4U8ZA

Crystal structure of mst3 with a pyrrolopyrimidine inhibitor (pf-06447475)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
290
structure length
289
Chain Sequence
GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase 24
publication title Discovery and preclinical profiling of 3-[4-(morpholin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-5-yl]benzonitrile (PF-06447475), a highly potent, selective, brain penetrant, and in vivo active LRRK2 kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 289
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u8zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u8zA01
4FG9A 4C3FA 2Q83A 4RVLA 5GIOE 5HIBA 3WF7A 2EXMA 3FYJX 3RCDA 4ZIMA 5HE0A 1AD5A 1R0PA 2ETMA 3KK8A 2R3IA 4L7SA 4LOQA 1YOLA 3D5VA 5E8ZA 3BHYA 2JLDA 4ZJJA 1GIJA 1OECA 4RFZA 3CTHA 5GJGA 3K3IA 4DFXE 2O65A 4FTMA 2GNJA 4L68A 4RJ7A 4ZP5A 4IFCA 3LM0A 4U79A 3V5PA 1ND4A 3EN6A 3R8VA 4XG8A 1FVVA 3HA8A 2VRXA 4ITHA 2EVAA 5DA3A 3G5DA 4RBLA 5JQ5A 3QQGA 1PKGA 3SRVA 2REIA 4YJPA 1XH6A 1M14A 5KHXA 4QYEA 1OL1A 3BV3A 2VD5A 3GENA 4GMYA 1XWSA 4QMVA 3BIZA 5CLPA 2J51A 3ANRA 3UO6A 3TACA 3DZOA 4K18A 4MNEB 2YZLA 5E92A 4DE4A 3O50A 3GU7A 2ITNA 4C8BA 3EKNA 5BYZA 5EOLA 4J53A 2WKMA 4FUXA 2F2CB 3KF4A 3N4UA 4NUSA 1U54B 3FLSA 3EL7A 3EQIA 3R22A 2C3KA 5FM3A 3RM6A 4GK3A 4LG4A 3E3BX 2WU6A 3QYWA 2UW4A 4U9AA 3DGKA 2Z02A 4I4EA 4QPMA 4E3CA 2NRUA 4OT5A 3GI3A 2BCJA 4FSYA 3F9NA 4YO6A 2JDRA 4DC2A 2V7OA 1RE8A 3R9DA 3DPKA 2Y8OA 5KBRA 4F70A 4AU8A 4GVAA 5CNNA 3V5JA 2RGPA 5DH3A 3KMWA 4DLJA 2WXVA 2IW9A 2VWYA 4KWPA 4DTBA 2C0OA 2WZJA 3UNKA 3BX5A 5TO8A 1P4FA 2X9FA 3T8OA 4BGQA 4RJ5A 5HO7A 1H0WA 4FC0A 3PVWA 4JDKA 2R3PA 4FNYA 2OJJA 2VTOA 4YZMA 2OXDA 4C61A 1UA2A 3CQUA 4QP3A 4R3RA 4WRSA 4QTEA 2HZ4A 3IKAA 4RJ3A 2W5HA 2NO3A 3LLTA 4IX3A 5AP4A 3LXKA 4AXAA 5KNJA 5M4IA 2WFYA 3QZIA 4MXAA 5L6OA 5HO8A 4XOYA 4G3GA 4OTHA 3VRYA 4DFBA 3MA3A 1BKXA 3FSFA 3VNTA 2VZ6A 3OT8A 3LXNA 4MWHA 3VC4A 2W5BA 2XKEA 2XS0A 3FXWA 3HMPA 4G3CA 4LOOA 5JRSA 4AGWA 2UW8A 4TYHB 4GUBA 4J52A 4C62A 4EZ3A 3OVVA 4G34A 2WIHA 4O83A 4MD7E 3CGOA 1NW1A 4IAYA 2W5AA 4BKYA 5CAVA 2BFXA 3PVGA 4YJQA 1OPJA 3RKBA 3EIDA 2X1NA 4A9TA 2OFVA 2PHKA 2JITA 2Z8CA 4L3PA 3UMWA 4EK4A 3F2NA 3LW0A 3K3JA 3QRUA 1GZ8A 4F6SA 3R7UA 2FSOX 4ZZNA 3FMHA 1G8AA 1S9JA 3D7ZA 3BYMA 5FXSA 4CT1A 3O2MA 4F08A 1HCKA 1Q8TA 2CGUA 3C4XA 4FV9A 5HD4A 5HVYA 2VTNA 3H30A 4NSTA 1OL2A 3VS7A 4A4LA 3ITZA 4YC3A 3TNIA 2ITWA 4QP2A 2ZV7A 3G9LX 3G2FA 4FTIA 4R7HA 3ZLSA 5IU2A 4IVCA 4RVMA 2GNLA 5DNRA 5C01A 3FKLA 1MRYA 4YJUA 4F65A 3NUAA 3R2BA 2YABA 4C36A 4RQKA 4HVSA 4O7SA 4OBOA 4I6QA 1WVYA 3D2IA 3PP0A 3UPZA 4DF3A 1FGIA 2QU5A 2WMQA 2BHHA 3VQHA 2ZJWA 2QOKA 3UVPA 3VBQA 1KOBA 4BDBA 1ZWSA 2XCKA 4IXPA 4PL4A 3A7JA 5B0XA 4GKHA 3TNPC 4IB5A 5AM6A 5KMJA 1JKSA 2P3GX 4V0GB 3LMHA 2UW7A 1XH9A 2RG6A 4PL3A 5GNKA 4RSSA 1O9UA 5IKWA 4DG2E 2W99B 5A14A 2XNMA 3PJCA 4RC3A 2UZTA 4EOQA 3FAAA 5L2IA 3NGAA 2J7TA 3QBNA 4B0GA 4UB7A 1M52A 5AR8A 4FT7A 5BQ0A 4XYFA 3VHKA 5LVOA 3PP1A 3W8LA 5A4TA 5JRQA 1KE8A 3KKVA 3PY3A 3NNVA 3OZ6A 3DT1A 3VS3A 4FOBA 4JRVA 4YO4A 4RVTA 1FOTA 1GY3A 4PNIA 5LVMA 5CEIA 2AUHA 5EYDA 3F6XA 4O21A 3BEAA 5KMIA 4QTBA 3VO3A 1U46A 5IH5A 5I9YA 2YM5A 4IZAA 4JBOA 5IEXA 4U3ZA 2PVKA 3AC5A 5HX6A 2WB8A 3CLYA 3FL5A 4TWOA 3MVMA 4I6BA 5CSWA 5TF9A 2IVTA 4K0YA 3TNQB 4FEQA 4NM5A 4BIBA 5IF1A 2J5FA 5HE3A 2C0TA 3UG2A 1QPDA 2QO7A 5FEQA 2W06A 3Q5ZA 4RWIA 4YSJA 4L42A 2ZV8A 3MFRA 4DGGA 1UU7A 3SHEA 3DXNA 4ID7A 4PWNA 4O82A 2P33A 4FV4A 4X6RA 2F9GA 2UZNA 3CTJA 4HGSA 4Y73A 3ACJA 4D2VA 4KIKA 3BHVA 3FKNA 4FEVA 2R5TA 4C3RA 3NW5A 3E87A 4EORA 1KSWA 4J96A 4NWMA 5IDPA 4EONA 2BDFA 4C4GA 5DYJA 3GXLA 3GU6A 2H96A 1LPUA 3HV6A 1PHKA 3VUGA 4ZJVA 4EUUA 2ACXA 2UW9A 5IEYA 4FKPA 4FIJA 4NL0A 2BROA 5L6WL 4I6HA 3WI6A 4ZTSA 2VTTA 4GU6A 5D7AA 4ZAUA 3NUNA 3FEGA 1STCE 4YHJA 4DBNA 4FKTA 1ZY5A 3FLYA 1Q99A 2Y9QA 4IWPA 4D55A 3QUPA 4MTAA 2Y0AA 4RIWB 2ZM4A 4YC6A 2PTKA 5AP6A 4WNMA 3LFDA 4ZZMA 5AAGA 3C4CA 4KB8A 3F3TA 3IQ7A 3LFSA 4OTIA 5EI6A 2Z2WA 4WUNA 4A9SA 4IAZA 4DT8A 4YBJA 4YJTA 2KTYA 2OJFE 1OKYA 1OUYA 1WVWA 1Q24A 1U59A 2B55A 4C58A 5HOAA 1H1PA 2ITYA 3ZFYA 3A7HA 2YISA 4BRXA 3IGGA 3MDYA 2QOCA 3TM0A 1OITA 3FMLA 3Q4UA 5L2TA 3N4TA 3EQCA 3OBJA 2CGXA 3CBLA 2RG5A 4DAWA 4XV3A 2GDOA 2YDIA 2J0KA 2QLQA 3GC7A 3GU8A 4GV1A 3QAME 3I1AA 4GYGA 3TT0A 4AOJA 3ZLXA 3BWJA 3AT4A 4WSYA 5D11A 5EHLA 4BGGA 2G2FA 4I6FA 4C37A 3V5LA 5KMNA 5L8KA 1WCCA 2OJIA 3VIDA 4YMJA 3CY2A 3DOGA 4OTQA 3UIUA 5EM5A 4AGCA 3PY0A 3ZSGA 2V0DA 4DFNA 4HPUE 3TN8A 4L7FA 3ORZA 4JR7A 4FYNA 2VTSA 1MQBA 2I0HA 3VN9A 4F9YA 5EW8A 5D9HA 5KHWA 2RFNA 3B2WA 1ZXEA 4NT4A 4B7TA 1KUTA 5CSHA 4APCA 4C3PA 3I4BA 1JLUE 4PTGA 3KULA 1XJDA 1LEZA 5AUZA 2XIKA 2R64A 5CU0A 2C6TA 3TV6A 3E8CA 3KEXA 3PIXA 4BDKA 3RAHA 4PF4A 4FKQA 5HBEA 3CIKA 4EJ7A 2VO0A 1Q8UA 3C0HA 3DDPA 3VWAA 4PPBA 1YWRA 2UVXA 2X2KA 2IVUA 4DCEA 2GHLA 2UV2A 3NVMB 3ODZX 4BDEA 5EI2A 3P79A 1WVXA 3T3VA 2C5VA 2QOQA 1FINA 4L43A 4F63A 3QLFA 4WT6A 5TR6A 2XM8A 2BPMA 3EFWA 4QNAA 4RZWA 1ZZ2A 5BPYA 2ZDUA 4MNFA 2XRWA 5FM2A 5K9IA 3V5QA 1H8FA 4O81A 1GOLA 3HDMA 1XQZA 5BUJA 1CSNA 4JG7A 4KINA 1W98A 3F88A 2LAVA 3LFCA 2QONA 3EZVA 5T6KA 4XBRA 4EH3A 3G90X 5CX9A 3EHAA 2WMBA 3HUCA 4X0MA 3VBWA 4EOIA 1NVSA 2UZUE 3KRJA 4FV2A 5TKDA 2VV9A 3U54A 5J1WA 3KXHA 3COMA 4I5MA 4F9BA 4Z55A 3A7IA 2VWZA 1A9UA 2Y4PA 2OIBA 4N0SA 4PMSA 1TKIA 3MFSA 2UZEA 2WMSA 1PXPA 2XNOA 4KNBA 2XKCA 3HMIA 3L8PA 4MXYA 3UYTA 5A4LA 4EZ5A 1H07A 2UW3A 3POZA 3L9LA 4IDTA 5DT4A 3R7YA 2OZAB 5LMKA 1YXSA 2W1ZA 4CFVA 2CGWA 1L3RE 4PDSA 1HOWA 5BVWA 2GNGA 4R3CA 4O91A 2QHNA 4CLJA 2Z7SA 4YLJA 4FGRA 5C26A 1VYZA 3VBVA 2GFSA 3OWJA 4ONAA 2RKUA 3UQGA 4JG8A 4XX9A 3D9VA 5HIEA 4J1RA 2BIKB 4BWXA 5GZ9A 3PJ8A 4ACCA 1WBPA 3KK9A 3TDWA 4BCMA 3LPBA 3FMNA 4PMPA 5DE2A 2BKKA 2ESMA 4X2KA 4FT3A 3W55A 3KMUA 4J98A 4EZ7A 3D5UA 4PNKA 4AT5A 3SVVA 1WBOA 4I5CA 2FB8A 3ALNA 3MA6A 3E8NA 3QQFA 2BHEA 4JIKA 3OMVA 4O6EA 4IADA 4PMMA 3R63A 2O5KA 1W84A 4D4SA 3FLZA 2R7BA 4U5JA 4F0GA 4KRCA 3TTIA 4CVAA 5L8LA 4CGAA 1QL6A 2W7XA 2WTWA 4KAOA 4NKAA 3DAKA 3R7EA 5LCKA 5AA9A 1YOJA 2QOIA 4QMWA 4AFJA 2VTQA 4CTCA 4PY1A 3SC1A 1XBAA 4OTDA 4F7LA 2YCSA 5FXQA 2I0YA 3R04A 2CNVA 2J0MB 3HNGA 3R1YA 4J8NA 3WE8A 2WMTA 5IDNA 1APME 2HW7A 3E8EA 3H10A 3GU4A 5FBNC 4EK3A 4XHKB 5AX9A 4AGDA 4C38A 2QKWB 4YPDA 3BLRA 2JKKA 5IG1A 4JDHA 4BTMA 4USFA 2JIIA 3O8TA 5IMEA 4M69A 2XCHA 4KBAA 4M7IA 1WBVA 3AC2A 1FVTA 3QLGA 4EOKA 5FTOA 1IAHA 3UP2A 4XG3A 3BQCA 3OW4A 5BVKA 3S0OA 4W4WA 3I60A 3UZPA 4BCJA 2JBPA 2W1EA 4PP7A 3QZHA 5A4CA 3WZDA 4CZUA 4ITIA 4FZ7A 5GHVA 2UVZA 5DR6A 3UC3A 2WQMA 3NNWA 3W33A 3LMIA 3AMBA 3V5TA 4G16A 5CVGA 1OIUA 4NM7A 4WG3A 4FV8A 4YP8A 3R7IA 2E9VA 2R2PA 3L8VA 3R1SA 3CR0A 4CMOA 1PXJA 3PPJA 3DV3A 4TY1A 2O63A 1OMWA 4EEVA 4BZDA 2B1PA 1PYEA 3Q4TA 1ZY4A 3D14A 4RRVA 4QP9A 3LM5A 3KC3A 1ZOGA 3FC2A 3OY1A 3TI1A 4FEWA 3GP0A 4YZ9A 2XJ1A 2VX1A 3HMOA 1PXMA 5H8BA 4A07A 5IQIA 3A8XA 1SNUA 3HRBA 4XJ0A 5AR3A 3ZEWA 2IPXA 5AP3A 2CKQA 5AWMA 3OBGA 1REKA 3IOKA 2G1TA 3TXOA 2EXEA 2VNWA 4E6QA 1DAYA 1W83A 5KMOA 4KA3A 5DLSA 1KWPA 2PVLA 4FMQA 4U0IA 3MI9A 4GG5A 2P55A 4I94A 1RW8A 3IONA 5ANOA 3ZC5A 4JAJA 3ORNA 3PXRA 4JQ8A 4NIFB 3RINA 4PTEA 5FRIA 5HTIA 5CASA 3ZUUA 2I0EA 2QLUA 3P4KA 4IC8A 4XV2A 3PWDA 3G15A 2PSQA 3CS9A 4A4OA 2R3RA 5HLNA 1M2RA 3JR1A 1WBSA 3FZ1A 3PVUA 4QMPA 3WZEA 3HDNA 4FKRA 4YJOA 5K4JA 2A0CX 3MH3A 3FPMA 5E8XA 4H36A 3IDBA 4XLIA 4KIPA 4BF2A 4HGTA 5CANA 5LARA 4HGLA 4NTSA 4LM5A 4RIXA 5ETFA 5IA1A 1OKVA 4XRLA 4M12A 4XG7A 2Y7JA 3AGLA 3O23A 3V51A 4F9AA 1I09A 2X7OA 4R78A 4YZNA 1DI8A 4IANA 3RGFA 5CF6A 4FTKA 2UW0A 4TTHB 4FIGA 3LJ0A 3SOCA 4UWYA 3TJCA 4B8MA 4O0XA 2XK9A 4E8AA 4L67A 3BWFA 5DN3A 3Q4CA 3PJ3A 3TJDA 2GQGA 1PY5A 2OF4A 2IVSA 4IZYA 3LQ8A 4C4EA 3PG3A 1IRKA 1UKHA 2Y6OA 5FDXA 4L01A 4O96A 1Q97A 3N9XA 4DCAA 4GT5A 4XG9A 2OW3A 5J95A 5ACBC 4LGDA 1S9IA 4UWBA 3EQDA 5LVNA 2E9OA 1PMVA 3OCSA 2XNGA 4BHNA 1E1XA 1PMNA 4IWQA 3JY0A 5HCXA 3KGAA 4AT3A 2XZSA 4GJ2A 4OTRA 4DH3A 4CKRA 5J7HA 2BTSA 3PRFA 4F6UA 4Z9LA 3UE4A 2KULA 2QR7A 2OO8X 3KQ7A 4NJDA 1KV2A 4U44A 2VX3A 2QHMA 3H0ZA 1Q5KA 2P2IA 3QALE 3VF9A 1JAMA 1YI3A 4BDDA 4E5AX 4FTLA 4RX9A 1B6CB 3DQWA 5CSXA 4IJ9A 4JQEA 3V6SA 3VHEA 4CV9A 4EUTA 4D5HA 5HKMA 4J71A 3GBZA 4L8MA 3PRIA 3FL4A 3D5WA 4X2JA 4BTJA 4BWKA 2C1AA 4BIEA 2OLCA 3I7CA 4C02A 5FLFA 4ZLOA 4FNWA 5BUIA 4D9UA 2B4SB 4ACMA 1DM2A 2OG8A 2GCDA 3OF0A 2C4GA 5HICA 5DWRA 3NYXA 4BTKA 2JGZA 4BCQA 3S1HA 2B53A 3FMJA 4TYJA 2WELA 5I5ZA 4K11A 4D1XA 4GSBA 5HEZA 3LQ3A 3IW4A 4GCJA 1ZARA 1TQPA 4JRNA 4O27B 3QKKA 5F4NA 3MFTA 4EOSA 3MTFA 5I3RA 3MH2A 4L44A 3DBCA 4KABA 3W2OA 3FJQE 2BR1A 4CFWA 5CNOA 3WIGA 2XK8A 4MXZA 4U7ZA 2QOOA 4MWIA 5AR7A 1O6YA 3RAWA 4CSVA 2OWBA 4WNKA 3QTWA 3MESA 3A62A 4R77A 4DTAA 3OW3A 1RJBA 1NVQA 3AC4A 3QRKA 3MY5A 2G15A 3IW8A 4D5KA 3ZBFA 4FGBA 4DHFA 3QTXA 2ERZE 3KRLA 3QRIA 4R8QA 4FV0A 3SD0A 5A54A 5IEVA 1JPAA 4IB3A 4CZYB 4J99A 4PX6A 4B4LA 5BYYA 3EN7A 4X3FC 3S4QA 1BMKA 2PUPA 5CWZA 3UO4A 5AX3A 2HY0A 2XH5A 4LL0A 4WNPA 5L6PA 3Q2JA 5HG9A 4ERWA 5EM6A 4E7WA 4R7BA 4O0VA 4U40A 3PA4A 2W9FB 4MD8E 2Z7RA 4AZTA 4CZTA 3TKIA 5CZHA 4DEGA 1CMKE 3R21A 3ATTA 1IEPA 1PMEA 3JVRA 1LP4A 3G6GA 3E7OA 1YDSE 3W2PA 2YM3A 3PPKA 4IE9A 2BRGA 3MB6A 3MB7A 3NRMA 4FL1A 5T68A 2C6OA 4KBKA 5DFPA 5I9WA 3PTGA 3R0TA 4AGUA 3R6XA 4PUZA 3RPRA 3BCEA 3NUUA 4K8AA 4OT6A 5FTGA 1OZ1A 4TNDA 1Y6AA 4BCFA 5AR5A 4EH5A 4BDCA 3F2AA 2IW6A 3EKKA 3DQXA 3KRRA 3PSDA 4CKIA 4CCBA 2X81A 5CSPA 1H00A 3RWQA 1UU8A 2PE2A 3MPTA 3WILA 3B8RA 4MEDA 2GFCA 4LUDA 1J7IA 3EFLA 3FMEA 4NJ3A 2E2BA 3WE4A 4JQ7A 3OCGA 2UW5A 3CXWA 3E88A 4RA5A 5I3OA 3U6JA 3ATSA 3RJCA 3ZUTA 4L46A 3FQSA 4E4NA 2CCIA 2XRUA 3CCNA 4X3FB 5C03A 2BZKB 2UZOA 4FL2A 2WMWA 4G9RA 2E9NA 2WTJA 3H4JA 1WMKA 3W8QA 5AEPA 1YHVA 5AR4A 3C50A 2QURA 3IG7A 3HMMA 4NK9A 4CMUA 5J87A 3P0MA 2PY3A 4PQNA 4ALVA 3UO5A 3BHUA 5HU9A 3HECA 1KE6A 2VN9A 3AD5A 2YM8A 4FZDB 1K3AA 3RI1A 1B38A 3UOLA 4BN1A 3IK3A 2DWBA 4EHEA 5A6OA 4X2GA 3FZPA 4YJVA 5AUXA 3VBXA 4DEEA 2R3FA 5DGZA 5A6NA 4H3PA 5IISA 5CF8A 3JYAA 3DBEA 2WEIA 3OUNB 2VTIA 5L8JA 3RPYA 3U87A 4K77A 3OY3A 4R1VA 1OBDA 5ANGA 3BZ3A 2ONLC 2QI8A 1YDTE 3Q4ZA 4I24A 5M55A 4FV3A 1PKDA 2GSFA 3Q32A 5H8GA 4F0IA 2A19B 2R3LA 5BVNA 2VUWA 2C6LA 3C4WA 4ZSJA 5B2MA 3R8UA 3OROA 4UMUA 2PYWA 3NAXA 4PPAA 5IQEA 5FTQA 5GZAA 2X6DA 5KMMA 5HBJA 3VVHA 2C6IA 5EHYA 4CTBA 4C34A 5D10A 5DIAA 3BV2A 4FV6A 3SXRA 2R7IA 4I5HA 2XVDA 2OU7A 2ZB1A 4IX6A 1OB3A 4E6CA 4L00A 1BYGA 3QTIA 3I7BA 2FH9A 1ZMWA 4QYYA 2HK5A 3QQHA 3R28A 3OHTA 4UZDA 5HI2A 4HVHA 5C27A 3KN6A 2GPHA 4XNEA 3HL7A 4DTKA 3ORIA 4TWPA 5TE0A 4ZS0A 1DS5A 1P14A 5CEMA 1Q8ZA 5TT7A 4FK6A 4OTFA 4II5A 1IA9A 3EYGA 4MKCA 2VWXA 4QTDA 2OXXA 4AN9A 3ZO2A 5AA8A 5A4EA 2PE0A 2EUFB 4MCVA 5CENA 2C0IA 5DBXA 4Q9ZA 2YIWA 4JR3A 1GZKA 4AAAA 4GIHA 3SAYA 5CYIA 4F0FA 4IVAA 3UDBA 4FKUA 3QC9A 4D0WA 4O0TA 2XF0A 3Q60A 5EM7A 3EQHA 4D2TA 4RGJA 3AD6A 3RBWA 3ZH8A 4XG4A 1QCFA 4YTHA 4DYMA 1PXKA 4U41A 2IJMA 4N6ZA 3KL8A 4FSTA 4L3JA 4TPTA 2JBOA 4E4MA 5FEDA 3E64A 3VW6A 3ZFXA 4QMMA 2PU8A 4X6QC 3LIJA 3CKXA 3RNYA 4IAFA 3BHHA 5ANDA 5IUIA 1YVJA 4KS7A 2HY81 1DI9A 1YOMA 1Y6BA 4RIYB 4XEYA 4QMOA 3QXOA 2PK9A 3ORXA 4ACGA 4FSMA 2J5EA 1JKLA 3D0EA 4TYEA 5HG7A 4CYIA 4Y95A 3POOA 3HVCA 4Y83A 3LFEA 5I0BA 3P7AA 2JKQA 4G1WA 3DLSA 5BUEA 3EZRA 3BU6A 1H1RA 1FMOE 3BGQA 4EHGA 1J1CA 3AMAA 2VX0A 4GFGA 2XBAA 4C35A 3NZ0A 3FV8A 4EHZA 1PRYA 3PXFA 4IMYA 3VUIA 4FV7A 4S2ZA 2BZJA 3ZRMA 1XKKA 3FMDA 1YHWA 3HZTA 2ITQA 4JXFA 4TYGA 5CT0A 3OEZA 3QTZA 3KXZA 4HNFA 4FSUA 4GEOA 3R73A 4D2PA 3GVUA 1XR1A 3ZTXA 3AD4A 4AT4A 4OUCA 5JH6A 3AC3A 5AUUA 4DFUA 1G3NA 3JPVA 1UU9A 4QOXA 2JDVA 3FDNA 3WZKA 1SVEA 4YC8A 4WG4A 2R3HA 4O2PA 3FPQA 2PUIA 1H1QA 4DEHA 5LQFA 3NVKI 1KE7A 1KE9A 2HW6A 5DRDA 4NM3A 5H3QA 2YCQA 3W2SA 2XK6A 2FUMA 2HYYA 3BPRA 2JC6A 3I6UA 4FZ6A 4GT4A 3NYOA 4QQCA 3W2QA 4FKVA 3LVPA 2VTPA 2Y6MA 4FKIA 4IAIA 4L45A 3Q6WA 2XK4A 4G5PA 3UOKA 4USEA 4ACDA 2R3KA 3MJ2A 4PMTA 4ASEA 5DMZA 3IDPA 5DG5A 5KE0A 4EOLA 5CI6A 3NYVA 3OWKA 5HESA 4TRLA 2OXYA 2QOLA 3FY0A 2W1GA 5DI1A 3SXFA 5K0XA 3EH9A 2X4ZA 4HNIA 2QO9A 1YXXA 5EK7A 3ZSIA 3TL8A 3SA0A 1SNXA 4Q2AA 2BAJA 3Q9WA 4GRBA 2EXCX 1URCA 3ZLWA 4AA5A 2OIDA 4OTGA 4I0SA 3LCTA 3RPOA 3RALA 2QCSA 2BIYA 4MQ1A 4D4RA 2GQSA 3HGKA 4IVDA 2ZM1A 4QMUA 3VQUA 5JZJA 4DEBA 4FR4A 3RNIA 2HCKA 2OICA 2F4JA 1V0BA 3DNDA 3KF7A 3NNUA 4U97A 4RX5A 5IA0A 3QYZA 4BCKA 3P86A 2W4OA 2NRYA 2E9UA 4GIIA 3ANQA 4A7CA 4QP6A 3AT2A 4DEAA 2F2UA 5LCJA 4CT2A 3B2TA 4D9TA 2QC6A 5EHOA 2UZLA 2XNEA 3A8WA 4AX8A 4DGNA 4MF1A 1Y8GA 3AC8A 3DBDA 3UZTA 3E93A 1OM1A 4CG8A 3D7TB 2BALA 4EKLA 1OKWA 1H0VA 4UEUA 5IQCA 3VAPA 5CU4A 3ULZA 4EH4A 5M4FA 3QCQA 2JD5A 3C1XA 3QXPA 5CEQA 4CXAA 3NWWA 3PIZA 5EOBA 2WQNA 4K6ZA 4AW5A 3DXPA 3QD4A 3SX9A 4M0YA 4FVPA 4BCNA 2G2HA 3GCUA 5JKGA 1BI7A 3I0OA 3O51A 4NW6A 3IOPA 2VTJA 2XKFA 4XOZA 1GAGA 4PV0A 1OIQA 3GCPA 4PDYA 2GU8A 5I9ZA 3Q9YA 4XH6A 4JL9A 4I0TA 4AW0A 3II5A 2PVHA 4MX9A 3WZUA 2W0JA 3DK7A 3ZCLA 4IW0A 4L3LA 5AV0A 1W8CA 4BI1A 3PUPA 5T3QA 5EKNA 4NH1A 4S30A 1BLXA 5CU2A 2W1FA 2C30A 4XP3A 3MV5A 2VWIA 2XB7A 4UMPA 3F82A 5LJJA 4IB0A 2W1HA 1T45A 2YWVA 3ZC6A 3IPHA 3TUBA 3V01A 2I40A 5FQDC 1E1VA 3F3ZA 4NKSA 3DKOA 3G9NA 3PXZA 1PF8A 2ITZA 2WTDA 3PXYA 5EH0A 1FBNA 4FIFA 3LXPA 4F99A 4ENYA 4JDIA 1JSUA 2WTCA 2JKMA 1R0EA 3V3VA 3WARA 4I92A 3QKLA 2IN6A 4G31A 4W4XA 3S95A 3QRTA 4FKLA 4I20A 4S33A 3LHJA 3LOKA 3QC4A 3RHXA 1UNGA 4JX7A 3ETAA 1GJOA 2BZIB 1Z57A 1F0QA 1URWA 4X21A 2RL5A 3LZBA 4FNXA 5C9CA 3U6HA 3QFVA 4D58A 3DKGA 2FGIA 4JLCA 3FBVA 3HUBA 4ZTLA 3VUMA 3DK3A 3SRVB 4JS8A 4J97A 4O1PA 1UU3A 3AGMA 4QPSA 1SZMA 4IHPA 4TWNA 4XBUA 5LMAA 2YEXA 3UJGA 4Y85A 3NUPA 3OD6X 5L2WA 1OPLA 4HCTA 4FG7A 2PVRA 3ZONA 4QTAA 2R9SA 4D2WA 4MAOA 3PJ1A 4LRMA 3C9WA 3T9TA 2JDTA 3QZFA 1OI9A 2R4BA 5CI7A 2O3PA 4HPTE 3GQLA 3VUTA 2PL0A 2X39A 4AOTA 1TVOA 4BB4A 1WBTA 1NY3A 3FLWA 4QNYA 3PSBA 5IQGA 3TNWA 1WFCA 2C6EA 5M08A 2RSVA 4HCUA 4RFYA 2JFLA 1Q3WA 3MSSA 4JAIA 4RT7A 4NCTA 3V04A 2F7EE 4FIIA 3VULA 2EWAA 3MPMA 4I21A 3UG1A 3ZM4A 2JAMA 3ACKA 3PPZA 1M2QA 2QQ7A 5K5XA 2BKZA 3CE3A 2W05A 4AF3A 4O7TA 2PZYA 2H9VA 3WOWA 4TXCA 2FSMX 3MY1A 4W4YA 4AN2A 1YI4A 1ZRZA 2P0CA 2VO3A 4H39A 3KFAA 5K3YA 4FTUA 1KV1A 3COKA 1XBBA 3NCGA 4M67A 1WBNA 2QG5A 4M97A 4ZTQA 3FYKX 3PXQA 4QYFA 1ZYLA 5I9VA 4BDHA 2Z7QA 3N51A 2XIXA 2RFEA 1ZOHA 3QUEA 2VTAA 3ID6C 2IVVA 4AZWA 1ZYDA 2R3NA 4U43A 3QA8A 3AG9A 4R5YA 1Q3DA 5EQEA 4U42A 3S3IA 3R9HA 5ITAA 3GCQA 3VW8A 4DGMA 3RWPA 1CKIA 1FQ1B 3ENMA 3RZBA 2ZV9A 4X2NA 5KZ0A 4MXCA 4F09A 5JFSA 3F5PA 5LOHA 4OAVB 2O0UA 2B52A 5ETAA 2IO6A 1YKRA 3QZGA 3KCKA 4PTCA 5M53A 3DNEA 4AUAA 3FI8A 2HWPA 4IZ5A 2YIRA 1U5QA 2CLXA 1SM2A 3UBDA 4KKHA 1JQHA 2OJ9A 2YLEA 4LFIA 4V05A 3ZOSA 4AQCA 2QNJA 4MQ2A 4WBBB 2YJRA 3CSVA 1A48A 2BTRA 2XK3A 4XS2A 3KB7A 3IS5A 2GHMA 4YHFA 5EDPA 3UVRA 4P90A 4CCUA 4LOPA 5J8IA 3UMXA 4D2SA 4DBXA 3UIMA 3I6WA 3KN5A 4QP8A 3TKHA 4F9CA 5BMMA 3ORMA 4G3EA 2RIOA 4BZOA 2C5XA 4A9RA 4J7BA 3IW7A 4V01A 2BRHA 4BDJA 3UQCA 2I7QA 5HIDA 3NYNA 4JOAA 5M07A 1AGWA 4WHZA 3WF5A 1H28A 5KX8A 2H6DA 1L8TA 3ALOA 3R8ZA 2CCHA 4WG5A 3CY3A 2VO7A 1GZOA 2E9PA 2VWWA 4NFNA 3C7QA 4AE9A 4E4LA 4F4PA 5KUPA 3ERKA 1O6LA 3KRXA 2BDWA 3W18A 3REPA 4IX4A 2BVAA 3P23A 4K33A 3P9JA 4UALA 3FMKA 3CPCA 5EKOA 3A2CA 1Y8YA 3PIYA 4HJOA 1NT2A 4FSWA 2Z7LA 4GU9A 3PZEA 1QPEA 4LYNA 4I5PA 4N4SA 5EQYA 3Q9ZA 2WIPA 2BAKA 3ZXZA 5E8VA 4OGRA 3CD8A 4OTWA 4BDFA 5L3AA 3EB0A 4WOVA 3JUHA 4YZBA 2W1CA 2HZIA 3C51A 4I0RA 4X2FA 4QYHA 1OGUA 4MBLA 4NTTA 3EMGA 4JDJA 1JKKA 1U5RA 5BYLA 5FUTA 1CKJA 3V8TA 3QRJA 1ZYJA 3QD2B 2QKRA 4APPA 4YUQA 4FNZA 3MVLA 2W96B 4E1ZA 2WOTA 4M68A 3Q9XA 4YLKA 3TDVA 4IQ6A 5CALA 4E93A 4DG0E 3VS6A 3FZOA 3GU5A 5EFQA 2B9HA 3RHKA 5K0KA 4ASDA 1P4OA 4CLIA 4LMUA 2AC5A 2UZVA 3HP2A 4ZTNA 5ANIA 3E3PA 3C5UA 2GTMA 4LL5A 3DB6A 3BE9A 3AQVA 4FTAA 4EH7A 4BCHA 2WPAA 4KIKB 5J9ZA 5M09A 5A3XA 3PYYA 1H24A 3MTLA 3BHTA 2BILB 3PJ2A 1ERKA 4JG6A 3TV7A 1MUOA 3NUYA 4IB1A 5KO1A 2C6KA 3MJ1A 3G33A 4WIHA 1PYXA 3EJ1A 2V22A 1H1SA 2WMUA 3CTQA 3PSCA 3FI3A 4G9CA 4LUEA 4OR5A 5AR2A 3P08A 5AADA 3NPCA 3OS3A 2CMWA 4WKQA 1BUHA 3EFKA 4ZLYA 3TUCA 4S32A 3NLBA 4EK5A 1X8BA 2X4FA 4EOOA 4E5WA 4S31A 3VJNA 1FPUA 4H3QA 3COIA 4FX3A 3NS9A 4QMXA 4H1MA 4R5SA 3DKCA 2J0IA 4I23A 4ZTHA 3GCVA 3BGPA 3PA5A 4MNEA 5KKRC 4IWDA 3HRCA 3QHWA 2C47A 4QPAA 3EQPA 5EYCA 2ZMDA 5JQ8A 4RX7A 4MH7A 4ZSAA 3EYHA 5LWMA 1U54A 2ETKA 2OIQA 1VJYA 3S00A 3DDQA 5EW9A 1YXUA 3BU3A 3L9NA 1JKTA 4RA4A 3CQWA 1OIRA 1NA7A 2PE1A 4PRJA 3BGZA 3UYSA 4DG3E 3I81A 3LXLA 4CFFA 3TV4A 3FUPA 2ZDTA 4G6OA 1MRUA 3E63A 4B99A 4BBMA 3GUBA 4D2RA 5M51A 2ITUA 3NW7A 2BRBA 3AOXA 3OC1A 2I6LA 4P5QA 4ZSEA 3FI4A 2ONLA 4LGHA 4JX3A 1XH4A 4O84A 4FOCA 4C4JA 3BKBA 4H58A 4E6DA 5AP5A 1O6KA 3MBLA 2XNPA 3QUDA 4O0YA 4BICA 4JBVA 5ANKA 4C33A 5GZ8A 3VS1A 2BMCA 1F5QA 4PPCA 3SGCA 3A60A 2SRCA 3UQFA 3NUXA 3A4PA 5DT0A 3DJ6A 3L9PA 3UNZA 4ASXA 3OCTA 3ZMMA 4OW8A 5HTBA 3F7ZA 5KKRB 2F57A 2OFUA 2A2AA 3HV4A 3KULB 4DGLC 2PPQA 4EYJA 2X7GA 5LMKC 2HXQA 3VJOA 4S34A 2YIYA 5L2SA 2JEDA 4FVRA 3H0YA 4TYHA 4E5BA 5HNGA 4C57A 4C2VA 4EKKA 3PE1A 1OKZA 3DS6A 4IVBA 3BRBA 1H25A 4UWCA 4W8EA 4FTOA 2CN5A 2R0IA 3R7OA 3ZZWA 3O17A 3R9OA 1UWHA 2JIUA 1KOAA 3GC0A 5DVRA 1V0OA 3TZ8A 3WF6A 5DEYA 5K5NA 5K4IA 3MVJA 4Y5QA 3FHRA 2OK1A 5DOSA 3U4UA 1YHSA 4ZXTA 4EHVA 3O8UA 4IACA 1G8SA 2OI4X 2G01A 3CPBA 5DPVA 1PXIA 2XEYA 4MBJA 2F7XE 4RJ8A 5HG5A 1M17A 3PWYA 5G6VA 3LJ2A 3LCKA 4ANNA 5A4QA 1PXNA 3GEQA 3QGWA 4XRJA 5I4NA 4IBMA 3ZHPC 1UWJA 4XUFA 5KCVA 4AE6A 1UKIA 5FWKK 3ZXTA 4KUJA 2WMVA 3O7LD 1WBWA 2DYLA 5HE2A 2J0LA 4OLIA 5IUHA 4BZNA 1XO2B 2VGOA 3FMMA 4ZJIA 4E20A 4CKJA 3BYOA 1P2AA 4RMZA 4ZEGA 1DAWA 4W9XA 2GMXA 1LUFA 4IC7A 3HAMA 1JBPE 4DA5A 4GW8A 4U45A 3UC4A 4FIHA 5HNIX 3NMUF 4V0GA 3E7VA 4F7NA 4FG8A 3K5VA 4DFLA 4RG0A 3I5NA 2PVMA 2NP8A 1GNGA 2PVJA 4FK3A 4X3JA 3HEGA 2C3JA 3TIZA 5IQFA 1CTPE 3SKCA 3BQRA 3C4FA 3ZSHA 2B9IA 3QQUA 2ZMCA 4D4VA 2ITXA 2QOHA 5CU6A 5CS6A 4GG7A 1IG1A 3CQEA 4O6LA 5CXHA 4X7QA 3D94A 3KXXA 4ZSLA 3S2PA 3CD3A 2B0QA 4U3YA 4G17A 3WIKA 4W4VA 4RC4A 2NPQA 2YA9A 1R39A 5LVPA 5IQHA 3O8PA 4WRGA 3EWHA 2CKOA 4KRDA 4MXXA 1YWVA 4M3QA 3RPSA 4MF0A 5CZIA 4FTNA 5E1EA 2WTKC 4CV8A 4GFOA 1IR3A 4WUAA 4PDPA 5KBQA 5F95A 4GT3A 3BLQA 3F5GA 3D83A 4O0RA 2VWBA 4ZMFA 5CQUA 3HYHA 3NDMA 3DTWA 3EQGA 4DH1A 3A4OX 3W1FA 3I0QA 2LGCA 2XEZA 3DZQA 4HCVA 4D4YA 1ZLTA 2JKOA 4ZY6A 4O7RA 4DFYA 5E91A 4TKSA 3TTJA 3U9NA 4GS6A 3VS2A 1H01A 4EK8A 4QQTA 3EQRA 3HAVA 3L1SA 2IG7A 3V6RA 2GNFA 2JDOA 2CN8A 4IDVA 1V1KA 3WYYA 4AA0A 4O7NA 3K5UA 1Q8WA 5I9UA 3TWJA 3KA0A 3WZJA 4AS0A 2J4ZA 5J9LA 2P2HA 4RWLA 1Q8YA 5CAOA 4HGEA 4EBWA 1H4LA 5HZNA 4FT0A 4H05A 4HZRA 2A1AB 5J79A 3M1SA 5M56A 1Q4LA 2WTVA 4M69B 3A7GA 4B8LA 2XMYA 3OEFX 3QTUA 1PXOA 4OBPA 1H08A 4YZCA 4E4XA 3F2RA 1ZOEA 5JFXA 1OVEA 1OL5A 2CNQA 4QP4A 1AQ1A 3DY7A 4C2WA 4EC8A 3QTSA 1REJA 1CDKA 2YLFA 3RAIA 2XKDA 4RIWA 3C0IA 4UBAA 4EJNA 2C68A 2ITPA 2X6EA 3JVSA 1JOWB 3OT3A 4UYAA 3W2CA 1T46A 3D4QA 3ZRKA 4W9WA 4CD0A 2W17A 2WTKB 3FQHA 3HLLA 3OOMA 4DT9A 1KE5A 3LKMA 4WNOA 3ZBXA 4EBVA 3UOJA 4ACHA 3UP7A 1JSTA 2W1DA 3UPXA 2I1MA 2Z60A 4M13A 2FVDA 3THBA 2QG7A 2X8EA 4F9WA 3NX8A 3R8LA 4AZVA 4BTFA 2BRMA 1Q41A 4EL9A 2X2LA 2ITOA 5HGIA 2J90A 3FY2A 4HYSA 4M66A 5FP6A 4AWIA 2HZNA 2R3JA 4RX8A 2WTIA 1ZZLA 3QA0A 5HQ0A 3QU0A 4KD1A 2YDKA 3P7BA 2YAAA 3WYXA 1OPKA 5JN2A 5E7RA 1R1WA 4F1MA 5B7VA 1V0PA 2C5NA 3OUKA 2HENA 3ORLA 1H27A 3E92A 5JGDA 4FTJA 3G51A 2H34A 3OCBA 3R02A 4ZY4A 1EH4A 1YW2A 1J7LA 2OH0E 5H9BA 2ZAZA 2GS7A 4G2FA 5IA5A 5EYKA 5GJFA 4M15A 4XP2A 4YZDA 3KXGA 2HOGA 5DR2A 4DH5A 5I9XA 3ZO1A 5E8WA 4FSRA 4L52A 5LXMA 4K1BA 4FEXA 3O71A 3ORPA 4I41A 1SYKA 4QQJA 1Y91A 3ENHA 3NAYA 3LAUA 4FVQA 4GKIA 3VS0A 2XNNA 4H3BA 4C0TA 3ZEPA 2HAKA 3G0FA 4HYHA 3FLNC 3GFEA 4IAAA 3DK6A 5L2QA 3FZRA 4HW7A 1MRVA 5CSVA 4RIXB 4WO5A 2JAVA 5AMNA 1MQ4A 1QPCA 3D5XA 3ORKA 2V62A 4GK2A 4LMNA 5ANJA 3C5IA 3EQFA 2RF9A 3JS2A 3BEGA 3DJ5A 1W7HA 4PL5A 3R30A 3ZYAA 1XH7A 2CNUA 4TZRA 1R3CA 2UZWE 5FGKA 4HVGA 2W4KA 3QX4A 1NVRA 3MIYA 4EH6A 3NUSA 4O2ZA 4YTFA 3NR9A 4F1OA 2ERKA 5ICPA 4GVJA 4TN6A 3TZ7A 4EYMA 3GC9A 5FD2A 4RPVA 3R1NA 2YERA 2OGVA 5HX8A 5HBHA 2C5YA 2ITTA 3N4VA 3EQBA 4GFMA 5D12A 5ETIA 3SV0A 3T9IA 2OF2A 3O0GA 4RC2A 3IW5A 5JSMA 4FTTA 4CFMA 2VU3A 4Q9SA 4QMLA 4BVUA 4E26A 2QODA 4KIOA 4BFMA 4N70A 2WOUA 3HV3A 5AUVA 2JDSA 4AP7A 4ANLA 3GC8A 3IECA 2FA2A 2AYPA 2OZAA 5HTCA 4I93A 4A9UA 4LV5A 2EU9A 3I5ZA 3DJ7A 1ZMUA 3PZHA 4EH9A 4Z7HA 4O7YA 5IQBA 4AA4A 5CEKA 4GJ3A 3MS9A 3OOGA 2OH4A 4QP7A 3ZDIA 2PVNA 1SVHA 3DKFA 2XYNA 4QT1A 4C4IA 2R3GA 5EDQA 3TKUA 2JFMA 2B9FA 2C3IB 4MYGA 3UOHA 3FZTA 3W32A 5BNJA 5KMKA 4F7SA 3F3VA 3CJGA 3MFUA 4GL9A 2GHGA 4XV1A 2WNTA 1VR2A 1ZAOA 4YU2A 2VGPA 2YJSA 3ZU7A 5GIPE 2X9EA 3ROYA 3ZM9A 3EL8A 3U8WA 1SVGA 3IO7A 3KVWA 3RVGA 4V04A 3D15A 4O22A 5BX0A 4IIRA 4QD6A 5ETCA 2CGVA 4UX9A 3GGFA 3DCVA 4IM0A 4KKEA 5C8NA 1M7QA 4FSNA 4F7JA 4ZS4A 1J3HA 4FKOA 4JNWA 4O7LA 2VO6A 3NEWA 3PFQA 4NU1A 4YJSA 3VS5A 4CNHA 5HG8A 4BDGA 4YTCA 4CG9A 3ORTA 3A61A 5AV2A 3TUDA 5LVLA 4Y72A 3L8XA 4RQVA 4PP9A 4D1ZA 3TG1A 2W9ZB 1OBGA 1UNHA 5BVEA 4FKJA 2ZYBA 2WQBA 3F7WA 4BKJA 4C4HA 5C4KA 4H1JA 2X7FA 4PDOA 4TYIA 5FEEA 2CKEA 3SQQA 4Q5HA 4BL1A 4GK4A 4YR8A 5B2LA 5IUGA 3VS4A 2X0GA 5BVFA 1JWHA 1R78A 4FKWA 4O1OA 4UMRA 4YLLA 4BI2A 4CQEA 4CYJA 3ZUVA 4XV9A 3C4ZA 4HOKA 2CDZA 1WZYA 3F5XA 4J95A 3UGCA 3SW4A 3DAEA 4BYIA 3UIBA 4KS8A 4CQGA 3W10A 2YFXA 5AUYA 1TQIA 5A9UA 5IH6A 2XIZA 3KXMA 3DLZA 3LFAA 2OSCA 3W16A 4G3DA 4ZSGA 4MBIA 2UVYA 4XG2A 2Q0BA 2PMLX 1CKPA 3RZFA 2R3MA 4FI1A 4FTQA 5H8EA 5IA3A 2YM7A 3IW6A 3MIAA 1W82A 3T3UA 2R3QA 3ZFMA 4BCIA 4BI0A 5E4HA 2W1IA 3ZZEA 4UYNA 5F9EA 5C4LA 4BBFA 2XK7A 4AW1A 1G5SA 3LCDA 3EN9A 3LQ5A 2QR8A 4QMZA 5F1ZA 4UMQA 3EN4A 1IASA 2O64A 4KSQA 5LMBA 4EQMA 4LI5A 3HX4A 4XCUA 2XBJA 1LEWA 3D2KA 2QU6A 5KZIA 5FP5A 2R3OA 4QMNA 3M11A 4IWOA 4BY9E 2A4LA 4WA9A 3VUDA 4DLIA 5J7BA 4FYOA 4WSQA 3LLAA 2IZTA 3AC1A 5JGBA 1HCLA 2W4JA 4Y8DA 3BE2A 5ANEA 3AT3A 5HVJA 2AC3A 4NIFA 4AACA 2YAKA 4O0SA 3OXTA 4DH8A 5E8UA 4ITJA 5JEBA 2PVFA 3CKWA 3KMMA 5IQDA 5LWNA 1FVRA 1K9AA 5M44A 3QQKA 2P4IA 5E8TA 4MXOA 3NW6A 4LQMA 3U51A 4O86A 2FSTX 3QCSA 5J1VA 4HYIA 5CAUA 1LR4A 3UIXA 4C7TA 1Z5MA 4ARKA 2Y4IC 4HVIA 5JGAA 4ANBA 1ATPE 2O2UA 4AN3A 4RLKA 4P2KA 3V8SA 1PMUA 3CGFA 5EDRA 1P5EA 3O96A 3VUHA 2BDJA 2ETRA 2WGJA 1GIHA 5HD7A 3KY2A 2XIYA 4J8MA 5AIKA 4I22A 1GIIA 4ZTMA 1UV5A 3QTRA 4CRLA 4YBKA 3ULIA 4D0XA 2CSNA 2YCFA 5AP1A 2FSLX 4BCPA 2XJ0A 4CFUA 4EOPA 2XUUA 3MW1A 3R1QA 2ZOQA 4O7ZA 2HWOA 3NNXA 4L53A 3OXIA 4EC9A 2IZRA 3BLHA 4FA2A 1WAKA 2B7AA 4CRSA 3EOCA 1Q62A 2OJGA 2VAGA 4M84A 1FMKA 5M57A 3GT8A 4C59A 3HKOA 4ZMEA 5J9YA 3LFNA 2X8DA 5HU3A 4ANSA 4RWJA 3L9MA 3CC6A 5CEOA 4RVKA 3P1AA 4AW2A 3QWKA 5HORA 2DUVA 3BBWA 2GNHA 2Y4IB 3FXXA 3R71A 3ROCA 4CFNA 4M8TA 3R8MA 3HP5A 3QKMA 4B6LA 3PLSA 2CJMA 5IQAA 4RJ6A 4ZLZA 3GQIA 4FZFB 4O7WA 4B9DA 4BYJA 4IH8A 1ZYCA 4DGOA 4NZWB 3HV5A 5DRBA 2PUNA 2C3LA 2GTNA 3FE3A 5CXZA 5BMSA 2XP2A 5FBOA 3ZLYA 5AAFA 5HCZA 5M4UA 4IX5A 4ALWA 4HYUA 4LRKA 1M7NA 4G6NA 4TWCA 4DEIA 3K2LA 4ZOGA 4W8DA 4AOIA 4XP0A 2YN8A 3E8DA 4I1ZA 5CAPA 2GQRA 4UZHA 4G5JA 3KVXA 4MD9E 1XBCA 4OBQA 4P4CA 4EWHA 3F5UA 5AUTA 3LFQA 3LJ1A 5IMXA 5FDPA 2PWLA 4ZZOA 3VUKA 4FBXA 4BKZA 2C1BA 2QOBA 2XA4A 4AZEA 2ZVAA 3NSZA 2XJ2A 4YGAA 3P5KA 1FGKA 3PDTA 4CEGA 4YURA 4RJ4A 3ODYX 4R1YA 4L6QA 3SOAA 3NIZA 5JK3A 2CHLA 5CVHA 3F66A 2G9XA 4QMYA 3QX2A 4FICA 2VTHA 2QOFA 5AUWA 2VTRA 4EH8A 2WQEA 3E5AA 4YHTA 2F49A 4FZAB 4JT3A 5G1XA 5HHWA 3PA3A 2PMIA 2ZV2A 4NEUA 3NCZA 4UN0C 3OFMA 1VZOA 3F3WA 2NNWB 3MGYA 3OWLA 5M06A 3QD0A 3KREA 4UY9A 4Q5EA 4QQ5A 4YTIA 2I0VA 3P78A 4K2RA 5C1QB 2Q0NA 1F3MC 5AV4A 2FO0A 1ZMVA 2IZUA 3GFWA 4I3ZA 2UW6A 1PXLA 2DS1A 4TNBA 2J9MA 2GS6A 4RZVA 3FXZA 1J7UA 4Z3VA 4WD5A 4A9YA 3Q3BA 4UXLA 5C8KA 5AP0A 4Z16A 4AZSA 3RAKA 4FV5A 4AG8A 1JNKA 4FSQA 4GYIA 4MVFA 4QP1A 4IM3A 1B39A 3LFBA 2RFSA 5CQWA 4G3FA 4F1TA 1Y57A 4X3FA 2J6MA 4R6VA 3DFAA 2OBJA 2XNBA 3Q6UA 4A4XA 4DEDA 4G6LA 4YNOA 3ZO3A 4R7IA 3MH1A 3UVQA 5A46A 2J2IB 3LMGA 4BWPA 3Q53A 5AV3A 3Q2MA 4UMTA 3FWQA 2VTLA 4IJPA 3V5WA 3KXNA 2BAQA 4EK6A 1XH5A 3HV7A 4OTPA 3RM7A 4EH2A 5JT2A 3FKOA 5CF5A 2G2IA 2VTMA 3F69A 3Q96A 5AP7A 3WF8A 3BU5A 1GZNA 2B9JA 4FUYA 5GINE 3DA6A 3RK5A 4BIDA 2PMOX 2C5OA 2XM9A 4FTCA 1Z9XA 4JJRA 4RWKA 4Y46A 4BDIA 3WF9A 3UNJA 4ASZA 2RFDA 3F61A 5AJQA 1UVRA 3VBYA 5ACKA 2CPKE 2YM4A 3HA6A 3L8SA 4P5ZA 4AZFA 4CFXA 1QMZA 3G6HA 3MN3A 2WMAA 3ET7A 3BELA 3OXZA 4YJNA 3RCJA 5E90A 4IZ7A 4QO9A 5E1SA 5JFWA 5F20A 4BR3A 3RK9A 4O7VA 4OAUC 3NIEA 4E6AA 2PVYA 2VNYA 2V55A 2PZPA 3A99A 4IEBA 4KBCA 5F94A 4BHZA 5HVKA 3RP9A 3ZS5A 4BCOA 2IZSA 3M2WA 3FLQA 4ANOA 4M0ZA 4UXQA 5TOZA 3A7FA 3TZMA 1VEBA 2QVSE 2O8YA 5IA2A 4DH7A 3VBTA 5B2KA 2H8HA 3MY0A 2IW8A 4DN5A 3QCYA 3M42A 5KMLA 3QQJA 4JIAA 3H9FA 3OTVA 3CJFA 2WQOA 3DBQA 4U8ZA 5M4CA 3TNHA 2HXLA 3H3CA 2J50A 3UZRA 3TCPA 1TQMA 4NM0A 3K54A 1XHAA 1BX6A 1BL6A 4RFMA 4USDA 5CEPA 3R00A 2XIRA 3AMYA 4KIQA 4NCTC 4EI4A 3FC1X 1J91A 4XMOA 5CF4A 3UODA 4JI9A 3EN5A 3HRFA 2YCRA 4GH2A 5CVFA 3RK7A 5CAQA 3DFCB 1OUKA 4KKGA 4C4FA 3KU2A 1PW2A 4EOJA 3F3UA 4KSPA 5E9EA 2C69A 3TZ9A 4QRCA 4U80A 1YDRE 3CEKA 1YXVA 4NW5A 3MVHA 5C8MA 4FIEA 1W0XC 1H1WA 1M2PA 4FL3A 2VWVA 3VF8A 4BGHA 3SW7A 3R01A 2DQ7X 4D1SA 4EWQA 3ZO4A 2ITVA 3SLSA 2XYUA 2C6DA 4TW9A 2WD1A 4LV8A 3R9NA 3RMFA 2V5QA 4FT5A 4JVGA 1RQQA 4K9YA 4ANMA 3VRZA 2GS2A 4ANQA 3RPVA 4IFGA 2X8IA 5CT7A 2BZHB 5AV1A 5HE1A 4MHAA 1JSVA 2BFYA 2YITA 2VWUA 4LRJA 3DXQA 3B8QA 2FYSA 2HELA 4D28A 2CKPA 4RIYA 2WHBA 5D7VA 5GJDA 3MPAA 2YM6A 3QHRA 2YZAA 3R9RA 4L9IA 4CMTA 4ERKA 1UNLA 1XH8A 4FF8A 3PXKA 3BYUA 1OL7A 3LE6A 5IZFA 4RIOA 4YSMA 5L4QA 3U9CA 3R2YA 4TL0A 4XG6A 4RLLA 2PMNX 2BRNA 3IDCA 1H26A 1BI8A 1OIYA 4JBQA 5EYMA 3H9OA 3I79A 3Q52A 4MK0A 3GNIB 3MH0A 2C6MA 4FT9A 3RTPA 4BDAA 1ZYSA 2ZB0A 4QMTA 1IA8A 3UTOA 5HO6A 3ZDUA 2YHVA 4YPSA 3BI6A 2B54A 3PVBA 2YIXA 5DEWA 5AIRA 3IGOA 5IPJA 3PY1A 4QTCA 4NYEA 2A27A 4LGGA 1YQJA 3EFJA 5BVDA 3C4EA 5FG8A 4O38A 2X2MA 4FODA 3SXSA 3TIYA 4E73A 2PULA 4ENXA 4QMQA 4A06A 3TEIA 2OZOA 2HIWA 2YWPA 3FQEA 4Y5HA 5CU3A 2R0UA 2V7AA 2YIQA 3QQLA 4FKGA 3R7VA 3W2RA 3JY9A 2HZ0A 2JIVA 4BBEA 4DITA 2WEVA 4FV1A 3OWPA 2PZRA 2WO6A 3QD3A 3QCXA 3PE2A 3U55A 1MP8A 5CY3A 4EQCA 2GNIA 5DR9A 1Q61A 4JBPA 4P7EA 1YWNA 2YDJA 5EW3A 4DINA 4QMSA 4UV0A 5JFVA 4HZSA 1SMHA 3R8PA 5D1JA 4N6YA 2ZM3A 3QL8A 3DTCA 5H2UA 1J1BA 1YI6A 4NFMA 3CP9A 4AFEA 1RDQE 2EB3A 1OL6A 3ELJA 3OG7A 3U6IA 1JVPP 2CLQA 5HLWA 3BYVA 2IWIA 4YJRA 5E8YA 4EOMA 3BBTB 3Q5IA 3QTQA 2UZDA 2F7ZE 5JZNA 2UZBA 1E9HA 2WMRA 3LCOA 4HVDA 4FEUA 3GB2A 1K2PA 4FTRA 5IH4A 2J0JA 3LCSA 4BC6A 4DFZE 2PZIA 2QD9A 4F64A 2QO2A 1A06A 3DB8A 4U81A 5EM8A 4ZK5A 3DAJA 3LFFA 3G0EA 3MWUA 5HNBA 4BCGA 4U6RA 4XLVA 5CTPA 4GUEA 3FHIA 4TT7A 5HLPA 5BVOA 4Z7GA 3QGYA 1BL7A 1CM8A 2WAJA 1NXKA 3V8WA 3D7TA 3PLAE 2WMXA 2UUEA 5AAEA 1VYWA 3H9RA 3PG1A 3SDJA 5FXRA 1I44A 5EG3A 1PJKA 3QWJA 5AP2A 4WBOA 3KCFA 5E8SA 5D41A 5EI8A 3SG9A 3C13A 2PUUA 2EB2A 5IA4A 1IAJA 3R7GA 3BYSA 1YXTA 2YACA 3U4WA 1YRPA 4O0WA 3FSKA 3O7LB 5J5TA 3P7CA 4I4FA 5J5SA 3GCSA 4O0UA 4FSZA 1U4DA 3ZRLA 2PZ5A 1QPJA 3AXWA 3QF9A 4QYGA 3JXWA 3E62A 3Q04A 4YNEA 2OKRA 3OTUA 4M14A 3WBLA 3KRWA 4N57A 3R83A 4FKSA 4ALUA 5AM7A 5JMSA 4ZY5A 3FI2A 4F6WA 4ZTRA 3GOPA 4IAKA 4EQUA 2BUJA 3SG8A 5AFVA 3GOKA 3DBFA 4FE2A 5EQPA 3HMNA 5HCYA 3DU8A 4IM2A 3OP5A 2WU7A 3FZSA 4R3PA 4ORKA 3COHA 3C0GA 5DT3A 5DHJA 3MYGA
chains in the Genus database with same CATH superfamily
4FG9A 4C3FA 2Q83A 4RVLA 5GIOE 5HIBA 3WF7A 2EXMA 3FYJX 3RCDA 4ZIMA 5HE0A 1AD5A 1R0PA 2ETMA 3KK8A 2R3IA 4L7SA 4LOQA 1YOLA 3D5VA 5E8ZA 3BHYA 2JLDA 4ZJJA 1GIJA 1OECA 4RFZA 3CTHA 5GJGA 3K3IA 4DFXE 2O65A 4FTMA 2GNJA 4L68A 4RJ7A 4ZP5A 4IFCA 3LM0A 4U79A 3V5PA 1ND4A 3EN6A 3R8VA 4XG8A 1FVVA 3HA8A 2VRXA 4ITHA 2EVAA 5DA3A 3G5DA 4RBLA 5JQ5A 3QQGA 1PKGA 3SRVA 2REIA 4YJPA 1XH6A 1M14A 5KHXA 4QYEA 1OL1A 3BV3A 2VD5A 3GENA 4GMYA 1XWSA 4QMVA 3BIZA 5CLPA 2J51A 3ANRA 3UO6A 3TACA 3DZOA 4K18A 4MNEB 2YZLA 5E92A 4DE4A 3O50A 3GU7A 2ITNA 4C8BA 3EKNA 5BYZA 5EOLA 4J53A 2WKMA 4FUXA 2F2CB 3KF4A 3N4UA 4NUSA 1U54B 3FLSA 3EL7A 3EQIA 3R22A 2C3KA 5FM3A 3RM6A 4GK3A 4LG4A 3E3BX 2WU6A 3QYWA 2UW4A 4U9AA 3DGKA 2Z02A 4I4EA 4QPMA 4E3CA 2NRUA 4OT5A 3GI3A 2BCJA 4FSYA 3F9NA 4YO6A 2JDRA 4DC2A 2V7OA 1RE8A 3R9DA 3DPKA 2Y8OA 5KBRA 4F70A 4AU8A 4GVAA 5CNNA 3V5JA 2RGPA 5DH3A 3KMWA 4DLJA 2WXVA 2IW9A 2VWYA 4KWPA 4DTBA 2C0OA 2WZJA 3UNKA 3BX5A 5TO8A 1P4FA 2X9FA 3T8OA 4BGQA 4RJ5A 5HO7A 1H0WA 4FC0A 4FJVA 3PVWA 4JDKA 2R3PA 2A98A 4FNYA 2OJJA 2VTOA 4YZMA 2OXDA 4C61A 1UA2A 3CQUA 4QP3A 4R3RA 4WRSA 4QTEA 2HZ4A 3IKAA 4RJ3A 2W5HA 2NO3A 3LLTA 4IX3A 5AP4A 3LXKA 4AXAA 5KNJA 5M4IA 2WFYA 3QZIA 4MXAA 5L6OA 5HO8A 4XOYA 4G3GA 4OTHA 3VRYA 4DFBA 3MA3A 1BKXA 3FSFA 3VNTA 2VZ6A 3OT8A 3LXNA 4MWHA 3VC4A 2W5BA 2XKEA 2XS0A 3FXWA 3HMPA 4G3CA 4LOOA 5JRSA 4AGWA 2UW8A 4TYHB 4GUBA 4J52A 4C62A 4EZ3A 3OVVA 4G34A 2WIHA 1TFFA 4MD7E 4O83A 3CGOA 1NW1A 4IAYA 2W5AA 4BKYA 5CAVA 2BFXA 3PVGA 4YJQA 1OPJA 3RKBA 3EIDA 2X1NA 4A9TA 2OFVA 2PHKA 2JITA 2Z8CA 4L3PA 3UMWA 4EK4A 3F2NA 3LW0A 3K3JA 1OGYA 3QRUA 1GZ8A 4F6SA 3R7UA 2FSOX 4ZZNA 3FMHA 1G8AA 1S9JA 3D7ZA 3BYMA 5FXSA 4CT1A 3O2MA 4F08A 1HCKA 1Q8TA 2CGUA 3C4XA 4FV9A 5HD4A 5HVYA 2VTNA 4AXCA 3H30A 4NSTA 1OL2A 3VS7A 4A4LA 3ITZA 4YC3A 2XANA 3P5JC 3TNIA 2ITWA 4QP2A 2ZV7A 3G9LX 3G2FA 4FTIA 4R7HA 3ZLSA 5IU2A 4IVCA 4RVMA 2GNLA 5DNRA 5C01A 3FKLA 1MRYA 4YJUA 4F65A 3NUAA 3R2BA 2YABA 4C36A 4RQKA 4HVSA 4O7SA 4OBOA 4I6QA 1WVYA 3D2IA 3PP0A 3UPZA 4DF3A 1FGIA 2QU5A 2WMQA 2BHHA 3VQHA 2ZJWA 2QOKA 3UVPA 3VBQA 1KOBA 4BDBA 1ZWSA 2XCKA 4IXPA 4PL4A 3A7JA 5B0XA 4GKHA 3TNPC 4IB5A 5AM6A 5KMJA 1JKSA 2P3GX 4V0GB 3LMHA 2UW7A 1XH9A 2RG6A 4PL3A 5GNKA 4RSSA 4AXFA 1O9UA 5IKWA 4DG2E 2W99B 5A14A 2XNMA 3PJCA 4RC3A 2UZTA 4EOQA 3FAAA 5L2IA 3NGAA 2J7TA 3QBNA 4B0GA 4UB7A 1M52A 5AR8A 4FT7A 5BQ0A 4XYFA 3VHKA 5LVOA 3PP1A 3W8LA 5A4TA 5JRQA 1KE8A 3KKVA 3PY3A 3NNVA 3OZ6A 3DT1A 3VS3A 4FOBA 4JRVA 4YO4A 4RVTA 1FOTA 1GY3A 4PNIA 5LVMA 5CEIA 2AUHA 5EYDA 3F6XA 4O21A 3BEAA 5KMIA 4QTBA 3VO3A 1U46A 5IH5A 5I9YA 3W0SA 2YM5A 4IZAA 4JBOA 5IEXA 4U3ZA 2PVKA 3AC5A 5HX6A 2WB8A 3CLYA 3FL5A 4TWOA 3MVMA 4I6BA 5CSWA 5TF9A 2IVTA 4K0YA 3TNQB 4FEQA 4NM5A 4BIBA 5IF1A 2J5FA 5HE3A 2C0TA 3UG2A 1QPDA 2QO7A 5FEQA 2W06A 3Q5ZA 4RWIA 4YSJA 4O4EA 4L42A 2ZV8A 3MFRA 4DGGA 1UU7A 3SHEA 3DXNA 4ID7A 4PWNA 4O82A 2P33A 4FV4A 4X6RA 2F9GA 2UZNA 3CTJA 4HGSA 4Y73A 3ACJA 4D2VA 4KIKA 3BHVA 3FKNA 4FEVA 2R5TA 4C3RA 3NW5A 3E87A 4EORA 1KSWA 4J96A 4NWMA 5IDPA 4EONA 2BDFA 4C4GA 5DYJA 3GXLA 2NYAA 3GU6A 2H96A 1LPUA 3HV6A 1PHKA 3VUGA 4ZJVA 4EUUA 2ACXA 2UW9A 5IEYA 4FKPA 4FIJA 4NL0A 2BROA 5L6WL 4I6HA 3WI6A 4ZTSA 3AKJA 2VTTA 4GU6A 5D7AA 4ZAUA 3NUNA 3FEGA 1STCE 4YHJA 4DBNA 4FKTA 1ZY5A 3FLYA 1Q99A 2Y9QA 4IWPA 4D55A 3QUPA 4MTAA 2Y0AA 4RIWB 2ZM4A 4YC6A 2PTKA 5AP6A 4FRFA 4WNMA 3LFDA 4ZZMA 5AAGA 3C4CA 4KB8A 3F3TA 3IQ7A 3LFSA 4OTIA 5EI6A 2Z2WA 4WUNA 4A9SA 4IAZA 4DT8A 4YBJA 4YJTA 2KTYA 2OJFE 1OKYA 1OUYA 1WVWA 1Q24A 1U59A 2B55A 4C58A 5HOAA 1H1PA 2ITYA 3ZFYA 3A7HA 2YISA 4BRXA 3IGGA 3MDYA 2QOCA 3TM0A 1OITA 3FMLA 3Q4UA 5L2TA 3N4TA 3EQCA 3OBJA 2CGXA 3CBLA 2RG5A 4DAWA 4XV3A 2GDOA 2YDIA 2J0KA 2QLQA 3GC7A 3GU8A 4GV1A 3QAME 3I1AA 4GYGA 3TT0A 4AOJA 3ZLXA 3BWJA 3AT4A 4WSYA 5D11A 5EHLA 4BGGA 2G2FA 4I6FA 4C37A 3V5LA 5KMNA 5L8KA 1WCCA 2OJIA 3VIDA 4YMJA 3CY2A 3DOGA 4OTQA 3UIUA 5EM5A 4AGCA 3PY0A 3ZSGA 2V0DA 4DFNA 4HPUE 3TN8A 4L7FA 3ORZA 4JR7A 4FYNA 2VTSA 1MQBA 2I0HA 3VN9A 4F9YA 5EW8A 5D9HA 5KHWA 2RFNA 3B2WA 1ZXEA 4NT4A 4B7TA 1KUTA 5CSHA 4APCA 4C3PA 3I4BA 1JLUE 4PTGA 3KULA 1XJDA 1LEZA 5AUZA 2XIKA 2R64A 5CU0A 2C6TA 3TV6A 3E8CA 3KEXA 3PIXA 4BDKA 3RAHA 4PF4A 4FKQA 5HBEA 3CIKA 4EJ7A 2VO0A 1Q8UA 3C0HA 3DDPA 2IF8A 4PPBA 3VWAA 1YWRA 2UVXA 2X2KA 2IVUA 4DCEA 2GHLA 2UV2A 3NVMB 3ODZX 4BDEA 5EI2A 3P79A 1WVXA 3T3VA 2C5VA 2QOQA 1FINA 4L43A 4F63A 3QLFA 4WT6A 5TR6A 2XM8A 2BPMA 3EFWA 4QNAA 4RZWA 1ZZ2A 5BPYA 2ZDUA 4MNFA 2XRWA 5FM2A 5K9IA 3V5QA 1H8FA 4O81A 1GOLA 3HDMA 1XQZA 5BUJA 1CSNA 4JG7A 4KINA 1W98A 3F88A 2LAVA 3LFCA 2QONA 3EZVA 5T6KA 4XBRA 4EH3A 3G90X 5CX9A 3EHAA 2WMBA 3HUCA 4X0MA 3VBWA 4EOIA 1NVSA 2UZUE 3KRJA 4FV2A 5TKDA 2VV9A 3U54A 5J1WA 1XMMA 3KXHA 3COMA 4I5MA 4F9BA 4Z55A 3A7IA 2VWZA 1A9UA 2Y4PA 2OIBA 4N0SA 4PMSA 1TKIA 3MFSA 2UZEA 2WMSA 1PXPA 2XNOA 4KNBA 2XKCA 3HMIA 3L8PA 4MXYA 3UYTA 5A4LA 4EZ5A 1H07A 2UW3A 3POZA 3L9LA 4IDTA 5DT4A 3R7YA 2OZAB 5LMKA 1YXSA 2W1ZA 4CFVA 2CGWA 1L3RE 4PDSA 3PFYA 1HOWA 5BVWA 2GNGA 4R3CA 4O91A 2QHNA 4CLJA 2Z7SA 4YLJA 4FGRA 5C26A 1VYZA 3VBVA 2GFSA 3OWJA 4ONAA 3W0MA 2RKUA 3UQGA 4JG8A 4XX9A 3D9VA 5HIEA 4J1RA 2BIKB 4BWXA 5GZ9A 3PJ8A 4ACCA 1WBPA 3KK9A 3TDWA 4BCMA 3LPBA 3FMNA 4PMPA 5DE2A 2BKKA 2ESMA 4X2KA 4FT3A 3W55A 3KMUA 4J98A 4EZ7A 3D5UA 4PNKA 4AT5A 3SVVA 1WBOA 4I5CA 2FB8A 3ALNA 3MA6A 3E8NA 3QQFA 4DDIA 2BHEA 4JIKA 3OMVA 4O6EA 4IADA 4PMMA 3R63A 2O5KA 1W84A 4D4SA 3FLZA 2R7BA 4U5JA 4F0GA 4KRCA 3TTIA 4CVAA 5L8LA 4CGAA 1QL6A 2W7XA 2WTWA 4KAOA 4NKAA 3DAKA 3R7EA 5LCKA 5AA9A 1YOJA 2QOIA 4QMWA 4AFJA 2VTQA 4CTCA 4PY1A 3SC1A 1XBAA 4OTDA 4F7LA 2YCSA 5FXQA 2I0YA 3R04A 2CNVA 1G8JA 2J0MB 3HNGA 3R1YA 4J8NA 3WE8A 2WMTA 5IDNA 1APME 2HW7A 3E8EA 3H10A 3GU4A 5FBNC 4EK3A 4XHKB 5AX9A 4AGDA 4C38A 2QKWB 4YPDA 3BLRA 2JKKA 5IG1A 4JDHA 4BTMA 4USFA 2JIIA 3O8TA 5IMEA 2X0PA 4M69A 2XCHA 4KBAA 4M7IA 1WBVA 3AC2A 1FVTA 3QLGA 4EOKA 5FTOA 1IAHA 3UP2A 4XG3A 3BQCA 3OW4A 5BVKA 3S0OA 4W4WA 3I60A 3UZPA 4BCJA 2JBPA 2W1EA 4PP7A 3QZHA 5A4CA 3WZDA 4CZUA 4ITIA 4FZ7A 5GHVA 2UVZA 5DR6A 3UC3A 2WQMA 3NNWA 3W33A 3LMIA 3AMBA 3V5TA 4G16A 5CVGA 1OIUA 4NM7A 4WG3A 3BL7A 2X0OA 4FV8A 4YP8A 3R7IA 2E9VA 2R2PA 3L8VA 3R1SA 3CR0A 4CMOA 1PXJA 3PPJA 3DV3A 4TY1A 2O63A 1OMWA 4EEVA 4BZDA 2B1PA 1PYEA 3Q4TA 1ZY4A 3D14A 4RRVA 4QP9A 3LM5A 3KC3A 1ZOGA 3FC2A 3OY1A 3TI1A 4FEWA 3GP0A 4YZ9A 2XJ1A 2VX1A 3HMOA 1PXMA 5H8BA 4A07A 5IQIA 3A8XA 1SNUA 3HRBA 4XJ0A 5AR3A 3ZEWA 4O4CA 2IPXA 5AP3A 2CKQA 5AWMA 3OBGA 1REKA 3IOKA 2G1TA 3TXOA 2EXEA 2VNWA 4E6QA 1DAYA 1W83A 5KMOA 4KA3A 5DLSA 1KWPA 2PVLA 4FMQA 4U0IA 3MI9A 4GG5A 2P55A 4I94A 1RW8A 3IONA 5ANOA 3ZC5A 4JAJA 3ORNA 3PXRA 4JQ8A 4NIFB 3RINA 4PTEA 5FRIA 5HTIA 5CASA 3ZUUA 2I0EA 2QLUA 3P4KA 4IC8A 4XV2A 3PWDA 3G15A 2PSQA 3CS9A 4A4OA 2R3RA 5HLNA 1M2RA 3JR1A 1WBSA 3FZ1A 3PVUA 4QMPA 3WZEA 3HDNA 4FKRA 4YJOA 5K4JA 2A0CX 3MH3A 3FPMA 5E8XA 4H36A 3IDBA 4XLIA 4KIPA 4BF2A 4HGTA 5CANA 5LARA 4HGLA 4NTSA 4LM5A 4RIXA 5ETFA 5IA1A 1OKVA 4XRLA 4M12A 4XG7A 2Y7JA 3AGLA 3O23A 3V51A 4F9AA 1I09A 2X7OA 4R78A 4YZNA 1DI8A 4IANA 3RGFA 5CF6A 4FTKA 2UW0A 4TTHB 4FIGA 3LJ0A 3SOCA 4UWYA 3TJCA 4B8MA 4O0XA 2XK9A 4E8AA 4L67A 3BWFA 5DN3A 3Q4CA 3PJ3A 3TJDA 2GQGA 1PY5A 2OF4A 2IVSA 4IZYA 3LQ8A 4C4EA 3PG3A 1IRKA 1UKHA 2Y6OA 5FDXA 4L01A 4O96A 1Q97A 3N9XA 4DCAA 4GT5A 4XG9A 2OW3A 5J95A 5ACBC 4LGDA 1S9IA 4UWBA 3EQDA 5LVNA 2E9OA 1PMVA 3OCSA 2XNGA 4BHNA 1E1XA 1PMNA 4IWQA 3JY0A 5HCXA 3KGAA 4AT3A 2XZSA 4GJ2A 4OTRA 4DH3A 4CKRA 5J7HA 4DHZA 2BTSA 3PRFA 4F6UA 4Z9LA 3UE4A 2KULA 2QR7A 2OO8X 3KQ7A 4NJDA 1KV2A 4U44A 2VX3A 2QHMA 3H0ZA 1Q5KA 2P2IA 3QALE 3VF9A 1JAMA 1YI3A 4BDDA 4E5AX 4FTLA 4RX9A 1B6CB 3DQWA 5CSXA 4IJ9A 4JQEA 3V6SA 3VHEA 4CV9A 4EUTA 4D5HA 5HKMA 4J71A 3GBZA 4L8MA 3PRIA 3FL4A 3D5WA 4X2JA 4BTJA 4BWKA 2C1AA 4BIEA 2OLCA 3I7CA 4C02A 5FLFA 4ZLOA 4FNWA 5BUIA 4D9UA 2B4SB 4ACMA 1DM2A 2OG8A 2GCDA 3OF0A 2C4GA 5HICA 5DWRA 3NYXA 4BTKA 2JGZA 4BCQA 3S1HA 2B53A 3FMJA 4TYJA 2WELA 5I5ZA 4K11A 4D1XA 4GSBA 5HEZA 3LQ3A 3IW4A 4GCJA 1ZARA 1TQPA 4JRNA 4O27B 3QKKA 5F4NA 3MFTA 4EOSA 3MTFA 5I3RA 3MH2A 4L44A 3DBCA 4KABA 3W2OA 3FJQE 2BR1A 4CFWA 5CNOA 3WIGA 2XK8A 4MXZA 4U7ZA 2QOOA 4MWIA 5AR7A 1O6YA 3RAWA 4CSVA 2OWBA 4WNKA 3QTWA 3MESA 1W2CA 3A62A 4R77A 4DTAA 3OW3A 1RJBA 1NVQA 3AC4A 3QRKA 3MY5A 2G15A 3IW8A 4D5KA 3ZBFA 4FGBA 4DHFA 3QTXA 2ERZE 3KRLA 3QRIA 4R8QA 4FV0A 3SD0A 5A54A 5IEVA 4AXEA 1JPAA 4IB3A 4CZYB 4J99A 4PX6A 4B4LA 5BYYA 3EN7A 4X3FC 3S4QA 1BMKA 2PUPA 5CWZA 3UO4A 5AX3A 2HY0A 2XH5A 4LL0A 4WNPA 5L6PA 3Q2JA 5HG9A 4ERWA 5EM6A 4E7WA 4R7BA 4O0VA 4U40A 3PA4A 2W9FB 4MD8E 2Z7RA 4AZTA 4CZTA 3TKIA 5CZHA 4DEGA 1CMKE 3R21A 3ATTA 1IEPA 1PMEA 3JVRA 1LP4A 3G6GA 3E7OA 1YDSE 3W2PA 2YM3A 3PPKA 4IE9A 4QEBA 2BRGA 3MB6A 3MB7A 3NRMA 4FL1A 5T68A 2C6OA 4KBKA 5DFPA 5I9WA 3PTGA 3R0TA 4AGUA 3R6XA 4PUZA 3RPRA 3BCEA 3NUUA 4K8AA 4OT6A 5FTGA 1OZ1A 4TNDA 1Y6AA 4BCFA 5AR5A 4EH5A 4BDCA 3F2AA 2IW6A 3EKKA 3DQXA 3KRRA 3PSDA 4CKIA 4CCBA 2X81A 5CSPA 1H00A 3RWQA 1UU8A 2PE2A 3MPTA 3WILA 3B8RA 3W0NA 4MEDA 2GFCA 4LUDA 1J7IA 3EFLA 3FMEA 4NJ3A 2E2BA 3WE4A 4JQ7A 3OCGA 2UW5A 3CXWA 3E88A 4RA5A 5I3OA 3U6JA 3ATSA 3RJCA 3ZUTA 4L46A 3FQSA 4E4NA 2CCIA 2XRUA 3CCNA 4X3FB 5C03A 2BZKB 2UZOA 4FL2A 2WMWA 4G9RA 2E9NA 2WTJA 3H4JA 1WMKA 3W8QA 5AEPA 1YHVA 5AR4A 3C50A 2QURA 3IG7A 3HMMA 4NK9A 3W0OA 4CMUA 5J87A 3P0MA 2PY3A 4PQNA 4ALVA 3UO5A 3BHUA 5HU9A 3HECA 1KE6A 2VN9A 3AD5A 2YM8A 4FZDB 1K3AA 3RI1A 1B38A 3UOLA 4BN1A 3IK3A 2DWBA 4EHEA 5A6OA 4X2GA 3FZPA 4YJVA 5AUXA 3VBXA 4DEEA 2R3FA 5DGZA 5A6NA 4H3PA 5IISA 5CF8A 2IEWA 3JYAA 3DBEA 2WEIA 3OUNB 2VTIA 5L8JA 3RPYA 3U87A 4K77A 3OY3A 4R1VA 1OBDA 5ANGA 3BZ3A 2ONLC 2QI8A 1YDTE 3Q4ZA 4I24A 5M55A 4FV3A 1PKDA 2GSFA 3Q32A 5H8GA 4F0IA 2A19B 2R3LA 5BVNA 2VUWA 2C6LA 3C4WA 4ZSJA 5B2MA 3R8UA 3OROA 4UMUA 2PYWA 3NAXA 4PPAA 5IQEA 5FTQA 5GZAA 2X6DA 5KMMA 5HBJA 3VVHA 2C6IA 5EHYA 4CTBA 4C34A 5D10A 5DIAA 3BV2A 4FV6A 3SXRA 2R7IA 4I5HA 2XVDA 2OU7A 2ZB1A 4IX6A 1OB3A 4E6CA 4L00A 1BYGA 3QTIA 3I7BA 2FH9A 1ZMWA 4QYYA 2HK5A 3QQHA 3R28A 3OHTA 4UZDA 5HI2A 4HVHA 5C27A 3KN6A 2GPHA 4XNEA 3HL7A 4DTKA 3ORIA 4TWPA 5TE0A 4ZS0A 1DS5A 1P14A 5CEMA 1Q8ZA 5TT7A 4FK6A 4OTFA 4II5A 1IA9A 3EYGA 4MKCA 2VWXA 4QTDA 2OXXA 3W0PA 4AN9A 4BJJB 3ZO2A 5AA8A 5A4EA 2PE0A 2EUFB 4MCVA 5CENA 2C0IA 5DBXA 4Q9ZA 2YIWA 4JR3A 1GZKA 4AAAA 4GIHA 3SAYA 5CYIA 4F0FA 4IVAA 3UDBA 4FKUA 3QC9A 4D0WA 4O0TA 2XF0A 3Q60A 5EM7A 3EQHA 4D2TA 4RGJA 3AD6A 3RBWA 3ZH8A 4XG4A 1QCFA 4YTHA 4DYMA 1PXKA 4U41A 2XAMA 2IJMA 4N6ZA 3KL8A 4FSTA 4L3JA 4TPTA 2JBOA 4E4MA 5FEDA 3E64A 3VW6A 3ZFXA 4QMMA 2PU8A 4X6QC 3LIJA 3CKXA 3RNYA 4IAFA 3BHHA 5ANDA 5IUIA 1YVJA 4KS7A 2HY81 1DI9A 1YOMA 1Y6BA 4RIYB 4XEYA 4QMOA 3QXOA 2PK9A 3ORXA 4ACGA 4FSMA 2J5EA 1JKLA 3D0EA 4TYEA 5HG7A 4CYIA 4Y95A 3POOA 3HVCA 4Y83A 3LFEA 5I0BA 3P7AA 1XMLA 2JKQA 4G1WA 3DLSA 5BUEA 3EZRA 3BU6A 1H1RA 1FMOE 3BGQA 4EHGA 1J1CA 3AMAA 2VX0A 4GFGA 2XBAA 4C35A 3NZ0A 3FV8A 4EHZA 1PRYA 3PXFA 4IMYA 3VUIA 4FV7A 4DDGA 4S2ZA 2BZJA 3ZRMA 1XKKA 3FMDA 1YHWA 3HZTA 2ITQA 4JXFA 4TYGA 5CT0A 3OEZA 3QTZA 3KXZA 4HNFA 4FSUA 4GEOA 3R73A 4D2PA 3GVUA 1XR1A 3ZTXA 3AD4A 4AT4A 4OUCA 5JH6A 3AC3A 5AUUA 4DFUA 1G3NA 3JPVA 1UU9A 4QOXA 2JDVA 3FDNA 3WZKA 1SVEA 4YC8A 4WG4A 2R3HA 1TZDA 4O2PA 3FPQA 1H1QA 4DEHA 5LQFA 2PUIA 3NVKI 1KE7A 1KE9A 2HW6A 5DRDA 4NM3A 5H3QA 2YCQA 3W2SA 2XK6A 2FUMA 2HYYA 3BPRA 2JC6A 3I6UA 4FZ6A 4GT4A 3NYOA 4QQCA 3W2QA 4FKVA 3LVPA 2VTPA 2Y6MA 4FKIA 4IAIA 4L45A 3Q6WA 2XK4A 4G5PA 3UOKA 4USEA 4ACDA 2R3KA 3MJ2A 4PMTA 4ASEA 5DMZA 3IDPA 5DG5A 5KE0A 4EOLA 5CI6A 3NYVA 3OWKA 5HESA 4TRLA 2OXYA 2QOLA 3FY0A 2W1GA 5DI1A 3SXFA 5K0XA 3EH9A 2X4ZA 4HNIA 2QO9A 1YXXA 5EK7A 3ZSIA 3TL8A 3SA0A 1SNXA 4Q2AA 2BAJA 3Q9WA 4GRBA 2EXCX 1URCA 3ZLWA 4AA5A 2OIDA 4OTGA 4I0SA 3LCTA 3RPOA 3RALA 2QCSA 2BIYA 4MQ1A 4D4RA 2GQSA 3HGKA 4IVDA 2ZM1A 4QMUA 3VQUA 5JZJA 4I6LA 4DEBA 4FR4A 3RNIA 2HCKA 2OICA 2F4JA 1V0BA 3DNDA 3KF7A 3NNUA 4U97A 4RX5A 5IA0A 3QYZA 4BCKA 3P86A 2W4OA 2NRYA 2E9UA 4GIIA 3ANQA 4A7CA 4QP6A 3AT2A 4DEAA 2F2UA 5LCJA 4CT2A 3B2TA 4D9TA 2QC6A 5EHOA 2UZLA 2XNEA 3A8WA 4AX8A 4DGNA 4MF1A 1Y8GA 3AC8A 3DBDA 3UZTA 3E93A 1OM1A 4CG8A 3D7TB 2BALA 4EKLA 1OKWA 1H0VA 4UEUA 5IQCA 3VAPA 5CU4A 3ULZA 4EH4A 5M4FA 3QCQA 2JD5A 3C1XA 3QXPA 5CEQA 4CXAA 3NWWA 3PIZA 5EOBA 2WQNA 4K6ZA 4AW5A 3DXPA 3QD4A 3SX9A 4M0YA 4FVPA 4BCNA 2G2HA 3GCUA 5JKGA 1BI7A 3I0OA 3O51A 4NW6A 3IOPA 2VTJA 2XKFA 4XOZA 1GAGA 4PV0A 1OIQA 3GCPA 4PDYA 2GU8A 5I9ZA 3Q9YA 4XH6A 4JL9A 4I0TA 4AW0A 3II5A 2PVHA 4MX9A 3WZUA 2W0JA 3DK7A 3ZCLA 4IW0A 4L3LA 5AV0A 1W8CA 4BI1A 3W0RA 3PUPA 5T3QA 5EKNA 4NH1A 4S30A 1BLXA 5CU2A 2W1FA 2C30A 4XP3A 3MV5A 2VWIA 2XB7A 4UMPA 3F82A 5LJJA 4IB0A 2W1HA 1T45A 2YWVA 3ZC6A 3IPHA 3TUBA 3V01A 2I40A 5FQDC 1E1VA 3F3ZA 4NKSA 3DKOA 3G9NA 3PXZA 1PF8A 2ITZA 2WTDA 3PXYA 5EH0A 1FBNA 4FIFA 3LXPA 4F99A 4ENYA 4JDIA 1JSUA 2WTCA 2JKMA 1R0EA 3V3VA 3WARA 4I92A 3QKLA 2IN6A 4G31A 4W4XA 3S95A 3QRTA 4FKLA 4I20A 4S33A 3LHJA 3LOKA 3QC4A 3RHXA 1UNGA 4JX7A 3ETAA 1GJOA 2BZIB 1Z57A 1F0QA 1URWA 4X21A 2RL5A 3LZBA 4FNXA 5C9CA 3U6HA 3QFVA 4D58A 3DKGA 2FGIA 4JLCA 3FBVA 3HUBA 4ZTLA 3VUMA 3DK3A 3SRVB 4JS8A 4J97A 4O1PA 1UU3A 3AGMA 4QPSA 1SZMA 4IHPA 4TWNA 4XBUA 5LMAA 2YEXA 3UJGA 4Y85A 3NUPA 3OD6X 5L2WA 1OPLA 4HCTA 4FG7A 2PVRA 3ZONA 4QTAA 2R9SA 4D2WA 4MAOA 3PJ1A 4LRMA 3C9WA 3T9TA 2JDTA 3QZFA 1OI9A 2R4BA 5CI7A 2O3PA 4HPTE 3GQLA 3VUTA 2PL0A 2X39A 4AOTA 1TVOA 4BB4A 1WBTA 1NY3A 3FLWA 4QNYA 3PSBA 5IQGA 3TNWA 1WFCA 2C6EA 5M08A 2RSVA 4HCUA 4RFYA 2JFLA 1Q3WA 3MSSA 4JAIA 4RT7A 4NCTA 3V04A 2F7EE 4FIIA 3VULA 2EWAA 3MPMA 4I21A 3UG1A 3ZM4A 2JAMA 3ACKA 3PPZA 1M2QA 3AKLA 2QQ7A 5K5XA 2BKZA 3CE3A 2W05A 4AF3A 4O7TA 2PZYA 2H9VA 3WOWA 4TXCA 2FSMX 3MY1A 4W4YA 4AN2A 1YI4A 1ZRZA 2P0CA 2VO3A 4H39A 3KFAA 5K3YA 4FTUA 1KV1A 3COKA 1XBBA 3NCGA 4M67A 1WBNA 2QG5A 4M97A 4ZTQA 3FYKX 3PXQA 4QYFA 1ZYLA