2XCKA

Crystal structure of pdk1 in complex with a pyrazoloquinazoline inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
284
structure length
275
Chain Sequence
KKRPEDFKFGKILGEGSFSTTVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSNFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
publication title Structure-Based Optimization of Potent Pdk1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 275
sequence length 284
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xckA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xckA01
2KULA 4UMPA 2R7BA 3O7LB 4TWPA 3CKWA 4MD8E 4YJTA 4I4FA 2QOOA 2W1GA 3OW3A 3R2YA 3W33A 4C8BA 4GRBA 5FP5A 5JGDA 4IH8A 4BCKA 3NVKI 4UMRA 2G1TA 3LFDA 1NT2A 3CLYA 3ZSHA 2HY81 2ETKA 3NLBA 5HG7A 5CU3A 5BYZA 4D2TA 4DBXA 4KS7A 2XCKA 4JIAA 1I09A 3E3BX 2PVRA 2VTIA 2Y9QA 4OTQA 3LJ2A 4QT1A 4U5JA 3VS7A 4F65A 2B52A 1H07A 4FV6A 4MF0A 3KRJA 2HW6A 4C4EA 5DR2A 2YITA 3NW7A 5BVFA 1NXKA 2VTMA 3A4PA 2PE0A 3BQRA 2F57A 3COIA 5AJQA 3GCQA 3NNXA 5CY3A 2UW4A 4FA2A 3TDVA 4TY1A 2C6EA 4ZZNA 3W2CA 5DPVA 4Z55A 2XMYA 2IO6A 3TNIA 2Q83A 3AOXA 4FK3A 4ZLZA 4D5HA 1WBOA 2P2IA 1LR4A 3QBNA 2IZUA 3D0EA 2BZKB 5B2MA 4A7CA 1WVYA 1OPJA 3F2NA 4FG8A 5BVOA 3JY0A 4Q9ZA 1YW2A 1FMKA 3ULZA 5J7HA 4YJPA 5L6OA 3MJ2A 4IX3A 3FI3A 4FBXA 5EYKA 2PUIA 1SMHA 3U8WA 1PY5A 4C3FA 4GSBA 3RCJA 4AOIA 4BTMA 3GBZA 3O96A 3IW4A 1DM2A 4NM5A 5IDPA 3RZBA 5C4LA 3UC4A 3VS6A 5KMNA 1ZY4A 3ZM4A 4O7VA 4NIFB 4XLIA 5HEZA 3KY2A 2C6OA 3VUHA 4BDIA 4YUQA 4W4YA 4BCHA 3PUPA 1M2QA 3F69A 3OOGA 2ZAZA 3HECA 3V5WA 3LM5A 3EQFA 2UZEA 3TACA 4DFZE 2F9GA 5IMEA 5AIKA 4YLJA 4C2WA 4HYUA 4CKJA 1B38A 4L00A 3ZUUA 4BBFA 4EOJA 2RFSA 4IM3A 1SM2A 2UVZA 3QTQA 4GYIA 5ETFA 3AXWA 3WF7A 4ASXA 4XNEA 1FQ1B 3Q52A 4EOOA 4HZSA 2GQGA 3OBJA 4JG8A 4N6YA 4DFUA 1GZOA 5BVKA 1JWHA 3KCFA 2RL5A 3NAYA 3OCGA 4FT9A 5CWZA 3H30A 5DA3A 3MPAA 2OU7A 2EXMA 1DI8A 4GEOA 3GFWA 3FZPA 4DBNA 3Q6UA 1EH4A 3FSKA 3RPOA 2ZM4A 4DHFA 4E5WA 5DI1A 5CU0A 3L8VA 1YOLA 5AV4A 3TKIA 4BIEA 1P2AA 3O7LD 3NUNA 5BUIA 4AE9A 2WKMA 4RX5A 3T9IA 1OKZA 2P0CA 4TNBA 2J5FA 4HPTE 4BCGA 3VUMA 1PMUA 4I21A 5LWNA 3BKBA 1H1PA 4XG8A 2WTCA 3POZA 3ZLYA 1QPCA 4RG0A 4QPAA 4ALWA 5B2KA 4TXCA 4OAUC 2QG5A 4RPVA 2VTHA 1J1BA 3O23A 4FSRA 3P5KA 1GIJA 1X8BA 3FSFA 3HP2A 3PJ3A 4FODA 3UJGA 3ZUVA 4NCTA 4CFNA 1UVRA 4YJOA 3ZLXA 2PYWA 4IMYA 1H28A 1P4OA 4H39A 3L9NA 2E9OA 3C0IA 3P4KA 2YCSA 4WRSA 3JY9A 5KKRC 2OIDA 4OT5A 2BR1A 5LVNA 3I79A 3HKOA 2WU6A 5FD2A 1IRKA 3PDTA 3ZDIA 2G9XA 5M06A 3HAVA 2BHHA 1JLUE 2W5HA 4UXLA 3DPKA 4AGDA 4LM5A 2VAGA 2XNOA 1QPEA 1YHSA 3NNWA 4OTFA 2ETRA 5IUIA 3MY1A 2QODA 3AMAA 1OPLA 1M7QA 4XP3A 2W4JA 3WZUA 3MI9A 2B9JA 2J90A 3MIAA 2BTRA 2CGXA 3RHKA 3DQXA 4PTEA 3VN9A 3WZDA 4E7WA 4R78A 3WOWA 1GZ8A 4K8AA 1OIUA 4EI4A 1JQHA 2VN9A 3OEFX 4LQMA 3VBQA 1OVEA 2WMUA 4GFOA 5EDPA 5HIBA 5C4KA 3VUKA 3SW4A 4YJQA 4ZTLA 4BL1A 2JKMA 4M14A 5JFSA 3RZFA 1U5QA 5DT4A 3WBLA 5B2LA 2OJIA 3A7FA 4NSTA 4YLLA 2GQRA 5E8VA 3A62A 4FKTA 2J2IB 2RGPA 4RIXA 3VWAA 1RJBA 1FINA 2X4ZA 2XJ2A 3UE4A 3ZLWA 1H1WA 4PDSA 2C1AA 3LVPA 3A2CA 3ZYAA 4C35A 1BI7A 4J1RA 2C1BA 1YVJA 2BVAA 5FBNC 3FLNC 1WVXA 3AC4A 3UIMA 3R21A 3WF6A 3UQCA 3QQGA 4FKSA 4BI1A 3P7CA 2XIKA 5M44A 2NO3A 3IW6A 4NKSA 3ZZWA 2W1CA 2XRUA 4PDYA 2R3MA 3VBXA 4ZTSA 4DGLC 2PULA 4HJOA 4YR8A 2HZ0A 4YJRA 3LFEA 4MXZA 2E2BA 3BV3A 3GB2A 4KUJA 2Z02A 2QI8A 2X2KA 3ZO3A 4ZMEA 1ZOGA 2Z7QA 1OM1A 3BLHA 3U4WA 3ZEWA 3WZEA 4ANBA 4RQKA 4TTHB 4C4IA 3U6HA 2PVMA 1UNHA 2EXEA 2R64A 4C58A 3OUKA 3ZHPC 4ACMA 5M56A 2O0UA 3WARA 3TN8A 5G6VA 4A9RA 5IH4A 3R9RA 3LXKA 2PUPA 3LJ1A 4KBAA 4ENYA 3DBDA 2UV2A 4NTTA 4N4SA 3FKLA 3R7UA 5IQGA 2Z2WA 5CU4A 4UWBA 4BZDA 3L8SA 3IECA 2EWAA 2IVUA 1ZRZA 2XB7A 3R7YA 2ITYA 2WTIA 4BIDA 4R7IA 2XK3A 3CPBA 4PF4A 1ZYLA 1OKVA 3QKLA 4G3EA 5ANJA 1YXXA 4KRCA 5E1SA 5DG5A 5IQIA 4P5QA 4FSMA 3BHTA 2C6KA 3A99A 3AC1A 3AC3A 3HRFA 3DZQA 4WKQA 3NCZA 2FB8A 3BLQA 3ORKA 4IAFA 4A07A 4EL9A 4M68A 4FNXA 3SAYA 1TQIA 3HLLA 5AWMA 2FA2A 3IW7A 2Y4IC 4FVPA 4QD6A 3BQCA 3DJ6A 3VIDA 3NYXA 4PMTA 2W1FA 3PJ2A 5HTBA 3F88A 5ETAA 2V62A 3VUGA 4ZZMA 2W1ZA 4KA3A 4FTTA 3UQFA 4EUUA 3SRVB 4GCJA 4BTKA 3TT0A 4QMUA 2YEXA 3FC1X 4DH5A 4ENXA 4L7FA 3QRJA 1W98A 2YCRA 3HMIA 1U5RA 2WFYA 4MBJA 1Q24A 3SLSA 1XH6A 2A19B 3QZFA 3GEQA 3PXFA 4O0YA 3CE3A 4YZDA 1H27A 2KTYA 4PQNA 3W55A 4FIHA 3ELJA 5EI6A 4F9BA 2RF9A 4JDKA 3Q96A 2J51A 3GFEA 4O2ZA 4P7EA 2UW0A 3SV0A 4LV8A 3CKXA 5GJDA 4OW8A 3DTCA 1QCFA 1FGKA 1Y6AA 3EQCA 2Z7SA 5HCYA 3NYNA 3QLGA 4GVAA 4FKRA 2IVVA 3PXQA 2QG7A 2VNYA 3I6UA 3ZLSA 5CSPA 1H0VA 4HYHA 3P0MA 1XQZA 3HAMA 2O65A 4FNYA 4U8ZA 5EKNA 5IQDA 2BRBA 2EUFB 2VO7A 3UVPA 5A54A 2PMLX 1H01A 3PZHA 3D2KA 3MPTA 3HX4A 2I1MA 3KVWA 3ITZA 3ZTXA 4FKVA 5C1QB 3DDQA 3PIYA 1G8AA 3PE1A 3E3PA 1F3MC 2J0KA 4B7TA 3LCKA 5FEQA 1L8TA 3G5DA 3R2BA 3ORXA 3EHAA 2CCIA 2XF0A 4FTLA 3UMXA 4EK3A 4E6DA 1AGWA 3WIGA 2VD5A 2WQOA 4PDPA 4XEYA 2ERZE 4D2RA 3CPCA 4FUXA 4OBPA 3Q9XA 4DINA 4NJ3A 2YZLA 4IZYA 2PMOX 3E87A 4BRXA 4NL0A 3CD8A 5BYLA 3V51A 3OROA 2OGVA 2YM4A 4LL0A 3HVCA 2PVYA 1RE8A 4CZUA 4PMSA 1R1WA 5DEWA 4JX3A 2UZTA 2UZBA 5EHOA 3K3JA 4FNZA 2VRXA 2WTKC 3EQBA 1ZLTA 3HMPA 4IW0A 4IWQA 4KKGA 4G3FA 4O2PA 1PKDA 4RBLA 5FXQA 4DCEA 4BB4A 4U6RA 3R63A 4NZWB 5A6NA 2O63A 3A60A 2CMWA 4A4LA 5E8YA 3SGCA 4GL9A 5DT0A 5FRIA 4DGNA 4JQEA 2UW3A 2CCHA 1WMKA 4KINA 4YPSA 3RAWA 1P14A 1XH8A 4ZP5A 5IH6A 3UG1A 5LMKA 3R1SA 4CCBA 4U97A 5AX9A 2EU9A 3EKKA 4O22A 2RFEA 3R9NA 3NNUA 3OCSA 1Q8TA 3PRFA 4RVKA 4MXXA 4DLJA 5JRQA 3TJDA 4F9YA 3DKGA 3HV7A 3F5UA 2Q0BA 4FSYA 4NWMA 3UP2A 4G1WA 4JLCA 1Q97A 3PA3A 5HHWA 1Q8UA 2P33A 5AIRA 4PL4A 4EC8A 1G8SA 2GCDA 2YCFA 3L8PA 3KULA 1NW1A 3UBDA 4AW1A 1B39A 4ZJIA 3PA4A 1H00A 3P7AA 3QGWA 5F4NA 4B0GA 3RK9A 4D28A 2YCQA 1BX6A 2J4ZA 4IBMA 4O7RA 4AZVA 4D1XA 4BDHA 3HV6A 5EKOA 2ZVAA 4MCVA 5BUJA 1NA7A 5I9ZA 4Z7HA 4KKEA 3D2IA 3DKFA 3QRIA 4BGQA 2JDSA 2JITA 4L3JA 5HG5A 4CTCA 1BL6A 2R2PA 4QP1A 4Y72A 3R83A 4DEGA 5HQ0A 3G0FA 4O7SA 5AUYA 4ZMFA 2B4SB 4F6WA 2ZV8A 5A46A 3NIZA 4CMTA 3SXFA 4IFGA 1FVRA 1WVWA 4GK2A 5D1JA 4ZTMA 3ALNA 1R3CA 1ZYJA 4NEUA 1QPDA 4LRKA 1GZNA 3A7HA 3RKBA 4D4VA 4EK8A 3O8UA 3Q4ZA 5DRDA 3QKMA 4NFMA 3QF9A 3UO5A 3GU5A 2E9NA 4E4XA 3PWDA 3SVVA 3UIBA 3C4ZA 5HGIA 3U4UA 1KWPA 1PF8A 4OTPA 4XV1A 3RAIA 3ZC5A 4OUCA 2ERKA 4E93A 3ZMMA 5DRBA 1S9JA 2HAKA 4UALA 1ZXEA 2ETMA 3EN5A 3E88A 3V6RA 5BVNA 5JK3A 2PVKA 3SXRA 3CD3A 1AQ1A 3MBLA 5AP1A 5KKRB 2ACXA 3GOPA 4MX9A 1XR1A 3CY3A 4DH3A 3TUCA 1UNLA 5CTPA 1OI9A 2WMXA 2QNJA 4IVDA 3RPRA 2QHMA 2VX1A 2J9MA 4EK6A 4HGEA 4CQGA 4XRLA 4LFIA 5FTGA 3JVRA 3KXNA 5FG8A 1H1RA 2QD9A 3GI3A 3DV3A 5IEYA 2QHNA 4Q2AA 4I0TA 5HLPA 4TN6A 4V0GA 2HZ4A 3R8PA 1ZYDA 5BVDA 2C3JA 1ZAOA 4ZIMA 2QURA 1H8FA 4G17A 2OBJA 5AP2A 3ZZEA 3F3UA 4IX5A 5JFVA 1PMEA 4M66A 4FZ6A 3CTHA 5HVKA 1VR2A 3D9VA 3DBQA 5DOSA 3R9DA 3ROCA 4IX6A 4JBOA 2PUNA 4F4PA 1CTPE 1IAHA 5HZNA 2OZAB 1OBGA 4BKJA 3ENMA 3E62A 5HE1A 3SX9A 3QHWA 4XLVA 3QYZA 4YU2A 4CV9A 4FZ7A 3V8WA 3VW8A 2GQSA 4G34A 3OOMA 4WNOA 2G15A 1XH5A 3TIZA 3EN4A 1OB3A 3Q9WA 2QR8A 3O71A 1U46A 2FSTX 4U81A 4S31A 4ZY6A 4F6UA 4LRMA 4XOZA 3UO6A 4TWNA 4GMYA 4HVSA 3TL8A 4KSPA 4D9UA 5HBEA 5J9YA 1MQ4A 4LMNA 4FGRA 3WZJA 4O82A 4JNWA 4XP2A 5BUEA 3V5TA 4GK3A 4XX9A 2CKPA 2WU7A 2C3KA 4GV1A 4FTOA 5EW3A 4L43A 4RX8A 4QTEA 3ZM9A 4QQ5A 3H10A 2PE1A 1BL7A 2C5NA 2VV9A 2W05A 3GC7A 1KOBA 4HOKA 2C6LA 3G51A 2OFUA 3GU4A 2ZV7A 3SG8A 2X4FA 2UW9A 2GNGA 3CGOA 3FV8A 5A6OA 3UZRA 5E8WA 5ITAA 4M15A 3NDMA 2GS2A 3D94A 4R6VA 1H25A 4FVRA 3QCYA 1O6KA 4RJ7A 4QTDA 5D41A 4DH7A 2WELA 3NW6A 4I24A 5H9BA 4Z16A 4HYSA 2XH5A 2FVDA 1KE7A 3UG2A 3VS3A 3AMYA 2I0EA 3I5NA 3QQUA 2HWPA 3FL4A 2PSQA 3G9LX 2H34A 1F5QA 1RW8A 4IZ7A 4IJPA 5C8MA 4CKRA 4AGUA 4DEDA 4DTBA 4JRNA 1IASA 1K3AA 2HXLA 3B2WA 4M97A 2Y4IB 4M12A 4U45A 5ETCA 4C36A 1T45A 3L1SA 4W9XA 2A0CX 4YURA 4P90A 3ZCLA 2W9ZB 4M69B 4CGAA 4EQMA 2QLQA 3FQSA 5HESA 4UWYA 2R4BA 1XO2B 1PYEA 4JBVA 5KE0A 4M0ZA 4E4LA 4O0RA 3HNGA 4IAIA 3S00A 1XH9A 3PXZA 3EQGA 1V1KA 4WA9A 1DAWA 3VUIA 4MVFA 2W96B 5IH5A 4FKLA 3N4UA 3KC3A 3N4VA 4ZJVA 3W2OA 3WF9A 4EYMA 3EFLA 3DAJA 3II5A 4QYHA 5AR7A 3D7ZA 3FLQA 2YWPA 1H1SA 4MNEB 4G6OA 3F9NA 5J5SA 5EI8A 4PTCA 4DGGA 4EH8A 4UMUA 4FVQA 4GKIA 5EW9A 5I4NA 5DE2A 4Q5EA 3UGCA 2NPQA 5H8BA 2CLQA 5TT7A 3DBCA 1VJYA 3I6WA 4LOOA 2ITWA 4QMQA 2OXXA 3AQVA 2CHLA 1NVRA 4PNIA 5ACKA 2O3PA 4NIFA 4PRJA 4DH8A 2PZ5A 5CQUA 4IZAA 1W82A 4ZSLA 4QMLA 1WCCA 1CKPA 4KIKB 5KMKA 2FGIA 1YWNA 4BDGA 2HELA 3VUTA 4OBQA 5J1WA 5EW8A 4R1YA 1YDTE 4TZRA 4TW9A 3D83A 2YM6A 1UKHA 2VTRA 4X2NA 3EKNA 3CP9A 3GGFA 3KXMA 4GG7A 4JS8A 4EH2A 1SNUA 4AA4A 4F1TA 3BHUA 4FZFB 1KOAA 2IJMA 4I5PA 5E4HA 5FBOA 2H8HA 3B8RA 3HDMA 4K18A 4IQ6A 4DG0E 2ZYBA 4F63A 3VW6A 4HVDA 3OT8A 5JFXA 4BZNA 1OIQA 5JMSA 4KS8A 2QOQA 3S3IA 1PJKA 2C0OA 4R77A 4YSJA 4H36A 3KXGA 4NM3A 1PYXA 3R73A 4O27B 3NUYA 3CGFA 2IZRA 3ALOA 2WB8A 3FMHA 4FYNA 1ZWSA 2AUHA 3SDJA 3A8XA 3E93A 3ORMA 4NCTC 5HOAA 1K2PA 3FHRA 5J8IA 4UMTA 4DEBA 4HVGA 4II5A 4L7SA 1WBTA 3TZ8A 1F0QA 3QTSA 4BKZA 2W5BA 3NMUF 4IM2A 4ZY4A 4EOMA 3PJ1A 5D11A 5IUGA 4UYAA 3ZSGA 3GC0A 1H1QA 2UVYA 2W5AA 3V04A 2YISA 4MBLA 3F3ZA 3FMLA 5E8XA 1BI8A 3NIEA 5IA0A 3FLYA 3R1YA 5EHYA 3GC8A 4DEIA 4CG9A 4GJ3A 3QRKA 2PWLA 4OTWA 4XBUA 3AD6A 3PPKA 4FT0A 5EQEA 5AUWA 2VTNA 4IX4A 3FWQA 3JPVA 5DYJA 3BZ3A 3EQIA 4GYGA 4R3RA 5HICA 4FT7A 3TG1A 4HGLA 4EZ5A 2WMVA 3OWLA 5CU6A 4D2WA 4I6HA 4BCPA 5M4FA 4LRJA 3BHVA 3ODZX 3EQHA 2JGZA 4GH2A 2JEDA 3IO7A 4UZHA 4XH6A 3VAPA 1IG1A 5TE0A 1SVEA 2F49A 2JBOA 2XBJA 4YHTA 3E64A 1PXIA 3EFJA 4YC8A 3F7WA 2W9FB 4EOQA 3CQWA 3I7CA 2V5QA 4FICA 5JZJA 1ZMWA 2XNEA 3POOA 4F9AA 3OMVA 4BCQA 1J7IA 5CVGA 1Q5KA 2I0VA 3MPMA 1GNGA 2BZJA 5EK7A 5HE2A 4DF3A 4MH7A 5HO7A 1ZARA 1PMNA 4FSTA 3R8VA 4CXAA 4C4GA 4K6ZA 2BKKA 4FKQA 2IZTA 4IAYA 4QMNA 4WRGA 4X2FA 4E5AX 5AA8A 3E8NA 2XJ1A 4FKPA 3C1XA 5CQWA 2YABA 4AWIA 3N4TA 1OGUA 2XBAA 3GCVA 3LOKA 3DJ5A 5AP4A 4DFLA 4DCAA 2C0TA 2RKUA 3BBWA 3IGOA 4S2ZA 5E8ZA 4EK5A 3D7TA 4C62A 3OC1A 3Q2JA 2IVSA 2V0DA 3LXPA 3KF4A 4YPDA 3EB0A 5GZ9A 4UX9A 2JKQA 3ID6C 2W1IA 4EOPA 3PIXA 2OXDA 1XJDA 4EUTA 4PPAA 4FNWA 3VULA 3HMMA 3TNWA 4L45A 2E9VA 1JNKA 4IAKA 4DTKA 4FTAA 5LOHA 1GAGA 5LVOA 2JDRA 3KN6A 3QZHA 2YERA 2QCSA 4QP4A 5AAGA 4I23A 2XCHA 3MYGA 4BICA 3Q5IA 2YJSA 3LMIA 3BCEA 5F20A 3BU5A 4M7IA 5H2UA 4EKKA 2X8DA 4QQCA 2WPAA 2BMCA 1M17A 2HIWA 4CLJA 3O51A 3C0HA 1VZOA 3MFRA 4HVIA 4AT5A 1Z57A 4CTBA 2ZB1A 3MJ1A 4ACDA 4YMJA 4D4YA 2R3QA 3PXYA 3G6GA 1ATPE 3V5PA 3JR1A 1T46A 3O50A 3TTIA 3DAEA 5F95A 4YNEA 1YI6A 4JL9A 5CXHA 1ZOHA 3F3WA 4AQCA 5L6PA 4U80A 3WILA 5HU9A 1GOLA 3KRRA 5IF1A 3CBLA 2PL0A 4V05A 3PP1A 3KB7A 4F0GA 2VTSA 5CEPA 2X9FA 1OECA 3R7IA 2JC6A 3OTVA 4PX6A 2V22A 3C4XA 2QOLA 3TV7A 3V6SA 2X7OA 5L4QA 4JDIA 4M3QA 4PTGA 3MVLA 5DGZA 3MH2A 3QL8A 2XNNA 4YBJA 2RFNA 4IFCA 3QCQA 3TZ7A 1H24A 4IB0A 1NVSA 3AMBA 4ZEGA 4RWIA 5L6WL 1Y8YA 2UW6A 3Q53A 1SZMA 5HO8A 4AW0A 4JDJA 2DYLA 2VX0A 2WAJA 4YGAA 3GC9A 1GZKA 3UIXA 4D5KA 3G33A 1DI9A 4QQJA 3GNIB 5AUUA 5AUZA 3R9OA 1V0BA 3EN9A 4AOJA 5FDPA 3ZOSA 3DK3A 3MB7A 2HK5A 4LMUA 4AN3A 4ZSAA 4BHZA 4KIPA 4YBKA 4G3DA 4Z9LA 4FUYA 1V0OA 4XBRA 4DGOA 1FGIA 1JSUA 3DBEA 2YWVA 3D5XA 2QO2A 1YKRA 4XV9A 2F2CB 3OY3A 3SQQA 2PZRA 4F6SA 5HLWA 2CKQA 3C0GA 3VJOA 2RG5A 5FDXA 5AFVA 5EDQA 3NWWA 5D9HA 2GTMA 2ONLA 4IDTA 4EH5A 3BHYA 4PNKA 3KRWA 2VWBA 4YTIA 2GNHA 4RGJA 3R04A 2CDZA 2UZOA 3D15A 3GXLA 4CV8A 2XS0A 1UU7A 4I0SA 4UB7A 5IISA 4JX7A 4Z7GA 3IK3A 4W9WA 3D14A 4W4XA 1YI4A 4CT2A 3B2TA 5K4JA 4JXFA 3ANQA 5JSMA 5DR9A 4UBAA 2B1PA 3DK7A 3HGKA 3ORZA 3TIYA 2WMRA 4YLKA 1OL5A 5AAEA 4W4WA 3BLRA 3P7BA 3AC5A 4LUEA 3KREA 2IW6A 3DKCA 4ZTNA 4F64A 1HCKA 2VTPA 1PRYA 1ZOEA 2BILB 1QPJA 4CRSA 1JKKA 4L9IA 4HVHA 5I9UA 4RIOA 3BU6A 3RPVA 2XM8A 2W06A 4DFBA 3SW7A 2VTQA 5C27A 3ZS5A 4I3ZA 5HCXA 3GCPA 3OD6X 2G01A 5IUHA 2X2LA 3UNJA 2W99B 4FSWA 5HE3A 1YOJA 2GHMA 2H6DA 3B8QA 3KA0A 4O6EA 5AADA 3UTOA 1ZYSA 4BC6A 3DNDA 5HD4A 4U40A 2C3LA 3RPSA 4K33A 3OBGA 2BDJA 1PXMA 3VS0A 5EDRA 3LFBA 4CFXA 4ZTHA 2WQMA 3KXZA 2GNLA 5LMKC 4O96A 2JKKA 3DTWA 4FOBA 4L46A 1H0WA 4RFYA 3FYJX 3G90X 3UDBA 4MKCA 4RJ3A 4RMZA 3ACJA 4XJ0A 1L3RE 3DAKA 1JKSA 3F5GA 3HMNA 2BRMA 5ACBC 2OFVA 4GKHA 5ANDA 2ITNA 3UOLA 2HW7A 5JRSA 3W32A 1KV1A 5CEMA 3R7EA 4EHVA 2OI4X 3FMDA 2JAVA 4WBBB 4Z3VA 2PMIA 5CVHA 2R3KA 3E7VA 3W1FA 3I0QA 2QC6A 2QVSE 4W8DA 3FZTA 4DT8A 1A06A 4A4OA 2YIWA 2QU5A 4QTAA 2XJ0A 1M2RA 3PE2A 3OW4A 3TV4A 2QR7A 5K9IA 3RAHA 4QYGA 3OP5A 1I44A 3DXQA 5IQHA 3KMWA 4YO6A 1STCE 4USFA 5ICPA 4I0RA 5EHLA 3EL8A 4JBQA 1BMKA 3EH9A 5DVRA 4O38A 4EEVA 2YM5A 2QONA 1R0EA 3L9LA 3NYOA 3QC9A 4FIJA 4OTRA 1PMVA 5DLSA 4A9UA 3RJCA 3VS1A 2VZ6A 4JAIA 5CT0A 1M14A 3T9TA 1LEWA 3DK6A 2X7FA 3LAUA 1ZY5A 3JYAA 3KRLA 4JIKA 2ZM3A 3TTJA 3VUDA 5K4IA 2QOKA 2VTOA 5HTCA 2PVLA 4H3PA 2JFMA 4QRCA 4FC0A 3UZPA 3SG9A 3ET7A 2OJJA 3IS5A 3MDYA 1UNGA 4AE6A 4EH9A 4F09A 5HBHA 5FGKA 3SC1A 4BDCA 2IN6A 3CCNA 3COKA 2CNUA 5CSVA 2BAQA 3A7IA 4PP9A 3C13A 3DDPA 3F3TA 4BWPA 4LOPA 1BUHA 4QQTA 2IG7A 1PKGA 3K54A 4I4EA 4DYMA 3MIYA 2YM7A 3VS4A 1APME 4YJUA 4HW7A 3QQFA 1UV5A 2OSCA 3VF9A 4AG8A 3QX2A 3BYSA 4ALVA 2Y6OA 2X7GA 5LCKA 4DEAA 5JZNA 5KBQA 2VTAA 2HENA 4KD1A 3MN3A 2HXQA 3A7JA 4R3PA 4YHFA 3MS9A 4JAJA 3Q4UA 5AR3A 3KCKA 2VX3A 4JR7A 4ZXTA 3LFFA 4RVTA 3U87A 4RT7A 3TKUA 2B9IA 1V0PA 4A06A 2WXVA 4G5PA 5CF8A 3MFTA 5T68A 4I22A 3TZMA 3S95A 4XG6A 3OWPA 5EYMA 4BYIA 4E6AA 3RMFA 1H4LA 4HYIA 4WG3A 3MFSA 2BPMA 4B8LA 1J7UA 4OTDA 3OFMA 4F70A 2ITTA 2DS1A 3TM0A 2F4JA 4YZ9A 4AFJA 4YJVA 1MRVA 4EOLA 4IAZA 4BDFA 4EWHA 5M4IA 2V7AA 2H9VA 3ANRA 4PY1A 4QP9A 4YZNA 2R9SA 2B0QA 4QMYA 4PL5A 2ZV9A 3NUPA 3VF8A 5J79A 4H58A 4GIIA 4MK0A 4U41A 2BUJA 4Y46A 4CFWA 4AA0A 2BIYA 3AG9A 4O7YA 4O83A 3LZBA 1G5SA 4OTHA 3UOJA 2PVJA 5IEXA 4R5YA 2R5TA 4IB5A 4EHZA 3HL7A 3RBWA 3AT3A 3MH1A 3QTXA 3P1AA 5DBXA 2FSMX 3K3IA 5KX8A 4AGCA 2EB2A 3LM0A 4I6QA 4FEWA 4RA5A 4HNIA 3AGLA 4GT5A 2ITVA 1SNXA 3PFQA 3EQPA 4S30A 4AZEA 4QMSA 1WBNA 3AT4A 1KE9A 3G9NA 3O8TA 5ETIA 4D4RA 4ACCA 3G6HA 4OTGA 3VVHA 4MEDA 4F1OA 5LVLA 4B9DA 5JFWA 2XKEA 1KE8A 4IB1A 2WTWA 4TL0A 3FUPA 1OMWA 2PUUA 4IXPA 4O0TA 4J8NA 2CNQA 4GK4A 2GMXA 2P4IA 3NS9A 4D9TA 3UODA 5GZAA 4IADA 5L8JA 4AACA 2O8YA 4KRDA 5C9CA 4FSZA 4NU1A 4EQCA 4EOIA 1E1VA 2CKEA 2VWXA 4CKIA 2Z7LA 4FKWA 4EONA 3ZFMA 1J91A 1UU3A 3QKKA 2UVXA 3F6XA 5EM5A 2CGVA 1RDQE 3P08A 3UYSA 1ZZLA 2X2MA 3FY0A 4YSMA 4ANOA 3Q32A 2WMAA 2UW8A 2HCKA 1XBAA 4CZTA 4FKIA 2XIRA 3OHTA 4YO4A 4UXQA 4PL3A 1KSWA 4NKAA 4AFEA 4QO9A 3RK5A 5AUTA 2CN5A 5L3AA 3VRYA 3HP5A 5D10A 4JQ7A 4MXOA 3V8TA 3VBYA 4BVUA 4EHEA 5BX0A 2BALA 1YXSA 1U54A 3BGQA 4HCUA 1YRPA 3GENA 4QP8A 4FKJA 4TWOA 1GIHA 2CN8A 4HZRA 3PJ8A 4KSQA 5KMLA 1Q61A 4X0MA 2GU8A 2VUWA 2WOUA 2ZDTA 3UVRA 4W4VA 2QQ7A 5IA5A 5C26A 5CZIA 5LWMA 5GIPE 2QOIA 3BE2A 4FV3A 5D7VA 3RNYA 4MWHA 4BCMA 1LP4A 3M42A 2BRNA 5EOLA 4GUBA 2XNBA 2OW3A 4IE9A 4XG4A 4IJ9A 4FI1A 2QOCA 4DEEA 4LGHA 3TNQB 4LI5A 5EOBA 2PHKA 5LVPA 3PSCA 3HDNA 4RIWB 4FV4A 4IIRA 4M69A 5HVJA 3R7VA 4H1JA 4ZTRA 4I94A 3PJCA 3QQJA 3NW5A 4O1PA 3CIKA 4KKHA 5AUXA 4IVBA 1XH7A 2R3FA 3MH0A 4GFMA 1XBBA 3KN5A 3ZXZA 4C7TA 4WG5A 3LHJA 4X3FA 3ZBXA 4WBOA 1Y8GA 3V5QA 5CASA 3I7BA 1FVTA 3AD5A 4QOXA 3WI6A 4GUEA 3LPBA 4EH3A 4D58A 4CG8A 1Q8ZA 4B4LA 3P79A 2XK4A 2ITXA 4IACA 4O86A 5CEIA 3DFCB 4MNEA 4WIHA 5I9YA 2OH0E 5M51A 3ORLA 5E1EA 4Q5HA 1TVOA 3PRIA 2XNMA 2O2UA 4EJNA 2X8IA 3EQRA 3DB8A 4FTRA 5AP0A 3QTZA 3C4WA 2QLUA 4FKUA 4GT4A 4X6RA 2JKOA 3WZKA 4C02A 5GINE 3VHEA 3ACKA 4G9RA 4S34A 1PXPA 3PY3A 4CYIA 4FEVA 4YP8A 3Q9ZA 1XHAA 2YFXA 1OIRA 3TNPC 4EOKA 4K11A 3OG7A 1WBWA 2CLXA 3R1QA 4HCVA 2GNFA 3ZO2A 2AYPA 4BZOA 5KHWA 3CQEA 3ENHA 4FIEA 2AC5A 4WT6A 4KIKA 2C0IA 5CAVA 5CENA 4G2FA 3ORNA 5HORA 4FEUA 4R1VA 3N9XA 1Q99A 4HPUE 2ZJWA 4O7WA 3Q9YA 3PVBA 5CI6A 3PSDA 2V7OA 3R01A 4QTCA 5GNKA 2BROA 3FPQA 1WBVA 4YZCA 4PPBA 2XKFA 1S9IA 3TWJA 3R8UA 5CXZA 3QXPA 3LFAA 2VU3A 4M84A 5I9XA 2XIYA 2W1EA 2X6DA 3FY2A 2J0JA 5A9UA 4MTAA 2GTNA 3A61A 2WMBA 1LUFA 2F7XE 3QQKA 5FM3A 4TYHA 4H3BA 1Q62A 2CPKE 3MFUA 1CKIA 4RFZA 3QD3A 3ROYA 4ZY5A 4X2GA 3CXWA 3DOGA 2GHLA 5JH6A 3V5LA 4FV9A 3V3VA 4B99A 2WTJA 2UZLA 1BLXA 4UWCA 5DR6A 1DAYA 4F1MA 2ZOQA 3PZEA 2VWVA 3GT8A 4JBPA 4AAAA 2R3GA 4XS2A 5F1ZA 1XWSA 4U44A 4G6LA 4X21A 3L8XA 4AZTA 4PMMA 2R3HA 1MRUA 4J8MA 3QD4A 3QGYA 4ASDA 2DQ7X 5A4TA 5EH0A 3C4FA 3V01A 3BE9A 3EYGA 4ZSGA 5AR4A 3P9JA 4EBVA 5IU2A 5TOZA 2XNPA 3F7ZA 4MBIA 3PSBA 3Q2MA 3M11A 4J7BA 2AC3A 3KK8A 5K5NA 3PG1A 1OL2A 4L8MA 3ZFXA 4RWLA 5KMJA 2A4LA 2C6MA 2NNWB 4F7LA 2NP8A 2YA9A 2PVNA 4Y83A 3E8DA 4DC2A 2R3RA 4PPCA 3ETAA 4FG7A 3UC3A 3WYXA 2CJMA 3FZ1A 1YWRA 4FIIA 2UZVA 4RC4A 5AP3A 5FP6A 4XP0A 1CSNA 3MY5A 3MY0A 5GJFA 1IEPA 2XVDA 4EOSA 1BYGA 2OF4A 4QMVA 1GIIA 3A4OX 3MVJA 3QUPA 3P23A 2BCJA 5TKDA 4CT1A 5HG9A 1YXTA 5FEEA 5HX6A 1R0PA 4FTKA 3UOHA 3BYVA 4BKYA 2ZM1A 4XV2A 4K9YA 2RSVA 3CQUA 4RWKA 4FZDB 3QWKA 4DG2E 4L01A 5FM2A 5EFQA 1WAKA 2XK6A 3I1AA 4ZOGA 3FEGA 4FX3A 2W1DA 4C4FA 3FZOA 5EM7A 2E9PA 4BWKA 5A4QA 3SHEA 1OUKA 3RINA 3ZRKA 3W10A 3MB6A 5CF6A 3HA8A 3W8QA 1TQMA 3FDNA 4IHPA 5TR6A 5K0XA 1CM8A 2C69A 4O6LA 4LGDA 4KB8A 3PPJA 4CQEA 3EJ1A 2W4OA 2WZJA 1REJA 4YC6A 4O21A 5M09A 3PLAE 2PE2A 3NCGA 5AV3A 5IQFA 2R3NA 1MP8A 4UY9A 4YJSA 4U0IA 3BELA 4AZSA 4I5MA 4Y5HA 3LE6A 5L8LA 4CZYB 2FSLX 3OF0A 4RFMA 4DLIA 2VWYA 5LARA 3KMMA 3EZVA 3OT3A 5CS6A 4KIOA 5FTQA 1Q8WA 3S2PA 4RVLA 4XOYA 2VWIA 4WD5A 4WO5A 3LQ3A 2OKRA 1FMOE 2XEZA 4FGBA 3GOKA 3ZUTA 5CF4A 5EYDA 5IKWA 3R02A 3FKOA 4IZ5A 2OXYA 5BPYA 2XA4A 3ORPA 4GT3A 4TRLA 2F7EE 1Q41A 1ZYCA 3UMWA 4X7QA 3IQ7A 2VO6A 3QQHA 4RC3A 5DFPA 3QAME 2BIKB 3F5PA 1YOMA 2VO3A 3E8EA 4DFNA 5KZ0A 3TUBA 4MQ2A 2CGWA 2O64A 2YN8A 2CGUA 3FMNA 3I81A 3QZIA 3W16A 4YNOA 4V01A 1R78A 3HEGA 4C38A 2WOTA 5DN3A 3OZ6A 2YIRA 5IA1A 4O7NA 1PHKA 2HY0A 3I60A 3IG7A 2JD5A 3MGYA 4I6BA 3BIZA 4V04A 3ZSIA 1IA9A 5JQ8A 4OLIA 5LCJA 1M2PA 1G3NA 4S33A 2WTKB 3BWJA 4USEA 2OF2A 2PZPA 4K0YA 4EWQA 3Q60A 3V8SA 2GPHA 3G0EA 2C30A 5CVFA 4MXAA 4Y95A 3COHA 3BX5A 3UPZA 3BBTB 4E8AA 4EC9A 1OITA 4IVAA 4LOQA 4MXYA 3QLFA 4IC7A 4E26A 3FXZA 2UZWE 5KZIA 2EXCX 5G1XA 4ANQA 2PMNX 2CKOA 1TKIA 2BFYA 1MQBA 4AW5A 5C03A 1URCA 4F0IA 4MF1A 4P5ZA 4ITHA 4ITIA 4E4MA 4ORKA 2P3GX 3MWUA 1YHVA 4FTUA 1W83A 4AW2A 3QTIA 4H3QA 4YHJA 4OT6A 3QA0A 4RLKA 3QTUA 1MRYA 5B7VA 1OKYA 4FL3A 3CS9A 4ALUA 3DT1A 3MSSA 4FIFA 4C57A 1M7NA 2YM3A 2X9EA 1J1CA 4RJ6A 3LCOA 3F61A 4FIGA 2ONLC 1SYKA 3FBVA 2NRUA 3ZRMA 3TUDA 4AUAA 4FMQA 2BZIB 2WQBA 3COMA 2ITQA 4KIQA 2Q0NA 4FTQA 1JSVA 4D2PA 3QD0A 3LXNA 3HUCA 4L68A 2CSNA 4FG9A 1W8CA 2ZMCA 4MQ1A 5HVYA 3LCTA 5HNGA 3TCPA 3U55A 1A9UA 4WSYA 4C59A 2HOGA 4FSNA 5AP6A 3C5IA 4U42A 2A2AA 2QKWB 2WMQA 3UYTA 4CSVA 5AR5A 4BDAA 2VGOA 4DN5A 2ZB0A 4EKLA 2EB3A 4QMPA 5EQPA 3C50A 4GFGA 5J5TA 5HCZA 4ZK5A 2GFCA 1OPKA 2OG8A 3S0OA 4QTBA 3REPA 2X1NA 3SKCA 1ND4A 3LLAA 4TYGA 4ASEA 3I4BA 5CSXA 3O2MA 4IC8A 4QYEA 2BAJA 2QOHA 2BKZA 5DIAA 4DFXE 3IKAA 5J87A 4D0XA 5CAOA 2YLEA 1GY3A 4JOAA 2OWBA 5DT3A 3ERKA 4I6FA 4ERWA 2WMTA 3H9FA 2PU8A 1IAJA 3F82A 4M13A 5DEYA 4TNDA 2REIA 3M2WA 4JRVA 1OL6A 3P86A 4AZWA 4F9CA 1XH4A 4KAOA 4XG3A 1WZYA 3RNIA 4BY9E 5IA4A 2QKRA 4J53A 1KE6A 2OH4A 3GVUA 4WNMA 2Y6MA 2R3OA 3DFAA 3EOCA 3UIUA 2E9UA 4O81A 3RPYA 4GG5A 1P5EA 2Y8OA 3FAAA 3ZDUA 2ZDUA 5IEVA 2FO0A 4KBKA 1UU8A 3MVMA 2W4KA 3TJCA 3NVMB 4AU8A 1WBPA 2XK7A 4WUAA 2C6IA 2W17A 5CALA 4X2JA 5GZ8A 1XKKA 1JKTA 3TV6A 2XEYA 1H08A 3GUBA 2JBPA 1E1XA 4EJ7A 3MA3A 3ORIA 4AS0A 4EQUA 4BDJA 4FYOA 3HA6A 2W1HA 3QCXA 4I41A 4TYEA 5HD7A 5HNBA 3TNHA 2X0GA 3GCSA 3ULIA 5IG1A 4ANMA 3OY1A 4L52A 3DGKA 1YQJA 5J7BA 1GJOA 3NGAA 5I3RA 4FEQA 2WTDA 5CSHA 4TKSA 2IWIA 4F7SA 4WOVA 1TQPA 5KMIA 2WQEA 4RQVA 2HYYA 5EM6A 4IEBA 4RIYB 4ARKA 3GU6A 3BPRA 1AD5A 1OL7A 2OIBA 4CEGA 5IQCA 5DNRA 3ZEPA 4KNBA 3RHXA 4C0TA 3P78A 4KABA 4DEHA 4FR4A 2J7TA 3OVVA 4X2KA 5ANEA 4ASZA 2GNIA 3EMGA 5A4EA 3BEGA 3I0OA 3OUNB 5AEPA 3W2RA 4RVMA 4AXAA 2Z7RA 4RLLA 3SRVA 4YTHA 1SVGA 1M52A 2QOBA 3EWHA 3RGFA 3DY7A 2PY3A 5FXSA 3WE8A 4ANNA 3I5ZA 2UZNA 4K2RA 3LMGA 2F7ZE 2XRWA 3DJ7A 5J9ZA 4AZFA 4R3CA 4AA5A 5M57A 5JEBA 3QZGA 4R5SA 2GS7A 1ZZ2A 4KWPA 5CT7A 4C3PA 5AR2A 4DTAA 2I6LA 3R8MA 5HE0A 4FSQA 2C5XA 4UZDA 3HYHA 5J1VA 3D5UA 2A1AB 4G9CA 2NRYA 3WF5A 5CEKA 5M08A 5JGAA 2ITZA 5IQAA 3AC8A 2WNTA 4FTJA 3ZC6A 4EORA 3TDWA 4WNPA 3TZ9A 3QRTA 1JVPP 3LKMA 1YDRE 2HZIA 3RALA 1OBDA 2Y0AA 4FF8A 2IZSA 2GHGA 4RWJA 5FXRA 3EN7A 1FBNA 3IDPA 1KV2A 1Z5MA 3NAXA 4UYNA 5AP5A 3T3VA 3CSVA 4ONAA 2JIVA 3VQHA 2C5VA 3QHRA 2Y4PA 4BDBA 4YTCA 5KO1A 2OJ9A 1KE5A 4N70A 5HBJA 2J5EA 4QNAA 3UNKA 3NUAA 2A27A 3Q4TA 4DE4A 3GCUA 5I9VA 4OAVB 3KEXA 3W2QA 3LFSA 4EZ7A 3DB6A 4E1ZA 2JIUA 2RG6A 4ANSA 2VTTA 3R30A 2FH9A 4MYGA 4BGHA 2VWZA 2ITPA 1PXJA 4AOTA 4BFMA 3FMJA 5BMMA 5HX8A 4QMMA 5JGBA 3MTFA 2XYUA 3DCVA 4QP7A 2I0HA 3VC4A 4DFYA 3FC2A 4H1MA 5AUVA 2UUEA 5T3QA 5AMNA 4FSUA 3CR0A 5CLPA 5FEDA 3R9HA 3TXOA 1YXVA 3HRCA 5AM7A 3U6JA 3OS3A 3CTQA 4W8EA 2WEIA 4XYFA 4BCIA 4FV1A 1JBPE 2BTSA 4R8QA 2DUVA 5M07A 1PXOA 4E6CA 2OICA 2OJFE 5M53A 1VYZA 1J3HA 3SOAA 3H9RA 3V5JA 3HMOA 3MTLA 3PY0A 4NTSA 3D7TB 5HLNA 4NH1A 5CSWA 4PWNA 5KBRA 4P2KA 4D2VA 5M4CA 4EBWA 4O91A 5E90A 2VO0A 4NT4A 3U6IA 2B7AA 3QUDA 2C4GA 3OWKA 3QUEA 4G5JA 3KF7A 4APCA 2YIQA 3PVUA 4MHAA 3LFCA 4WNKA 4CFUA 5J9LA 2BFXA 3BGPA 2BDFA 4M67A 3BV2A 2C3IB 3BU3A 5HTIA 2H96A 1PXKA 5EQYA 4QNYA 1REKA 4MAOA 4TYIA 5HI2A 4Q9SA 2XK8A 4EH7A 2YDKA 2GDOA 3DU8A 3K2LA 4ZSJA 4BIBA 3QFVA 2WMSA 3UVQA 4Y5QA 2R3PA 4N57A 3R8ZA 3FI2A 5AV1A 1JPAA 5AR8A 2IPXA 3NRMA 3FLWA 4FZAB 1ZMVA 3SXSA 3FLZA 2C5OA 5D7AA 4FL1A 5KMMA 2YZAA 3DXNA 3FZRA 3EQDA 4CLIA 4J99A 5FLFA 3BEAA 4FK6A 5M4UA 2BHEA 5KMOA 4QMOA 3A8WA 4I1ZA 4IANA 2YHVA 3E5AA 4FTMA 2ITOA 3FPMA 2UW5A 4GVJA 2YAAA 5HIDA 5CEOA 3QYWA 3H0YA 3QQLA 4ZTQA 3SD0A 5CF5A 1W7HA 2R0UA 1W0XC 3C4CA 3AT2A 5A4CA 4BGGA 4ZS4A 4B6LA 2R0IA 5JN2A 3WYYA 4GJ2A 3GU7A 3WF8A 4ZLYA 4D1SA 2B9FA 5K3YA 2XKDA 5D12A 3DA6A 3LCSA 3BWFA 5EG3A 4IWPA 1FPUA 5A3XA 1YXUA 1W84A 2PK9A 3FLSA 3R6XA 4I92A 3M1SA 5DH3A 3D5WA 1PXLA 5C01A 4A9TA 4JQ8A 3BHHA 3UPXA 4BR3A 3UO4A 3HRBA 3ZO4A 2BAKA 1OZ1A 4J71A 4M8TA 5E8TA 4RX7A 1OKWA 3U54A 3KXXA 3EFKA 5BYYA 4RIWA 2JDOA 3ZU7A 4CFFA 3LXLA 4X3FC 5DMZA 3JVSA 5IQBA 5IPJA 4BDEA 4BF2A 4TWCA 2VTLA 3MESA 5JQ5A 4YZMA 4O0XA 3MW1A 3R8LA 3IPHA 4XV3A 5E8UA 3PY1A 3QWJA 3KK9A 4AT3A 4YZBA 2WGJA 3FZSA 2XM9A 2JDTA 2VNWA 4ITJA 4N0SA 5BVEA 2XUUA 4B8MA 4LGGA 5K5XA 5M55A 5KUPA 1MUOA 3G15A 5CNOA 4ID7A 3TEIA 4QMXA 3KRXA 5CI7A 3RM6A 4D2SA 4C37A 4BCFA 3E63A 3KVXA 5I5ZA 4PP7A 3R22A 5FQDC 1U59A 4C34A 4EHGA 4L53A 2YJRA 3H0ZA 2P2HA 2WEVA 3MA6A 4GU6A 4JJRA 4U43A 2WO6A 2XYNA 5LQFA 4EK4A 3PA5A 2G2IA 4BCJA 1O6YA 3HZTA 3ATTA 4RIXB 2ZV2A 3OEZA 3IONA 3QCSA 4FOCA 5FWKK 4FT3A 5F94A 4F7JA 5I3OA 4F99A 3OCTA 5KHXA 3RWPA 3R7OA 5IQEA 1YDSE 4ZSEA 2XNGA 4CNHA 4BBEA 3C4EA 3NUUA 4JG6A 4CRLA 3A7GA 4O7LA 5IA3A 3OCBA 3PP0A 3WIKA 3KMUA 3GQIA 2OZAA 1B6CB 3VHKA 3AC2A 3H3CA 2OIQA 3QU0A 4K1BA 3CC6A 4MD9E 4NM0A 3W18A 3LMHA 2R3LA 3KGAA 4CMUA 2R3JA 4ZJJA 2F2UA 2HZNA 4HGTA 5H8EA 3ZO1A 1PW2A 3EN6A 2PPQA 4I93A 4NYEA 3IW5A 1Q3DA 5E91A 5CAPA 3EL7A 2QO9A 3SA0A 3HV3A 2FYSA 4X3JA 5CAQA 4P4CA 4D0WA 3R71A 2GFSA 2R3IA 5EI2A 4BTJA 2IW8A 4AP7A 4ZLOA 3ATSA 4XCUA 3QC4A 4L67A 4O0UA 2RFDA 5K0KA 2VTJA 4FT5A 3T8OA 5F9EA 2V55A 4G31A 3FL5A 4I5HA 4EZ3A 2WMWA 4KBCA 3QXOA 3BYUA 3ODYX 4FTCA 2X81A 3O0GA 4PUZA 4RA4A 4C4JA 5C8NA 2X6EA 5AM6A 4F7NA 5HG8A 3DKOA 4G6NA 2P55A 1LPUA 4IAAA 4OGRA 2UW7A 3PYYA 3OXIA 3AGMA 4OBOA 5AX3A 4E5BA 3VS5A 3S4QA 1Y91A 1H26A 4J95A 5LJJA 3K5VA 4NUSA 4QMWA 4FEXA 3ZH8A 3L9MA 5BNJA 3LQ5A 5HKMA 3FHIA 3UQGA 2PTKA 3HUBA 3NZ0A 3W2SA 3QD2B 3U51A 1LEZA 2PVFA 2WD1A 4FV2A 4D4SA 3IDCA 1HCLA 2QO7A 3NYVA 4ERKA 4BYJA 1YI3A 4F08A 3DLZA 5HIEA 2WHBA 5LVMA 4QYYA 5AP7A 3VBVA 1UWJA 2LAVA 2Z60A 4QYFA 2RIOA 3NNVA 1YHWA 3HV4A 3KQ7A 2WTVA 4JDHA 4O7ZA 4IVCA 4G16A 2B55A 3FMMA 4PV0A 2JFLA 2G2HA 2J0MB 4JVGA 4QP2A 1FVVA 5CAUA 2JLDA 1KUTA 4ACGA 3D5VA 2JIIA 3F3VA 3PLSA 3CTJA 4XG9A 4XUFA 2GS6A 3NEWA 4U79A 4CYJA 3IW8A 3RK7A 4NW5A 1DS5A 3RAKA 3OWJA 4Y73A 4HGSA 2YIXA 3DXPA 5AA9A 4G3GA 3UOKA 4ANLA 1UA2A 3EYHA 4DT9A 4JI9A 4XHKB 3VQUA 1OL1A 3H9OA 3ZBFA 2OJGA 3Q04A 4FV5A 3OXTA 3UNZA 1Y6BA 4U9AA 5CANA 3ZFYA 3N51A 4HNFA 5AV2A 2C6DA 4GIHA 2ZMDA 1P4FA 4O0VA 5KCVA 3R0TA 3LCDA 1NY3A 2B9HA 2WIHA 4RSSA 3VO3A 4IWDA 3KKVA 2GSFA 3LJ0A 3QRUA 3RWQA 3VNTA 3E92A 3F2AA 4FL2A 3PG3A 3R00A 3NUXA 3IOPA 2ESMA 5CYIA 4APPA 5L2WA 1J7LA 1XBCA 4CMOA 4DG3E 4CVAA 2PVHA 3C5UA 3IDBA 4WUNA 1UWHA 2C68A 4A4XA 4BHNA 3NX8A 3IGGA 4Y85A 4WSQA 4OTIA 4O84A 5LMBA 5AV0A 5IZFA 4RZWA 4C2VA 3FQEA 3BI6A 3DZOA 2ITUA 4FTIA 4L44A 3NR9A 4E3CA 4E6QA 3FI4A 3FMEA 1Y57A 1HOWA 3LIJA 3R7GA 5A4LA 5HU3A 5L2IA 4CCUA 3MH3A 4O0WA 2GNJA 3S1HA 4AN9A 4FE2A 3RI1A 3FI8A 2PZIA 3D4QA 4M0YA 4BDDA 5TO8A 4D55A 5CX9A 4XRJA 2XIXA 3E8CA 1NVQA 4D1ZA 2I40A 1IA8A 3JXWA 3VBWA 4BI2A 4J97A 4BTFA 2X39A 3TKHA 4AGWA 3RP9A 2C6TA 2YDJA 3LLTA 4EYJA 2OZOA 4WHZA 3PVGA 4O1OA 4ZAUA 4AX8A 4IDVA 2C5YA 3JS2A 5JKGA 3MV5A 5GHVA 2G2FA 4GU9A 5H3QA 1CMKE 2IVTA 3F5XA 4LG4A 2J0IA 4MD7E 4G3CA 4RJ5A 3EZRA 1QMZA 4RRVA 2XK9A 5KNJA 4NFNA 3VS2A 4F0FA 5C8KA 2W0JA 4U3YA 4I5CA 4YTFA 3KU2A 2YIYA 1ERKA 5HNIX 3ZRLA 4CFMA 5ANGA 1CDKA 2QU6A 5IMXA 5E92A 3IOKA 2YDIA 4HCTA 2FUMA 3WE4A 5CEQA 3C9WA 4JT3A 5ANOA 4C4HA 4QMZA 4BN1A 3O8PA 3BGZA 2Y7JA 3PXKA 3R28A 2SRCA 3PVWA 3OXZA 3FXWA 4J98A 3PTGA 2Z8CA 4C3RA 3KULB 5L2TA 5LXMA 3FXXA 3G2FA 5IDNA 4DA5A 2OO8X 4J52A 3NSZA 4NJDA 2I7QA 4OR5A 4QP3A 4BBMA 4FV8A 4IB3A 3FYKX 2WQNA 5T6KA 4MNFA 3W2PA 1JKLA 1U54B 3HV5A 4A9SA 4TPTA 3PXRA 3R1NA 3K5UA 4U3ZA 2OK1A 3F66A 4O0SA 4RX9A 4XG7A 3FQHA 3QA8A 4YC3A 5JT2A 1FOTA 5CZHA 4TT7A 4ZZOA 3RCDA 4J96A 4QPMA 4NW6A 3F2RA 5DWRA 3C51A 5LMAA 4AF3A 1K9AA 1QL6A 2J50A 3BRBA 2JAMA 3E7OA 3Q5ZA 4C33A 1WBSA 3VJNA 2VWUA 4AN2A 1WFCA 1YWVA 4R7BA 5ANKA 4RJ8A 1RQQA 4LL5A 4USDA 4UMQA 2DWBA 3UZTA 2CNVA 5J95A 3CJGA 2W7XA 4EH4A 1URWA 3ORTA 2QOFA 2WIPA 3KL8A 4FTNA 3PIZA 4L3PA 4MXCA 4R7HA 4EH6A 4LV5A 2X8EA 2B53A 3TI1A 4U7ZA 4RJ4A 3LQ8A 1R39A 4BCNA 5A14A 2FSOX 3GP0A 5BMSA 4F9WA 5ANIA 5EM8A 4CD0A 1VEBA 2XP2A 2BRGA 3QALE 4AT4A 4GS6A 4X3FB 1SVHA 1Z9XA 4L6QA 1JOWB 3EFWA 4RC2A 2XKCA 5IA2A 4UEUA 4BCOA 4L3LA 2BDWA 2B54A 5B0XA 3QTWA 3QX4A 1Q8YA 1JSTA 4IM0A 4N6ZA 2UZDA 5CNNA 3LFNA 1E9HA 4NM7A 5EYCA 3U9CA 3THBA 2UZUE 4E20A 4RZVA 4QPSA 4CFVA 5DHJA 3CY2A 2BZHB 3CJFA 4GW8A 3NUSA 4I20A 3FJQE 5E7RA 2YAKA 5BVWA 4DAWA 4H05A 3W8LA 4PMPA 3DS6A 1BKXA 3Q4CA 2J6MA 3L9PA 4TYJA 2OLCA 4V0GB 3Q6WA 5GIOE 5TF9A 4X6QC 4DH1A 3Q3BA 1A48A 3MVHA 4Y8DA 3NPCA 2J0LA 3OTUA 4XG2A 5FUTA 2VGPA 4S32A 3FE3A 1CKJA 4MWIA 3DBFA 5L2SA 1Q3WA 3VRZA 4FV7A 4FKOA 2XZSA 3LW0A 4QMTA 3T3UA 2LGCA 3KXHA 3JUHA 2O5KA 1ZMUA 4A9YA 1JAMA 2I0YA 4LUDA 3GQLA 3DLSA 4L42A 3EIDA 4FKGA 3KFAA 2EVAA 5I0BA 4C61A 5E8SA 3BYMA 5L2QA 4O7TA 4IWOA 2XIZA 2BRHA 4LYNA 3H4JA 4FV0A 4RIYA 3ZONA 5CU2A 1UU9A 3LFQA 4JR3A 1VYWA 2C47A 5H8GA 3AD4A 4YJNA 3SOCA 5BQ0A 3FKNA 1U4DA 5HO6A 3VBTA 3ZXTA 2PZYA 3GU8A 5FTOA 3RVGA 3BYOA 3FMKA 4TYHB 4DITA 1O9UA 3PPZA 1O6LA 3DNEA 3DQWA 2IW9A 4E73A 4PDOA 2R7IA 3U9NA 3RTPA 3QTRA 2VWWA 4ZS0A 2YM8A 4BDKA 1OIYA 2YLFA 4K77A 3PWYA 3O17A 1IR3A 4NK9A 4DGMA 1OUYA 3C7QA 4UV0A 2JDVA 4WG4A 2HWOA 5AAFA 4BI0A 5L8KA 3RM7A 4E4NA 4BWXA 3CEKA 1UKIA 5E9EA 4JG7A 1PXNA 4QP6A 5I9WA 4XMOA 4ACHA 4UN0C 5GJGA 2YACA 1Q4LA 3UP7A
chains in the Genus database with same CATH superfamily
2KULA 4UMPA 2R7BA 3O7LB 4TWPA 3CKWA 4MD8E 4YJTA 4I4FA 2QOOA 2W1GA 3OW3A 3R2YA 3W33A 4C8BA 4GRBA 5FP5A 4DHIB 5JGDA 4IH8A 4BCKA 3NVKI 4UMRA 2G1TA 3LFDA 1NT2A 3CLYA 3ZSHA 2HY81 2ETKA 3NLBA 5HG7A 5CU3A 5BYZA 4D2TA 4DBXA 4KS7A 2XCKA 4JIAA 1I09A 1OGYA 3E3BX 2PVRA 2VTIA 2Y9QA 4OTQA 3LJ2A 4QT1A 4U5JA 3VS7A 4F65A 2B52A 1H07A 4FV6A 4MF0A 3KRJA 2HW6A 4C4EA 5DR2A 2YITA 2XAMA 3NW7A 5BVFA 1NXKA 2VTMA 3A4PA 2PE0A 3BQRA 2F57A 3COIA 5AJQA 3GCQA 3NNXA 5CY3A 2UW4A 4FA2A 3TDVA 4TY1A 2C6EA 4ZZNA 3W2CA 5DPVA 4Z55A 2XMYA 2IO6A 3TNIA 2Q83A 3AOXA 4FK3A 4ZLZA 4D5HA 1WBOA 2P2IA 1LR4A 3QBNA 2IZUA 3D0EA 2BZKB 5B2MA 4A7CA 1WVYA 1OPJA 3F2NA 4FG8A 5BVOA 3JY0A 4Q9ZA 1YW2A 1FMKA 3ULZA 5J7HA 4YJPA 5L6OA 3MJ2A 4IX3A 3FI3A 4FBXA 3KIOC 5EYKA 2PUIA 1SMHA 3U8WA 1PY5A 4C3FA 4GSBA 3RCJA 4AOIA 4BTMA 3GBZA 3O96A 3IW4A 1DM2A 4NM5A 5IDPA 3RZBA 5C4LA 3UC4A 3VS6A 5KMNA 1ZY4A 3ZM4A 4O7VA 4NIFB 4XLIA 5HEZA 3KY2A 2C6OA 3VUHA 4BDIA 4YUQA 4W4YA 4BCHA 3PUPA 1M2QA 3F69A 3OOGA 2ZAZA 3HECA 3V5WA 3LM5A 3EQFA 2UZEA 3TACA 4DFZE 2F9GA 5IMEA 5AIKA 4YLJA 4C2WA 4HYUA 4CKJA 1B38A 4L00A 3ZUUA 4BBFA 4EOJA 2RFSA 4IM3A 1SM2A 2UVZA 3QTQA 4GYIA 5ETFA 3AXWA 3WF7A 4ASXA 4XNEA 1FQ1B 3Q52A 4EOOA 4HZSA 2GQGA 3OBJA 4JG8A 4N6YA 4DFUA 1GZOA 5BVKA 1JWHA 3KCFA 2RL5A 3NAYA 3OCGA 4FT9A 5CWZA 3H30A 4AQKA 5DA3A 3MPAA 2OU7A 2EXMA 1DI8A 4GEOA 3GFWA 3FZPA 4DBNA 3Q6UA 1EH4A 3FSKA 3RPOA 2ZM4A 4DHFA 4E5WA 5DI1A 5CU0A 3L8VA 1YOLA 5AV4A 3TKIA 1W2DA 4BIEA 1P2AA 3O7LD 3NUNA 5BUIA 4AE9A 2WKMA 4RX5A 3T9IA 1OKZA 2P0CA 4TNBA 2J5FA 4HPTE 4BCGA 3VUMA 1PMUA 4I21A 5LWNA 3BKBA 1H1PA 4XG8A 2WTCA 3POZA 3ZLYA 1QPCA 4RG0A 4QPAA 4ALWA 5B2KA 4TXCA 4OAUC 2QG5A 4RPVA 2VTHA 1J1BA 3O23A 4FSRA 3P5JC 3P5KA 1GIJA 1X8BA 3FSFA 3HP2A 3PJ3A 4FODA 3UJGA 3ZUVA 4NCTA 4CFNA 1UVRA 4YJOA 3ZLXA 2PYWA 4IMYA 1H28A 1P4OA 4H39A 3L9NA 2E9OA 3C0IA 3P4KA 2YCSA 4WRSA 3JY9A 5KKRC 2OIDA 4OT5A 2BR1A 5LVNA 3I79A 3HKOA 2WU6A 5FD2A 1IRKA 3PDTA 3ZDIA 2G9XA 5M06A 3HAVA 2BHHA 1JLUE 2W5HA 4UXLA 3DPKA 4AGDA 4LM5A 1W2CA 2VAGA 2XNOA 4O4DA 1QPEA 1YHSA 3NNWA 4OTFA 2ETRA 5IUIA 3MY1A 2QODA 3AMAA 1OPLA 1M7QA 4XP3A 2W4JA 3WZUA 3MI9A 2B9JA 2J90A 3MIAA 2BTRA 2CGXA 3RHKA 3DQXA 4PTEA 3VN9A 3WZDA 4E7WA 3BL7A 4R78A 3WOWA 1GZ8A 4K8AA 1OIUA 4EI4A 1JQHA 2VN9A 3OEFX 4LQMA 3VBQA 1OVEA 2WMUA 4GFOA 5EDPA 5HIBA 5C4KA 3W0OA 3VUKA 3SW4A 4YJQA 4ZTLA 4BL1A 2JKMA 4M14A 5JFSA 3RZFA 1U5QA 5DT4A 3WBLA 5B2LA 2OJIA 3A7FA 4NSTA 4YLLA 2GQRA 5E8VA 4BJJA 3A62A 4FKTA 2J2IB 2RGPA 4RIXA 3VWAA 1RJBA 1FINA 2X4ZA 2XJ2A 3UE4A 3ZLWA 1H1WA 4PDSA 2C1AA 3LVPA 3A2CA 3ZYAA 4C35A 1BI7A 4J1RA 2C1BA 1YVJA 2BVAA 2X0QA 5FBNC 3FLNC 1WVXA 3AC4A 3UIMA 3R21A 3WF6A 3UQCA 3QQGA 4FKSA 4BI1A 3P7CA 2XIKA 5M44A 2NO3A 3IW6A 4NKSA 3ZZWA 2W1CA 2XRUA 3PUFC 2R3MA 3VBXA 4PDYA 4ZTSA 4DGLC 2PULA 4HJOA 3W0PA 4YR8A 2HZ0A 4YJRA 3LFEA 4MXZA 2E2BA 3BV3A 3GB2A 4KUJA 2Z02A 2QI8A 2X2KA 3ZO3A 4ZMEA 1ZOGA 2Z7QA 1OM1A 3BLHA 3U4WA 3ZEWA 3WZEA 4ANBA 4RQKA 4TTHB 4C4IA 3U6HA 2PVMA 1UNHA 2EXEA 2R64A 4C58A 3OUKA 3ZHPC 4ACMA 5M56A 2O0UA 3WARA 3TN8A 5G6VA 4A9RA 5IH4A 3R9RA 3LXKA 2PUPA 3LJ1A 4KBAA 4ENYA 3DBDA 2UV2A 4NTTA 4N4SA 3FKLA 3R7UA 5IQGA 2Z2WA 5CU4A 4UWBA 4BZDA 3L8SA 3IECA 2EWAA 2IVUA 1ZRZA 2XB7A 3R7YA 2ITYA 2WTIA 4BIDA 4R7IA 2XK3A 3CPBA 4PF4A 1ZYLA 1OKVA 3QKLA 4G3EA 5ANJA 1YXXA 4KRCA 5E1SA 5DG5A 5IQIA 4P5QA 4FSMA 3BHTA 2C6KA 3A99A 3AC1A 3AC3A 3HRFA 3DZQA 4WKQA 3NCZA 2FB8A 3BLQA 3ORKA 4IAFA 4A07A 4EL9A 4M68A 4FNXA 3SAYA 1TQIA 3HLLA 5AWMA 2FA2A 3IW7A 2Y4IC 4FVPA 4QD6A 3BQCA 3DJ6A 3VIDA 3NYXA 4PMTA 4AXFA 2W1FA 3PJ2A 5HTBA 3F88A 5ETAA 2V62A 3VUGA 4ZZMA 2W1ZA 4KA3A 4FTTA 3UQFA 4EUUA 3SRVB 4GCJA 4BTKA 3TT0A 4QMUA 2YEXA 3FC1X 4DH5A 4ENXA 4L7FA 3QRJA 1W98A 2YCRA 3HMIA 1U5RA 2WFYA 4MBJA 1Q24A 3SLSA 1XH6A 2A19B 3QZFA 3GEQA 3PXFA 4O0YA 3CE3A 4YZDA 1H27A 2KTYA 4PQNA 3W55A 4FIHA 3ELJA 5EI6A 4F9BA 2RF9A 4JDKA 3Q96A 2J51A 3GFEA 4O2ZA 4P7EA 2UW0A 3SV0A 4LV8A 3CKXA 1G8JA 5GJDA 4OW8A 3DTCA 1QCFA 1FGKA 1Y6AA 3EQCA 2Z7SA 5HCYA 3NYNA 3QLGA 4GVAA 4FKRA 2IVVA 3PXQA 2QG7A 2VNYA 3I6UA 3ZLSA 5CSPA 1H0VA 4HYHA 3P0MA 1XQZA 3HAMA 2O65A 4FNYA 4U8ZA 5EKNA 5IQDA 2BRBA 2EUFB 2VO7A 3UVPA 5A54A 2PMLX 1H01A 3PZHA 3D2KA 3MPTA 3HX4A 2I1MA 3KVWA 3ITZA 3ZTXA 4FKVA 5C1QB 3DDQA 3PIYA 1G8AA 3PE1A 3E3PA 1F3MC 2J0KA 4B7TA 3LCKA 5FEQA 1L8TA 3G5DA 3R2BA 3ORXA 3EHAA 2CCIA 2XF0A 4FTLA 3UMXA 4EK3A 4E6DA 1AGWA 3WIGA 2VD5A 2WQOA 4PDPA 4XEYA 2ERZE 4D2RA 3CPCA 4FUXA 4OBPA 3Q9XA 4DINA 4NJ3A 1XMLA 2YZLA 4IZYA 2PMOX 3E87A 4BRXA 4NL0A 3CD8A 5BYLA 3V51A 3OROA 2OGVA 2YM4A 4LL0A 3HVCA 2PVYA 1RE8A 4CZUA 4PMSA 1R1WA 5DEWA 4JX3A 2UZTA 2UZBA 5EHOA 3K3JA 4FNZA 2VRXA 2WTKC 3EQBA 1ZLTA 3HMPA 4IW0A 4IWQA 4KKGA 4G3FA 4O2PA 1PKDA 4RBLA 5FXQA 4DCEA 4BB4A 4U6RA 3R63A 4NZWB 5A6NA 2O63A 3TMOA 3A60A 2CMWA 4A4LA 5E8YA 3SGCA 4GL9A 5DT0A 5FRIA 4DGNA 4JQEA 2UW3A 2CCHA 1WMKA 4KINA 4YPSA 3RAWA 1P14A 1XH8A 4ZP5A 5IH6A 3UG1A 5LMKA 3R1SA 4CCBA 4U97A 5AX9A 2EU9A 3EKKA 4O22A 2RFEA 3R9NA 3NNUA 3OCSA 1Q8TA 3PRFA 4RVKA 4MXXA 4DLJA 5JRQA 3TJDA 4F9YA 3DKGA 3HV7A 3F5UA 2Q0BA 4FSYA 4NWMA 3UP2A 4G1WA 4JLCA 1Q97A 3PA3A 5HHWA 1Q8UA 2P33A 5AIRA 4PL4A 4EC8A 1G8SA 2GCDA 2YCFA 3L8PA 3KULA 1NW1A 3UBDA 4AW1A 1B39A 4ZJIA 3PA4A 1H00A 3P7AA 3QGWA 5F4NA 4B0GA 3RK9A 4D28A 2YCQA 1BX6A 2J4ZA 4IBMA 4O7RA 4DDGA 4AZVA 4D1XA 4BDHA 3HV6A 5EKOA 2ZVAA 4MCVA 5BUJA 1NA7A 5I9ZA 4Z7HA 4KKEA 3D2IA 3DKFA 3QRIA 4BGQA 2JDSA 2JITA 4L3JA 5HG5A 4CTCA 1BL6A 2R2PA 4QP1A 4Y72A 3R83A 4DEGA 5HQ0A 3G0FA 4O7SA 5AUYA 4ZMFA 2B4SB 4F6WA 2ZV8A 5A46A 3NIZA 4CMTA 3SXFA 4IFGA 1FVRA 1WVWA 4GK2A 5D1JA 4ZTMA 3ALNA 1R3CA 1ZYJA 4QDEA 2ZFYA 4NEUA 1QPDA 4LRKA 1GZNA 3A7HA 3RKBA 4D4VA 4EK8A 3O8UA 3Q4ZA 5DRDA 3QKMA 4NFMA 3QF9A 3UO5A 3GU5A 2E9NA 4E4XA 3PWDA 3SVVA 3UIBA 3C4ZA 5HGIA 3U4UA 1KWPA 1PF8A 4OTPA 4XV1A 3RAIA 3ZC5A 4OUCA 2ERKA 4E93A 3ZMMA 5DRBA 1S9JA 2HAKA 4UALA 1ZXEA 2ETMA 3EN5A 3E88A 3V6RA 5BVNA 5JK3A 2PVKA 3SXRA 3CD3A 1AQ1A 3MBLA 5AP1A 5KKRB 2ACXA 3GOPA 4MX9A 1XR1A 3CY3A 4DH3A 3TUCA 1UNLA 5CTPA 1OI9A 2WMXA 2QNJA 4IVDA 3RPRA 2QHMA 2VX1A 2J9MA 4EK6A 4HGEA 4CQGA 3AKJA 4XRLA 4LFIA 5FTGA 3JVRA 3KXNA 5FG8A 1H1RA 2QD9A 3GI3A 3DV3A 5IEYA 2QHNA 4Q2AA 4I0TA 5HLPA 4TN6A 4V0GA 2HZ4A 3R8PA 1ZYDA 5BVDA 2C3JA 1ZAOA 4ZIMA 2QURA 1H8FA 4G17A 2OBJA 5AP2A 3ZZEA 3F3UA 4IX5A 5JFVA 1PMEA 4M66A 4FZ6A 3CTHA 5HVKA 1VR2A 3D9VA 3DBQA 5DOSA 3R9DA 3ROCA 4IX6A 4JBOA 2PUNA 4F4PA 1CTPE 1IAHA 5HZNA 2OZAB 1OBGA 4BKJA 3ENMA 3E62A 5HE1A 3SX9A 3QHWA 4XLVA 3QYZA 4YU2A 4CV9A 4FZ7A 3V8WA 3VW8A 2GQSA 4G34A 3OOMA 4WNOA 2G15A 1XH5A 3TIZA 3EN4A 1OB3A 3Q9WA 2QR8A 3O71A 1U46A 2FSTX 4U81A 4S31A 4ZY6A 4F6UA 4LRMA 4XOZA 3UO6A 4TWNA 4GMYA 4HVSA 3TL8A 4KSPA 4D9UA 5HBEA 5J9YA 1MQ4A 4LMNA 4FGRA 3WZJA 4O82A 4JNWA 4XP2A 5BUEA 3V5TA 4GK3A 4XX9A 2CKPA 2WU7A 2C3KA 4GV1A 4FTOA 5EW3A 4L43A 4RX8A 4QTEA 3ZM9A 4QQ5A 3H10A 2PE1A 1BL7A 2C5NA 2VV9A 2W05A 3GC7A 1KOBA 4HOKA 2C6LA 3G51A 2OFUA 3GU4A 2ZV7A 3SG8A 2X4FA 2UW9A 2GNGA 3CGOA 3FV8A 5A6OA 3UZRA 5E8WA 5ITAA 4M15A 3NDMA 2GS2A 3D94A 4R6VA 1H25A 4FVRA 3QCYA 1O6KA 4RJ7A 4QTDA 5D41A 4DH7A 2WELA 3NW6A 4I24A 5H9BA 4Z16A 4HYSA 2XH5A 2FVDA 1KE7A 3UG2A 3VS3A 3AMYA 2I0EA 3I5NA 3QQUA 2HWPA 3FL4A 2PSQA 3G9LX 2H34A 1F5QA 1RW8A 4IZ7A 4IJPA 5C8MA 4CKRA 4AGUA 4DEDA 4DTBA 4JRNA 1IASA 1K3AA 2HXLA 3B2WA 4M97A 2Y4IB 4M12A 4U45A 5ETCA 4C36A 1T45A 3L1SA 4W9XA 2A0CX 4YURA 4P90A 3ZCLA 2W9ZB 4M69B 4CGAA 4EQMA 2QLQA 3FQSA 5HESA 4UWYA 2R4BA 1XO2B 1PYEA 4JBVA 5KE0A 4M0ZA 4E4LA 4O0RA 3HNGA 4IAIA 3S00A 1XH9A 3PXZA 3EQGA 1V1KA 4WA9A 1DAWA 3VUIA 4MVFA 2W96B 5IH5A 4FKLA 3N4UA 3KC3A 3N4VA 4ZJVA 3W2OA 3WF9A 4EYMA 3EFLA 3DAJA 3II5A 4QYHA 5AR7A 3D7ZA 3FLQA 2YWPA 1H1SA 4MNEB 4G6OA 3F9NA 5J5SA 5EI8A 4PTCA 4DGGA 4EH8A 4UMUA 4FVQA 4GKIA 5EW9A 5I4NA 5DE2A 4Q5EA 3UGCA 2NPQA 5H8BA 2CLQA 1G8KA 5TT7A 3DBCA 1VJYA 3I6WA 4LOOA 2ITWA 4QMQA 2OXXA 3AQVA 2CHLA 1NVRA 4PNIA 5ACKA 2O3PA 4NIFA 4PRJA 4DH8A 2PZ5A 5CQUA 4IZAA 1W82A 4ZSLA 4QMLA 1WCCA 1CKPA 4KIKB 5KMKA 2FGIA 3ML1A 1YWNA 4BDGA 2HELA 3VUTA 3VONA 4OBQA 5J1WA 5EW8A 4R1YA 1YDTE 4TZRA 4TW9A 3D83A 2YM6A 1UKHA 2VTRA 4X2NA 3EKNA 3CP9A 3GGFA 3KXMA 4GG7A 4JS8A 4EH2A 1SNUA 4AA4A 4F1TA 3BHUA 4FZFB 1KOAA 2IJMA 4I5PA 5E4HA 5FBOA 2H8HA 3B8RA 3HDMA 4K18A 4IQ6A 4DG0E 2ZYBA 4F63A 3VW6A 4HVDA 3UDTA 3OT8A 5JFXA 4BZNA 1OIQA 5JMSA 4KS8A 1XMMA 2QOQA 3S3IA 1PJKA 2C0OA 4R77A 4YSJA 4H36A 3KXGA 4NM3A 1PYXA 3R73A 4O27B 3NUYA 3CGFA 2IZRA 3ALOA 2WB8A 3FMHA 4FYNA 1ZWSA 2AUHA 3SDJA 3A8XA 3E93A 3ORMA 4NCTC 5HOAA 1K2PA 3FHRA 5J8IA 4UMTA 4DEBA 4HVGA 4II5A 4L7SA 1WBTA 3TZ8A 1F0QA 3QTSA 4BKZA 2W5BA 3NMUF 4IM2A 4ZY4A 4EOMA 3PJ1A 5D11A 5IUGA 4UYAA 3ZSGA 3GC0A 1H1QA 2UVYA 2W5AA 3V04A 2YISA 4MBLA 4DDIA 3F3ZA 3FMLA 5E8XA 1BI8A 3NIEA 5IA0A 3FLYA 3R1YA 5EHYA 3GC8A 4DEIA 4CG9A 4GJ3A 3QRKA 2PWLA 4OTWA 4XBUA 4LV7A 3AD6A 3PPKA 4FT0A 5EQEA 5AUWA 2VTNA 4IX4A 3FWQA 3JPVA 5DYJA 3BZ3A 3EQIA 4GYGA 4R3RA 5HICA 4FT7A 3TG1A 4HGLA 4EZ5A 2WMVA 3OWLA 5CU6A 4D2WA 4I6HA 4BCPA 5M4FA 4LRJA 3BHVA 3ODZX 3EQHA 2JGZA 4GH2A 2JEDA 3IO7A 4UZHA 4XH6A 3VAPA 1IG1A 5TE0A 1SVEA 2F49A 2JBOA 2XBJA 4YHTA 3E64A 1PXIA 3EFJA 4YC8A 3F7WA 2W9FB 4EOQA 3CQWA 3I7CA 2V5QA 4FICA 5JZJA 1ZMWA 2XNEA 3POOA 4F9AA 3OMVA 4BCQA 1J7IA 5CVGA 3W0SA 1Q5KA 2I0VA 3MPMA 1GNGA 2BZJA 5EK7A 5HE2A 4DF3A 4MH7A 5HO7A 1ZARA 1PMNA 4FSTA 3R8VA 4CXAA 4C4GA 4K6ZA 2BKKA 4FKQA 2IZTA 4IAYA 4QMNA 4WRGA 4X2FA 4E5AX 5AA8A 3E8NA 2XJ1A 4FKPA 3C1XA 5CQWA 2YABA 4AWIA 3N4TA 1OGUA 2XBAA 3GCVA 3LOKA 3DJ5A 5AP4A 4DFLA 4DCAA 2C0TA 2RKUA 3BBWA 3IGOA 4S2ZA 5E8ZA 4EK5A 3D7TA 4C62A 3OC1A 3Q2JA 2IVSA 2V0DA 3LXPA 3KF4A 4YPDA 3EB0A 5GZ9A 4UX9A 2JKQA 3ID6C 2W1IA 4EOPA 3PIXA 2OXDA 1XJDA 4EUTA 4PPAA 4FNWA 3VULA 3HMMA 3TNWA 4L45A 2E9VA 1JNKA 4IAKA 2NYAA 4DTKA 4FTAA 5LOHA 1GAGA 5LVOA 2JDRA 3KN6A 4QDVA 3QZHA 2YERA 2QCSA 4QP4A 5AAGA 4I23A 2XCHA 3MYGA 4BICA 3Q5IA 2YJSA 4DHZA 3LMIA 3BCEA 5F20A 3BU5A 4M7IA 5H2UA 4EKKA 2X8DA 4QQCA 2WPAA 2BMCA 1M17A 2HIWA 4CLJA 3O51A 3C0HA 1VZOA 3MFRA 4HVIA 4AT5A 1Z57A 4CTBA 2ZB1A 4QEBA 3MJ1A 4ACDA 4YMJA 4D4YA 2R3QA 3PXYA 3G6GA 1ATPE 3V5PA 3JR1A 1T46A 3O50A 3TTIA 3DAEA 5F95A 4YNEA 1YI6A 4JL9A 5CXHA 1ZOHA 3F3WA 4AQCA 5L6PA 4U80A 3WILA 5HU9A 1GOLA 3KRRA 5IF1A 3CBLA 2PL0A 4V05A 3PP1A 3KB7A 4F0GA 2VTSA 5CEPA 2X9FA 1OECA 3R7IA 2JC6A 3OTVA 4PX6A 2V22A 3C4XA 2QOLA 3TV7A 3V6SA 2X7OA 5L4QA 4JDIA 4M3QA 4PTGA 3MVLA 5DGZA 3MH2A 3QL8A 2XNNA 4YBJA 2RFNA 4IFCA 3QCQA 3TZ7A 1H24A 4IB0A 1NVSA 3AMBA 4ZEGA 4RWIA 5L6WL 1Y8YA 2UW6A 3Q53A 1SZMA 5HO8A 4AW0A 4JDJA 2DYLA 2VX0A 2WAJA 4YGAA 3GC9A 1GZKA 3UIXA 4D5KA 3G33A 1DI9A 4QQJA 3GNIB 5AUUA 5AUZA 3R9OA 1V0BA 3EN9A 4AOJA 5FDPA 3ZOSA 3DK3A 3MB7A 2HK5A 4LMUA 4AN3A 4ZSAA 4BHZA 4KIPA 4YBKA 4G3DA 4Z9LA 4FUYA 1V0OA 4XBRA 4DGOA 1FGIA 1JSUA 3DBEA 2YWVA 3D5XA 2QO2A 1YKRA 4XV9A 2F2CB 3OY3A 3SQQA 2PZRA 4F6SA 5HLWA 2CKQA 3C0GA 3VJOA 2RG5A 5FDXA 5AFVA 5EDQA 3NWWA 5D9HA 2GTMA 2ONLA 4IDTA 4EH5A 3BHYA 4PNKA 3KRWA 2XANA 2VWBA 4YTIA 2IF8A 2GNHA 4RGJA 3R04A 2CDZA 2UZOA 3D15A 3GXLA 4CV8A 2XS0A 1UU7A 4I0SA 4UB7A 5IISA 4JX7A 4Z7GA 4AXEA 3IK3A 4W9WA 3D14A 4W4XA 1YI4A 4CT2A 3B2TA 5K4JA 4JXFA 3ANQA 5JSMA 5DR9A 4UBAA 2B1PA 3DK7A 3HGKA 3ORZA 3TIYA 2WMRA 4YLKA 1OL5A 5AAEA 4W4WA 3BLRA 3P7BA 3AC5A 4LUEA 3KREA 2IW6A 3DKCA 4ZTNA 4F64A 1HCKA 2VTPA 1PRYA 1ZOEA 2BILB 1QPJA 4CRSA 1JKKA 4L9IA 4HVHA 5I9UA 4RIOA 3BU6A 3RPVA 2XM8A 2W06A 4DFBA 3SW7A 2VTQA 5C27A 3ZS5A 4I3ZA 5HCXA 3GCPA 3OD6X 2G01A 5IUHA 2X2LA 3UNJA 2W99B 4O4FA 4FSWA 5HE3A 1YOJA 2GHMA 2H6DA 3B8QA 3KA0A 4O6EA 5AADA 3UTOA 1ZYSA 4BC6A 3DNDA 5HD4A 4U40A 2C3LA 3RPSA 4K33A 3OBGA 2BDJA 1PXMA 3VS0A 5EDRA 3LFBA 4CFXA 4ZTHA 2WQMA 3KXZA 2GNLA 5LMKC 4O96A 2JKKA 3DTWA 4FOBA 4L46A 1H0WA 4RFYA 3FYJX 3G90X 3UDBA 4MKCA 4RJ3A 4RMZA 3ACJA 4XJ0A 1L3RE 3DAKA 1JKSA 3F5GA 3HMNA 2BRMA 5ACBC 2OFVA 4GKHA 5ANDA 2ITNA 3UOLA 2HW7A 4JMQA 5JRSA 3W32A 1KV1A 5CEMA 3R7EA 4EHVA 2OI4X 3FMDA 2JAVA 4WBBB 4Z3VA 2PMIA 5CVHA 2R3KA 3E7VA 3W1FA 3I0QA 2QC6A 2QVSE 4W8DA 3FZTA 4DT8A 1A06A 2XAOA 4A4OA 2YIWA 2QU5A 3UDSA 4QTAA 2XJ0A 1M2RA 3PE2A 3OW4A 3TV4A 2QR7A 5K9IA 3RAHA 4QYGA 3OP5A 1I44A 3DXQA 5IQHA 3KMWA 4YO6A 1STCE 4USFA 5ICPA 4I0RA 5EHLA 3EL8A 3W0RA 4JBQA 1BMKA 3EH9A 5DVRA 4O38A 4EEVA 2YM5A 2QONA 1R0EA 3L9LA 3NYOA 3QC9A 4FIJA 4OTRA 1PMVA 5DLSA 4A9UA 3RJCA 3VS1A 2VZ6A 4JAIA 5CT0A 1M14A 3T9TA 1LEWA 3DK6A 2X7FA 3LAUA 1ZY5A 3JYAA 3KRLA 4JIKA 2ZM3A 3TTJA 3VUDA 5K4IA 2QOKA 2VTOA 5HTCA 2PVLA 4H3PA 2JFMA 4QRCA 4FC0A 3UZPA 3SG9A 3ET7A 2OJJA 3IS5A 3MDYA 1UNGA 4AE6A 4EH9A 1ST0A 4O4CA 4F09A 5HBHA 5FGKA 3SC1A 4BDCA 2IN6A 3CCNA 3COKA 2CNUA 5CSVA 2BAQA 3A7IA 4PP9A 3C13A 3DDPA 3F3TA 4BWPA 4LOPA 1BUHA 4QQTA 2IG7A 1PKGA 3K54A 4I4EA 4DYMA 3MIYA 2YM7A 3VS4A 1APME 4YJUA 4HW7A 3QQFA 1UV5A 2OSCA 3VF9A 4AG8A 3QX2A 3BYSA 4ALVA 2Y6OA 2X7GA 5LCKA 4DEAA 5JZNA 5KBQA 2VTAA 2HENA 4KD1A 3MN3A 2HXQA 3A7JA 4R3PA 4YHFA 3MS9A 4JAJA 3Q4UA 5AR3A 3KCKA 2VX3A 4JR7A 4ZXTA 3LFFA 4RVTA 3U87A 4RT7A 3TKUA 2B9IA 1V0PA 4A06A 2WXVA 4G5PA 5CF8A 3MFTA 5T68A 4I22A 3TZMA 3S95A 4XG6A 3OWPA 5EYMA 4BYIA 4E6AA 3RMFA 1H4LA 4HYIA 4WG3A 3MFSA 2BPMA 4B8LA 1J7UA 4OTDA 3OFMA 4F70A 2ITTA 2DS1A 3TM0A 2F4JA 4YZ9A 4AFJA 4YJVA 1MRVA 4EOLA 4IAZA 4BDFA 4EWHA 5M4IA 2V7AA 2H9VA 3ANRA 4PY1A 1W2FA 4QP9A 2R9SA 4YZNA 2B0QA 4QMYA 4PL5A 2ZV9A 3NUPA 3VF8A 5J79A 4H58A 4GIIA 4MK0A 4U41A 2BUJA 4Y46A 4CFWA 4AA0A 2BIYA 4AXCA 3AG9A 4O7YA 4O83A 3LZBA 1G5SA 4OTHA 3UOJA 2PVJA 5IEXA 4R5YA 2R5TA 4IB5A 4EHZA 3HL7A 3RBWA 3AT3A 3MH1A 3QTXA 3P1AA 5DBXA 2FSMX 3K3IA 5KX8A 4AGCA 2EB2A 3LM0A 4I6QA 4FEWA 4RA5A 4HNIA 3AGLA 4GT5A 2ITVA 1SNXA 3PFQA 3EQPA 4S30A 4AZEA 4QMSA 1WBNA 3AT4A 1KE9A 3G9NA 3O8TA 5ETIA 4D4RA 4ACCA 3G6HA 4OTGA 3VVHA 4MEDA 4F1OA 5LVLA 4B9DA 5JFWA 2XKEA 1KE8A 4IB1A 2WTWA 4TL0A 3FUPA 1OMWA 2PUUA 4IXPA 4O0TA 4J8NA 2CNQA 4GK4A 2GMXA 2P4IA 3NS9A 4D9TA 3UODA 5GZAA 4IADA 5L8JA