4U8ZA

Crystal structure of mst3 with a pyrrolopyrimidine inhibitor (pf-06447475)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
290
structure length
289
Chain Sequence
GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase 24
publication title Discovery and preclinical profiling of 3-[4-(morpholin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-5-yl]benzonitrile (PF-06447475), a highly potent, selective, brain penetrant, and in vivo active LRRK2 kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 289
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u8zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u8zA01
4FEQA 3FPMA 3BI6A 1UVRA 4UBAA 2WQNA 1YDTE 2VTPA 2HZ0A 2YITA 3O50A 4A9SA 3BWFA 1GZKA 3OUNB 3FY0A 5LWNA 3H0ZA 3HAVA 2VTMA 3OWJA 2YA9A 4FKQA 5C9CA 3K5VA 1WMKA 2HOGA 3ORIA 3R7OA 4HW7A 3RWQA 2CN5A 3U4UA 4EBVA 2YFXA 3LFQA 5A4CA 1QPEA 5AP4A 4OTQA 3UNZA 1H1PA 2PVRA 2VWWA 3VO3A 4BCQA 5KMJA 2PUNA 1ZYSA 3N4VA 4CTCA 1VR2A 4ZAUA 4N6ZA 4JDIA 3RHXA 5BYLA 4XG9A 5CSXA 3EHAA 1P4FA 1PJKA 2HENA 4MH7A 5E91A 4O82A 3ORNA 4G17A 5JFVA 2VO0A 4EH3A 4ZY5A 4FGRA 3DT1A 2CGUA 3DNDA 5K0XA 3TM0A 3ZZWA 3MPAA 3L9NA 4W4YA 5E8VA 5ANGA 3C5UA 5CU2A 2CN8A 4S31A 2BDWA 2YIQA 3PWYA 3GUBA 5DN3A 1S9IA 2UZDA 3GOPA 5HG9A 4GIHA 3LFSA 2UW3A 4RMZA 4ZP5A 5L3AA 4ACCA 3F5UA 4FL3A 2VTRA 3ZLYA 5CEPA 2OIBA 3ZMMA 5L2QA 2J0JA 1YVJA 3A4PA 1ZZ2A 4X3FA 4IM0A 4NM7A 3R8ZA 3BU3A 1UA2A 3C4ZA 2VO3A 4Q5EA 2HAKA 4JL9A 4O86A 3COMA 4RQKA 3VS6A 3GCPA 4K33A 4K1BA 3FHIA 3W18A 4UY9A 4DCAA 2BZHB 5FEQA 3CGFA 4O96A 4BF2A 4IANA 4N0SA 2C5OA 4FZ7A 4KSQA 3PE1A 4AZTA 3W32A 2VRXA 5FLFA 4DEAA 3LW0A 4QP8A 4AZVA 2J0IA 3DQXA 3UO5A 4PX6A 5GJFA 3KRXA 4GFGA 5BVEA 4ANBA 5F94A 3HV4A 2JEDA 4FEWA 4H1JA 4RJ3A 2QHNA 5FP6A 3RAHA 4AGCA 2VU3A 2PZRA 3NSZA 1VJYA 4J8MA 2XKFA 4YZ9A 2XK3A 2Y7JA 4R7BA 4B7TA 4Z55A 3G90X 5AEPA 3NZ0A 3E3BX 4USEA 1BYGA 5EK7A 4I5CA 4O7WA 3QL8A 3O8PA 2QKWB 1Q41A 1CSNA 3QTXA 3L8SA 4ANQA 1O9UA 4Y46A 5LMKA 3UOLA 4FL2A 1DM2A 1XH7A 4E4LA 4JRVA 4QQ5A 3LCDA 2H9VA 3O8TA 4O2PA 2WFYA 2C4GA 4FTUA 1OECA 4IAIA 3R1YA 2QOIA 5AUUA 5CANA 1OIRA 4ERWA 3ZUVA 4EK4A 1OKYA 1VYZA 3A2CA 4UMUA 2OKRA 1H28A 4IZ5A 4MYGA 4NCTC 2X4FA 4RJ6A 4FV3A 3F3VA 4DEIA 5DR9A 3GOKA 3D7TA 3IG7A 4JIKA 3OOMA 4L00A 3ERKA 4UWCA 2FSLX 2PE2A 4FL1A 3WF8A 3Q6WA 5LMBA 4ERKA 5IEYA 3BLHA 3V01A 2HK5A 1H1QA 3QQKA 4JDHA 4AXAA 3FLNC 3R7IA 3MB7A 1GY3A 4GT4A 4F6UA 3R22A 2R3IA 3DTWA 3FPQA 4BKZA 4ZZNA 3ORPA 1YOJA 5CU0A 2ONLA 4YZNA 4E6DA 1JKKA 4FG8A 4WRSA 2X8EA 3DGKA 3CY2A 5KNJA 2WEVA 3HMIA 4G31A 3PP0A 5BYYA 3ETAA 2IVVA 4U0IA 2VWBA 4Q9SA 5AR4A 3VUTA 4F4PA 2WMRA 2YHVA 4YTIA 3JPVA 1UNHA 3KMWA 3FLYA 3ORXA 3KCKA 2BRHA 2R3JA 3DK6A 5G1XA 3VULA 3GC7A 1Q3WA 3DKFA 2VUWA 4X3FB 4S2ZA 4CV8A 2QOLA 3ODZX 3VW8A 3KRRA 5J7BA 5DT0A 4C2WA 2CKPA 4PL5A 3EQCA 4G16A 4MXYA 3MSSA 5DR6A 4DF3A 3ELJA 4CQEA 4YSJA 1STCE 3PG1A 4TKSA 5IA2A 2WMTA 1TQPA 3ZH8A 3TZ8A 2GNLA 3VHKA 3OP5A 1J1BA 5EKOA 3W33A 2X7FA 3ULIA 4K77A 2VNYA 4ZTHA 2XH5A 1PF8A 2OXDA 5TOZA 5A14A 2P2HA 3KK8A 3MA3A 4YP8A 2JAMA 3S00A 4IE9A 5JK3A 3QRUA 4YJUA 5HLPA 1QMZA 4MD8E 5DWRA 4BTMA 5FEDA 3AC5A 2WIPA 5E8XA 2X39A 1ZAOA 1TQIA 2QCSA 3FMKA 3PIXA 5HLNA 1UKHA 4FZAB 3Q9YA 4EOIA 1SVHA 1RW8A 3UIXA 5EDRA 5CSHA 4FKRA 4LI5A 3RPRA 3WIKA 4D2VA 3GCSA 5CEOA 4I24A 3Q3BA 3QTWA 5M4CA 4AZSA 4C59A 2VTAA 2J0MB 3NWWA 4FV1A 3HRBA 4X2KA 2PVYA 4C3FA 4C3PA 4AQCA 1QPCA 2BTSA 3EZVA 4A07A 4C02A 4DINA 5C8NA 3ORMA 4IEBA 4DGMA 3R28A 4E26A 3UZTA 3K3IA 4TNBA 3Q9ZA 4ZTSA 3DQWA 4MXCA 3OG7A 4QD6A 2QODA 4FVPA 4KABA 5AA8A 2PVHA 2R3OA 2IN6A 2Q83A 4I5PA 1P14A 1NVSA 4JNWA 3BHTA 5DMZA 1JNKA 1IEPA 3BV2A 2DQ7X 3NW7A 4S33A 2VAGA 4O84A 3W55A 5CALA 2GHLA 4WIHA 3ZEPA 2GFCA 4D1ZA 4E4MA 3DCVA 3FYKX 5M08A 3KQ7A 3D7TB 3CD8A 3HRCA 3AC1A 1ZOGA 3MH3A 4H3QA 5CU6A 2QG7A 3ORLA 3DFAA 3K2LA 5G6VA 3U4WA 4YGAA 3OTVA 5CEQA 5CAVA 5J79A 5HVKA 3C50A 4OTRA 2R2PA 5HG5A 3UBDA 3MFTA 4I6FA 4MBJA 3ULZA 4BCPA 2C6EA 2BZKB 3DXNA 4XLIA 4YBKA 4Y5QA 3R9HA 1B39A 5IQDA 2PVFA 4TWNA 4QMMA 1WBOA 4U3YA 1DI8A 1Y6AA 3FUPA 3BPRA 5EQYA 3ZXZA 3VAPA 4XS2A 2YWPA 5HNBA 2C1BA 5HI2A 4FTNA 4AOTA 3O17A 2P33A 3R2YA 4GK4A 4IB5A 5HIBA 3ZS5A 2BAQA 5KO1A 4NW6A 5JSMA 3JY0A 5CXHA 2UW7A 4CQGA 2J5FA 3UE4A 4RWIA 3GT8A 2J5EA 5IUGA 2W06A 2NPQA 4ZJIA 5FUTA 5J1WA 2IWIA 3DK7A 1XO2B 3LM0A 1XBAA 2BAKA 1TVOA 2OFUA 4BCKA 4D5HA 4QYGA 2IZSA 2XF0A 4LG4A 2B9HA 4J1RA 2G01A 2HZ4A 1MRVA 3P78A 4LOOA 1YI3A 5DT4A 1RE8A 1ZYCA 2PTKA 2PE0A 2XMYA 4BCFA 4D4VA 4FKUA 4ASZA 4F63A 3ZLWA 2BTRA 3C4XA 4F08A 4JDJA 2YLFA 4C57A 4EWHA 2G2IA 4AN3A 1UU3A 3MJ2A 3VW6A 3ZRKA 4DBNA 5DIAA 4TWCA 3ET7A 3CS9A 3WE4A 3O96A 5HCZA 5EG3A 3SKCA 4BYIA 3HAMA 4U81A 4PTGA 4C4JA 1IG1A 4ZSLA 4QPSA 2HCKA 3I6UA 4C4IA 3PPKA 3KEXA 4KNBA 5K5NA 3TUBA 3G9NA 4ZSAA 4G34A 3PA5A 3BQRA 3EQHA 3RK7A 4BDJA 3UC3A 4BTFA 1V1KA 4F9BA 3MDYA 1G8SA 3BU6A 4H3PA 2E2BA 1BMKA 2W1DA 3VIDA 1SVGA 3PLSA 4RWKA 4RX5A 1UKIA 3RBWA 3N51A 2J6MA 2PZIA 2R3KA 4ZOGA 3RI1A 5C03A 2Y4IC 5FBOA 2C0IA 2I7QA 4I6QA 3GU8A 4NM5A 4RIXA 4BHZA 2WHBA 2X8IA 2QO7A 3V5WA 4L7FA 3FZTA 4TWOA 3M11A 4MQ1A 2WOTA 2X7OA 5GNKA 3ZBFA 5HX8A 2XKDA 2QI8A 1KV2A 3QLGA 2UVXA 3IO7A 4GJ2A 2YM6A 3OT8A 4IAZA 4IAAA 4RJ7A 1JPAA 5HVJA 5A4QA 5HU3A 3UG2A 5M56A 2JD5A 3W2PA 2QO2A 2O65A 3W2OA 3PDTA 1R78A 4GFOA 5M07A 2OWBA 3G0EA 4YC6A 3R7VA 3ZDUA 4WNMA 3RK5A 5D7AA 4NUSA 3KULB 4DFNA 3EKNA 4LMUA 4ACDA 4FV2A 3GENA 4JR7A 5JGBA 2W9FB 2R0IA 3HL7A 4W4XA 5CVHA 2PSQA 4PTEA 4X0MA 3PXZA 3UDBA 3DBFA 3O8UA 3EL8A 3FZPA 4PDPA 5FM3A 4NZWB 3ZSHA 3AGMA 2E9NA 3DB8A 2WMBA 3FBVA 2R3MA 5JGAA 3EQFA 2HIWA 2X9EA 2R3PA 3OBGA 2X6EA 3E8EA 3NAYA 1CKJA 3NNWA 3CQWA 3QYZA 4RVLA 1G5SA 4BB4A 5JZJA 3TUDA 4ZS4A 3WE8A 3VQUA 4WG5A 3UP7A 4EHGA 4RFYA 1CM8A 3WYYA 3LCKA 5A54A 5H2UA 3REPA 3KVWA 1ZARA 4BBEA 3VWAA 5EYCA 1IR3A 1JKTA 2ETMA 4IX3A 3L8PA 1ZLTA 4MHAA 4DG0E 3A60A 3O7LD 2YLEA 4MKCA 3MFSA 4EKLA 4YURA 1H1SA 2CDZA 4HOKA 3IOPA 1PXIA 3LCOA 4X6QC 1E1VA 4QMQA 1PHKA 2R7BA 4BGQA 5KHWA 5E1SA 2R3RA 2ZMCA 4G5PA 2XUUA 4B9DA 4BGGA 4WUAA 2XYUA 2VTLA 3N4TA 1I09A 4DGLC 1WCCA 3UIBA 4EH7A 2BRNA 2CNVA 3DBEA 5HNGA 4KUJA 4FUYA 3LQ8A 2XCHA 1Z5MA 2A4LA 2YCFA 5HBJA 3FYJX 3LIJA 4RQVA 1PXLA 4QMZA 4G3EA 1AGWA 1KE9A 4BCGA 4Y72A 4O0RA 3UP2A 4U9AA 2JC6A 4BCHA 4DGGA 1M2PA 1URCA 5JZNA 5KMLA 1JKLA 2ITQA 3HV7A 2OK1A 2VTNA 4FA2A 5LVNA 3KCFA 3KVXA 3VBTA 5DR2A 5EYDA 2ETKA 3NLBA 4IWPA 4D0WA 2BMCA 5DPVA 4NT4A 5CY3A 3F9NA 5CT7A 4L46A 4DH7A 2BFYA 4YPDA 3QGWA 2ZM4A 2XNEA 2RKUA 4ZMEA 2XIXA 2E9PA 4JQEA 1IRKA 3M42A 4AFEA 4YSMA 3AMBA 5JH6A 1H0WA 5DI1A 4O0XA 4OUCA 4FT3A 4CZUA 4F9AA 4PMPA 3TJDA 4GT5A 5L2TA 4XBRA 5F20A 4DH5A 1OZ1A 2VNWA 3HECA 4GIIA 1YQJA 4DH3A 1OKZA 4NWMA 4TYEA 2WMXA 4KKEA 4UALA 1QPJA 3ZUUA 4FTRA 2HYYA 4G3FA 3BHYA 5FWKK 2ITZA 3PXQA 3FDNA 2X2MA 4UMQA 2J4ZA 4CMTA 5CX9A 4O1PA 2XIKA 4DTAA 4KA3A 2OH4A 3G6GA 4FNYA 3TV7A 1OIQA 2WQMA 4BTJA 1OIUA 4FT5A 3W2CA 2VTIA 4CV9A 3WZJA 5H8EA 2R7IA 1OMWA 3FWQA 3P7CA 4TY1A 4KKHA 3KMMA 4FX3A 3C51A 3COIA 3RPYA 3P4KA 4PPBA 4HPUE 2UZOA 4O22A 2C6LA 5LCJA 2CKEA 4JS8A 4EC8A 3QKMA 4M67A 4HYUA 4D9TA 4EOKA 2W1FA 1Y8YA 5AP6A 4IQ6A 2PVKA 3VS0A 3KN5A 5CASA 4DLIA 3R83A 4DG3E 5A6NA 5ANDA 4K6ZA 3CTQA 3VUHA 4D2RA 1U46A 3NUUA 3VS5A 2AC3A 5AIKA 3VVHA 3Q32A 4F7SA 3MH1A 4XCUA 2BKZA 5EKNA 5CF6A 5T6KA 5ANKA 2ITVA 5HZNA 4FK6A 3G5DA 3R7YA 4MK0A 4BDAA 1CKPA 2EXCX 3QD2B 3NUXA 5LOHA 1Q8ZA 2QQ7A 1ZZLA 2OU7A 3T3UA 4CMOA 1QCFA 3CR0A 3P9JA 5J95A 5E4HA 3CGOA 2NO3A 1U4DA 3FMDA 3OFMA 3CSVA 4BWKA 1SNXA 2JITA 2UW8A 3U54A 2BIYA 2FUMA 5EYKA 2ZMDA 1R1WA 2YM7A 3H3CA 4RRVA 4WRGA 3U6HA 4XG4A 3KXGA 2PWLA 2FGIA 3S95A 4YHJA 5JKGA 3LMHA 1E1XA 2C3JA 1XH4A 4XG2A 3SDJA 3QD0A 4LRKA 4F64A 4R7IA 1KUTA 5M06A 1FGIA 2O63A 2JLDA 5A4LA 2GCDA 3QRKA 4TTHB 4PQNA 4AOIA 2XK4A 4E93A 4J53A 3S3IA 4O7YA 5KBRA 2B52A 2C69A 4I0SA 4ZY6A 4EZ7A 1T45A 3GCQA 3VS7A 3P7AA 4IFCA 2WMAA 3RINA 5HORA 3WI6A 3ZSIA 2ERKA 3ZYAA 4DFYA 2GU8A 5AV1A 4RA4A 5LVPA 4E5AX 4ENYA 3QRIA 4KRDA 3KXMA 3WZEA 4QMTA 4OTFA 3GFWA 2IZRA 2OZOA 3NR9A 5E9EA 5EOBA 2HZNA 4AP7A 2BZJA 3PXYA 2HWOA 3G0FA 4PPCA 2C30A 2WZJA 4GU6A 3JVRA 3RTPA 5FTGA 3DOGA 3FMHA 4UMTA 3FKOA 4JI9A 1H07A 4EOJA 5IH4A 5EQPA 4FGBA 2ITNA 2UZWE 4IHPA 1H24A 2OJGA 4BDGA 1J3HA 2RFSA 2OI4X 3E3PA 1V0PA 1ZOHA 2GTMA 3BELA 4W8EA 3R1QA 3MTLA 3NGAA 4IZYA 4JLCA 4ZSEA 4L53A 4QYHA 3QFVA 3OWLA 3M2WA 4U5JA 3QX4A 4F99A 1O6LA 3DJ5A 3JR1A 5IDPA 3CC6A 3PXFA 4J97A 3U51A 4KAOA 3HMPA 3KXNA 4FNXA 5L6PA 2IPXA 2W5AA 3SG9A 3I5NA 5J5SA 5JQ5A 5CS6A 2RF9A 1H08A 1J91A 5AV2A 2BKKA 4K2RA 4PRJA 3A7JA 4EQCA 2JDVA 3FSKA 4RA5A 3MY5A 3BX5A 5DFPA 2HELA 3DZOA 3LQ3A 4XG8A 5DYJA 5EW9A 3ZC6A 2ZV9A 3SA0A 1JAMA 3C4WA 3PP1A 4BI1A 5GIOE 3Q53A 3ANQA 5AADA 4IAFA 4TT7A 5E7RA 3NNUA 1YHSA 3I0OA 3D9VA 4KKGA 5BUEA 1NVQA 4K0YA 5AAFA 3RNIA 4EUTA 2WTCA 5HCYA 1GJOA 1KV1A 1IA9A 3TKIA 3SVVA 3WARA 1MQBA 3WYXA 3FQSA 2I6LA 3BIZA 5HKMA 1Y6BA 3G2FA 4DC2A 5F1ZA 3PJ8A 4P5ZA 3Q60A 1WBPA 3DAKA 3OS3A 3LQ5A 1CKIA 4FSNA 5CF5A 1FINA 4D0XA 3EFWA 4C4FA 4C8BA 2PPQA 3PA4A 4DITA 5B7VA 5ITAA 2KULA 3RVGA 3Q52A 3D5UA 2J50A 3HV3A 4FOCA 3SQQA 4HGEA 4BCIA 4FKGA 3BQCA 4JT3A 3CPBA 5L8LA 4M0ZA 5CZIA 1APME 2BPMA 3DU8A 2UZTA 5CVGA 5KHXA 3ZRLA 4FNWA 5EQEA 2VWXA 4QTBA 4I1ZA 2YDKA 4EJNA 4EH5A 2ITXA 4FKLA 2GFSA 4I0RA 4EI4A 4BWXA 2ZB0A 3FMLA 3A4OX 3POOA 4ZY4A 3HKOA 3IW5A 3NDMA 3UOJA 5EYMA 3QTRA 3R00A 5IQBA 3AD5A 3EB0A 4XRLA 5BMMA 2W1CA 5FBNC 5BMSA 2YWVA 2PK9A 5FM2A 3GI3A 3KXXA 2GS2A 1O6KA 4EH8A 2CNUA 1M2QA 3R0TA 4MF0A 2NRYA 3C4EA 4RX7A 1WVXA 5I3OA 2OW3A 2C1AA 5KZ0A 4TN6A 2CLXA 5HEZA 4TNDA 4FTIA 2F57A 4YBJA 4XV9A 4IDVA 4AFJA 2VTOA 2C6TA 4WNPA 4P7EA 3IK3A 1ERKA 4ZTQA 3TTJA 4D1XA 3TKUA 2R9SA 4DEHA 1KE7A 4BR3A 4AUAA 3TL8A 2Y6MA 3VUDA 2W1EA 1E9HA 5JN2A 4JIAA 3FLZA 4QTDA 5IA3A 3MFRA 2DUVA 3HRFA 4KBCA 5JFSA 2OLCA 1HOWA 1RJBA 1YOMA 2CSNA 2QONA 2BCJA 5IEVA 3BGPA 4MXZA 3SW7A 3NNXA 2PMLX 4KSPA 5ANJA 3TEIA 3VBVA 4RLKA 1VEBA 1U54A 5BYZA 4J8NA 4DE4A 2GQSA 1XBBA 4M12A 3Q4TA 3DBDA 1YI6A 4O7VA 3CEKA 1OIYA 2Z7QA 1GIIA 2JIIA 2UW5A 3MJ1A 4RG0A 4M66A 1SMHA 1GZOA 1OBDA 5IQIA 1YWVA 4H36A 4CGAA 3OEFX 4Q2AA 5C01A 2FSMX 1H01A 1J7IA 3F3WA 5TKDA 3WF7A 4CNHA 2QOKA 2VTTA 3LXNA 2CGXA 1H4LA 5TE0A 4C7TA 3D2IA 4D4SA 4FTTA 4O0UA 3H9OA 4L9IA 5DE2A 1IAJA 2PVJA 2YZAA 3Q4ZA 5EH0A 3ZO2A 1P2AA 1M14A 2C3IB 2ZOQA 3GC0A 3MGYA 3WZKA 2C0OA 3TJCA 5IH5A 3LFFA 3QQLA 1GZNA 4FV7A 4V01A 4N70A 5GZ9A 2GQGA 4Y95A 3DS6A 5TR6A 3UMXA 4FIHA 5HBHA 3IS5A 4JX3A 3UOHA 3W8LA 2GQRA 2B9JA 3SW4A 2O8YA 4YO4A 1DAWA 3IW7A 3W16A 5HQ0A 4GV1A 4CLJA 5LJJA 5LMKC 2W1IA 3SC1A 1IAHA 4GK2A 3OVVA 3Q4UA 4BDDA 5J1VA 4N6YA 2ITYA 2WOUA 3Q04A 4AS0A 2HW7A 4IH8A 5D41A 4N4SA 4I5MA 1K9AA 3KFAA 1IASA 5M4FA 2GTNA 3WF5A 3A8WA 4Y5HA 5H8GA 4DEEA 4EH9A 4BDHA 4CFUA 2JGZA 5IPJA 2VO7A 4IM3A 3EQBA 3UYTA 3HP5A 3COHA 4BDEA 2HWPA 4F9YA 5CI6A 3AT4A 2XJ2A 3T8OA 3F5PA 3E88A 3SRVA 4C37A 5EW8A 2UZUE 3GQIA 2Q0NA 4B0GA 5J9ZA 4IX5A 4KIOA 4ACMA 5KX8A 3T3VA 2XRWA 5IZFA 3RGFA 3B8RA 3PZHA 3GEQA 3SD0A 4ALUA 1BUHA 3OEZA 3E92A 2R3LA 3JUHA 3KMUA 4ZZOA 1WBWA 3FI4A 4I3ZA 1JSTA 3I5ZA 1FVTA 1TQMA 1OB3A 1KOBA 4CFXA 4CZTA 3B8QA 5DRDA 4ASEA 2RFDA 3DAEA 4JQ8A 3DBQA 4UYAA 4FZ6A 4O7SA 3DB6A 5F4NA 3V6SA 4YZDA 5E8YA 3CKXA 3D94A 4HCVA 3TNQB 5CU4A 3QA8A 4I94A 4GG7A 4CYIA 2JIVA 2OJJA 4QP4A 4RC2A 5L2WA 2GMXA 2OIQA 2VWYA 2XKCA 3OY1A 4BIEA 2GSFA 4S30A 1U54B 4QMWA 1G3NA 3MI9A 4FV4A 3VC4A 1PXKA 3PZEA 2NP8A 4WG4A 4FV0A 4GS6A 1K3AA 4ZXTA 4AZFA 1NT2A 1JKSA 3P79A 4RJ8A 4YJOA 4F70A 3PJ3A 1ZYLA 1WBVA 3R7UA 3QUEA 4G6OA 1J7UA 3JS2A 2XCKA 4TYIA 5AUYA 4C35A 3EN5A 2C3KA 4M8TA 3PYYA 2CGVA 4QT1A 2YEXA 2HY81 4D2PA 4YTFA 3LXLA 4QYYA 4C58A 1FVVA 3NVKI 4FKOA 5F95A 2HZIA 4U7ZA 3QTSA 4KWPA 5IA0A 1VYWA 3KB7A 4XP3A 3C9WA 5IG1A 4EOOA 2R3NA 4WSYA 2E9UA 4LV5A 4JRNA 3I1AA 4CCUA 4MWHA 1OGUA 1ZOEA 4QQCA 2VTHA 3TG1A 3ACJA 3CBLA 4S32A 4NH1A 3EIDA 3LFBA 3KREA 1Q61A 3ZO4A 5FQDC 5AR8A 4HNFA 4ALVA 3P5KA 4AF3A 2G1TA 3ZO1A 4AW0A 3DXPA 4O7TA 2VX3A 5IKWA 4EQMA 3D5VA 2QLUA 2Z7RA 5IDNA 2YM8A 5L6OA 3E64A 5AAEA 2VTQA 3KRLA 3ITZA 2WB8A 3HUBA 4XEYA 3FKNA 4AE6A 3FZ1A 1NA7A 2XYNA 4DGNA 4EOPA 5M4UA 2OJFE 4U42A 4F1OA 2XNNA 5BVOA 1SVEA 2B53A 2F4JA 3KKVA 1H1RA 3QQFA 4YJNA 2WTVA 3RK9A 2JDTA 1S9JA 3R21A 1PXJA 5C8MA 2YCRA 3UTOA 3OXTA 1WVYA 4XP2A 5B2MA 2O3PA 4GJ3A 3V8TA 3ZRMA 2XA4A 3SRVB 3JYAA 3R71A 4FICA 4MD7E 3HEGA 3IQ7A 4MTAA 2LGCA 4FZDB 2QD9A 4XX9A 3DKOA 4PP7A 4O83A 4L3LA 3PFQA 2IZTA 3E7OA 4FTCA 4FEXA 4FSUA 1PMUA 4Q9ZA 4X2GA 2ZDTA 3KN6A 4B4LA 4C36A 2PUPA 3BEAA 4GVAA 1YDRE 5HHWA 3RJCA 3KULA 2GS6A 4LL0A 4BGHA 4ZTLA 3RPOA 4PWNA 1F0QA 1YDSE 3BE9A 2P3GX 3FY2A 4I93A 4L6QA 4U97A 5AMNA 4CLIA 5GINE 3FMNA 1MRUA 3ZBXA 4IVAA 3H10A 4GFMA 4OLIA 1J1CA 2ETRA 3HGKA 4CFMA 3RCJA 2XK9A 4JAIA 2OXXA 5JEBA 3PA3A 4PF4A 1M7QA 3D7ZA 1JSUA 4R5SA 2IG7A 4HVHA 3F69A 2WEIA 4P5QA 3MYGA 4F7JA 1OPLA 5AX9A 4BIBA 4ZMFA 4AU8A 3V5TA 5EDPA 2XNGA 2YZLA 4GU9A 5BX0A 2QNJA 3MH0A 4LRJA 3R2BA 3THBA 4NM3A 2VN9A 4BI0A 5KMNA 2C6OA 1Q4LA 5GJGA 4JXFA 4K8AA 4GH2A 3ENHA 4I0TA 1MQ4A 5AUWA 5JRQA 4EBWA 4CSVA 1B38A 5EOLA 3R01A 1FOTA 2UW4A 3BYSA 4Y83A 4RIYA 1B6CB 4QMSA 4X3FC 3UO4A 3BWJA 4G3DA 3QX2A 4ZS0A 4F9CA 3HDMA 5I9WA 4RLLA 2RL5A 3O71A 2B9FA 3IPHA 4H3BA 4BL1A 5ACBC 1LEZA 2W17A 3O51A 2XBAA 3EN4A 1YXTA 1Y91A 4BZNA 2WU6A 4QMYA 5FGKA 3D2KA 1YI4A 3RAWA 3VUGA 2NNWB 3ROYA 3AC2A 4O1OA 2PVNA 3PJ2A 4QNYA 4O6LA 4FK3A 3VF8A 4RIOA 3BZ3A 4XBUA 3A7FA 3OTUA 5HESA 3ZUTA 4NU1A 4AAAA 1PW2A 4MVFA 4B6LA 1UU9A 5AV4A 1UNGA 3EJ1A 4GUBA 3NIEA 4M15A 3KK9A 4BZOA 4ZTRA 5CSWA 3V5LA 2F7EE 5CAUA 3MA6A 4IMYA 3ZDIA 2PMNX 3LMGA 4YHTA 3UPXA 3OW4A 4D55A 5JFXA 3NUSA 5CZHA 5I9YA 2WMSA 3O23A 4D58A 3GNIB 3U55A 2QURA 2ZDUA 3QCYA 2V22A 2IW6A 4FSZA 2EXEA 5H9BA 3VUKA 3MBLA 3PY1A 4J99A 2UV2A 2QOOA 3NUYA 2BHEA 3QWJA 4WBBB 2RG5A 4MBLA 2C5XA 3DNEA 3IW4A 2ITWA 4FC0A 5ETFA 4V0GA 4CMUA 5IMXA 2WTDA 3GFEA 1WBNA 5CSPA 5AFVA 3C4CA 3OUKA 2C5YA 3AQVA 2UZBA 4ANMA 3CTJA 4KS7A 3EL7A 4C4GA 2RFEA 2JKKA 4MNEA 5L4QA 1ZY5A 4WHZA 1WZYA 4IC8A 2XJ1A 4UWYA 4WNKA 2PZ5A 3LE6A 3V3VA 4IFGA 2C47A 1YXVA 4M3QA 2Y8OA 3NNVA 3V5JA 4CXAA 5FTQA 5CQUA 4XV3A 2R3GA 3E62A 3NW5A 1OPKA 3E7VA 2YAAA 5BUIA 3MPTA 4YNOA 4IX6A 1DS5A 3ORTA 3C1XA 3EYHA 2XNOA 2V7OA 5EW3A 4PMSA 4UXQA 3UYSA 4R3PA 2ACXA 4AWIA 5HTCA 3KY2A 4GUEA 2OH0E 3RPVA 4I20A 1JBPE 5BVKA 1H0VA 4YZCA 5CQWA 1ZRZA 2YM5A 3TWJA 2BDJA 2WMVA 3LKMA 3LLAA 3ID6C 5CAOA 1EH4A 1M17A 4L3JA 4W4WA 2WQEA 1Q62A 2XK7A 4RIYB 4AA4A 5E8WA 3QBNA 1XR1A 5IMEA 2F9GA 2R3FA 3KF7A 1OUKA 2QG5A 3O7LB 5AWMA 3Q2JA 2CGWA 4PL3A 2EU9A 2GHMA 3U87A 1JVPP 4YJVA 1GAGA 3D5XA 4MBIA 3S1HA 3ZCLA 3FQEA 5BPYA 3EYGA 1Q24A 4O38A 3LM5A 4FTOA 3UMWA 3II5A 2H34A 2Z7LA 5L8KA 2G2HA 4GG5A 4USDA 1R39A 3R8PA 4F65A 3F3UA 4H39A 4IJPA 1SZMA 2VWZA 4IACA 1L3RE 4BCOA 3EQGA 3FLWA 3FXZA 1Z9XA 2WGJA 1YWRA 4JBOA 4ZSJA 5K5XA 1H00A 1REKA 3IW8A 4KB8A 2OBJA 3P23A 1GNGA 2WMQA 1A06A 1CTPE 4HGSA 2UW0A 5GJDA 1AQ1A 4H58A 3BEGA 5E92A 4CYJA 5C4LA 3ATSA 4QMVA 4RJ4A 3TZ7A 3PPZA 4XV2A 4L67A 2QHMA 4IC7A 1KOAA 4LFIA 2YCQA 4GSBA 2UZLA 2WMUA 1XBCA 2BHHA 3KRWA 4G6LA 5IUHA 5JT2A 1H26A 3QHRA 4ANLA 2Q0BA 1M2RA 4HVGA 4OTGA 4EOQA 5AAGA 4U80A 5D9HA 4EQUA 4RX9A 4OTIA 4V0GB 3FV8A 5ANEA 3ZEWA 3WF9A 2AYPA 2PE1A 4YLLA 3RALA 3SXSA 4XP0A 4QOXA 4AA0A 4XJ0A 3TDVA 1K2PA 1Q3DA 4O0WA 3DKGA 4UN0C 4MXOA 2EWAA 3LXKA 3FC2A 4MNEB 2JAVA 2ITUA 4FV9A 4AACA 3V04A 3C7QA 3HZTA 2QOFA 3ENMA 3NRMA 4FR4A 4I4FA 4LOQA 4NTSA 3N4UA 5BVFA 4ZTNA 2A0CX 5EI6A 3HMNA 3IOKA 3LPBA 3RAKA 2X4ZA 4IJ9A 2AUHA 3A7GA 5KKRC 4TWPA 4M97A 4UB7A 5HD7A 5J9YA 3Q6UA 1Q99A 4IB0A 3UJGA 4PNKA 5K4IA 4IWDA 2ITTA 3Q9WA 4JOAA 3R30A 4YJTA 2UZNA 1Q97A 4M69B 4OGRA 2WTKB 4CCBA 2B0QA 5E8TA 3BU5A 5IQCA 4ENXA 2F49A 4PMMA 3RZFA 3ZO3A 3FZOA 3BBWA 4WA9A 4BHNA 5I4NA 2JKOA 3IW6A 4IWQA 5JFWA 3O2MA 4FTQA 4MXXA 3CD3A 3CXWA 2WIHA 4P90A 3PRIA 3LFEA 4IBMA 2P4IA 4II5A 3UO6A 3QHWA 4IXPA 4F0GA 4UZHA 5EDQA 2UW9A 4RIWA 2LAVA 3UOKA 5IF1A 2F7XE 5HBEA 4A7CA 4BVUA 3U6IA 3AT3A 1PXOA 3OF0A 4ITIA 2F2CB 2VTJA 1ZYDA 5CU3A 5EHLA 4TYGA 3RM6A 5JRSA 3C4FA 4J98A 3EH9A 4OBOA 4OTDA 3V51A 4ITJA 4YUQA 3KXHA 4L42A 5KMOA 3ZC5A 4JVGA 1XHAA 4I22A 4WT6A 4XG3A 5AUVA 4R3CA 3MS9A 2XIYA 4I21A 3EMGA 2V0DA 3F66A 3CTHA 4R1YA 4FODA 2GS7A 2XM8A 1OVEA 3RAIA 4FYOA 2XB7A 4QP7A 4GL9A 4NJDA 5C4KA 4NIFA 4LYNA 4OT6A 3WZDA 4NSTA 4QRCA 4AT3A 3TIZA 5DEYA 4BFMA 3OD6X 3JY9A 3KC3A 4GRBA 4QP2A 2QC6A 2GNFA 3LJ2A 4YTHA 3CE3A 3SOCA 1OL7A 5CVFA 4F09A 5IQHA 3I7BA 4FYNA 4RJ5A 2Z8CA 2YM3A 1OL2A 4CD0A 3PY0A 4K11A 4NFMA 4USFA 3BCEA 2IW9A 3HYHA 2GPHA 4HCUA 4BDIA 4EH4A 3UIMA 4CFVA 4A9RA 2OF4A 2XEYA 3RMFA 2PY3A 4YNEA 1JWHA 4YTCA 2HXLA 3EFKA 4AX8A 2GNJA 4FTLA 3OXIA 4AT5A 1H1WA 3VJOA 4EUUA 3KL8A 4RVKA 2XBJA 4JAJA 4DTBA 2OJIA 4U3ZA 5AR7A 5EFQA 2P0CA 4D2WA 2R0UA 5M51A 3UQCA 3RWPA 3NAXA 4XUFA 3OCSA 2B9IA 5CEIA 1VZOA 4D28A 3QQUA 3MY0A 4Z9LA 3OHTA 4KIPA 3BGZA 3COKA 4EK8A 3KGAA 4F7LA 1URWA 3E8DA 4AN2A 4NCTA 4DT8A 4YR8A 3TDWA 4HYHA 4RFMA 3HMMA 4BY9E 4MAOA 2YCSA 4EZ3A 5DNRA 2PU8A 3FLQA 2X7GA 1UU7A 2SRCA 4PDOA 4ZJJA 2ZV7A 3W2RA 4JBPA 3WZUA 1ZY4A 3HNGA 5EM7A 2Y4PA 4Z16A 4FE2A 2OFVA 3R6XA 5AP7A 3TTIA 4RZVA 3WBLA 2YM4A 2BRMA 3DLSA 3MY1A 2VZ6A 3MIYA 4YU2A 4MF1A 3BKBA 4O0VA 4RVTA 3IDBA 2BALA 5J9LA 3P7BA 3MN3A 3G51A 2C6MA 2EB3A 4U43A 4YLJA 4H05A 5ETCA 3FE3A 1JLUE 4EORA 1H8FA 2RFNA 4CZYB 4RIWB 4RGJA 3S4QA 4CG9A 4YMJA 2C5VA 5LVLA 2XS0A 3MWUA 5E8SA 3KU2A 5C1QB 4X7QA 1OBGA 4QQJA 4ZZMA 2PZYA 4MWIA 2UVZA 3ZM4A 3ANRA 4LGDA 3HLLA 3CCNA 1PMNA 3FSFA 4FSWA 2H8HA 2JDSA 3DJ7A 3TXOA 4AT4A 2WTIA 3QCSA 3ZLXA 5KMIA 3R1NA 3AC8A 4R7HA 3TT0A 3HVCA 4DFZE 4OAVB 2HXQA 2X1NA 4U79A 4WD5A 3L9MA 5IQEA 4FV5A 3VRYA 1OUYA 5GZAA 5M09A 1MUOA 3DPKA 1XH5A 4XH6A 3E8NA 2W4OA 5ANOA 1WAKA 1Q8WA 3FL4A 3CQEA 4NIFB 3SX9A 2V55A 1XWSA 3C0IA 3DDQA 2YIRA 3NX8A 4L8MA 1W0XC 2ZVAA 4IX4A 4V05A 2I40A 3BLQA 3VBYA 5CENA 2X81A 4CVAA 4QMXA 3ZFYA 3FAAA 3E93A 3R9RA 4DT9A 4O27B 2X8DA 2X9FA 4L52A 4M68A 4ACHA 5IQGA 2IZUA 5D11A 4CT1A 5CAPA 1OKVA 3GCVA 4L45A 1GZ8A 2WO6A 3PJ1A 3LFNA 4R1VA 3AG9A 3GXLA 4R3RA 4L44A 3FEGA 4BI2A 2QU5A 1YXUA 4ASDA 5L2SA 3PPJA 4ANOA 2E9OA 5CI7A 5I3RA 3VQHA 1YW2A 2B55A 3AC3A 2R4BA 4RVMA 4APCA 4ARKA 5AP3A 3CJFA 1OM1A 3QZGA 4KBAA 5FP5A 4CKJA 5CYIA 2Z2WA 1GIJA 4EEVA 4EC9A 2PUIA 3PSDA 3G6HA 2H6DA 5IU2A 2IVUA 3CIKA 4BDCA 4EYJA 4FKSA 2PVMA 3RCDA 4E3CA 1A9UA 3OCTA 3UVQA 2WNTA 3SHEA 4UWBA 4GCJA 3R7GA 4O7LA 3QZIA 4K9YA 4C33A 4BZDA 3ZONA 3PWDA 1OKWA 4HJOA 4K18A 2W4JA 3TNIA 5LARA 2JKQA 3UC4A 4FI1A 5BUJA 2ESMA 4G5JA 1G8AA 4HYSA 4PPAA 3DAJA 5AR2A 5EHOA 3QUPA 4FIFA 1DI9A 2IO6A 3D83A 3ZFXA 3VBWA 3BYMA 4OT5A 3IDPA 3NS9A 4L7SA 4A9UA 4EL9A 2W96B 2OF2A 3AMAA 3IGOA 4NFNA 1YXSA 4ZSGA 1ZMUA 4I41A 2O2UA 3KXZA 4UMPA 4GVJA 4UMRA 2PVLA 4NKSA 2JFLA 4BN1A 5GIPE 3ZZEA 1REJA 3VN9A 3OT3A 4OR5A 4B8LA 3H9FA 4BWPA 3AGLA 3QKKA 3POZA 3RKBA 3TKHA 1BL6A 4BDFA 4CEGA 4EHVA 3NUPA 4DFUA 5FXRA 3MVMA 5C8KA 5ACKA 4R77A 3TNWA 5TF9A 1Q8TA 3D5WA 4J7BA 2NRUA 3A8XA 4FNZA 5DT3A 3UNJA 5K3YA 4G3CA 3OC1A 3QF9A 4O0TA 5T68A 4QTAA 1U5QA 4R78A 5K4JA 4AW1A 3GU4A 3ATTA 2UW6A 4QNAA 4NJ3A 3V6RA 3GC8A 3V5QA 4ZLZA 5B0XA 3UZRA 3QAME 3R1SA 2J7TA 4O21A 1UU8A 3R9NA 3HDNA 4XOYA 4YC8A 4EH6A 1OITA 5DHJA 1RDQE 1UV5A 2BDFA 4LOPA 2WQOA 1U5RA 1PXNA 5HO8A 4DFLA 4E5BA 4J71A 2YAKA 3QCXA 4IVDA 3FMEA 4BKJA 3K5UA 4JJRA 4X2FA 4E6QA 2BVAA 1A48A 1W98A 4EOLA 4NL0A 3ZM9A 4DLJA 4A4OA 3F3TA 4WKQA 2VX1A 1QPDA 3LLTA 4YJPA 4EYMA 5BVDA 3LOKA 5HX6A 4U8ZA 4UXLA 4F7NA 4GK3A 4YJQA 5FXSA 4ZIMA 3BHHA 5D12A 2QOBA 3FQHA 3W2QA 1XH9A 2DYLA 1OL6A 2ITOA 3MH2A 1XH6A 4I5HA 3SXRA 2XNPA 1V0BA 3QUDA 4HVDA 2J2IB 5DA3A 1M7NA 1W82A 4UEUA 4EHZA 4IDTA 1FMKA 3UODA 2YJSA 4V04A 4D9UA 4F0FA 4R6VA 3P86A 2JFMA 4FTJA 3NYVA 2RGPA 4BCJA 3KF4A 4E20A 3SLSA 1NY3A 5EM8A 4EK6A 3RM7A 3F6XA 4FTAA 2OG8A 4U44A 2FYSA 3ZTXA 3LVPA 4KIKA 3Q2MA 3DZQA 4YZMA 1ZMVA 2QO9A 4C3RA 2PMOX 2QR7A 4FSRA 4CKRA 4O81A 4NK9A 5CWZA 2YABA 3EOCA 4BIDA 3BE2A 5D7VA 4LM5A 3GC9A 3BHUA 4QMPA 4HVIA 4AZEA 2C6KA 2I0YA 3HV5A 4FKVA 4AGUA 3QC4A 4JG8A 5JQ8A 5DGZA 3GP0A 2J9MA 2OXYA 1P4OA 3TZ9A 2VGPA 3W10A 4O7NA 4ONAA 4EHEA 3C13A 3V5PA 2VWIA 4L68A 5D1JA 5GHVA 2C6IA 2R3QA 4TW9A 3SXFA 4FKTA 4MXAA 2BUJA 4AW5A 4FIJA 1UNLA 3FXXA 4L01A 1FGKA 5AR5A 4APPA 1LPUA 3I81A 4D4YA 4UYNA 3A62A 5AUTA 2CLQA 3EQPA 1Z57A 4FVRA 2EXMA 3VF9A 3EFLA 3QALE 4FIEA 2QVSE 2XM9A 2PHKA 3AOXA 4EJ7A 1PY5A 5FEEA 4E4NA 3GCUA 2HW6A 4YJRA 4BICA 3P1AA 4EOSA 5CAQA 4JQ7A 3LHJA 3TCPA 4GYGA 2W5BA 3SOAA 2OZAA 3VRZA 5HD4A 3FC1X 5DEWA 4BDBA 2XIRA 3W1FA 2G9XA 2J0KA 3EQDA 1OL5A 4DFXE 4F1MA 5KUPA 3OCBA 1TKIA 4FBXA 4FG9A 5KCVA 3MVJA 1JOWB 3BYOA 4DFBA 3LMIA 1Y8GA 3C0GA 4AGWA 5AM7A 4GYIA 1YRPA 3PUPA 5CNNA 1PXMA 2WMWA 4FSQA 5CNOA 1UWJA 4NEUA 4CFFA 4G6NA 3E87A 3TV6A 4TYJA 2ERZE 5I0BA 2BROA 4HVSA 4F6WA 1ZXEA 2WTJA 1LEWA 4E6AA 3PSCA 3NIZA 3OY3A 5FDXA 5I9XA 3CP9A 4QTEA 2BAJA 3MPMA 4DA5A 2CPKE 2JBPA 3H0YA 4FKJA 4RC4A 2B54A 3EZRA 4EK3A 3UNKA 4BCNA 1H27A 2J0LA 3D4QA 3F7ZA 5J8IA 3EN6A 5TO8A 2RG6A 5M44A 2OO8X 2ZV2A 1U59A 5CEKA 3GBZA 3DXQA 1FVRA 4O6EA 2XJ0A 4FSTA 2XZSA 5BQ0A 2YISA 2C68A 3QU0A 3PIYA 4Z3VA 3MTFA 2W9ZB 4EONA 4DEBA 2FH9A 3PVGA 3FI3A 2Y4IB 3EKKA 3CY3A 4OTPA 3SG8A 3LFAA 5A46A 3QQHA 2XNMA 4FT9A 3D15A 2UUEA 3GU6A 4FOBA 1RQQA 3T9IA 4YLKA 5E8UA 4QMOA 4E73A 3AC4A 2V62A 4DGOA 2R5TA 4L43A 3EN9A 4PV0A 5L6WL 5L2IA 2J90A 3DTCA 4KIKB 4E7WA 4FVQA 3NUAA 3R8LA 1PYXA 3IKAA 2WD1A 2BILB 1ND4A 3EWHA 3VJNA 3NPCA 3NVMB 4KRCA 1J7LA 4HPTE 4FKWA 4HZSA 3FZSA 4W8DA 3DFCB 3CPCA 1YWNA 3JXWA 3BYVA 3FKLA 2Z60A 2W05A 2ZB1A 5KE0A 4RWLA 2BRGA 4XG7A 2WPAA 4AW2A 3EQRA 3FMMA 3RZBA 2JDRA 4ZLOA 3FI8A 3GGFA 3R7EA 2W0JA 5FDPA 5HNIX 3D14A 4HCTA 4J52A 5AUXA 5AJQA 2GNIA 2GNGA 4DHFA 3F88A 2YIWA 4QPAA 3ZOSA 4WNOA 4NW5A 2XKEA 3GQLA 4BCMA 4HYIA 1X8BA 4OW8A 3HP2A 4HZRA 3UGCA 4D2SA 3TACA 4D4RA 1ATPE 4WBOA 3BV3A 5HE3A 2WTWA 3D0EA 3RHKA 5IQFA 4ORKA 2ZM3A 1BI7A 3OCGA 1BKXA 2WQBA 5BVNA 4TL0A 4XHKB 2OZAB 4KBKA 4C38A 5GZ8A 1CDKA 1XH8A 2KTYA 4EK5A 2VWVA 2C5NA 2PZPA 4G2FA 4W4VA 3PTGA 4ITHA 5L8JA 3F2RA 3CKWA 3GVUA 3PJCA 4A9TA 4E1ZA 4UX9A 3VS3A 4U45A 3EN7A 4M13A 5HO6A 2YIXA 1WFCA 3ZXTA 5CXZA 5IISA 4ZJVA 3TNHA 3C0HA 3BYUA 1Y57A 3F7WA 5DH3A 1LP4A 4IWOA 5AP0A 1ZWSA 2W4KA 4DAWA 3QZHA 4O0YA 2O0UA 3QZFA 5TT7A 2P2IA 4PL4A 3JVSA 4FEVA 3TI1A 2VO6A 5ICPA 3SAYA 4PY1A 5HOAA 3LFCA 5M57A 4Z7GA 2B7AA 4QTCA 4KD1A 5LMAA 4TXCA 4GT3A 4HNIA 3ZSGA 4IB3A 4DYMA 1CMKE 3WF6A 4I4EA 4X2NA 3EQIA 4AA5A 4U41A 3V8WA 4Q5HA 1W8CA 4G3GA 4EH2A 3VS4A 3QTQA 5LXMA 1MRYA 5EI2A 5AX3A 1QL6A 1JQHA 5ETAA 3WOWA 3E8CA 1H25A 1KE6A 3L8VA 5M55A 3R63A 2CJMA 2XIZA 3F2NA 2ZV8A 3CJGA 3PE2A 1HCLA 3EFJA 4QO9A 5FG8A 1OL1A 4FV8A 4JBVA 3DY7A 2YN8A 5H3QA 2PMIA 3NCZA 3NUNA 1YHWA 3R8VA 4B8MA 4XNEA 5HG7A 4D1SA 5KZIA 4DBXA 2CNQA 4BC6A 2I0EA 4PDSA 3PVUA 3R04A 5EI8A 4IZ7A 5I5ZA 3TIYA 3ORZA 4A4XA 4R5YA 5M4IA 3Q96A 3PVWA 3HA6A 1GIHA 4QPMA 5AP2A 3FJQE 4FT0A 2QR8A 2BZIB 2QU6A 5JGDA 3HV6A 2Y6OA 5HU9A 4FEUA 3PG3A 3FLSA 3QWKA 4O2ZA 4C2VA 3NYXA 3ORKA 4CFWA 3MV5A 4JX7A 4UZDA 4LV8A 4RZWA 1WVWA 3H9RA 3U9NA 3O0GA 4C62A 4WO5A 5D10A 4FF8A 2VV9A 2IJMA 4O7ZA 5KKRB 4JDKA 5HG8A 5AIRA 4C61A 3LFDA 2W1GA 4IW0A 4M69A 4XV1A 4LUDA 5ETIA 4CG8A 3HUCA 3I0QA 3TZMA 2ONLC 3OOGA 2JKMA 3IGGA 1Q8YA 3DBCA 3L9LA 4AGDA 4ANSA 4J95A 3AD6A 4FIIA 4F1TA 5FRIA 2UZEA 4MX9A 4RSSA 4EKKA 2A1AB 1NVRA 5AA9A 3DJ6A 4DCEA 3OBJA 1IA8A 4YJSA 5AV0A 4FKPA 4C4HA 4C34A 4I6HA 4TZRA 3FI2A 3FZRA 4YO6A 3SGCA 3VUMA 1BL7A 2JIUA 1PYEA 4D2TA 3DDPA 3RP9A 4DH8A 4EOMA 4UV0A 4Y73A 5AR3A 3MVHA 5DRBA 3UQGA 5A4TA 4IIRA 5F9EA 3DKCA 4D5KA 5HGIA 2DS1A 3VS1A 3ZFMA 5E90A 3FHRA 5I9UA 2EVAA 2ZYBA 3OWKA 3U8WA 3R8UA 1WBSA 3W8QA 2OJ9A 2W5HA 3S2PA 3P0MA 4CT2A 2W7XA 4BBMA 3E63A 4FIGA 4RPVA 2GHGA 5E8ZA 2CKQA 1ZYJA 5LQFA 1YOLA 2O5KA 2XVDA 3K3JA 3IDCA 4ZK5A 1M52A 1Q5KA 2V7AA 3BHVA 4YPSA 4F9WA 2QOCA 3L9PA 3QGYA 1PMVA 5FXQA 3ROCA 2X6DA 4MNFA 3AT2A 5A4EA 3HMOA 2R64A 2I0HA 5HVYA 5HICA 1XJDA 4CFNA 5HLWA 5K9IA 2RSVA 4X6RA 1PRYA 1KE8A 3AXWA 2X2KA 4QYEA 4DEDA 4IM2A 1T46A 3LXPA 2AC5A 2CCHA 1SNUA 5B2KA 3R73A 3FMJA 1YXXA 3UVPA 1OPJA 3I79A 5IUIA 3Q5ZA 2Y9QA 4O91A 4NTTA 4WG3A 2UZVA 2ITPA 1UWHA 5AP5A 3LCTA 5LCKA 4QP1A 5AV3A 3R9OA 4W9WA 2A19B 3LCSA 4E8AA 4F0IA 2F2UA 5E1EA 4XMOA 3R02A 5T3QA 4FV6A 4TPTA 4OBPA 3IECA 5CT0A 4ZEGA 2OIDA 4O0SA 4NYEA 2OICA 2IVSA 3QQGA 2BR1A 3QA0A 4M0YA 3L8XA 5HIEA 2XP2A 3QD4A 4RIXB 4G9CA 4X2JA 4IAYA 3QC9A 3LJ0A 3Q4CA 3Q9XA 4GEOA 5J7HA 3L1SA 2YACA 4FUXA 4OAUC 4XLVA 4R8QA 3ALNA 4CTBA 3U9CA 4FMQA 1L8TA 4FT7A 4LRMA 4U40A 5ANIA 5IQAA 2XRUA 4YC3A 2ZM1A 2O64A 3I4BA 2YDJA 4FSMA 2F7ZE 2ZAZA 2WKMA 3OWPA 4J96A 4AZWA 3F82A 5IEXA 4ACGA 4IAKA 5FTOA 3C5IA 4O7RA 5HTBA 3W2SA 5HCXA 4LQMA 4G1WA 2G2FA 5JMSA 4XOZA 2C6DA 3TV4A 4CRSA 2CMWA 2FA2A 3N9XA 4QP6A 4BKYA 4NM0A 4PDYA 4L3PA 3WILA 4FG7A 3OMVA 1KE5A 5HE0A 3M1SA 4KINA 1GOLA 5FD2A 2YERA 3A99A 2VD5A 3AMYA 3I7CA 3NW6A 3QLFA 4JG7A 3MVLA 4MD9E 4NKAA 1I44A 3CLYA 2VGOA 2R3HA 4MQ2A 2UVYA 3DK3A 4BBFA 3VUIA 4X21A 2FB8A 3QTZA 3F3ZA 4FSYA 4WUNA 5BNJA 2Z02A 4AN9A 5AP1A 3MFUA 1R3CA 4RBLA 1W83A 4FTKA 1R0PA 4XRJA 2I0VA 3ZLSA 4XG6A 3QD3A 4BYJA 4RWJA 4PMTA 3NYNA 2GDOA 3F5XA 4W9XA 3RPSA 3QYWA 4TYHA 3U6JA 5CSVA 2J51A 3FL5A 3QRJA 4C0TA 2CCIA 3QTUA 4MCVA 5AM6A 5EHYA 2FVDA 4I6BA 4S34A 2CKOA 2VTSA 5IA5A 4CRLA 5BVWA 4E6CA 1WBTA 5A6OA 2FSTX 2BIKB 4M7IA 2WU7A 3H4JA 3R9DA 3TN8A 3UVRA 5IA4A 4QQTA 3VHEA 2GNHA 5CEMA 4QMLA 1FMOE 3PY3A 3QKLA 5I9VA 4QMNA 1PKDA 4LGGA 4DTKA 4DG2E 4P2KA 4C4EA 2XK6A 1FPUA 2W99B 3MB6A 4H1MA 3E5AA 1SYKA 4KS8A 3VBQA 4Z7HA 3T9TA 3PVBA 4A06A 4QMUA 4TRLA 3CQUA 3K54A 4DN5A 3NYOA 2WAJA 1BLXA 3BBTB 1AD5A 3OW3A 1KWPA 1LR4A 5J5TA 4GMYA 4I23A 4B99A 4DEGA 3R8MA 4M14A 3A61A 3ACKA 3P08A 5LWMA 2OGVA 5HE1A 3UIUA 3V8SA 3PIZA 3UZPA 3MIAA 3VS2A 3B2WA 4AE9A 4ID7A 3UG1A 3F2AA 4IVCA 5HTIA 4PTCA 2BFXA 4LL5A 3LZBA 2REIA 4FTMA 4JR3A 2W1HA 2JBOA 3A7IA 1BI8A 1ZMWA 3OZ6A 3Q5IA 5LVMA 5LVOA 1NW1A 4ANNA 4JG6A 4BRXA 4G9RA 3RNYA 1DAYA 2IVTA 2XK8A 2B4SB 2Z7SA 5EM6A 4WSQA 4GW8A 5J87A 2ZJWA 5KBQA 4OBQA 4X3JA 2VWUA 1YHVA 2QLQA 4RX8A 2RIOA 4ZLYA 3F61A 1KSWA 1P5EA 2A27A 4YZBA 3H30A 4MEDA 5EM5A 5HE2A 4HGTA 1O6YA 2FSOX 4IVBA 3G33A 3DLZA 3IONA 3ODYX 3QTIA 3QXPA 5CLPA 5HIDA 4PNIA 4A9YA 4BDKA 3UPZA 1W84A 4EZ5A 1SM2A 3QQJA 2JDOA 4ZTMA 5IH6A 5DG5A 1FBNA 1PXPA 3A7HA 3DA6A 5C26A 3I60A 3GB2A 5KMMA 4CKIA 5KMKA 5IA1A 5I9ZA 1W7HA 3TUCA 4GKIA 4E4XA 5A9UA 3F5GA 4A4LA 2W1ZA 4IADA 4LMNA 3TNPC 3G15A 2WTKC 1F3MC 4E5WA 3BRBA 2CHLA 5K0KA 3PSBA 1XKKA 3SV0A 2C0TA 2VX0A 4QP9A 1BX6A 2V5QA 2IW8A 2EUFB 4KIQA 4PP9A 4IB1A 4RC3A 5H8BA 2YIYA 3WIGA 4FKIA 4F6SA 2WXVA 4TYHB 2BRBA 1JSVA 1PMEA 2XEZA 2DWBA 2PL0A 3I6WA 3FXWA 5CF4A 1LUFA 4Y8DA 1R0EA 2QOQA 5DBXA 3PXRA 1F5QA 3NCGA 3KA0A 2I1MA 3QRTA 5C27A 2HY0A 4JBQA 5DOSA 2G15A 3ZU7A 5DLSA 5B2LA 5HO7A 4M84A 5M53A 4QP3A 4RT7A 5AUZA 3PRFA 4ALWA 3UQFA 2E9VA 1YKRA 1MP8A 2P55A 3BLRA 3NEWA 4YHFA 4HGLA 5DVRA 2OSCA 2PYWA 3NMUF 3QXOA 2B1PA 4EWQA 3OXZA 4ASXA 3PLAE 3QCQA 1Q8UA 2X0GA 1NXKA 3KRJA 4QYFA 2A2AA 1OI9A 3AD4A 3B2TA 3OROA 3VBXA 4OTWA 2PUUA 2FO0A 4FZFB 4P4CA 4Y85A 4RFZA 2EB2A 4DH1A 3GU7A 4PUZA 3HA8A 1HCKA 1PKGA 2YJRA 4AG8A 4WOVA 2C3LA 4LGHA 3MW1A 3VNTA 4IZAA 5A3XA 4OTHA 2WELA 3LJ1A 5CTPA 2X2LA 3LAUA 4N57A 4U6RA 2YDIA 1FQ1B 3GU5A 3PXKA 4AOJA 4LUEA 3MESA 2QKRA 3S0OA 3G9LX 3ZHPC 3DV3A 3ALOA 4BTKA 2PULA 4GKHA 1XQZA 3BGQA 2XNBA 4I92A 4XYFA 2H96A 5CF8A 3HX4A 1V0OA 2Y0AA 2QOHA
chains in the Genus database with same CATH superfamily
4FEQA 3FPMA 3BI6A 1UVRA 4UBAA 2WQNA 1YDTE 2VTPA 2HZ0A 2YITA 3O50A 4A9SA 3BWFA 1GZKA 3OUNB 3FY0A 5LWNA 3H0ZA 3HAVA 2VTMA 3OWJA 2YA9A 4FKQA 5C9CA 3K5VA 1WMKA 2HOGA 3ORIA 3R7OA 4HW7A 3RWQA 2CN5A 3U4UA 4EBVA 2YFXA 3LFQA 5A4CA 1QPEA 5AP4A 4OTQA 3AKKA 3UNZA 1H1PA 2PVRA 2VWWA 3VO3A 4BCQA 5KMJA 2PUNA 1ZYSA 3N4VA 4CTCA 1VR2A 4ZAUA 4N6ZA 4JDIA 3RHXA 5BYLA 4XG9A 5CSXA 3EHAA 1P4FA 1PJKA 1W2CA 2HENA 4MH7A 5E91A 4O82A 3ORNA 4G17A 5JFVA 2VO0A 4EH3A 4ZY5A 4FGRA 3DT1A 2CGUA 3DNDA 5K0XA 3TM0A 3ZZWA 3MPAA 3L9NA 4W4YA 5E8VA 5ANGA 3C5UA 5CU2A 2CN8A 4S31A 2BDWA 2YIQA 3PWYA 3GUBA 5DN3A 1S9IA 2UZDA 3GOPA 5HG9A 4GIHA 3LFSA 2UW3A 4RMZA 4ZP5A 5L3AA 4ACCA 3F5UA 4FL3A 2VTRA 3ZLYA 5CEPA 2OIBA 3ZMMA 5L2QA 2J0JA 1YVJA 3A4PA 1ZZ2A 4X3FA 4IM0A 4NM7A 3R8ZA 3BU3A 1UA2A 3C4ZA 2VO3A 4Q5EA 2HAKA 4JL9A 4O86A 3COMA 4RQKA 3VS6A 3GCPA 4K33A 4K1BA 3FHIA 3W18A 4UY9A 4DCAA 2BZHB 5FEQA 3CGFA 4O96A 4BF2A 4IANA 4N0SA 2C5OA 4FZ7A 4KSQA 3PE1A 4AZTA 3W32A 2VRXA 5FLFA 4DEAA 3LW0A 4QP8A 4AZVA 2J0IA 3DQXA 3UO5A 4PX6A 5GJFA 3KRXA 4GFGA 5BVEA 4ANBA 5F94A 3HV4A 2JEDA 4FEWA 4H1JA 4RJ3A 2QHNA 5FP6A 3RAHA 4AGCA 2VU3A 2PZRA 3NSZA 1VJYA 4J8MA 2XKFA 4YZ9A 2XK3A 2Y7JA 4R7BA 4B7TA 4Z55A 3G90X 5AEPA 3NZ0A 3E3BX 4USEA 1BYGA 5EK7A 4I5CA 4O7WA 3QL8A 3O8PA 2QKWB 1Q41A 1CSNA 3QTXA 3L8SA 4ANQA 1O9UA 4Y46A 5LMKA 3UOLA 4FL2A 1DM2A 1XH7A 4E4LA 4JRVA 4QQ5A 3LCDA 2H9VA 3O8TA 4O2PA 2WFYA 2C4GA 4FTUA 1OECA 4IAIA 2X0OA 3R1YA 2QOIA 5AUUA 5CANA 1OIRA 4ERWA 3ZUVA 4EK4A 1OKYA 1VYZA 3A2CA 4UMUA 2OKRA 1H28A 4IZ5A 4MYGA 4QDEA 4NCTC 2X4FA 4RJ6A 4FV3A 3F3VA 4DEIA 5DR9A 3GOKA 3D7TA 3IG7A 4JIKA 3OOMA 4L00A 3ERKA 4UWCA 2FSLX 2PE2A 4FL1A 3WF8A 3Q6WA 5LMBA 4ERKA 5IEYA 3BLHA 3V01A 2HK5A 1H1QA 3QQKA 4JDHA 4AXAA 3FLNC 3R7IA 3MB7A 1GY3A 4GT4A 4F6UA 3R22A 2R3IA 3DTWA 3FPQA 4BKZA 4ZZNA 3ORPA 1YOJA 5CU0A 2ONLA 4YZNA 4E6DA 1JKKA 4FG8A 4WRSA 2A98A 2X8EA 3DGKA 3CY2A 5KNJA 2WEVA 3HMIA 4G31A 3PP0A 5BYYA 3ETAA 2IVVA 4U0IA 2VWBA 4Q9SA 5AR4A 3VUTA 4F4PA 2WMRA 2YHVA 4YTIA 3JPVA 1UNHA 3KMWA 3FLYA 3ORXA 3KCKA 2BRHA 2R3JA 3DK6A 5G1XA 3VULA 3GC7A 1Q3WA 3DKFA 2VUWA 4X3FB 4S2ZA 4CV8A 2QOLA 3ODZX 3VW8A 3KRRA 5J7BA 5DT0A 4C2WA 2CKPA 4PL5A 3EQCA 4G16A 4MXYA 3MSSA 5DR6A 4DF3A 3ELJA 4CQEA 4YSJA 1STCE 3PG1A 4TKSA 5IA2A 2WMTA 1TQPA 3ZH8A 3TZ8A 2GNLA 3VHKA 3OP5A 1J1BA 5EKOA 3W33A 2X7FA 3ULIA 4K77A 2VNYA 4ZTHA 2XH5A 1PF8A 2OXDA 5TOZA 5A14A 2P2HA 3KK8A 3MA3A 4YP8A 2JAMA 3S00A 4IE9A 5JK3A 3QRUA 4YJUA 5HLPA 1QMZA 4MD8E 5DWRA 4BTMA 5FEDA 3AC5A 2WIPA 5E8XA 2X39A 1ZAOA 1TQIA 2QCSA 3FMKA 3PIXA 5HLNA 1UKHA 4BJJA 4FZAB 3Q9YA 4EOIA 1SVHA 1RW8A 3UIXA 5EDRA 5CSHA 4FKRA 4LI5A 3RPRA 3WIKA 4D2VA 3GCSA 5CEOA 4I24A 3Q3BA 3QTWA 5M4CA 4AZSA 4C59A 2VTAA 2J0MB 3NWWA 4FV1A 3HRBA 4X2KA 2PVYA 4C3FA 4C3PA 4AQCA 1QPCA 2BTSA 2XALA 3EZVA 4A07A 4C02A 4DINA 5C8NA 3ORMA 4IEBA 4DGMA 3R28A 4E26A 3UZTA 3K3IA 4TNBA 3Q9ZA 4ZTSA 3DQWA 4MXCA 3OG7A 4QD6A 2QODA 4FVPA 4KABA 5AA8A 2PVHA 2R3OA 2IN6A 2Q83A 4I5PA 1P14A 1NVSA 4JNWA 3BHTA 5DMZA 1JNKA 1IEPA 3BV2A 2DQ7X 3NW7A 4S33A 2VAGA 4O84A 3W55A 5CALA 2GHLA 4WIHA 3ZEPA 2GFCA 4D1ZA 4E4MA 3DCVA 3FYKX 5M08A 3KQ7A 3D7TB 3CD8A 3HRCA 3AC1A 1ZOGA 3MH3A 4H3QA 5CU6A 2QG7A 3ORLA 3DFAA 3K2LA 5G6VA 3W0NA 3U4WA 4YGAA 3OTVA 5CEQA 5CAVA 5J79A 5HVKA 3C50A 4OTRA 2R2PA 5HG5A 3UBDA 3MFTA 4I6FA 4MBJA 3ULZA 4BCPA 2C6EA 2BZKB 3DXNA 4XLIA 4YBKA 4Y5QA 3R9HA 1B39A 5IQDA 2PVFA 4TWNA 4QMMA 1WBOA 4U3YA 1DI8A 1Y6AA 3FUPA 3BPRA 5EQYA 3ZXZA 3VAPA 4XS2A 2YWPA 2AEGA 5HNBA 2C1BA 5HI2A 4FTNA 4AOTA 3O17A 2P33A 3R2YA 4GK4A 4IB5A 5HIBA 3ZS5A 2BAQA 5KO1A 4NW6A 5JSMA 3JY0A 5CXHA 2UW7A 4CQGA 2J5FA 3UE4A 4RWIA 3GT8A 2J5EA 5IUGA 2W06A 2NPQA 4ZJIA 5FUTA 5J1WA 2IWIA 3DK7A 1XO2B 3LM0A 1XBAA 2BAKA 1TVOA 2OFUA 4BCKA 4D5HA 4O4FA 4QYGA 2IZSA 2XF0A 4LG4A 2B9HA 4J1RA 2G01A 2HZ4A 1MRVA 3P78A 4LOOA 1YI3A 5DT4A 1RE8A 1ZYCA 2PTKA 2PE0A 2XMYA 4BCFA 4D4VA 4FKUA 4ASZA 4F63A 3ZLWA 2BTRA 3C4XA 4F08A 4JDJA 2YLFA 4C57A 4EWHA 2G2IA 4AN3A 1UU3A 3MJ2A 3VW6A 3ZRKA 4DBNA 5DIAA 4TWCA 3ET7A 3CS9A 3WE4A 3O96A 5HCZA 5EG3A 3SKCA 4BYIA 3HAMA 4U81A 4PTGA 4C4JA 1IG1A 4ZSLA 4QPSA 2HCKA 3I6UA 4C4IA 3PPKA 3KEXA 4KNBA 5K5NA 3TUBA 3G9NA 4ZSAA 4G34A 3PA5A 3BQRA 3EQHA 3RK7A 4BDJA 3UC3A 4BTFA 1V1KA 4F9BA 3MDYA 1G8SA 3BU6A 4H3PA 3UDTA 2E2BA 1BMKA 2W1DA 3VIDA 1SVGA 3PLSA 4RWKA 4RX5A 1UKIA 3RBWA 3N51A 2J6MA 2PZIA 2R3KA 4ZOGA 3RI1A 5C03A 2Y4IC 5FBOA 2C0IA 2I7QA 4I6QA 3GU8A 4NM5A 4RIXA 4BHZA 2WHBA 2X8IA 2QO7A 3V5WA 4L7FA 3FZTA 4TWOA 3M11A 4MQ1A 2WOTA 2X7OA 5GNKA 3ZBFA 5HX8A 2XKDA 2QI8A 1KV2A 3QLGA 2UVXA 3IO7A 4GJ2A 2YM6A 3OT8A 4IAZA 4IAAA 4RJ7A 1JPAA 5HVJA 5A4QA 5HU3A 3UG2A 5M56A 2JD5A 3W2PA 2QO2A 2O65A 3W2OA 3PDTA 1R78A 4GFOA 5M07A 2OWBA 3G0EA 4YC6A 3R7VA 3ZDUA 4WNMA 3RK5A 5D7AA 4NUSA 3KULB 4DFNA 3EKNA 4LMUA 4ACDA 4FV2A 3GENA 4JR7A 5JGBA 2W9FB 2R0IA 3HL7A 4W4XA 5CVHA 2PSQA 4PTEA 4X0MA 3PXZA 3UDBA 3DBFA 3O8UA 3EL8A 3FZPA 4PDPA 5FM3A 4NZWB 3ZSHA 3AGMA 2E9NA 3DB8A 2ZFYA 2WMBA 3FBVA 2R3MA 5JGAA 3EQFA 2HIWA 2X9EA 2R3PA 3OBGA 2X6EA 3E8EA 3NAYA 1CKJA 3NNWA 3CQWA 3QYZA 4RVLA 1G5SA 4BB4A 5JZJA 3TUDA 4ZS4A 3WE8A 3VQUA 4WG5A 3UP7A 4JMQA 4EHGA 4RFYA 1CM8A 3WYYA 3LCKA 5A54A 5H2UA 3REPA 3KVWA 1ZARA 4BBEA 3VWAA 5EYCA 1IR3A 1JKTA 2ETMA 4IX3A 3L8PA 1ZLTA 4MHAA 4DG0E 3A60A 3O7LD 2YLEA 4MKCA 3MFSA 4EKLA 4YURA 1H1SA 2CDZA 4HOKA 3IOPA 1PXIA 3LCOA 4X6QC 1E1VA 4QMQA 1PHKA 2R7BA 4BGQA 5KHWA 4DHZA 5E1SA 2R3RA 2ZMCA 4G5PA 2XUUA 4B9DA 4BGGA 4WUAA 2XYUA 2VTLA 3N4TA 1I09A 4DGLC 1WCCA 3UIBA 4EH7A 2BRNA 2CNVA 3DBEA 5HNGA 4KUJA 4FUYA 3LQ8A 2XCHA 1Z5MA 2A4LA 2YCFA 5HBJA 3FYJX 3LIJA 4RQVA 1PXLA 4QMZA 4G3EA 1AGWA 1KE9A 4BCGA 4Y72A 4O0RA 3UP2A 4U9AA 2JC6A 4BCHA 4DGGA 1M2PA 1URCA 5JZNA 5KMLA 1JKLA 2ITQA 3HV7A 2OK1A 2VTNA 4FA2A 5LVNA 3KCFA 3KVXA 3VBTA 5DR2A 5EYDA 2ETKA 3NLBA 4IWPA 4D0WA 2BMCA 5DPVA 4NT4A 5CY3A 3F9NA 5CT7A 4L46A 4DH7A 2BFYA 4YPDA 3QGWA 2ZM4A 2XNEA 2RKUA 4ZMEA 2XIXA 2E9PA 4JQEA 1IRKA 3M42A 4AFEA 4YSMA 3AMBA 5JH6A 1H0WA 5DI1A 4O0XA 4OUCA 4FT3A 4CZUA 4F9AA 4PMPA 3TJDA 4GT5A 5L2TA 4XBRA 5F20A 4DH5A 1OZ1A 2VNWA 3HECA 4GIIA 1YQJA 4DH3A 1OKZA 4NWMA 4TYEA 2WMXA 4KKEA 4UALA 4MUQA 1QPJA 3ZUUA 4FTRA 2HYYA 4G3FA 3BHYA 5FWKK 2ITZA 3PXQA 3FDNA 2X2MA 4UMQA 2J4ZA 4CMTA 5CX9A 4O1PA 2XIKA 4DTAA 4KA3A 2OH4A 3G6GA 4FNYA 3TV7A 1OIQA 2WQMA 4BTJA 1OIUA 4FT5A 3W2CA 2VTIA 4CV9A 3WZJA 5H8EA 2R7IA 1OMWA 3FWQA 3P7CA 4TY1A 4KKHA 3KMMA 4FX3A 3C51A 3COIA 3RPYA 3P4KA 4PPBA 4HPUE 2UZOA 4O22A 2C6LA 5LCJA 2XARA 2CKEA 4JS8A 4EC8A 3QKMA 4M67A 4HYUA 4D9TA 4EOKA 2W1FA 1Y8YA 5AP6A 4IQ6A 2PVKA 3VS0A 3KN5A 5CASA 4DLIA 3R83A 4DG3E 5A6NA 5ANDA 4K6ZA 3CTQA 3VUHA 4D2RA 1U46A 3NUUA 3VS5A 2AC3A 5AIKA 3VVHA 4QDVA 3Q32A 4F7SA 3MH1A 4XCUA 2BKZA 5EKNA 5CF6A 5T6KA 5ANKA 2ITVA 5HZNA 4FK6A 3G5DA 3R7YA 4MK0A 4BDAA 1CKPA 2EXCX 3QD2B 3NUXA 5LOHA 1Q8ZA 2QQ7A 1ZZLA 2OU7A 4AAYA 3T3UA 4CMOA 1QCFA 3CR0A 3P9JA 5J95A 5E4HA 3CGOA 2NO3A 1U4DA 3FMDA 3OFMA 3CSVA 4BWKA 1SNXA 2JITA 2UW8A 3U54A 2BIYA 2FUMA 5EYKA 2ZMDA 1R1WA 2YM7A 3H3CA 4RRVA 4WRGA 3U6HA 2XANA 4XG4A 3ML1A 3KXGA 2PWLA 4QEBA 2FGIA 3S95A 4YHJA 5JKGA 3LMHA 1E1XA 2C3JA 1XH4A 4XG2A 3SDJA 3QD0A 4LRKA 4F64A 4R7IA 1KUTA 5M06A 1FGIA 2O63A 2JLDA 5A4LA 2GCDA 3QRKA 4TTHB 4PQNA 4AOIA 2XK4A 4E93A 4J53A 3S3IA 4O7YA 5KBRA 2B52A 2C69A 4I0SA 4ZY6A 4EZ7A 1T45A 3GCQA 3VS7A 3P7AA 4IFCA 2WMAA 3RINA 5HORA 3WI6A 3ZSIA 2ERKA 3ZYAA 4DFYA 2GU8A 5AV1A 4RA4A 5LVPA 4E5AX 4ENYA 3QRIA 4KRDA 3KXMA 3WZEA 4QMTA 4OTFA 3GFWA 2IZRA 2OZOA 3NR9A 5E9EA 5EOBA 2HZNA 4AP7A 2BZJA 3PXYA 2HWOA 3G0FA 4PPCA 2C30A 2WZJA 4GU6A 3JVRA 3RTPA 5FTGA 3AKLA 3DOGA 3FMHA 4UMTA 3FKOA 4JI9A 1H07A 4EOJA 5IH4A 5EQPA 4FGBA 2ITNA 2UZWE 4IHPA 1H24A 2OJGA 1W2DA 4BDGA 1J3HA 2RFSA 2OI4X 3E3PA 1V0PA 1ZOHA 2GTMA 3BELA 4W8EA 3R1QA 3MTLA 3NGAA 4IZYA 4JLCA 4ZSEA 4L53A 4QYHA 3QFVA 3OWLA 3M2WA 4U5JA 3QX4A 4F99A 1O6LA 3DJ5A 3JR1A 5IDPA 3CC6A 3PXFA 4J97A 3U51A 4KAOA 3HMPA 3KXNA 4FNXA 5L6PA 2IPXA 2W5AA 3SG9A 3I5NA 5J5SA 5JQ5A 5CS6A 2RF9A 1H08A 1J91A 5AV2A 2BKKA 4K2RA 4PRJA 3A7JA 4EQCA 2JDVA 3FSKA 4RA5A 3MY5A 3BX5A 5DFPA 2HELA 3DZOA 3LQ3A 4XG8A 5DYJA 5EW9A 3ZC6A 2ZV9A 3SA0A 1JAMA 3C4WA 3PP1A 4BI1A 5GIOE 3Q53A 3ANQA 5AADA 4IAFA 4TT7A 5E7RA 3NNUA 1YHSA 3I0OA 3D9VA 4KKGA 5BUEA 1NVQA 4K0YA 5AAFA 3RNIA 4EUTA 2WTCA 5HCYA 1GJOA 1KV1A 1IA9A 3TKIA 3SVVA 3WARA 1MQBA 3WYXA 3FQSA 2I6LA 3BIZA 5HKMA 1Y6BA 3G2FA 4DC2A 5F1ZA 3PJ8A 4P5ZA 3Q60A 1WBPA 3DAKA 3OS3A 3LQ5A 1CKIA 4FSNA 5CF5A 1FINA 4D0XA 3EFWA 4C4FA 4C8BA 2PPQA 3PA4A 4DITA 5B7VA 5ITAA 2KULA 3RVGA 3Q52A 3D5UA 2J50A 3HV3A 4FOCA 3SQQA 4HGEA 4BCIA 4FKGA 3BQCA 4JT3A 3CPBA 5L8LA 4M0ZA 5CZIA 1APME 2BPMA 3DU8A 2UZTA 5CVGA 5KHXA 3ZRLA 4FNWA 5EQEA 2VWXA 4QTBA 4I1ZA 2YDKA 4EJNA 4EH5A 2ITXA 4FKLA 2GFSA 4I0RA 4EI4A 4BWXA 2ZB0A 3FMLA 3A4OX 3POOA 4ZY4A 3HKOA 3IW5A 3NDMA 3UOJA 5EYMA 3QTRA 3R00A 1XMLA 5IQBA 3AD5A 3EB0A 4XRLA 5BMMA 2W1CA 5FBNC 5BMSA 2YWVA 2PK9A 5FM2A 3GI3A 3KXXA 2GS2A 1O6KA 4EH8A 2CNUA 1M2QA 3R0TA 4MF0A 2NRYA 3C4EA 4RX7A 1WVXA 5I3OA 2OW3A 2C1AA 5KZ0A 4TN6A 2CLXA 3W0SA 5HEZA 4TNDA 4FTIA 2F57A 4YBJA 1TZDA 4XV9A 4IDVA 4AFJA 2VTOA 2C6TA 4WNPA 4P7EA 3IK3A 1ERKA 4ZTQA 3TTJA 4D1XA 3TKUA 2R9SA 4DEHA 1KE7A 4BR3A 4AUAA 3TL8A 1ST0A 2Y6MA 3VUDA 2W1EA 1E9HA 5JN2A 4JIAA 3FLZA 4QTDA 5IA3A 3MFRA 2DUVA 3HRFA 4KBCA 3W0OA 5JFSA 2OLCA 1HOWA 1RJBA 1YOMA 2CSNA 2QONA 2BCJA 5IEVA 3BGPA 4MXZA 3SW7A 3NNXA 2PMLX 4KSPA 5ANJA 3TEIA 3VBVA 4RLKA 1VEBA 1U54A 5BYZA 4J8NA 4DE4A 2GQSA 1XBBA 4M12A 3Q4TA 3DBDA 1YI6A 4O7VA 3CEKA 1OIYA 2Z7QA 1GIIA 2JIIA 2UW5A 3MJ1A 4RG0A 4M66A 1SMHA 1GZOA 1OBDA 5IQIA 1YWVA 4H36A 4CGAA 3OEFX 4Q2AA 5C01A 2FSMX 1H01A 1J7IA 3F3WA 5TKDA 3WF7A 4CNHA 2QOKA 2VTTA 3LXNA 2CGXA 1H4LA 5TE0A 4C7TA 3D2IA 4D4SA 4FTTA 4O0UA 3H9OA 4L9IA 5DE2A 1IAJA 2PVJA 2YZAA 3Q4ZA 5EH0A 3ZO2A 4DDIA 1P2AA 1M14A 2C3IB 2ZOQA 3GC0A 3MGYA 3WZKA 2C0OA 3TJCA 5IH5A 3LFFA 3QQLA 1GZNA 4FV7A 4V01A 4N70A 5GZ9A 1TFFA 2GQGA 4Y95A 3DS6A 5TR6A 3UMXA 4FIHA 5HBHA 3IS5A 4JX3A 3UOHA 3W8LA 2GQRA 2B9JA 3SW4A 2O8YA 4YO4A 1DAWA 3IW7A 3W16A 5HQ0A 4GV1A 4CLJA 5LJJA 5LMKC 2W1IA 3SC1A 1IAHA 5BV3A 4GK2A 3OVVA 3Q4UA 4BDDA 5J1VA 4N6YA 2ITYA 2WOUA 3Q04A 4AS0A 2HW7A 4IH8A 5D41A 4N4SA 4I5MA 1K9AA 3KFAA 1IASA 5M4FA 2GTNA 3WF5A 3A8WA 4Y5HA 5H8GA 4DEEA 4EH9A 4BDHA 4CFUA 2JGZA 5IPJA 3UDZA 2VO7A 4IM3A 3EQBA 3UYTA 3HP5A 3COHA 4BDEA 2HWPA 4F9YA 5CI6A 3AT4A 2XJ2A 3T8OA 3F5PA 3E88A 3SRVA 4C37A 5EW8A 2UZUE 3GQIA 2Q0NA 4B0GA 5J9ZA 4IX5A 4KIOA 4ACMA 5KX8A 3T3VA 2XRWA 5IZFA 3RGFA 3B8RA 3PZHA 3GEQA 3SD0A 4ALUA 1BUHA 3OEZA 3E92A 2R3LA 3JUHA 3KMUA 4ZZOA 1WBWA 3FI4A 4I3ZA 1JSTA 3I5ZA 1FVTA 1TQMA 1OB3A 1KOBA 4CFXA 4CZTA 3B8QA 5DRDA 4ASEA 2RFDA 3DAEA 4JQ8A 3DBQA 4UYAA 4FZ6A 4O7SA 3DB6A 5F4NA 3V6SA 4YZDA 5E8YA 3CKXA 3D94A 4HCVA 3TNQB 5CU4A 3QA8A 4I94A 4GG7A 4CYIA 2JIVA 2OJJA 4QP4A 4RC2A 5L2WA 2GMXA 2OIQA 2VWYA 2XKCA 3OY1A 4BIEA 2GSFA 4S30A 1U54B 4QMWA 1G3NA 3MI9A 4FV4A 3VC4A 1PXKA 3PZEA 2NP8A 4WG4A 4FV0A 4GS6A 1K3AA 4ZXTA 4AZFA 1NT2A 1JKSA 3P79A 4RJ8A 4YJOA 4F70A 3PJ3A 1ZYLA 1WBVA 3R7UA 3QUEA 4G6OA 1J7UA 3JS2A 2XCKA 4TYIA 5AUYA 4C35A 3EN5A 2C3KA 4M8TA 3PYYA 2CGVA 4QT1A 2YEXA 2HY81 4D2PA 4YTFA 3LXLA 4QYYA 4C58A 1FVVA 3NVKI 4FKOA 5F95A 2HZIA 4U7ZA 3QTSA 4KWPA 5IA0A 1VYWA 3KB7A 4XP3A 3C9WA 5IG1A 4EOOA 2R3NA 3W0PA 4WSYA 2E9UA 4LV5A 4JRNA 3I1AA 4CCUA 4MWHA 1OGUA 1ZOEA 4QQCA 2VTHA 3TG1A 3ACJA 3CBLA 4S32A 4NH1A 3EIDA 3LFBA 3KREA 1Q61A 3ZO4A 5FQDC 5AR8A 4HNFA 4ALVA 3P5KA 4AF3A 2G1TA 3ZO1A 4AW0A 3DXPA 4O7TA 2VX3A 5IKWA 4EQMA 3D5VA 2QLUA 2Z7RA 5IDNA 2YM8A 5L6OA 3E64A 5AAEA 2VTQA 3KRLA 3ITZA 2WB8A 3HUBA 4XEYA 3FKNA 4AE6A 3FZ1A 1NA7A 2XYNA 4DGNA 4EOPA 5M4UA 2OJFE 4U42A 4F1OA 2XNNA 5BVOA 1SVEA 2B53A 2F4JA 3KKVA 1H1RA 3QQFA 4YJNA 2WTVA 3RK9A 2JDTA 1S9JA 3R21A 1PXJA 5C8MA 2YCRA 3UTOA 3OXTA 1WVYA 4XP2A 5B2MA 2O3PA 4GJ3A 3V8TA 3ZRMA 2XA4A 3SRVB 3JYAA 3R71A 4FICA 4MD7E 3HEGA 3IQ7A 4MTAA 2LGCA 4FZDB 2QD9A 4XX9A 3DKOA 4PP7A 4O83A 4L3LA 3PFQA 2IZTA 3E7OA 4FTCA 4FEXA 4FSUA 1PMUA 4Q9ZA 4X2GA 2ZDTA 3KN6A 4B4LA 4C36A 4DDGA 2PUPA 3BEAA 4GVAA 1YDRE 5HHWA 3RJCA 3KULA 2GS6A 4LL0A 4BGHA 4ZTLA 3RPOA 4PWNA 2AQXA 1F0QA 1YDSE 3BE9A 2P3GX 3FY2A 4I93A 4L6QA 4U97A 5AMNA 4CLIA 5GINE 3FMNA 1MRUA 3ZBXA 4IVAA 3H10A 2XAMA 4GFMA 4OLIA 1J1CA 2ETRA 3HGKA 4CFMA 3RCJA 2XK9A 4JAIA 2OXXA 5JEBA 3PA3A 4PF4A 1M7QA 3D7ZA 1JSUA 4R5SA 2IG7A 4HVHA 3F69A 2WEIA 4P5QA 3MYGA 4F7JA 1OPLA 5AX9A 4BIBA 4ZMFA 4AU8A 3V5TA 5EDPA 2XNGA 2YZLA 4GU9A 3BL9A 5BX0A 2QNJA 3MH0A 4LRJA 3R2BA 3THBA 4NM3A 2VN9A 4BI0A 5KMNA 2C6OA 1Q4LA 5GJGA 4JXFA 4K8AA 4GH2A 3ENHA 4I0TA 1MQ4A 5AUWA 5JRQA 4EBWA 4CSVA 1B38A 5EOLA 3R01A 1FOTA 2UW4A 3BYSA 4Y83A 4RIYA 1B6CB 4QMSA 4X3FC 3UO4A 3BWJA 3PUFC 4G3DA 3QX2A 4ZS0A 4F9CA 3HDMA 5I9WA 4RLLA 2RL5A 3O71A 2B9FA 3IPHA 4H3BA 4BL1A 5ACBC 1LEZA 2W17A 3O51A 2XBAA 3EN4A 1YXTA 1Y91A 4BZNA 2WU6A 4QMYA 5FGKA 3D2KA 1YI4A 3RAWA 3VUGA 2NNWB 3ROYA 3AC2A 4O1OA 2PVNA 3PJ2A 4QNYA 4O6LA 4FK3A 3VF8A 4RIOA 3BZ3A 4XBUA 3A7FA 3OTUA 5HESA 3ZUTA 4NU1A 4AAAA 1PW2A 4MVFA 4B6LA 1UU9A 5AV4A 4DHIB 1UNGA 3EJ1A 4GUBA 3NIEA 4M15A 3KK9A 4BZOA 4ZTRA 5CSWA 3V5LA 2F7EE 5CAUA 3MA6A 4IMYA 3ZDIA 2PMNX 3LMGA 4YHTA 3UPXA 3OW4A 4D55A 5JFXA 3NUSA 5CZHA 5I9YA 2WMSA 3O23A 4D58A 3GNIB 3U55A 2QURA 2ZDUA 3QCYA 2V22A 2IW6A 4FSZA 2EXEA 5H9BA 3TYKA 3VUKA 3MBLA 3PY1A 4J99A 2UV2A 2QOOA 3NUYA 2BHEA 3QWJA 4WBBB 2RG5A 4MBLA 2C5XA 3DNEA 3IW4A 2ITWA 4FC0A 5ETFA 4V0GA 4CMUA 5IMXA 2WTDA 3GFEA 3W0MA 1WBNA 4AXEA 5CSPA 5AFVA 3C4CA 3OUKA 2C5YA 3AQVA 2UZBA 4ANMA 3CTJA 4KS7A 3EL7A 4C4GA 2RFEA 2JKKA 4MNEA 5L4QA 1ZY5A 4WHZA 1WZYA 4IC8A 2XJ1A 4UWYA 4WNKA 2PZ5A 3LE6A 3V3VA 4IFGA 2C47A 1YXVA 4M3QA 2Y8OA 3NNVA 3V5JA 4CXAA 3P5JC 5FTQA 5CQUA 4XV3A 2R3GA 3E62A 3NW5A 1OPKA 3KIOC 3E7VA 2YAAA 5BUIA 3MPTA 1W2FA 4YNOA 4IX6A 1DS5A 3ORTA 3C1XA 4AXCA 3EYHA 2XNOA 2V7OA 5EW3A 4PMSA 4UXQA 3UYSA