA 2FSOX 3FI4A 4QMQA 2AUHA 2E9NA 4ZJVA 4UY9A 1YOLA 2P0CA 4I0RA 4BCIA 4KD1A 2OIDA 2ITQA 2WAJA 5GJFA 2WIPA 4F9YA 3NW6A 3EQBA 3BYUA 4FE2A 4PL4A 5DRDA 2WQBA 2X9EA 5EDPA 2FB8A 2YCQA 4I5MA 1OBDA 2JBPA 3LXNA 3Q60A 4HCTA 3TJCA 4J71A 2IW8A 4RG0A 5HESA 5DMZA 3QX2A 1KE8A 2C69A 3OW4A 4Y85A 5AUTA 2EXMA 4C58A 3HRCA 3K5VA 3LFSA 4BZOA 4WNMA 5J7BA 3NVKI 4L7SA 1KOAA 4TPTA 3NYNA 4M14A 3U6IA 2C6OA 2UZNA 3OWKA 4IAZA 4K33A 4IIRA 4FTLA 3BYVA 3M2WA 2OIQA 3D7TB 5KMLA 3HKOA 2Z8CA 4WG5A 3PSCA 2QD9A 2Z7RA 2OJ9A 4FKUA 4MWHA 4CKRA 4XG6A 5CSXA 3DZQA 2RF9A 1U5QA 4ZZMA 4AN9A 5KHXA 2KTYA 4FV9A 4F65A 1JLUE 2QC6A 3U55A 4NZWB 4FIJA 2CPKE 4R3CA 3VUGA 2Y6OA 2B9FA 2W99B 3DU8A 1R3CA 3EQPA 4RIXA 4WIHA 3E3BX 3ELJA 3F2NA 3I7BA 3FYKX 2GCDA 4CZUA 4YR8A 3LXKA 4DGOA 4E5BA 4F6SA 3NMUF 3KMMA 5AR3A 1FOTA 4TNBA 4F6UA 4EH8A 4UMRA 4LGHA 4L01A 5M09A 2QOIA 2XKCA 3D83A 4E6CA 1YWVA 4OAUC 4YJUA 2XIZA 3FLSA 2OH4A 5JKGA 4PL3A 3I79A 3ENMA 1R0EA 3CD3A 4O0XA 3U51A 4BKYA 3AT3A 1Y57A 5CEPA 3ENHA 4RWIA 2RFSA 4CMUA 3DA6A 4EQUA 3DFCB 5HNIX 2W5AA 4YJVA 3FHRA 3RPYA 4D9TA 1FMKA 1YDRE 5DT4A 4FT0A 4DAWA 3SRVA 4CG8A 3DKFA 3MI9A 4L53A 4IFGA 3RK7A 4YJRA 2H8HA 2J7TA 4FT5A 5J87A 3EHAA 4PTCA 4GU6A 2BMCA 3C0HA 4JJRA 5AA8A 5BVEA 5CEQA 3U54A 2XCKA 3TL8A 1PXOA 2UW7A 5CZHA 1URWA 2FO0A 2XNMA 2HY81 4GT5A 4KIQA 5FDXA 5JN2A 3UJGA 5ANIA 4IM0A 4QYYA 4GVJA 4L3JA 4U40A 4BIEA 2CNQA 2FYSA 3TDVA 3Q5IA 5AMNA 4NK9A 3TZ7A 4TKSA 1YHVA 2PMLX 3F61A 3KK9A 1BX6A 4FVQA 5KMKA 3WIKA 4FKOA 3GC0A 2XJ0A 4M97A 3LMGA 3CCNA 3VHEA 4DT8A 4FK6A 1XKKA 3KEXA 3DQXA 3R8LA 4RFYA 4D0XA 1U59A 1UU8A 4CQEA 4O7ZA 1SMHA 3DB6A 4EK5A 4G5JA 1OITA 3FLZA 3DAEA 4O2PA 2IW9A 2GFSA 4CVAA 2PYWA 1V0BA 2R7BA 2G9XA 1PW2A 5TT7A 1EH4A 3UBDA 5KKRB 2HIWA 2JIIA 1LR4A 2RG5A 1YXXA 3RHKA 4RBLA 4ZXTA 1OKWA 3IPHA 2X39A 2XNOA 5HI2A 2EVAA 4DG0E 1G8AA 4RX9A 3PIYA 4RSSA 3SW7A 3PSBA 4FKQA 4XP3A 2IZUA 1GOLA 4KB8A 4FOCA 1K9AA 5K0KA 4R7HA 4G6LA 4AGCA 3P7AA 2O3PA 3V5QA 4AZFA 4FG9A 1OL6A 4S31A 1RJBA 2YIXA 4RIOA 3R71A 3V5WA 2WB8A 5HTCA 5AIRA 2A27A 4G3GA 5ANGA 4AN3A 4BCGA 3TUDA 3OVVA 4EH5A 2JDOA 1PXJA 4DFZE 4GT3A 3O17A 5FXQA 3IK3A 3U87A 3QTZA 3TXOA 4KBCA 4R3RA 4PF4A 2QOKA 2UW6A 4RWKA 5A4TA 2BALA 2PVKA 5KBQA 3DV3A 3ZFMA 2PE1A 3A62A 3IKAA 3BIZA 2PZYA 4C4EA 4Q9ZA 2X81A 4O82A 1MRVA 3ZONA 5IDNA 4HZRA 4WNOA 4TYHA 2WTDA 3QXOA 3UG2A 4A9TA 3MWUA 4KKGA 3Q9YA 2E9VA 4YTFA 4QTCA 1IASA 4UMPA 5DG5A 2GS7A 4JIKA 1DI8A 3MGYA 3PE1A 4WKQA 5AR7A 4CKIA 3C13A 3RPRA 4FKIA 5FD2A 2QR7A 4OW8A 3U9NA 3EN9A 3R0TA 2DYLA 4MD9E 2R3GA 4FGRA 3F7WA 4H58A 2QKWB 2C1AA 1XH6A 5GIPE 2YJRA 3FSFA 3L1SA 4TWCA 3QA0A 3VW6A 2XBJA 3IOPA 4EEVA 3OTUA 3C4CA 4J98A 2WU6A 2VV9A 2ONLA 5EW9A 4EK3A 2Q83A 3F3TA 5J95A 2CGUA 3QTRA 1ZLTA 3TV4A 1WFCA 4KBKA 3ID6C 3KXNA 4JX3A 2ITTA 2OF2A 2YM4A 5J1VA 2HW7A 4HGTA 3ZLYA 1WBWA 5H8GA 5LMKA 4R1YA 2WMSA 2PUNA 3LFEA 5AR4A 3SXFA 3PLAE 2XBAA 3LW0A 3RAIA 3P7CA 3QCXA 5E7RA 3R6XA 3OXIA 2XS0A 2WXVA 2JDVA 5KMOA 4CTCA 5A14A 4CXAA 3SDJA 2QI8A 2C1BA 3R00A 4IEBA 4Z7GA 3T9TA 3FEGA 4FUXA 5LCJA 3CXWA 3PY3A 4I21A 2WMAA 3ORTA 5E91A 1XO2B 3C5IA 4QYHA 2CHLA 3UO4A 4DEAA 2BZJA 5ETCA 2X8EA 1Q8ZA 2JEDA 4OUCA 3VVHA 3COKA 3IECA 4U44A 1S9JA 3GU5A 4MX9A 4NM5A 5CSVA 2G2FA 2REIA 4OLIA 3OG7A 5EQEA 3MIAA 3I1AA 3UVRA 4X2GA 3DNEA 3KXMA 5HG9A 4PMMA 3ZSIA 5EYMA 3L9NA 3U8WA 3CY2A 4AOIA 2BAJA 3TG1A 2BIYA 5M4IA 4FV4A 3BELA 4U79A 2PMOX 3LJ2A 4F1TA 5CZIA 5TKDA 4RC3A 2ZDTA 4FL3A 5E8YA 4AG8A 4L9IA 5CAPA 2F2UA 2HCKA 4BHNA 1H1QA 5L6WL 2PE2A 3DOGA 1H8FA 3DAJA 3R22A 4G3FA 4EOPA 2GHGA 5AAGA 4O1PA 3DGKA 4FI1A 4Z7HA 1ZXEA 2PU8A 3PRIA 3UIXA 4EUUA 3VO3A 1UNLA 4GG7A 2RFEA 3BGZA 2J50A 1F0QA 3QCQA 3ZEPA 4TTHB 4DGNA 2Y4PA 3ODYX 4BKJA 4YURA 2PUPA 4EYMA 3Q2JA 3F5XA 3QHWA 1QL6A 1OPJA 4JNWA 1FVTA 1TQIA 2PTKA 5DR6A
chains in the Genus database with same CATH superfamily
3QA8A 1KUTA 3RPSA 4ZTQA 3AT4A 2PVHA 3Q6UA 5AV2A 4I6HA 1A06A 4DINA 3V01A 4AZEA 4L42A 4YTHA 2R3QA 3OMVA 4CFWA 3SKCA 3QGWA 2W1EA 4XOZA 3U9CA 2W1IA 3GU7A 3QD3A 3OY1A 2C0IA 1RE8A 3KN6A 3L8PA 2X0OA 4IHPA 4KS7A 4NL0A 3OCTA 3V8WA 3IW6A 3FKNA 3Q32A 4CNHA 4UALA 2AYPA 5AP4A 3FXZA 4BDCA 3PXRA 3AC4A 2X8DA 1YKRA 4XUFA 5AP0A 3FI3A 2J0LA 3MSSA 4C02A 4JDJA 1FGKA 1W83A 3R73A 2J5EA 3MFRA 3MS9A 3GCSA 3KC3A 4RIWA 5J79A 3G6HA 4QYGA 1PXMA 1UU3A 2HZNA 3AT2A 2P2IA 4EJ7A 5FG8A 2WQEA 2YACA 3SQQA 5AX3A 4BDIA 5EHYA 3PFYA 3SV0A 4MXOA 2BUJA 3GQIA 4BGQA 4Q2AA 2VWIA 4FL2A 4W4VA 3TJDA 4ZTSA 1PF8A 3E63A 1IG1A 3FMKA 1WZYA 3TTJA 5KO1A 3ZLSA 3UPZA 1YXVA 3LAUA 3UO5A 5EM6A 1Q99A 4OBQA 4FYNA 3E7OA 4EJNA 3ZSGA 1K3AA 3VW8A 5CASA 4O83A 4JVGA 4V0GB 4UEUA 2WQMA 3LHJA 2XNGA 3R9HA 4FEWA 4HYHA 3DJ6A 4NTTA 5DOSA 3LFDA 2W05A 5H3QA 4MNEA 2VX3A 4R3PA 4AGDA 2ZB1A 3W16A 4LG4A 4JBPA 4L8MA 2JKKA 4E8AA 5JRQA 2OZAA 5HO6A 4MTAA 2G2IA 5K3YA 4PMPA 3ATSA 4AA5A 4F7JA 5CAVA 5HIEA 5KUPA 3HVCA 1XMMA 4BJJA 3VS3A 5HVJA 1M2QA 4F7SA 5HIDA 2EB2A 3FI8A 5CF4A 5JGAA 5ICPA 5IH5A 4EI4A 2ITZA 5E9EA 3NNXA 2ZDUA 3D5UA 3BU5A 1BUHA 4MVFA 5C8NA 2XRWA 3L9MA 3I0OA 4GT4A 3BHTA 4B9DA 5KMJA 3FMMA 3ORXA 4E20A 4MUQA 5CU6A 2I40A 3FE3A 3ZFXA 5I4NA 4KKEA 1ZYSA 2RG6A 3FMJA 3QZIA 4OTWA 1YI6A 2ZVAA 4FRFA 4O27B 4JT3A 2XK3A 3EJ1A 3K54A 4L67A 4CRLA 3P1AA 4ZTMA 3N4TA 3C4XA 3E64A 3MA6A 4ONAA 4BYIA 5L2WA 2CNVA 2B54A 1J1BA 3HUBA 4F6WA 4ZLZA 4B8LA 4RRVA 1ZOHA 3QRTA 5LQFA 2QG5A 2QNJA 3SXRA 3Q53A 3QHRA 1H08A 4I22A 5HIBA 5KBRA 2XEZA 3DK7A 3C4EA 3VNTA 3U4WA 3EIDA 4L44A 3GCVA 2JDSA 3R7OA 3R30A 4A9UA 2VNWA 2OO8X 2V55A 5HE1A 3PWDA 5FDPA 1AQ1A 2B9HA 2O0UA 4H3PA 4FL1A 3KVWA 4IAIA 4TT7A 4FEVA 4GYIA 3LCTA 2OXDA 4D1SA 5KMIA 4F08A 1UKIA 2BTRA 2C6LA 4IB3A 2O2UA 1URCA 3AC8A 4FTJA 2XH5A 1XQZA 3BYOA 4FZAB 5J1WA 3LQ5A 3HL7A 3QYZA 2QOBA 5IUIA 4X2JA 2OSCA 3G90X 2GNFA 4DLIA 3LFQA 4TZRA 2XZSA 4G34A 4H3BA 4PX6A 4ZSLA 4AW2A 5HTIA 3MW1A 3UC4A 3RKBA 2XNNA 5LOHA 4C0TA 2A4LA 3OWPA 4O7TA 4FZFB 2KULA 5LARA 2IVTA 3Q96A 4HCVA 4S2ZA 1KE9A 2J0MB 3PA3A 4WG4A 3FBVA 1FPUA 2BAKA 4K2RA 1Q62A 3WF8A 4EH6A 3LPBA 2CKQA 3MTFA 3QBNA 2ERKA 3PPZA 3ZS5A 1JBPE 4ACCA 4F0FA 5KNJA 2PUIA 4AXEA 2BHEA 2XK8A 2XM8A 4I6QA 4PP9A 4EC9A 4LDTA 1GZNA 1NY3A 1XJDA 4PPCA 1ST4A 5HE3A 4A9RA 2XIYA 3WBLA 3LLTA 2QOCA 3QZFA 4YO6A 4DLJA 1M2PA 3HLLA 4GYGA 4K77A 5DN3A 3A7FA 3TV7A 2R5TA 4BY9E 4FKPA 2JLDA 2X2MA 3VUDA 2WNTA 1T45A 1YXUA 4O4EA 4YLLA 5CYIA 4EOMA 3N4UA 3CIKA 4AXDA 1RDQE 2Y4IC 1H07A 1W8CA 1H26A 4CCUA 5IF1A 2E2BA 3ZXZA 1ZY4A 1JVPP 4RZWA 2J51A 4XP0A 4C4GA 4ZY6A 3MFUA 2CCHA 3RJCA 2IVVA 4RJ4A 3FPQA 5HNGA 3VUHA 4AN2A 4V05A 2VWVA 3UPXA 4G16A 3FZPA 3I7CA 3NYOA 1OIQA 4GJ2A 4GVAA 4BIDA 3PPKA 4OT5A 4HPTE 4IW0A 4BDFA 4AAAA 3PYYA 2ITWA 3KL8A 3REPA 4JAJA 3OWLA 4PDOA 5AP1A 4BGGA 1PXIA 2YAKA 4QNYA 3ZLXA 2CN5A 4I1ZA 3S3IA 4FTKA 2HW6A 3I60A 5DR2A 3T9IA 3CGFA 3ALNA 2NPQA 5E8SA 2JD5A 4KKHA 3R9NA 4R5SA 4ZK5A 1REJA 3VONA 2BPMA 4I5PA 2PHKA 3D5XA 2YWPA 2W1ZA 5L8JA 5EI8A 3UVQA 1XWSA 2NRUA 2F4JA 2NP8A 3BYMA 4IJ9A 4APPA 4CCBA 4AP7A 2YIRA 4A07A 2F7XE 1MRUA 4ZZOA 1VJYA 4J8MA 4XV2A 2ZJWA 3RGFA 4OTRA 4S33A 1JKLA 1Q3WA 3C5UA 4RJ7A 4MF1A 3AMYA 2PVJA 2SRCA 1W7HA 2W4JA 4FKLA 3HP2A 4BTMA 3A8WA 4MF0A 2OBJA 4FTUA 3ORLA 4U7ZA 3IW8A 2DWBA 5BVOA 3NUXA 5CNNA 3PVBA 5JFVA 3SG9A 2VO3A 2R9SA 3A2CA 4FT7A 2XK4A 3R7VA 2BRGA 1JKTA 3TWJA 5GZAA 4YHJA 2GQSA 4FX3A 2UW9A 2Y8OA 3QC9A 3R8MA 4EWQA 5HQ0A 4PDSA 5CXHA 2LGCA 1PHKA 2B7AA 3I5NA 3ITZA 2QKRA 1LUFA 3QALE 5AUXA 4DCEA 3CQUA 1SZMA 3P0MA 5IQFA 2E9OA 4L46A 4MXAA 3KGAA 4FT9A 3CJFA 1YRPA 2QODA 4UWCA 3D15A 3UP7A 4DEIA 4G2FA 2BDJA 3H30A 4EOKA 2DQ7X 1Q97A 3PRFA 4PDPA 4O86A 2UW3A 4XNEA 3VN9A 3VBTA 3QCYA 2WMBA 5AP7A 2UW5A 1B39A 3HEGA 3PVUA 1DI9A 3FI2A 3ZU7A 4FTRA 4EYJA 5FBOA 1LP4A 2C6KA 3BLAA 2XJ1A 2C4GA 2W7XA 4JRNA 3A7JA 4FVRA 3WF6A 2IG7A 3KF7A 1Z57A 3SHEA 4BYJA 2EUFB 4GFGA 3JS2A 2WTCA 3L9PA 4BCQA 3Q4TA 1DAYA 5BQ0A 4BCHA 2QONA 4ID7A 2C5OA 2YA9A 4IB1A 1LEWA 1Y8YA 4GU9A 4UYAA 4H39A 4RVTA 4AOTA 1OL7A 4AZWA 4BTFA 3RZBA 3TEIA 5HVKA 3UG1A 2QQ7A 3FPMA 3TKUA 3NAXA 3HMOA 2GNIA 5D9HA 3R9DA 4CQGA 4MCVA 5L6PA 5EYKA 3VQHA 4GUEA 1GY3A 3KRLA 2O5KA 4GKHA 2GU8A 4LMNA 4IH8A 2F2CB 5DRBA 5AUZA 2WTIA 3R02A 4NEUA 4AZTA 4K0YA 3EN5A 4Y5QA 4BL1A 4KIKA 4D9UA 4DEHA 3NUUA 3VQUA 4TL0A 4CT1A 4FIGA 5DPVA 4IB5A 1NA7A 3MFSA 4DE4A 4F78A 5H2UA 2UVZA 4AUAA 3SXSA 3KIOC 3CEKA 3V04A 4C34A 4K11A 5CAOA 5E1EA 1WAKA 2EXEA 2OK1A 4NIFB 3D7TA 4QMTA 2QVSE 5CVFA 1CKPA 1BYGA 1CDKA 1PXPA 4QPAA 1UU7A 2QOHA 3RAWA 5LVNA 5EOLA 1ZYJA 3EN7A 4ORKA 1X8BA 3EQIA 4QMWA 4V04A 4ENXA 3PIXA 4U41A 4NWMA 2ITNA 2YIWA 4FV3A 3DKCA 3UOKA 3OXZA 4AA4A 2YM5A 5IH6A 3LMHA 4R78A 5ETIA 3VBYA 3RI1A 2UW4A 4QYEA 3KMUA 3FQHA 4HVGA 5EHOA 3GU6A 5IH4A 3BE2A 1Q3DA 4YTIA 3WE8A 4AGWA 3NW7A 4AE6A 1WBNA 4EH4A 3ZM4A 4DGMA 5M57A 4FIHA 4MKCA 4RC4A 4N70A 4KINA 4YC8A 4LI5A 3KY2A 2HK5A 1KWPA 3DY7A 4PUZA 1Q5KA 2J0JA 2JBOA 3TUCA 4DDIA 3OROA 5HVYA 3QZHA 4CSVA 1H1WA 3PG1A 3MA3A 2YM3A 1KE6A 4X2KA 5HLNA 5K4IA 2UW8A 2VTJA 3ET7A 4OTFA 4L3PA 5IZFA 4XS2A 4AXAA 4MXCA 3R9RA 4GIHA 2OWBA 3L8SA 4I3ZA 4GUBA 4BZNA 2CGWA 2IF8A 5E8TA 4Y95A 3DLZA 2C3LA 5BX0A 4RT7A 3OTVA 5CF8A 4G3DA 2OGVA 3H0ZA 5CEIA 4ASEA 4CYIA 4ZLOA 3CD8A 4U43A 3AG9A 3ZUTA 3ZSHA 2OXYA 4AX8A 4IWOA 4C61A 3RALA 2XJ2A 3KXHA 4DTBA 2BRMA 2JKMA 1TZDA 5EM5A 3BBTB 3NDMA 4LQMA 2GQGA 5F4NA 3PTGA 3D2KA 5EW8A 3MTLA 3N4VA 3NPCA 2WQOA 3ZC5A 1YXTA 3VJOA 5HLWA 4DBXA 2J9MA 4L43A 4IAFA 2HY0A 2WTJA 4KAOA 2F57A 3DJ5A 4QMVA 1Y8GA 2FSMX 4GK3A 4M12A 4YC3A 5K5NA 4MBJA 3KF4A 4FZ6A 1P4OA 2XCHA 4CG9A 2F7EE 2PVNA 3FMEA 3S4QA 3GFEA 3OT3A 2ITVA 2YCFA 4HGSA 4EONA 4EHZA 4DHIB 2XKEA 2VO6A 4U0IA 4XX9A 3ANQA 5AUWA 2I1MA 4EOOA 4F63A 4XJ0A 2W1FA 2CKPA 2JAVA 3ZO3A 4I0SA 2OJFE 3CTHA 4G6OA 3GOPA 1KE7A 1O6KA 3LM5A 3F5PA 3UOJA 5HBJA 4UN0C 2YITA 2Y6MA 3DXPA 1Y6BA 3ZOSA 3PJCA 5EFQA 1BLXA 3KMWA 5GHVA 3NUPA 5E4HA 2UVXA 4FIIA 3C9WA 1W0XC 2QLQA 4NJDA 4IM3A 4BVUA 1J7UA 2ITYA 3HV6A 4YC6A 3FJQE 2W0JA 5L2IA 4DEBA 4DFYA 4EORA 4F7NA 4F4PA 3AC2A 3QF9A 1ZOEA 1WBSA 3VAPA 3T3UA 4W9XA 4EKLA 3EL7A 2R3PA 3NWWA 2OU7A 2ITPA 2C5XA 3O96A 3A61A 4RX7A 4XRLA 4O22A 4X2FA 2VD5A 3SX9A 4I94A 3ZRKA 4LL0A 4U42A 3FKOA 4YJPA 2YDIA 4QP8A 3NAYA 4LUEA 3F5GA 4TYGA 5C4LA 3W0RA 5EI2A 3EWHA 1PYEA 4X3FA 4XG7A 3PVGA 5KZIA 2OF4A 4F9BA 1JPAA 4QMYA 4DT9A 5LWNA 5CU3A 2G01A 3LXLA 5ANJA 1MQBA 2QU5A 2W06A 2QHMA 4OTQA 4EZ7A 2VO0A 4CFNA 4YJNA 4CLJA 1OB3A 4O0SA 4W4WA 4WOVA 1YXSA 3F2RA 1GIHA 2VN9A 2R3KA 3GNIB 3ORKA 3TDWA 1BMKA 3VBXA 5CU0A 2UZWE 5GZ8A 1APME 5KZ0A 5HU3A 2W17A 3OT8A 4U6RA 4Y8DA 3LJ1A 3Q2MA 3TNPC 4QMSA 4QMOA 1AD5A 4BTJA 2VWXA 1F3MC 4G1WA 2FSLX 3UC3A 5K4JA 5J7HA 2QO7A 5HTBA 1Q8UA 4QO9A 4EH3A 3GU8A 4X0MA 5AV3A 3POZA 2JDRA 3FAAA 3F88A 4S32A 4BWPA 2Y7JA 2O64A 2JGZA 4FNYA 4A06A 3OOMA 3R2BA 3F3VA 2IVSA 3TNWA 3GGFA 3LFBA 5E90A 2R3FA 4AS0A 2PVMA 4K8AA 4ACHA 5JGDA 3DPKA 3T3VA 4O84A 1ERKA 4FICA 1M7NA 4FT3A 4LRKA 2VZ6A 4WSQA 1U54B 2R64A 3BU6A 3ML1A 3EQGA 3UGCA 4E4NA 4FVPA 3Q4ZA 3IW4A 3R8ZA 3P5JC 2PVRA 1JKSA 4WG3A 3RBWA 4ARKA 3QQHA 1NT2A 3EL8A 3L9LA 1G8JA 3MFTA 5A4CA 1JSUA 5DEWA 3QU0A 2YDJA 4KS8A 4O38A 5DEYA 4ZIMA 4NKAA 4TNDA 3S95A 3PUFC 5TOZA 5LVLA 4JG7A 3ZC6A 2BILB 2WFYA 3R7IA 2JFMA 4X3JA 4BGHA 4F9AA 1V0PA 2GHMA 4YSJA 4CFMA 3R01A 2VX0A 4FSMA 2W1HA 3C4WA 4JBVA 5J9YA 3CKWA 1OM1A 2Y9QA 3H0YA 3P79A 3QQKA 2HXQA 5BNJA 2V5QA 3VWAA 3HMMA 3NCZA 2WEVA 4BFMA 3VS6A 4ITHA 4CLIA 1J1CA 2QO2A 4IC7A 2IZSA 3ACJA 3G0EA 4RVLA 5EDRA 5HNBA 2ETKA 1H1PA 2H34A 5FWKK 4AGUA 4GEOA 4BZDA 2ITOA 2ZFYA 3ZUUA 2YLFA 4A7CA 3TNHA 3RZFA 5K0XA 1YWNA 4XBUA 3S00A 2JKOA 3JVRA 4UZDA 3ROYA 3G33A 4H05A 3DK6A 3QQJA 2PSQA 3PDTA 4ZSEA 5CT0A 4FJVA 3GXLA 3OP5A 4LRMA 4DH3A 4ZJJA 3POOA 3RPOA 4HNFA 2WMWA 5CANA 1ND4A 2Z7QA 4JLCA 5DT0A 3W0MA 2X7OA 3MBLA 4QTDA 4K6ZA 3D7ZA 5L8LA 1GZKA 2X6EA 3BYSA 5A3XA 3AKJA 4NU1A 3HA8A 5E8XA 3NZ0A 4ZTNA 4FV2A 1YW2A 2YZAA 3QC4A 3QCSA 4UX9A 3NYXA 3QD2B 4FV0A 2E9UA 2FUMA 2WIHA 4GG5A 4QD6A 3QZGA 4J52A 4FSWA 3WZDA 3JPVA 2XNPA 1OIUA 1H00A 3ALOA 4QRCA 4AW0A 4GH2A 4HCUA 2WMTA 5IPJA 3BV2A 1UA2A 3FQSA 4C2VA 4CZTA 3A4PA 3HNGA 4RX8A 5H8EA 1UNHA 1OGYA 3ZEWA 4EWHA 3WI6A 3PXZA 2F7ZE 3ETAA 4V0GA 4NCTC 3G15A 1ZMUA 2UZEA 4KNBA 4C57A 5HEZA 1XR1A 4AW5A 3KA0A 4L52A 3PG3A 3BHHA 3OCBA 4I4EA 1NVQA 5CF6A 4M66A 3AQVA 3H9OA 2CJMA 2PL0A 4MEDA 4QTBA 4NW6A 2OH0E 4H1MA 4RJ3A 2ACXA 1E9HA 5DBXA 5ETAA 1OGUA 2CLQA 3HMPA 5GJGA 3VBWA 5HX6A 2Z60A 4G3CA 5CTPA 3I0QA 4E6DA 2WEIA 3ULIA 1PYXA 4PV0A 3P86A 3ZH8A 4B6LA 5BPYA 2I0VA 4D28A 2CDZA 4EHVA 3NR9A 2VNYA 1WVXA 3EZRA 4JDIA 5B0XA 3FHIA 1WVYA 4D2WA 1PMVA 2WTVA 3FMDA 3MVHA 1TQMA 3QLFA 5CSWA 2R0IA 3A4OX 3B2WA 1SM2A 4J96A 5C01A 3Q6WA 4ZP5A 3W2SA 4F09A 2C5YA 4PTEA 5ETFA 5EI6A 4AW1A 4E7WA 4DH7A 3GC8A 2B9JA 2GDOA 4QP3A 5I9XA 4FSTA 4FYOA 2ZB0A 5D7VA 3ZLWA 3E92A 2Z7LA 1OI9A 5H8BA 5AWMA 4HGLA 3Q4UA 4IAYA 4G6NA 4PMSA 4UBAA 4CFFA 2HOGA 2EU9A 4YPDA 4ANOA 3HP5A 3QTXA 4IQ6A 3FL5A 4KA3A 3BRBA 4FEQA 4E3CA 5CI7A 3OHTA 4WRGA 3D14A 3VULA 4V01A 3WYYA 2PULA 3G9NA 5BMMA 3UYTA 3E7VA 4ALUA 2B55A 3UQFA 3NYVA 4YU2A 5AUVA 2XNBA 3EOCA 4QPSA 2C6MA 2WO6A 3R1SA 1WBVA 5AIKA 3A7GA 3ORIA 4D5HA 4O4BB 5IA2A 4YHFA 1E1VA 2IZRA 4PPBA 4D2TA 2JAMA 1O6YA 4FEUA 3DKOA 2HZ4A 3F5UA 3JYAA 3NFFB 4RA5A 4TW9A 3Q3BA 4EOLA 4NTSA 3ERKA 3EYHA 2E9PA 3QAME 4UXQA 3V5TA 5JZJA 1L3RE 5A4EA 3IGOA 4FG8A 5EK7A 1CM8A 3O71A 3EFWA 3V6RA 2OICA 3LCKA 3QL8A 5CNOA 3QD0A 4TYHB 3CJGA 2EWAA 2O65A 2RSVA 3EN4A 1ZRZA 3NGAA 3TUBA 1SVHA 2WMRA 4C3PA 4MBLA 3IQ7A 3AC3A 3FSKA 4N4SA 4O1OA 4PMTA 4AE9A 4AFJA 2PVFA 3PJ8A 4M0ZA 5B2KA 4CFXA 3F2AA 3F6XA 1XBBA 3BU3A 4G5PA 3DBEA 3W55A 1YI4A 3E3PA 3FYJX 3MDYA 4IZ7A 4QQCA 4TYIA 4AT4A 1HOWA 4EH2A 4FV7A 4CT2A 2B4SB 1KSWA 2Q0BA 2OW3A 5LCKA 4GCJA 2JFLA 1TQPA 2WMUA 4IANA 1DS5A 4OT6A 2Y4IB 5AAEA 4S30A 3R1QA 4HW7A 1NVRA 1ZOGA 4NSTA 5EH0A 2R3HA 4Y73A 3ZTXA 4B99A 4QMMA 4EH7A 4FG7A 2QOFA 1MP8A 3I6UA 5E8VA 5I9YA 3OFMA 1DM2A 3V51A 1WBTA 3QXPA 3VF8A 4AT5A 3BLQA 5T6KA 3W8QA 4LMUA 4E93A 4D5KA 1W82A 4F1OA 5IUHA 2WU7A 4U81A 3HV5A 4UMQA 3GU4A 3LE6A 4BKZA 1XH7A 4JQ8A 4FKVA 4ACDA 4O0YA 2B9IA 2DUVA 5CQUA 4LGDA 4W4XA 4RIYB 3EH9A 4HYUA 3RPVA 4DGGA 4D2SA 3E8CA 2IVUA 3RNIA 5AA9A 1L8TA 4LFIA 4GFOA 2XK7A 4F7LA 1YOMA 3WF5A 2EB3A 2W5HA 3HUCA 3W0PA 5M4CA 4I0TA 1QCFA 4BDEA 1XBAA 4FKTA 4FSRA 3BHVA 1G3NA 4MWIA 4UWYA 1J7IA 2J5FA 4FTTA 4BDBA 5IEYA 3GQLA 5EW3A 3BEAA 5G1XA 3UNZA 2G2HA 2P33A 2OIBA 4FKGA 4IWQA 4EC8A 4WSYA 3FKLA 1PKDA 4QMUA 4LUDA 4AFEA 5IKWA 2JDTA 2PVLA 3HRBA 1FBNA 3GCQA 4OAVB 4R1VA 5HCYA 4GRBA 2XF0A 2ZMDA 1R78A 4O0WA 4O7YA 2P3GX 1UVRA 4O4DA 4C8BA 5HG5A 3B8QA 3LXPA 3FLNC 2NNWB 4KBAA 2VGPA 4R8QA 4RFZA 2VTMA 3EB0A 4FKWA 4EOIA 5B7VA 3ZRMA 3FZTA 4CV8A 5GIOE 1OL5A 4KRCA 3QQGA 1Z5MA 4IBMA 3RMFA 3CSVA 4Z55A 1Z9XA 3R1YA 4E5AX 4MD8E 2P55A 2X7FA 3GCPA 3QYWA 4BDAA 2AC3A 2R3IA 4CFUA 5M4UA 4QMLA 3BKBA 3CPBA 2UZOA 3QWJA 4JRVA 4PRJA 4DEGA 2P2HA 2QHNA 4NT4A 3RM7A 2XYNA 2XK6A 3O7LB 5AEPA 3VS5A 4LV7A 5M07A 4O96A 5FM2A 2I0HA 3AD5A 5L2QA 3P08A 3WZEA 3BQCA 5HD7A 3RK5A 1YQJA 4IZYA 4YJSA 4CTBA 4GIIA 1Q4LA 4FMQA 1IA8A 3PJ1A 1S9IA 4O0RA 4RIWB 4DH8A 3AGLA 4XP2A 2C6EA 3ORMA 3NUSA 1J7LA 4YJQA 2VTTA 1KV1A 4IWDA 5FP5A 3VUIA 2WKMA 2YJSA 4E4XA 2BRNA 2X7GA 4CZYB 5CAQA 1P14A 3OF0A 4GK4A 4ZSJA 1FGIA 4M69B 1XMLA 2VTRA 2YFXA 4O91A 3TIYA 4D4RA 1G5SA 1OPLA 3F82A 4DTKA 5LMKC 3HZTA 3LFFA 3KREA 4NM0A 2J6MA 3WE4A 5FXRA 4O4CA 4GSBA 1R0PA 4FF8A 3MY0A 2ERZE 4QPMA 4USEA 4X6QC 3CR0A 3CS9A 4CEGA 4ASDA 3NSZA 2W4OA 1YHWA 4QTEA 4YLKA 3LVPA 4UMTA 3LMIA 2OZAB 1Q8WA 3FC1X 2W4KA 2HYYA 3LIJA 4MAOA 4NIFA 4YLJA 2H9VA 3COHA 4YNEA 4D55A 4EZ3A 1VEBA 5AUYA 3BE9A 3C0IA 4YTCA 4F70A 4BJJB 1K2PA 3EZVA 3PY0A 5BUJA 3W10A 3ATTA 4FEXA 4BCFA 4YZDA 2CCIA 3H9FA 3MN3A 5BV3A 3E8DA 4JQ7A 5JEBA 4YP8A 3V8SA 4DN5A 3IGGA 5LVMA 4MYGA 2GS2A 4U9AA 5C03A 5I9ZA 3NUAA 2WTWA 5L2SA 2YM8A 3K2LA 4QP6A 2YM6A 4FTQA 1ZZLA 3ZDUA 3PZEA 4WHZA 4QNAA 2HXLA 4EZ5A 4QOXA 3ZBFA 3UQGA 3V6SA 4RC2A 2UZUE 5A9UA 4D1XA 4Q5EA 4XLVA 3RNYA 4UYNA 3T8OA 3FLYA 4DH1A 2X9FA 1H24A 5IG1A 1IR3A 5F20A 5JMSA 1PY5A 4IX6A 3II5A 3QUEA 3UMXA 2J4ZA 2VTHA 4CGAA 3QUPA 3WYXA 4D1ZA 5DR9A 3UIMA 3SGCA 2VTQA 1OIRA 2YABA 4DG2E 2VWYA 3D4QA 2F9GA 4IXPA 1IAHA 3RVGA 2FSTX 2XRUA 2HWPA 2OJJA 1OECA 4O0TA 4TXCA 3RCDA 4H1JA 3VF9A 5IA1A 3B2TA 3DQWA 4NJ3A 3CTQA 3W1FA 3NIZA 4D0WA 1ZYCA 2GHLA 3DK3A 1H0VA 3H3CA 3M42A 5D41A 4ERKA 5F94A 5L8KA 1HCKA 3W2PA 3MPMA 4DC2A 3KULB 5HORA 5LVOA 2AC5A 2PZIA 1FINA 4ERWA 3W33A 5J9ZA 1YI3A 4EQMA 3RP9A 4C3FA 1KOBA 1OMWA 2ZM4A 4FBXA 3EFJA 5HLPA 5BVFA 5EKOA 3TMOA 4MQ2A 2VO7A 3HAVA 1U5RA 1RW8A 3AC5A 4X7QA 4U8ZA 4YJTA 3GFWA 4IVBA 3NCGA 3UVPA 4GJ3A 4I5CA 5A4LA 3WF7A 1I09A 2R2PA 3BZ3A 2JKQA 4JG8A 4FTIA 4GK2A 1GNGA 3SC1A 1QPEA 3TZ8A 5CLPA 4FR4A 3KRJA 5HO7A 2R3JA 4X6RA 3QQUA 4MD7E 1IA9A 5C4KA 5FXSA 5DNRA 3LJ0A 5DIAA 5AX9A 3DB8A 5ANDA 4DFNA 5AV1A 4O81A 3QLGA 5AP6A 3FMLA 4LM5A 3K3IA 4OTGA 4Q5HA 5AR8A 4DH5A 4YO4A 3TKIA 3ZBXA 3OCGA 4FKJA 3G6GA 1W98A 4E4MA 3G0FA 1ZYDA 5I9UA 4APCA 2ZAZA 4IB0A 2XAMA 2GTNA 4EOJA 1XBCA 3THBA 4ZAUA 5K5XA 2PK9A 4BWKA 3TM0A 3S2PA 4DDGA 3ORZA 1M2RA 2X0QA 3ZMMA 4M7IA 2BVAA 2A0CX 5M56A 4OTHA 3FV8A 3UQCA 5JFSA 1Q61A 5KHWA 3CP9A 3EMGA 3SD0A 1PXLA 2PY3A 3O2MA 3W2QA 5HCZA 4YZ9A 3HV3A 2XVDA 3PJ2A 3OEFX 3B8RA 4Y46A 4YZBA 4HVDA 5CAUA 3BL9A 3DXNA 5FLFA 3DFAA 1H01A 2XB7A 2V0DA 4I4FA 4O6EA 4DBNA 3MJ2A 4MBIA 4YNOA 5DA3A 2YIYA 2R3RA 3UOHA 1P2AA 4F9WA 2XKDA 4QEBA 3KVXA 3FL4A 5I9WA 5HE0A 2A98A 3TNIA 4AACA 1GIJA 2W9FB 4FIEA 4DYMA 3JR1A 4ZTLA 1MRYA 4F1MA 4U3ZA 2X0PA 5CY3A 3ROCA 1IAJA 3ODZX 3FY2A 4HPUE 3GCUA 5CEMA 3D2IA 3GC7A 1ZY5A 5IQGA 3O0GA 4JQEA 4TN6A 2ZM3A 3FZSA 4RLLA 3LM0A 2UW0A 2X0GA 3UDTA 4FNXA 3SAYA 3OBGA 4DEDA 4BDJA 4FNZA 4EQCA 5C26A 5ANKA 4WUAA 1MUOA 3DBDA 3PJ3A 3ULZA 4KRDA 4BWXA 2BRBA 4C36A 4LRJA 4ZMFA