2XCKA

Crystal structure of pdk1 in complex with a pyrazoloquinazoline inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
284
structure length
275
Chain Sequence
KKRPEDFKFGKILGEGSFSTTVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSNFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
publication title Structure-Based Optimization of Potent Pdk1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 275
sequence length 284
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xckA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xckA01
4OBQA 2W4JA 4FKVA 4GG7A 5AUYA 4WD5A 5BVKA 3HV6A 1KV2A 2Y4IC 5HCXA 5EHOA 1O6YA 4IFCA 3KY2A 3P5KA 2GS6A 1YI3A 2X6EA 2GTMA 2R64A 2V7OA 3HV3A 4KKHA 5C8KA 3SC1A 3M42A 4LL5A 1S9JA 2ZOQA 4IWDA 3RGFA 4D9TA 1Q8WA 2YM6A 1H0VA 4BCPA 4ASDA 2JBOA 5DA3A 5A4EA 1ATPE 1URWA 3Q4TA 3VNTA 3UQCA 4ALWA 2OZOA 4J52A 4JX3A 4FEXA 3GUBA 3RALA 4LOQA 4AN9A 4AW5A 1H0WA 2UW9A 4C2WA 3FHIA 4LM5A 5EYDA 4JOAA 2O2UA 5AADA 4CGAA 3E8EA 2ERZE 1TKIA 4K9YA 1PXIA 4L43A 1O9UA 4B99A 3PPKA 4DEAA 5EM5A 3W1FA 4H3BA 4KRCA 2RKUA 5HVJA 1WBTA 1OGUA 2WQBA 1XBCA 3R1NA 1F5QA 4NZWB 1XBAA 2GNHA 3MY1A 3FC2A 3FL4A 4NJDA 3OS3A 5J9LA 3NDMA 4YC3A 3TL8A 2F7XE 2YM8A 4W4YA 3SXFA 4F6WA 4QMSA 2WTWA 4QTEA 3K5UA 3L8XA 3R7GA 2V0DA 2OFVA 3AGMA 4RJ6A 4CT2A 2BIKB 3TJCA 5AAGA 1JKKA 1GIIA 3RHKA 3MBLA 4GKIA 3CTJA 1YI4A 2GFSA 4M69A 3AD6A 5M44A 4Z9LA 1CKIA 3S2PA 2VV9A 3GFEA 3A7GA 3F2RA 5GIPE 2WQNA 3R7UA 4C4GA 2QLQA 2Z7RA 4IW0A 1Q8ZA 4DE4A 2C3KA 4GK2A 4G9CA 3ZLWA 5FP5A 3DT1A 4PMMA 1UA2A 3U9CA 3RCDA 5CXZA 3CSVA 3LOKA 4R77A 4ZS4A 3QUEA 5I9UA 3C0GA 3PXFA 4BI1A 4YSMA 3FLNC 5IH5A 4L00A 4B9DA 4JAIA 4FVQA 3MVHA 4GW8A 5LWNA 3CTQA 4QYEA 5FTOA 3I6UA 4FTKA 1YW2A 3JPVA 5FP6A 3ENHA 5AR7A 5A4QA 4WRGA 2Q0NA 3OF0A 4A07A 4CMUA 4PX6A 3FZ1A 4QTAA 3DV3A 3BYSA 1FINA 2DUVA 4F0FA 4JJRA 3I5ZA 3QC4A 3R1QA 3SVVA 4YC6A 3V6SA 2QU5A 4HGEA 4KS7A 2ZM4A 3K54A 1NA7A 4IZ5A 3R28A 1WVXA 4QP7A 5KX8A 2XF0A 2XK8A 4I0TA 4IVDA 4F0GA 3DFAA 4M68A 1CDKA 3Q9ZA 4XYFA 1JAMA 2XEYA 5TT7A 2UZVA 4K6ZA 4O84A 4ZJIA 4P4CA 4RA4A 3BQRA 4C4IA 2PZIA 3V04A 5BYZA 1MQBA 1U46A 2V5QA 4RQVA 3QLGA 3UOKA 4ANBA 5J7HA 3WZEA 2GQGA 5F94A 5JMSA 1OMWA 2JGZA 4QTCA 4EZ7A 4DEDA 5LXMA 2Y0AA 4BZNA 4KKEA 4BDJA 3EQCA 5IQDA 1JSVA 1YXVA 3FJQE 3FZRA 3LXPA 4FF8A 5H2UA 5C01A 3UC4A 4F6UA 4XNEA 3FLWA 1OL1A 5BUEA 3RAHA 3NZ0A 5EQPA 3EKNA 4LRMA 4AOJA 4ZS0A 2QC6A 3CD3A 3EIDA 3QD0A 4CFMA 3E7VA 3QYWA 2BDFA 4YR8A 2XS0A 3LPBA 3QQHA 1JSTA 5ANJA 4N4SA 4Q2AA 4JX7A 2ITVA 3CKWA 3TV6A 3ANQA 4U3ZA 2XCHA 2ERKA 4RX9A 4FI1A 4LUDA 3AD4A 3KK9A 2WOTA 4IE9A 3P86A 5D7AA 5J8IA 4IMYA 1H1PA 3AC5A 4RWJA 4HGSA 3DNDA 3NIZA 4B0GA 4EWHA 5LMKA 3S1HA 2YIYA 3QKMA 1L8TA 5HNGA 4XOZA 4AE6A 4N0SA 4ZSAA 3LMIA 4LI5A 3WILA 3G6GA 4C4EA 1A9UA 4YGAA 1H26A 3HMIA 2H96A 4DGNA 4QPMA 2W1FA 1OITA 3DK3A 2HXLA 4C2VA 3Q4UA 3N51A 1E1VA 3D94A 5KUPA 5ETIA 3ORLA 3UZRA 3BLRA 3BGPA 4YLJA 3C13A 1W83A 3QWJA 1JBPE 4MNEB 4CVAA 2C1AA 4IC7A 4YPSA 3TV7A 3FXXA 4EOKA 3FYKX 4EJ7A 4O7RA 5E92A 1YWVA 4IQ6A 1XH7A 3VWAA 5C26A 3ZMMA 3NUAA 2BRGA 3FXZA 3LXNA 4GKHA 3HMPA 3H4JA 5JQ5A 5J1VA 4AE9A 2OICA 3PE2A 3QA8A 4XV1A 3UGCA 3W33A 3U6IA 5L2SA 3C4ZA 1MRVA 4XMOA 4BDAA 2W4OA 4F9BA 4RX8A 1VJYA 2EB3A 2OFUA 1E1XA 3PG3A 3QALE 4FTMA 1DAWA 4I0SA 4Y5HA 2X81A 2J9MA 4RJ5A 4RFZA 2XIYA 5HOAA 3MJ1A 4Y83A 3D7TA 3VQHA 1U54B 3THBA 5IH6A 3QZHA 1ZMWA 5EM7A 4EH8A 2X7GA 2JDVA 2W5HA 4ZSEA 3IO7A 1Q3WA 5J5TA 1KWPA 4YTIA 4BDHA 5LMKC 3R0TA 3RWPA 2B52A 3FMHA 5HESA 3KXXA 3BHHA 2GDOA 4PL5A 4QMWA 3HRBA 1YHSA 4U9AA 3LCDA 4FG8A 3FPQA 3F6XA 5AUZA 4G3CA 4EZ5A 4ANLA 2R9SA 4FTLA 4YTFA 3I1AA 1VYZA 4KBKA 3GXLA 5M56A 4APCA 3UZTA 2HWOA 4FTTA 4RLLA 2JC6A 2WTDA 2G2HA 4RJ4A 2PVMA 4KKGA 2BRHA 5GJFA 2A19B 4FKUA 4X3FB 4RC2A 2JAVA 3Q3BA 2VTRA 5IZFA 4LMUA 5GHVA 3L1SA 4LOOA 3QXPA 1BX6A 3BIZA 5AV4A 3UQGA 1KE7A 4HCTA 4O7WA 3DNEA 3I79A 1IA9A 1GJOA 3PA5A 2BALA 3ZM4A 4I4EA 4LGGA 2J2IB 5AR5A 3R22A 3DJ5A 4FV0A 5E8UA 5E8YA 4NUSA 1RQQA 3R9HA 3CLYA 2CN8A 4LOPA 4BDBA 5H3QA 3HMNA 4H58A 4G3EA 2WQOA 3QD4A 3VF9A 4S32A 4F99A 3IW7A 1UV5A 4QP2A 4B4LA 5FM2A 4C3FA 4J95A 3MW1A 3G0EA 4JBOA 4AU8A 4FKLA 5KMIA 3F3TA 4XEYA 1BLXA 2DS1A 2Z7QA 1GNGA 3UP2A 1UKIA 4KUJA 4RPVA 2VNWA 4QP6A 2DYLA 1PF8A 3ITZA 3E3BX 4A4OA 4ERWA 1FBNA 3DLSA 1KV1A 2XYUA 4HYSA 4X3FC 4PL3A 1Q62A 3FAAA 1PXPA 2PVHA 2B54A 5IKWA 2B9HA 1ZOEA 2XK9A 3EN4A 2QLUA 5E9EA 3KC3A 3NX8A 1LUFA 3BHUA 1Y6AA 2C0IA 5EW9A 5A6NA 5I3RA 3KRLA 4FV2A 3QAME 5I9ZA 3MY0A 4CT1A 2PVYA 2GS2A 2J50A 3ZS5A 3CBLA 2I0EA 2PU8A 1I09A 1H1WA 5EI6A 4EH6A 4AA0A 1NXKA 5M06A 4EKKA 2PTKA 1M2RA 4L45A 2C5OA 3RPYA 3R02A 2V7AA 5HX8A 2I7QA 2HZNA 4HYUA 1Q41A 3UMXA 4QPAA 1IAHA 1M14A 4O27B 4DG3E 4K11A 4XG6A 5CAVA 4OUCA 3W8QA 2WKMA 4BCNA 2RFSA 5L6WL 4RZVA 3DA6A 5L8KA 5CSPA 3FKLA 2C6EA 4YLLA 2BZJA 3UIUA 2VWZA 3ET7A 3IDPA 1UU8A 3OOGA 3QKLA 4CYJA 4WT6A 5DNRA 4DLIA 4O7YA 3EN7A 1Q5KA 2QCSA 4F08A 2WTKB 1Y8GA 1WAKA 3CGOA 4D5HA 4XJ0A 4CFXA 2CKOA 3NLBA 3TM0A 3CS9A 4L67A 4FT3A 3RAIA 4TRLA 3A2CA 2IVTA 3Q2MA 2IVSA 2XEZA 3R1SA 3SOAA 3BYMA 2XNGA 2YDJA 2O3PA 3F88A 4BFMA 4FGRA 4LG4A 4M0YA 3MFUA 4NM0A 1OKZA 4HVHA 3BX5A 3Q32A 3DBCA 3EN6A 4DH1A 5C03A 4CZTA 4H36A 4E7WA 3BELA 2GMXA 3QTIA 5AP0A 3BWFA 4BCJA 2RL5A 4BWPA 4C62A 4O6LA 3RP9A 5HG7A 3NUXA 4MWHA 5FGKA 4FTQA 3ALOA 1W98A 2B9JA 4GK4A 2JFLA 5FQDC 1IAJA 2HW7A 4CG8A 1A06A 4FVRA 4FZDB 4CLIA 5CZIA 1ZAOA 4E8AA 5DFPA 3UIBA 2G2IA 1P5EA 3PLSA 3ZO3A 3LCKA 4RSSA 4YJUA 3UDBA 2H9VA 2WTKC 4GVAA 2GFCA 3FDNA 4ASZA 1PXJA 3PIXA 3WF6A 3BPRA 4O0TA 4LRJA 1TVOA 4DGMA 5CQWA 4C59A 4ITIA 5CVFA 3JY0A 2VWIA 4BTFA 3PJ1A 2BFYA 2UW4A 3UBDA 1FOTA 3OD6X 5M4IA 3V51A 4M66A 5E8XA 5DBXA 2QOIA 3CKXA 5HVYA 4FK3A 4C57A 4JR3A 5GNKA 2Z7SA 3ZC6A 2ZV8A 4MXCA 4F7SA 4KB8A 2ZM3A 4AA5A 1WFCA 3QKKA 5GZ8A 5M51A 5C8NA 3IK3A 5J87A 3CQEA 3BCEA 3TZ9A 2WELA 4UWCA 4FTRA 2Z02A 3S4QA 3G9LX 3NS9A 4L7FA 4CRLA 3GGFA 2CNQA 3EQRA 4I6QA 4L6QA 4FIGA 5JKGA 4MNEA 4GFMA 2LAVA 5HTCA 4DG0E 1J7LA 4YO6A 4FE2A 3IECA 2YDIA 1WCCA 4MBLA 5CSXA 2WGJA 1J7UA 2YIWA 3Q96A 2C6KA 2W1GA 1M2QA 4H1JA 4LFIA 3ZXTA 4C3PA 2J0KA 1H1RA 3TDWA 4G6NA 4G5PA 3TWJA 5HD7A 1PXLA 1ZYSA 4KABA 3KF4A 2PVJA 4BVUA 3OEZA 1L3RE 3R7IA 4ONAA 1U54A 1XH5A 4YHFA 4RA5A 2AYPA 4JG8A 1RW8A 1ZWSA 1S9IA 2PZYA 5BMSA 1WBSA 2JDSA 2YWVA 2OW3A 2R7IA 4MD9E 4W8DA 5HIBA 1KE5A 5T3QA 2C68A 5CSWA 4BDDA 1URCA 4XCUA 3RK9A 3QCQA 2YITA 3AT2A 3U6HA 4CRSA 1H25A 4D2WA 3LCTA 3IDBA 3NYNA 3OEFX 3OHTA 4XLIA 5AJQA 5HX6A 4KIQA 1H1QA 1OBGA 5BYLA 1VEBA 4FV4A 5JH6A 4IWQA 4U40A 5IQGA 5GIOE 3NCZA 1OKVA 2ZV9A 4X3FA 4USDA 4I5MA 5HE0A 4EQCA 4I21A 1OL2A 3L8SA 4APPA 2KULA 4E4NA 2ITWA 2F7ZE 4EHVA 4FA2A 2CSNA 4ZSGA 2VGOA 1MP8A 4ACHA 5AX3A 2LGCA 4FVPA 1PW2A 3JR1A 3EMGA 5CVHA 2XIRA 5CASA 3A8XA 2ITNA 4FTCA 5DT0A 5K4IA 4FSRA 5L2IA 4BKJA 5CEMA 3F5UA 2XJ2A 1BKXA 3WZUA 4ANQA 2XYNA 3QC9A 2ITUA 3PXYA 1Q8TA 3KREA 2BRNA 3NRMA 3E8DA 5AV2A 4M3QA 3ROCA 2YM4A 5E8WA 2J0MB 2JEDA 4EHZA 3FMLA 5EI2A 3VBXA 1KE8A 2OBJA 3TI1A 3UYSA 3JS2A 2RGPA 3FZSA 3NWWA 5HLPA 3G5DA 1GY3A 4KBCA 4RFMA 4AA4A 3NVKI 2J6MA 4TYHB 4WNPA 5K5NA 2VU3A 2W5AA 4HGTA 3ZYAA 3T8OA 2BRMA 3FWQA 4M84A 4EEVA 5LOHA 3FLSA 5EOBA 5CF8A 3HP5A 5LCKA 4I1ZA 5LVPA 4CMTA 5FXRA 4AW2A 3B8RA 4AOIA 3FQEA 4QO9A 4O96A 3TN8A 3D15A 3ULZA 4NW5A 3HMMA 4OAVB 5M08A 2XKDA 3VUTA 3EQHA 3BEAA 1GIHA 5BVOA 1Q99A 4CXAA 2EB2A 3BE2A 5D12A 3PY1A 3V5TA 1QPJA 4U0IA 3DY7A 5BNJA 2XM8A 3MVJA 5DWRA 3KCKA 2UW0A 3NW7A 4PUZA 2IW6A 4GT5A 4EK6A 2PUUA 3PPZA 3GQIA 3E8CA 4HCVA 2O0UA 4X2FA 4IHPA 4XG3A 5EI8A 3RVGA 4BDGA 2GSFA 1R0PA 2A2AA 2QO9A 5CWZA 5IA0A 2I1MA 5K5XA 4BIEA 3R71A 5FBNC 4MAOA 3UE4A 4I41A 1YRPA 3DKFA 5CY3A 3VQUA 4YZBA 2ITZA 4ALVA 4QYHA 4UZHA 2GQSA 5E4HA 2BZIB 5B2LA 4NYEA 5D10A 3KRXA 2C30A 3V5JA 4D28A 3UC3A 1QMZA 3FMDA 3Q52A 5CNNA 3QTZA 4GUBA 2WMTA 2I0YA 4LGDA 1BYGA 3D83A 4WHZA 4EL9A 3SAYA 4DT9A 1U5QA 3I81A 2ACXA 3QTXA 4XV3A 4IDTA 3PVBA 3OROA 4FEVA 3ZSHA 4L3LA 4BHZA 3AOXA 4TN6A 2UVYA 1OL5A 3KRWA 3P23A 4BCOA 3I0OA 3EFKA 4A7CA 5HD4A 4TYEA 3HX4A 1MQ4A 3CJFA 4G17A 4RZWA 2G1TA 5EG3A 2BCJA 2NRYA 4NTTA 5JRSA 3EKKA 3RINA 4M8TA 4FSTA 3AGLA 1KUTA 3Q5IA 1A48A 4IZYA 3LFEA 5CAUA 4D2RA 3NSZA 5BPYA 4RJ7A 5L8JA 4ANNA 4FV7A 4IB1A 5HG8A 4CEGA 2IO6A 2RF9A 2IZRA 2W96B 4QMMA 4RT7A 4C33A 4DFUA 3AC1A 4YC8A 4R1VA 1YKRA 2X1NA 4IZAA 3TZ7A 3LCSA 4RLKA 4O0RA 3FLQA 2PE1A 3OT3A 3GC0A 3L8PA 3BBWA 2GHMA 1RE8A 2IZSA 3OWKA 4M12A 5F4NA 1OVEA 4WSQA 4F7LA 5EK7A 3PXKA 3QXOA 3NUYA 2CKPA 3FMJA 1TQIA 3HZTA 5F9EA 2XNOA 3GC8A 3QYZA 4U97A 2BROA 2VWBA 4UXLA 4JNWA 4IB0A 2I40A 4JDHA 3QCSA 3REPA 3ANRA 3MIYA 2WU6A 4BF2A 3MTLA 5EKNA 4RBLA 3S3IA 5DVRA 3VBYA 3R9RA 5DIAA 4TPTA 4LQMA 5M4FA 3TNPC 3H0YA 2UZDA 3MTFA 1DAYA 2BRBA 4DYMA 5ETCA 3EB0A 1PY5A 3PA4A 4J97A 3DBQA 3O23A 3EQIA 2J0JA 4FL1A 2BZHB 1ZZLA 3G6HA 4RWLA 5AP7A 4FSZA 4XBUA 4RJ3A 4QQTA 4D5KA 2P33A 2C0TA 3LLAA 4HVSA 3A7IA 3R8LA 2GS7A 2QG7A 3MH1A 2HELA 2FSTX 2P2IA 4TKSA 3GU6A 4ZY6A 2Y4IB 5C27A 4CKIA 4DH8A 5J79A 4G31A 2JIIA 3PYYA 1PKGA 5K0KA 5A4LA 4IDVA 2ZVAA 4M0ZA 2XIXA 4C4JA 3VVHA 5FDPA 4L3PA 2UZLA 2GTNA 3RKBA 3TCPA 4X6QC 4BCQA 4USFA 2ZV2A 4L68A 4M67A 4TNBA 3ETAA 3R7EA 3VULA 3VC4A 4TL0A 3DXPA 4N70A 2CGWA 3VW8A 4FNXA 4E93A 4ANOA 3RPRA 3CPCA 3KF7A 3U4UA 3AG9A 4MBIA 4HJOA 3V5PA 4D2PA 4OAUC 4AP7A 4EHGA 1U59A 3MGYA 3ACKA 3HKOA 5EW3A 4IVCA 3UTOA 2WMSA 3LAUA 4FOBA 4YNEA 1U4DA 4AZWA 1NVRA 4C35A 4DEBA 5KKRB 2UW7A 2YABA 2CNVA 4FV8A 4GIIA 4FV5A 4JDKA 3FMMA 4NSTA 4UEUA 1H8FA 5D41A 1U5RA 3IONA 4BCIA 4Z7HA 2GNJA 4J7BA 5BVDA 4JDJA 3ENMA 3A4OX 3NNVA 3TG1A 3S0OA 3DZQA 3D5VA 1SVGA 5AX9A 5CEOA 1XR1A 3M11A 4NWMA 5E8ZA 3BLQA 4FTIA 2JDRA 3NUNA 4CMOA 4ZOGA 2UZOA 3HRFA 4DF3A 3ZEWA 4BI2A 3JXWA 3O8TA 2ITXA 3TKHA 4HYIA 4L9IA 1OUYA 2B4SB 2CLQA 4BWXA 4YUQA 4O86A 3BWJA 3RWQA 3DAKA 4UYAA 3PSCA 4PMTA 5AV3A 1G3NA 2GHGA 1PYEA 3QRKA 4C36A 3S00A 3DK6A 2BVAA 4G5JA 3EJ1A 1P2AA 3QWKA 1UNHA 5IU2A 5ANDA 4PF4A 2B7AA 4I3ZA 5AA9A 4BCHA 3HL7A 2JIUA 3MPAA 4NKSA 5H8EA 3VW6A 4E4XA 3CY3A 3QX4A 5FDXA 3C50A 4FGBA 4PP7A 3FSFA 3D2IA 4ZLZA 1H00A 4R8QA 4C3RA 5KKRC 2PZRA 2ITOA 4DFLA 3QQKA 4X2JA 4F9YA 1O6LA 2OXDA 2QQ7A 3ODYX 4TYHA 3CEKA 4FV1A 2QO2A 4FIIA 3W2RA 4QD6A 3C5UA 2VZ6A 4B8LA 2OLCA 3QTQA 3NYXA 4WA9A 4G16A 5GJDA 3WZDA 4AXAA 4O7LA 2VWVA 5IA5A 3IOPA 5C4LA 3BU3A 2QOBA 2YAKA 3DAJA 4QYYA 4AZSA 2VAGA 2X0GA 3OFMA 4DFXE 3MH2A 3TTJA 2XNBA 3ZRKA 3RBWA 5CANA 1KOAA 2YIXA 3AT3A 3QU0A 3OOMA 4ITHA 5CX9A 2OJJA 3MY5A 1PMVA 2C6IA 3N4UA 3FY0A 3LFDA 5AIKA 4ENXA 3F5PA 3GU5A 4OTHA 1F3MC 3KVXA 4O6EA 4FNZA 5DR6A 5HE1A 3COIA 2AC3A 4F9AA 3VUIA 4RIOA 4ZJVA 4PPAA 5DYJA 2C6OA 3R73A 2R3LA 4S2ZA 3PVWA 4O0VA 1J3HA 1PYXA 2QONA 4GSBA 4OTFA 5E1EA 4A4XA 3A7FA 4E5BA 3ZZEA 2VX1A 2GQRA 1UU7A 3V5WA 1H28A 1XH8A 2HY0A 3Q5ZA 2YWPA 3QBNA 3QGYA 4O0YA 1ZY5A 3NIEA 3U54A 3H9RA 4AOTA 4QYGA 2B9IA 4IBMA 4DITA 2HENA 4AAAA 1JWHA 4B7TA 3DDPA 2BUJA 3TTIA 3ZBXA 4MF1A 4FZ6A 3E88A 3LQ8A 4KRDA 5AUXA 2WTIA 4PNIA 4BDFA 3I4BA 1XBBA 3A7JA 1M2PA 2X39A 4NM5A 3PXRA 4FKQA 4KWPA 2W1IA 4NU1A 5EFQA 4ZTNA 3W10A 3SA0A 4AS0A 5DE2A 4MXOA 2HIWA 2I6LA 3EN5A 3FZTA 5LMBA 3GCSA 1RJBA 5HBJA 2DQ7X 4IAKA 4O22A 1QCFA 5CEIA 4BDKA 2IPXA 4PY1A 4A9SA 4K0YA 4DGGA 3N4VA 3E92A 4ZTHA 4PPBA 2WMBA 1FVTA 1ERKA 5AP1A 3DOGA 2GPHA 3W2QA 5B7VA 1XJDA 2J0LA 2YCFA 3ZZWA 3O51A 2WMRA 5AMNA 1OIQA 3F5GA 1DS5A 5M09A 1AGWA 4QMUA 4D4SA 2I0HA 3KCFA 3CP9A 3FBVA 4IAYA 3C0IA 4PPCA 4S31A 3QQLA 2BHHA 1I44A 5EKOA 5JRQA 4PRJA 5HZNA 2ZB1A 2FSMX 2WIPA 3WOWA 4ACDA 4Y73A 3SGCA 3L9NA 4MNFA 4CTCA 3EHAA 3D5WA 1EH4A 3CGFA 2YDKA 3C4FA 4QMVA 4NCTA 2JKKA 1V1KA 2YCQA 5JSMA 3OY3A 4RQKA 4FL2A 3OCBA 4CCBA 1M52A 4G6LA 4MXYA 4IWPA 4W9XA 5D9HA 1H07A 4AX8A 2X9FA 4C7TA 1P14A 2FSOX 2WNTA 2SRCA 2P55A 3VAPA 2JKOA 3DTWA 2F4JA 4DCEA 2EWAA 3IKAA 3PY0A 4AW1A 3VJOA 4HOKA 3ZFXA 3R8VA 3KFAA 2C5NA 4I6BA 3T9IA 3UYTA 1Q61A 4WG4A 4O0XA 5A46A 3GBZA 1B6CB 2IN6A 1YXUA 1PJKA 5HO8A 2VTPA 4Y72A 4PL4A 5JN2A 3ZFMA 2VUWA 4NM7A 2ITQA 3C4CA 3W8LA 2C5XA 4QP8A 3ZHPC 2PUPA 1IRKA 4M7IA 1FMKA 2WPAA 4NTSA 3PP1A 4UBAA 3V5QA 5KBRA 4WBOA 4UALA 4CFFA 4FODA 2PUNA 5BVNA 3PLAE 3OMVA 3E62A 3R8PA 2HZ0A 2Y6OA 3UVRA 5HTBA 4XV2A 3U8WA 1LEZA 2GCDA 3LVPA 4F0IA 4IM3A 2WTCA 3TIZA 3FEGA 3II5A 3UOHA 2A27A 2W9ZB 4IJ9A 5AP6A 5IDNA 2W1DA 3AMYA 4J71A 2OK1A 4ZY5A 4CQEA 5AUVA 3PJ2A 2ONLC 4BCGA 5HO6A 1XH4A 3F3WA 3O17A 3EQFA 3OZ6A 3QD2B 4QNAA 2XZSA 2R3PA 2KTYA 5LWMA 5DRBA 4KIOA 2FUMA 5AA8A 5FEDA 4IM0A 4QP3A 1R0EA 4DH7A 3F66A 4QPSA 4R1YA 4YJNA 4F70A 3PG1A 4PTGA 3ZO4A 3UOJA 5CYIA 3ZXZA 5I9VA 1DI9A 1KE9A 1OKWA 4X0MA 3HYHA 4QQJA 4Y46A 3TNQB 4DINA 4DH5A 1ZYCA 3FI8A 2Q83A 3TZMA 3JVRA 2QHNA 5TF9A 2UVZA 4JL9A 5A54A 2YERA 3ODZX 5F1ZA 4Y5QA 4FNWA 5C9CA 2OJGA 3TKUA 5HQ0A 4RVLA 4I5PA 4GYIA 1FPUA 2R3OA 4U6RA 4FZ7A 3VHKA 4JQEA 4F63A 4F1MA 2F7EE 4IAFA 5K0XA 3RPVA 4H39A 2OXXA 2XH5A 3BKBA 2UW3A 4OTDA 4GMYA 4OTPA 4AGCA 5AV1A 5HG5A 3PY3A 3C4EA 3QTWA 3ZLXA 3QLFA 4AZTA 4CZUA 4BR3A 3FC1X 2WTVA 3MA3A 3A62A 1ZARA 4WIHA 5CXHA 3BZ3A 4XP2A 2WB8A 3NW5A 1OL6A 4MYGA 4DFZE 5CEPA 4FV3A 1BMKA 2WOUA 3PJ8A 3TUCA 4RC3A 5IMXA 2ETRA 2W1EA 2WO6A 1ZRZA 3LW0A 2HXQA 3VBWA 4BKZA 5HU9A 2C6DA 2CCHA 4XH6A 5IA1A 2R3IA 3QQJA 1Z9XA 4TYJA 3ID6C 1YHVA 3HV7A 5AUTA 1SMHA 1APME 3A99A 3GQLA 3R63A 1W0XC 1ZLTA 2JITA 4FT9A 4A9YA 3MFTA 2R3QA 3ZOSA 3R21A 3CD8A 2YEXA 3KN6A 3PRFA 3SLSA 2V62A 4EC9A 2E9VA 3H9OA 4UMQA 3NEWA 4IADA 2W0JA 2YA9A 3OWPA 4GU6A 2F2CB 4P5QA 4YJQA 4L7SA 2W7XA 4EBVA 4E6AA 4JAJA 3MJ2A 2XKFA 2R0IA 3BLHA 3PZHA 4QNYA 4EH3A 2OIDA 4KS8A 2WU7A 2XRUA 4MKCA 4OTRA 4ZJJA 4K77A 3PDTA 5FBOA 4JBVA 4ZSJA 3W2OA 2G2FA 4O7ZA 2GNLA 3HDMA 2WMWA 1O6KA 3LM5A 4K18A 4C37A 4WBBB 5IH4A 1XH6A 3PSBA 5AP3A 3FKOA 3W2PA 4ORKA 4IB3A 2A4LA 5JQ8A 3PRIA 4QP1A 4YLKA 3IW4A 2WFYA 3TEIA 3F9NA 3LJ0A 2EUFB 4CZYB 3I7CA 1JPAA 2H8HA 3PTGA 3BYOA 4IACA 4RC4A 5E1SA 5A14A 1GOLA 4DBNA 5DMZA 2VWUA 3P7BA 3UVPA 5IUHA 2VX3A 2YM3A 3CE3A 2PMLX 3LFSA 4K2RA 2P0CA 2QOQA 2WQMA 3MYGA 4YZCA 4DTAA 3ACJA 3ORNA 4BZDA 2W06A 5D7VA 2V22A 3O71A 1HOWA 5IQBA 3E8NA 2QR7A 5K9IA 3AC3A 2WTJA 1K9AA 3UNKA 4CG9A 2HYYA 1YWRA 1KOBA 3Q04A 1GZOA 3HDNA 2CKQA 3NVMB 4IX4A 4J99A 4IFGA 4V04A 2J4ZA 4E73A 2HCKA 4NKAA 3ZU7A 4FEUA 2ETMA 2GU8A 1P4FA 3LXLA 2XK6A 3V01A 4GIHA 3QQFA 4XG7A 5KMNA 2X4ZA 2CNUA 2ZJWA 3I7BA 2VTHA 4FKJA 5K4JA 3BHVA 5AIRA 4H05A 3BI6A 3N9XA 2W1CA 3D4QA 3IQ7A 5EQEA 5KMKA 3D0EA 4FIFA 3HNGA 5CAQA 1T45A 2OJ9A 2X4FA 3BV3A 3BBTB 5J7BA 1Y8YA 2V55A 1YXSA 5BUIA 3MFRA 1W7HA 3LJ2A 2C0OA 3HEGA 4PDYA 1T46A 2Z2WA 4TTHB 3VN9A 3HV4A 1GAGA 3NUSA 3O96A 3NNUA 1FVVA 3P08A 5JK3A 3GU4A 3CQUA 1YHWA 3EFLA 2G01A 3B8QA 4S34A 2IW9A 4BCFA 5HI2A 4RX5A 5ICPA 2NP8A 4OTWA 4RJ8A 4TXCA 4CFNA 4F9CA 3GENA 3IW5A 3VS4A 3RJCA 3F2AA 3Q4ZA 2ONLA 3GU8A 3T9TA 4BBEA 5HIDA 3ZDIA 3CQWA 3DCVA 3PJCA 5JGAA 2WAJA 1CMKE 4W4WA 5LCJA 5J5SA 5CU6A 5KMLA 1HCKA 1E9HA 2BKZA 5EM8A 4OT6A 4BRXA 3BU6A 4FT5A 1SNXA 1Q3DA 3FLZA 4FKGA 5D11A 4C61A 3LQ3A 2B1PA 5CU2A 4GUEA 4Z7GA 3WYXA 3KXGA 2J7TA 2XA4A 3QX2A 4TNDA 4F09A 5CF5A 1ZYLA 5HORA 2R3RA 3UIXA 1Q24A 2VTTA 3ZUUA 1WBVA 3KRRA 3QGWA 5DGZA 5KZIA 3W18A 4EJNA 5HIEA 4EQUA 4WUNA 3EQPA 3KVWA 3VRZA 4FZFB 3MPTA 3LE6A 4U41A 3MWUA 4KBAA 1W84A 3BGZA 3G15A 5E7RA 4FTAA 3KA0A 2UW5A 5CZHA 3V8WA 4BI0A 4S30A 1V0OA 4YTHA 3DB8A 3UJGA 4E4LA 3FLYA 2YIRA 4MWIA 2VX0A 3L8VA 5L2QA 5KZ0A 4HYHA 4EH9A 2CKEA 5BYYA 4FSQA 2CGXA 3PWYA 4BTKA 4BN1A 5IUGA 4DCAA 5BVEA 2BAKA 5CF4A 3A8WA 5HBHA 5M4CA 2I0VA 4G34A 5EW8A 4YHTA 3D9VA 4U45A 3FKNA 1ZYDA 3HA8A 4XP3A 1SM2A 4R6VA 5ETFA 4C8BA 1GZ8A 4CV9A 3HMOA 4DEEA 5BX0A 1JKTA 1PXMA 3FQHA 1CKPA 4HW7A 3RZBA 2PE0A 2ZDTA 5FXSA 3H9FA 4NH1A 3WARA 2ZAZA 4UMTA 3CPBA 3PXQA 3TKIA 3UPXA 3HAMA 4Y95A 2JKMA 3PE1A 3DK7A 4IANA 4MVFA 3RAKA 3ORKA 2JDTA 3Q60A 4JLCA 4PNKA 3ZO2A 3HUCA 5EM6A 3IPHA 1X8BA 4YJTA 5CU3A 1WBNA 1SZMA 2VTOA 3RM6A 3VBTA 2PULA 2R3GA 3SRVB 5CI6A 4XS2A 2OO8X 3AXWA 3GB2A 4AT4A 5KCVA 4FNYA 4IVBA 5CEKA 1YI6A 5DEYA 4L46A 4XG4A 5IMEA 5CT0A 2Y6MA 3TV4A 1J91A 3V5LA 4ZY4A 4AT3A 4JIKA 2AC5A 5HVKA 5E8SA 3IGOA 3LXKA 2OJFE 3VS5A 3RI1A 4ZEGA 1Z57A 2PUIA 4RVKA 3PA3A 4MF0A 4D2VA 1ND4A 1KE6A 1SYKA 3K3IA 4M14A 5HEZA 2B55A 5CENA 3GP0A 3P9JA 4CV8A 2RFEA 4Z3VA 4BTJA 3NMUF 5DR9A 3ZONA 4EBWA 4RWIA 5ETAA 3PVGA 2J5EA 4D0WA 5I0BA 1ZMVA 3OW3A 3SXSA 2G9XA 2J5FA 4ZLOA 3MB6A 3LLTA 4DFYA 5JZJA 4HNFA 3RPSA 3ALNA 4DFNA 2WHBA 4Y85A 4O38A 2YLEA 4CKRA 4RIYB 5AR4A 2CJMA 2ITPA 2YLFA 3ZRMA 3NUUA 3I6WA 3CC6A 4ZTQA 1PMUA 1P4OA 4YBKA 3R1YA 4FYNA 3VJNA 4AW0A 2Q0BA 2J90A 5KMMA 4LV8A 4FTOA 4II5A 5AV0A 4X2NA 3UMWA 3V6RA 2HWPA 2J51A 3Q53A 3JUHA 3R6XA 4HZSA 4BICA 2Z7LA 3C0HA 1XO2B 3C51A 4OR5A 5KMJA 2O65A 4AGDA 1AQ1A 2R3JA 4LUEA 5IA4A 3CR0A 4BGGA 3EQDA 4WO5A 2C69A 4V01A 4FSUA 5KHXA 2XBAA 5TR6A 2QKRA 3KEXA 3AC2A 4DGLC 5AR2A 4EOOA 5IISA 2XKEA 4LRKA 3QZGA 4CQGA 3ZC5A 3KB7A 3NYVA 3DPKA 1OL7A 5FG8A 2VWYA 2R4BA 3LJ1A 4F65A 4W8EA 3JY9A 4TWPA 4ZZMA 3F7ZA 1NVSA 2C3LA 3KK8A 5IQEA 4UMUA 4AGWA 1BUHA 2VO3A 1B39A 4E5AX 4ZTMA 1UU3A 2HW6A 2R3FA 4FKIA 2W9FB 4OTQA 3DLZA 1CM8A 1CSNA 5I9WA 3NNXA 3V8SA 2O8YA 4I0RA 1UU9A 2OSCA 2QHMA 5EDRA 3QZIA 2P4IA 4B8MA 2WMUA 3BHYA 4CSVA 1IEPA 1SVEA 5JZNA 4F7JA 2C5VA 3UODA 3Q6WA 1YQJA 5G6VA 3DS6A 4W4VA 2UW8A 3IOKA 4RVTA 4I22A 4ZTRA 2W05A 1PXKA 3NYOA 2EXMA 2X8EA 3NAXA 4J8MA 5L8LA 3QZFA 5FD2A 2WIHA 3RCJA 4AFEA 4DFBA 3OWJA 3TXOA 5ACBC 3BYVA 2OI4X 2UZTA 3WYYA 5FUTA 2ESMA 2XJ1A 1PHKA 5CALA 4E20A 5CF6A 4GT3A 4GJ3A 4BL1A 1OKYA 5JFSA 3NCGA 3DFCB 2QR8A 4YJSA 2HOGA 3C4WA 3G90X 1JNKA 2OF2A 5T68A 3ZFYA 1JSUA 5CS6A 2FB8A 3SW4A 4FKPA 2QKWB 3PIYA 4EQMA 4BY9E 3UQFA 5IEVA 2JFMA 2PHKA 2PY3A 2QG5A 3AMAA 4O0UA 1B38A 1UVRA 2XNNA 3A4PA 4GEOA 4TWOA 4QTDA 1BI8A 2W1HA 3QRTA 4FKTA 2YM5A 3G2FA 4YPDA 4UWYA 3OW4A 4NIFB 3WF5A 4AZVA 4ALUA 1DM2A 4V05A 4JIAA 3DXQA 1R78A 4MCVA 4ZMEA 4Q5HA 1XHAA 3R9DA 2OZAB 4D55A 3ZH8A 2CLXA 3QTUA 3H10A 3WF7A 3DBFA 4YMJA 3ATTA 3F61A 2X7OA 1H24A 5CSVA 1HCLA 3QD3A 5KE0A 4YTCA 4XUFA 4FYOA 4G3GA 1WBPA 5EDQA 1MRUA 2R5TA 4IZ7A 4AT5A 4QP9A 3HECA 3QA0A 2HZ4A 4O0WA 3QF9A 5CI7A 3PSDA 5I9YA 2B53A 5ITAA 5EHYA 2XKCA 5B2MA 3GOKA 3ROYA 2VTLA 5HU3A 4U42A 4TY1A 5DEWA 1LP4A 4C4FA 4ITJA 5J9ZA 2OH0E 3TJDA 3QFVA 3KKVA 3C4XA 5JEBA 3RK5A 4Q5EA 2XJ0A 3ORXA 3UIMA 4I92A 4EC8A 2E9PA 2UW6A 4O81A 4A9RA 4Q9SA 3H30A 2W99B 3EH9A 4DEIA 1FMOE 1NVQA 5AM7A 3ZO1A 5FM3A 3BEGA 4L53A 4P5ZA 3UG1A 3TUBA 4RFYA 3R83A 3UP7A 4ANMA 5JGBA 2PVNA 4CD0A 4BTMA 2DWBA 4CYIA 1F0QA 3IG7A 3DAEA 3OBJA 3OTUA 3ZUVA 3U6JA 2QOLA 4RIWB 4FL3A 3DQWA 4BWKA 3L9MA 5EQYA 4AF3A 1V0BA 5BMMA 3FZPA 4O0SA 5E8VA 2YIQA 4EOIA 5LQFA 5IG1A 3I0QA 4GU9A 3GCVA 4P90A 5KHWA 2XP2A 3R7OA 4FG7A 2E9OA 4FG9A 3LFFA 5I9XA 1PRYA 4HVIA 4WNKA 3SRVA 2IW8A 3MB7A 4UXQA 3FY2A 5IEXA 2C3IB 3C1XA 3R9OA 1JLUE 2QI8A 1XH9A 2ZM1A 2X2KA 5IQHA 2IZTA 3P7CA 3EWHA 2FGIA 4E5WA 4Z55A 4XRLA 3VBQA 4BCMA 3VO3A 4RMZA 4EOLA 1Y91A 3WIKA 3C7QA 1PXNA 3Q6UA 1G5SA 4IC8A 3IW6A 4H3QA 5I3OA 2IVUA 2YHVA 4WOVA 5CQUA 4X6RA 2HAKA 4RIXB 3QHWA 3WBLA 1XQZA 4ARKA 5HLNA 2PPQA 3P1AA 3UZPA 1Q4LA 1CTPE 2VWXA 3MI9A 3MDYA 3NUPA 4FTJA 4IVAA 4UZDA 4DN5A 4F1OA 5L2WA 4X2KA 4L52A 3PPJA 4AFJA 4C4HA 2FH9A 1OI9A 3TNIA 3MA6A 2UZBA 3ORIA 3LFAA 4FUYA 4RIYA 4YZDA 4FZAB 4KD1A 4PWNA 4J98A 3SV0A 3T3VA 4DT8A 3IS5A 3PZEA 1JOWB 2GNIA 2PVKA 4FKRA 2VO0A 3EL7A 4ZXTA 4E6QA 1FQ1B 3FI2A 4FT0A 4CFUA 3G33A 3P4KA 4ZTSA 5CAOA 2YCRA 1OECA 1YOLA 2PVRA 4W4XA 3QRIA 2BTSA 4ACCA 4TYIA 5CTPA 4I24A 3OVVA 1R1WA 4R5SA 4HVGA 4FIEA 2YM7A 4GG5A 2PL0A 4IB5A 5B0XA 4YBJA 5IQCA 4E6CA 3VS2A 4WUAA 5IF1A 5GJGA 2H34A 3NR9A 3KMWA 4YNOA 1FGKA 3R00A 5IA2A 1YDTE 2QNJA 3FI4A 3G0FA 1R39A 3TACA 4WNOA 3U87A 2EXCX 4AZEA 5T6KA 1J7IA 4U81A 2GNFA 5HE2A 4RVMA 3Q9XA 3TNWA 2ZMCA 4EOJA 2XM9A 2YACA 2CDZA 3MS9A 4EONA 4TW9A 2C5YA 2UV2A 2OH4A 3JYAA 5BQ0A 4YJVA 3WZKA 3R7YA 3WE4A 3R2YA 3FXWA 1SVHA 3JVSA 4BBFA 4OTGA 4EOQA 4OBPA 4BDIA 4E4MA 5CLPA 4UB7A 4D1SA 3HUBA 3C9WA 5EOLA 5ANKA 3IDCA 5TOZA 2VN9A 3F3ZA 3A60A 5K3YA 3RAWA 4ZMFA 5LARA 3KGAA 5LVMA 4OGRA 4O82A 2Y8OA 5DG5A 2A1AB 5J1WA 3Q2JA 4YZ9A 1J1CA 4FR4A 5ANEA 4AN3A 2H6DA 4YJOA 4WKQA 4IWOA 3EQBA 4MXAA 4L8MA 3VIDA 3WE8A 3OBGA 4JQ8A 3T3UA 3F3VA 3QUPA 2UZEA 1ZXEA 4BHNA 4YSJA 3KMUA 2W4KA 1Y6BA 3FSKA 3BV2A 3GC7A 3MFSA 4FK6A 4NJ3A 1OM1A 3ZTXA 2WMAA 5DPVA 3M1SA 4NT4A 3OXTA 2A0CX 1UNGA 1YXXA 3SG9A 4KIPA 3EFJA 4D1XA 3COHA 4EOPA 4JBQA 4I5CA 3KQ7A 5IQFA 5HCZA 5J95A 4AGUA 2OIBA 2IWIA 3H3CA 2F9GA 4BZOA 4O21A 3DKGA 5LJJA 3GU7A 3A7HA 1UNLA 2XRWA 4AACA 4C58A 1RDQE 1OPKA 3QQUA 4MD8E 4NM3A 2C1BA 3PP0A 4L3JA 4DGOA 3B2WA 4BC6A 5EYKA 2EVAA 4LMNA 4Z16A 1ZOGA 4MEDA 4AWIA 5AR8A 4O83A 4NIFA 3ZCLA 5M53A 2RIOA 3VS6A 2PMOX 2Z8CA 4QT1A 3VUMA 4A9TA 3QTSA 4ZP5A 4BB4A 3KULB 1UWHA 2OZAA 2BHEA 4WNMA 4DC2A 1NY3A 3C5IA 4G9RA 3KL8A 4QMPA 3GI3A 5HTIA 2FA2A 3LFCA 4NL0A 2JLDA 2YZAA 2NPQA 2XCKA 3BE9A 3U4WA 3EZRA 3O0GA 4I4FA 5DH3A 4OT5A 5IDPA 4NEUA 4JS8A 3W32A 1XWSA 1UKHA 4ACMA 2VD5A 5HHWA 4ANSA 4EUTA 4I6HA 4JG6A 4MBJA 3ZSIA 1H01A 4L42A 2W1ZA 4RWKA 4J96A 1R3CA 3P7AA 4F7NA 3Q9WA 4XV9A 3RM7A 3COKA 4G6OA 2QOOA 2O64A 4U7ZA 3QCYA 3MVLA 4F1TA 5LVOA 3DXNA 3FYJX 3KN5A 4WRSA 3FUPA 4Q9ZA 4USEA 3HV5A 2OIQA 3U55A 2RFDA 3ATSA 4IX3A 1STCE 4NW6A 3OG7A 3TZ8A 1PXOA 3ZSGA 5DHJA 4EH5A 5A4CA 3COMA 4E26A 4ENYA 3GFWA 3QUDA 1FGIA 2XBJA 3RZFA 4JRVA 4W9WA 4Y8DA 4EUUA 5TKDA 4RIWA 4AZFA 5JFXA 3DBDA 1ZMUA 2VTJA 4UY9A 2BFXA 4ZZOA 3CCNA 5C1QB 2P3GX 1VZOA 5B2KA 4IJPA 2UZWE 2BR1A 5M4UA 5LMAA 3R30A 3D5XA 3F82A 3D2KA 4EHEA 2R2PA 2VTIA 4EI4A 4YHJA 2Z60A 4JVGA 2YCSA 2BAQA 4CKJA 3LKMA 1Y57A 4IX6A 4YURA 5M57A 3PUPA 1GZKA 4JI9A 4V0GB 4HPTE 2YN8A 4DTBA 1Q97A 1JKSA 4D1ZA 5F20A 3R8MA 5CVGA 1KSWA 4AQCA 4EK5A 2JD5A 4GK3A 3VUGA 5AFVA 4YU2A 1TQPA 3AQVA 1QPCA 3F69A 5ANGA 1ZOHA 4GVJA 3FMKA 5ANIA 2PVFA 2VTNA 3VS1A 4WSYA 3L9PA 2PSQA 5KBQA 1YXTA 4KAOA 3W55A 3FHRA 2VGPA 3KXZA 1OUKA 4RIXA 4C0TA 4S33A 2WMVA 1W82A 3CTHA 5HKMA 4PV0A 1QL6A 5DI1A 3DBEA 4FIHA 2JDOA 3R04A 3GT8A 3BYUA 1YDSE 4IM2A 5CU4A 1OPLA 2WXVA 3DGKA 4ZTLA 3OCTA 4MHAA 2F57A 5AAEA 1WMKA 4HVDA 4JBPA 2VO6A 4OW8A 2YZLA 4U44A 4UX9A 3AC4A 2XUUA 3U51A 3UO4A 5AEPA 5HCYA 5E91A 4LL0A 4O1PA 5KMOA 4KNBA 3EFWA 4QTBA 4JRNA 4A06A 5L2TA 2X7FA 5BVWA 2PE2A 2ZDUA 3LZBA 4FSNA 3VRYA 1REJA 5A6OA 1G8AA 3WF9A 3OCSA 4FT7A 3R01A 3Q9YA 4X2GA 2CGVA 3SQQA 4E1ZA 3PWDA 4LV5A 4BBMA 2OGVA 2YFXA 4IAIA 3ZUTA 2EU9A 2BILB 2VTMA 3Q4CA 4PP9A 3LCOA 5AUWA 5A4TA 2R3NA 2CCIA 3P79A 4CCUA 3HRCA 2AUHA 5AWMA 2OF4A 4DH3A 3QQGA 4H3PA 5HGIA 5CNOA 3DJ7A 4D2TA 3RMFA 2WZJA 2NNWB 3IGGA 3ZRLA 1YOJA 3D14A 3POOA 3E93A 4GCJA 4DLJA 3CJGA 4BGHA 1OBDA 1W8CA 4MQ1A 4TWCA 5E90A 2OJIA 2PMIA 5FRIA 2F2UA 5HNIX 3LFQA 3OY1A 4GV1A 1LR4A 2PK9A 4PDPA 4E3CA 3PIZA 3GCQA 3HVCA 3QTRA 4GYGA 3FMEA 5JGDA 2UZUE 4EWQA 2BTRA 4O7SA 5ANOA 3R8UA 5L3AA 2VNYA 3G9NA 3SDJA 2BAJA 1PMNA 3GC9A 4XG2A 2FYSA 4KIKB 4XX9A 5FEEA 5FWKK 1WBOA 3RNIA 5KO1A 5F95A 2C6MA 2Y7JA 3QHRA 3UO5A 1PKDA 1XKKA 2QOKA 2BDWA 4ZAUA 4E6DA 4GRBA 4RGJA 4GFGA 4X21A 5CSHA 4FUXA 4EK8A 3UO6A 5M55A 3HA6A 2QOCA 3AC8A 3BRBA 4U5JA 1OIRA 1VYWA 1ZYJA 2CHLA 5AM6A 2ZYBA 4BDEA 4QP4A 4WG5A 4FTUA 3OWLA 5AP5A 4DTKA 4PTCA 3R9NA 4GH2A 2RG5A 3KXNA 5EYMA 4DEHA 3WIGA 1BL6A 3RPOA 4CLJA 1PMEA 3F3UA 1REKA 4BGQA 1SNUA 4JQ7A 4JDIA 3ORMA 4OTIA 3PVUA 3LMHA 3F2NA 4TZRA 4HPUE 4D4VA 2R3MA 3OP5A 3MESA 2OXYA 3KRJA 3FPMA 1WBWA 1OPJA 4UV0A 5TO8A 4UMPA 4U80A 3O7LD 2PMNX 2FO0A 5DOSA 4P7EA 2C47A 2QVSE 5H9BA 3H0ZA 4PTEA 3K5VA 4FMQA 5DR2A 2FSLX 3SX9A 3SW7A 5H8BA 2CMWA 2X8DA 1GZNA 3LQ5A 2XIKA 1OIUA 4R5YA 4NK9A 4PMPA 2VWWA 3DDQA 2VRXA 3KULA 4GT4A 5FTGA 1MRYA 1OIYA 4CFWA 4IX5A 3EL8A 4D0XA 4K33A 1MUOA 1GIJA 2X6DA 5GZ9A 1ZY4A 3OC1A 1NW1A 3WZJA 3M2WA 4K1BA 4XLVA 3ULIA 1G8SA 3HP2A 2XIZA 4MTAA 2RFNA 3V8TA 1TQMA 2ZB0A 3PFQA 5DN3A 4JG7A 5HBEA 5JFVA 2WEVA 5FXQA 3SXRA 3PJ3A 3DZOA 5EHLA 4OBOA 2Y9QA 2ZV7A 4M97A 2P2HA 3MSSA 3BU5A 1IA8A 3EN9A 4H1MA 3EYGA 4EOMA 3HGKA 3AD5A 4BCKA 1M7NA 4M15A 3DB6A 4BYIA 4B6LA 2YISA 3QRJA 2VTSA 3POZA 3SOCA 1BI7A 3GEQA 3NW6A 1M17A 2PZ5A 3FQSA 4PDOA 2W5BA 3ORPA 3ZDUA 3ZLSA 3QRUA 4MD7E 4EORA 4F9WA 5HLWA 4HGLA 4ID7A 4IH8A 4YJPA 4BIBA 4MH7A 3VUKA 2R7BA 4IIRA 4BDCA 5L6PA 4O7TA 4D2SA 2C6LA 3W2CA 3UNJA 3GNIB 3DTCA 3LFNA 4AN2A 4FX3A 2GNGA 4WG3A 4O2PA 5HG9A 4N6ZA 4NFMA 4YO4A 2NO3A 5IQAA 3G51A 4HCUA 1UWJA 4FC0A 4IXPA 4QQCA 4BIDA 5CU0A 4CNHA 1WZYA 1FVRA 3RK7A 4R3CA 5A9UA 1JQHA 2XNPA 1JVPP 4PDSA 4XG8A 5IEYA 4KSPA 2C3JA 4FV9A 4I20A 4V0GA 4NFNA 3N4TA 3HAVA 2W17A 3WF8A 3O7LB 4TT7A 5TE0A 2X9EA 4CTBA 3MN3A 2XNMA 3OT8A 3QCXA 2ZMDA 4PMSA 4TWNA 4JT3A 4EYMA 4PQNA 4J1RA 4U79A 2C4GA 4ERKA 1OB3A 5D1JA 5AP4A 4I5HA 2F49A 1M7QA 4CFVA 3TNHA 1YOMA 4FIJA 3RTPA 3W2SA 3NAYA 4GS6A 1K3AA 2E9NA 3FI3A 3ELJA 3HLLA 2BZKB 2R0UA 3FL5A 2E2BA 3FV8A 1Z5MA 1H08A 4XG9A 3SKCA 3ZM9A 4EYJA 5LVNA 4N6YA 3VUDA 1H4LA 4FOCA 4QOXA 4DA5A 5DT4A 2WQEA 1LPUA 4P2KA 4C38A 4D58A 3FZOA 4N57A 2ITYA 5EDPA 1YDRE 2QD9A 2QURA 5HE3A 5DT3A 3VF8A 4ZLYA 4G2FA 5G1XA 3D7ZA 5IA3A 3BGQA 4GFOA 4D4RA 2QOFA 2X2MA 3MH3A 4F6SA 3MH0A 3UVQA 3O8UA 5HICA 5EYCA 3TUDA 4DBXA 4ACGA 2RG6A 4I6FA 5AR3A 2PVLA 3LHJA 1YWNA 4M69B 4QYFA 4A9UA 4LYNA 4RRVA 5FTQA 2PWLA 2VO7A 2XB7A 3O50A 3SG8A 3PXZA 4LGHA 4D4YA 2Y4PA 2UUEA 2GHLA 4UN0C 2CN5A 4O2ZA 5DLSA 4C02A 3EYHA 2QU6A 3OCGA 4QQ5A 3OUNB 4FEQA 4FKOA 4J53A 4X3JA 1IASA 2B0QA 3ORZA 3FE3A 3O8PA 5ACKA 3UNZA 3UG2A 3GCPA 3TDVA 4R7IA 2CGUA 1WVYA 3E5AA 1H27A 3SHEA 3U9NA 5HO7A 2ETKA 3E64A 4R7BA 5J9YA 4ASEA 2VTQA 5HNBA 3VS0A 4J8NA 5AAFA 3TT0A 3R2BA 4FTNA 3VHEA 4QMZA 5M07A 3RHXA 1DI8A 1V0PA 4BKYA 4F64A 3L9LA 1LEWA 4FSWA 1WVWA 4KIKA 4QMXA 4DEGA 5EH0A 2IG7A 4AUAA 5DRDA 4JXFA 4A4LA 3LIJA 3ZEPA 5KNJA 4U43A 5AP2A 4QMYA 2OU7A 1IG1A 1ZZ2A 2VTAA 4U8ZA 4RG0A 2BPMA 4FSYA 1K2PA 4I93A 3K2LA 4TYGA 5FLFA 4EOSA 3CXWA 4EZ3A 4OLIA 5LVLA 3E87A 1AD5A 5GINE 2X8IA 3OXZA 4FEWA 4GL9A 4YZNA 3S95A 1NT2A 3BQCA 4FICA 2OG8A 2XNEA 3EQGA 3IW8A 5GZAA 4O1OA 5IUIA 4EH2A 5JT2A 3MPMA 3NNWA 4K8AA 4X7QA 5IPJA 4XOYA 2B9FA 2RSVA 4DHFA 3B2TA 3LFBA 3TIYA 1QPDA 2WMXA 5E8TA 4EK3A 3EOCA 1BL7A 3SD0A 4I23A 4O91A 4EH7A 1JKLA 2G15A 2WD1A 4MX9A 4EK4A 4R78A 2ITTA 4YP8A 3UOLA 3MV5A 4D9UA 4EH4A 2XVDA 3DU8A 3I5NA 4U3YA 1J1BA 3KXMA 4FBXA 2HK5A 3DKCA 2FVDA 2QOHA 4G3DA 4UMRA 3V3VA 2YAAA 2R3KA 3CIKA 2WEIA 4R3RA 3ZLYA 3E63A 4C34A 2OKRA 4MK0A 1H1SA 3R8ZA 3VBVA 2JKQA 3AMBA 3MVMA 1VR2A 4XP0A 3OUKA 4MQ2A 4G1WA 2NRUA 4ZZNA 4L44A 2JIVA 3VS3A 5C8MA 2IZUA 4ZIMA 4UYNA 1Q8YA 4FKWA 2QODA 4MXZA 4MXXA 5BVFA 3DKOA 3AT4A 3GVUA 2IVVA 4O7NA 4R3PA 4G3FA 2REIA 4KINA 4IAAA 3P0MA 3ORTA 4BYJA 4QMNA 3ERKA 3MIAA 4XRJA 2UVXA 5I5ZA 4XBRA 4EKLA 2PYWA 3F5XA 4HZRA 3R7VA 4UWBA 2O5KA 5AUUA 2XK3A 3VUHA 3DJ6A 1YVJA 2O63A 3LMGA 5FEQA 4QMQA 3K3JA 1QPEA 4DAWA 3ZBFA 3UPZA 4XHKB 3GOPA 2C6TA 2HZIA 4M13A 4QMTA 3LM0A 3NGAA 5I4NA 3WI6A 3EZVA 2CPKE 3I60A 2JAMA 3QL8A 4YJRA 3D5UA 5CAPA 3CY2A 4AG8A 4QMOA 5H8GA 2JBPA 5CT7A 2OWBA 4FV6A 5A3XA 5L4QA 4FSMA 3KMMA 4JR7A 3GCUA 4KSQA 1CKJA 2HY81 2BDJA 3O2MA 2BMCA 3FMNA 3D7TB 4NCTC 5C4KA 3VS7A 2UZNA 3P78A 4KA3A 3BHTA 4IAZA 1IR3A 4YZMA 4DG2E 2QO7A 2R3HA 2E9UA 2XK7A 3KU2A 3OTVA 3KXHA 4QMLA 2YJRA 3E3PA 3OXIA 3F7WA 4GJ2A 2X2LA 5JFWA 4ZSLA 5CEQA 3RNYA 4L01A 3W16A 2WMQA 5IQIA 4IEBA 2EXEA 5BUJA 3E7OA 4R7HA 2IJMA 2XK4A 1OZ1A 3NPCA 3A61A 4HNIA 4I94A 4RX7A 4F4PA 2XMYA 4FKSA 5L6OA 1Q8UA 2J0IA 4QRCA 4ASXA 2BKKA 3DQXA 4ZK5A 2BIYA 2PZPA 2YJSA 4O7VA
chains in the Genus database with same CATH superfamily
4OBQA 2W4JA 4FKVA 4GG7A 5AUYA 4WD5A 5BVKA 3HV6A 1KV2A 2Y4IC 5HCXA 5EHOA 1O6YA 4IFCA 3KY2A 3P5KA 2GS6A 1YI3A 2X6EA 2GTMA 2R64A 2V7OA 3HV3A 4KKHA 5C8KA 3SC1A 3M42A 4LL5A 1S9JA 2ZOQA 4IWDA 3RGFA 4D9TA 1Q8WA 2YM6A 1H0VA 4BCPA 4ASDA 2JBOA 5DA3A 5A4EA 1ATPE 1URWA 3Q4TA 3VNTA 3UQCA 4ALWA 2OZOA 4J52A 4JX3A 4FEXA 4DHJA 3GUBA 3RALA 4LOQA 4AN9A 4AW5A 1H0WA 2UW9A 4C2WA 3FHIA 4LM5A 5EYDA 4JOAA 2O2UA 5AADA 4CGAA 3E8EA 2ERZE 1TKIA 4K9YA 1PXIA 4L43A 1O9UA 4B99A 3PPKA 4DEAA 5EM5A 3W1FA 4H3BA 4KRCA 2RKUA 5HVJA 1WBTA 1OGUA 2WQBA 1XBCA 3R1NA 1F5QA 4NZWB 1XMLA 4MUQA 1XBAA 2GNHA 3MY1A 4DHZA 3FC2A 3FL4A 4NJDA 3OS3A 5J9LA 3NDMA 4YC3A 3TL8A 2F7XE 2YM8A 4W4YA 3SXFA 4F6WA 4QMSA 2WTWA 4QTEA 3K5UA 3L8XA 3R7GA 2V0DA 2OFVA 3AGMA 4RJ6A 4CT2A 2BIKB 3TJCA 5AAGA 1JKKA 1GIIA 3RHKA 3MBLA 4GKIA 3CTJA 1YI4A 2GFSA 4M69A 3AD6A 5M44A 4Z9LA 1CKIA 3S2PA 2VV9A 3GFEA 3A7GA 3F2RA 5GIPE 2WQNA 3R7UA 4C4GA 2QLQA 2Z7RA 4IW0A 1Q8ZA 4DE4A 2C3KA 4GK2A 4G9CA 3ZLWA 5FP5A 3DT1A 4PMMA 1UA2A 3U9CA 3RCDA 5CXZA 3CSVA 3LOKA 4R77A 4ZS4A 3QUEA 5I9UA 3C0GA 3PXFA 4BI1A 4YSMA 3W0MA 3FLNC 5IH5A 4L00A 4B9DA 4JAIA 4FVQA 3MVHA 4GW8A 5LWNA 4AXCA 3CTQA 4QYEA 5FTOA 3I6UA 4FTKA 1YW2A 3JPVA 5FP6A 3ENHA 5AR7A 5A4QA 4WRGA 2Q0NA 3OF0A 4A07A 4CMUA 4PX6A 3FZ1A 4QTAA 3DV3A 3BYSA 1FINA 2DUVA 4F0FA 4JJRA 3I5ZA 3QC4A 3R1QA 3SVVA 4YC6A 3V6SA 2QU5A 4HGEA 4KS7A 2ZM4A 3K54A 1NA7A 4IZ5A 1VLRA 3R28A 1WVXA 4QP7A 5KX8A 2XF0A 2XK8A 4I0TA 4IVDA 4F0GA 3DFAA 4M68A 1CDKA 4JMQA 3Q9ZA 4XYFA 1JAMA 2XEYA 5TT7A 2UZVA 4K6ZA 4O84A 4ZJIA 4AAYA 4P4CA 4RA4A 3BQRA 4C4IA 2PZIA 3V04A 5BYZA 1MQBA 1U46A 2V5QA 4RQVA 3QLGA 3UOKA 4ANBA 5J7HA 3WZEA 2GQGA 5F94A 5JMSA 1OMWA 2JGZA 4QTCA 4EZ7A 4DEDA 5LXMA 2Y0AA 4BZNA 4KKEA 4BDJA 3EQCA 5IQDA 1JSVA 1YXVA 3FJQE 3FZRA 3LXPA 4FF8A 5H2UA 5C01A 3UC4A 4F6UA 4XNEA 3FLWA 1OL1A 5BUEA 3RAHA 3NZ0A 5EQPA 3EKNA 4LRMA 4AOJA 4ZS0A 2QC6A 3CD3A 3EIDA 3QD0A 4CFMA 3E7VA 3QYWA 2BDFA 4YR8A 2XS0A 3LPBA 3QQHA 1JSTA 5ANJA 4N4SA 4Q2AA 4JX7A 2ITVA 3CKWA 3TV6A 3ANQA 4U3ZA 2XCHA 2ERKA 4RX9A 4FI1A 4LUDA 3AD4A 3KK9A 2WOTA 4IE9A 3P86A 4DDGA 5D7AA 1W2DA 5J8IA 4IMYA 1H1PA 3AC5A 4RWJA 4HGSA 3DNDA 3NIZA 4B0GA 4EWHA 5LMKA 3S1HA 2YIYA 3QKMA 1L8TA 5HNGA 4XOZA 4AE6A 4N0SA 4ZSAA 3LMIA 4LI5A 3WILA 3G6GA 4C4EA 1A9UA 4YGAA 1H26A 3HMIA 2H96A 4DGNA 4QPMA 2W1FA 1OITA 3DK3A 2HXLA 4C2VA 3Q4UA 3N51A 1E1VA 3D94A 5KUPA 5ETIA 3ORLA 3UZRA 3BLRA 3BGPA 4YLJA 3C13A 1W83A 3QWJA 1JBPE 4MNEB 4CVAA 2C1AA 4IC7A 4YPSA 3TV7A 3FXXA 4EOKA 3FYKX 4EJ7A 4O7RA 5E92A 1YWVA 4IQ6A 1XH7A 3VWAA 5C26A 3ZMMA 3NUAA 2BRGA 3FXZA 3LXNA 4GKHA 3HMPA 3H4JA 5JQ5A 5J1VA 4AE9A 2OICA 3PE2A 3QA8A 4XV1A 3UGCA 3W33A 3U6IA 5L2SA 3C4ZA 1MRVA 4XMOA 4BDAA 2W4OA 4F9BA 4RX8A 1VJYA 2EB3A 2OFUA 1E1XA 3PG3A 3QALE 4FTMA 1DAWA 4I0SA 4Y5HA 2X81A 2J9MA 4RJ5A 4RFZA 2XIYA 5HOAA 3MJ1A 4Y83A 3D7TA 3VQHA 1U54B 3THBA 5IH6A 3QZHA 1ZMWA 5EM7A 4EH8A 2X7GA 2JDVA 2W5HA 4ZSEA 3IO7A 1Q3WA 5J5TA 1KWPA 4YTIA 4BDHA 5LMKC 3R0TA 3RWPA 2B52A 3FMHA 5HESA 3KXXA 3BHHA 2GDOA 4PL5A 4QMWA 3HRBA 1YHSA 4U9AA 3LCDA 4FG8A 3FPQA 3F6XA 5AUZA 4G3CA 4EZ5A 4ANLA 2R9SA 4FTLA 4YTFA 3I1AA 1VYZA 4KBKA 3GXLA 5M56A 4APCA 3UZTA 2HWOA 4FTTA 4RLLA 2JC6A 2WTDA 2G2HA 4RJ4A 2PVMA 4KKGA 2BRHA 5GJFA 2A19B 4FKUA 4X3FB 4RC2A 2JAVA 3Q3BA 2VTRA 5IZFA 4LMUA 5GHVA 3L1SA 4LOOA 3QXPA 1BX6A 3BIZA 5AV4A 3UQGA 1KE7A 4HCTA 4O7WA 3DNEA 3I79A 1IA9A 1GJOA 3PA5A 2BALA 3ZM4A 4I4EA 4LGGA 2J2IB 5AR5A 3R22A 3DJ5A 4FV0A 5E8UA 5E8YA 4NUSA 1RQQA 3R9HA 3CLYA 2CN8A 4LOPA 4BDBA 5H3QA 3HMNA 4H58A 4G3EA 2WQOA 3QD4A 3VF9A 4S32A 4F99A 3IW7A 1UV5A 4QP2A 4B4LA 5FM2A 4C3FA 4J95A 3MW1A 3G0EA 4JBOA 4AU8A 4FKLA 5KMIA 3F3TA 4XEYA 1BLXA 2DS1A 2Z7QA 1GNGA 3UP2A 1UKIA 4KUJA 4RPVA 2VNWA 4QP6A 2DYLA 1PF8A 3ITZA 3E3BX 4A4OA 4ERWA 1FBNA 3DLSA 1KV1A 2XYUA 4HYSA 4X3FC 4PL3A 2A98A 1Q62A 3FAAA 1PXPA 2PVHA 2B54A 5IKWA 2B9HA 1ZOEA 2XK9A 3EN4A 2QLUA 5E9EA 3W0OA 3KC3A 3NX8A 1LUFA 3BHUA 1Y6AA 2C0IA 5EW9A 5A6NA 5I3RA 3KRLA 4FV2A 3QAME 5I9ZA 3MY0A 4CT1A 2PVYA 2GS2A 2J50A 3ZS5A 3CBLA 2I0EA 2PU8A 1I09A 1H1WA 5EI6A 4EH6A 4AA0A 1NXKA 5M06A 4EKKA 2PTKA 1M2RA 4L45A 2C5OA 3RPYA 3R02A 2V7AA 5HX8A 2I7QA 2HZNA 4HYUA 1Q41A 3UMXA 4QPAA 1IAHA 1M14A 4O27B 4DG3E 4K11A 4XG6A 5CAVA 4OUCA 3W8QA 2WKMA 4BCNA 2RFSA 5L6WL 4RZVA 3DA6A 5L8KA 5CSPA 4BJJB 3FKLA 2C6EA 4YLLA 2BZJA 3UIUA 2VWZA 3ET7A 3IDPA 1UU8A 3OOGA 3QKLA 4CYJA 4WT6A 5DNRA 4DLIA 4O7YA 3EN7A 1Q5KA 2QCSA 4F08A 2WTKB 1Y8GA 3AKLA 1WAKA 3CGOA 4D5HA 4XJ0A 4CFXA 2CKOA 3NLBA 2IF8A 3TM0A 3CS9A 4L67A 4FT3A 3RAIA 4TRLA 3A2CA 2IVTA 3Q2MA 2IVSA 2XEZA 3R1SA 3SOAA 3BYMA 2XNGA 2YDJA 2O3PA 3F88A 4BFMA 4FGRA 4LG4A 4M0YA 3MFUA 4NM0A 3O5AA 1OKZA 4HVHA 3BX5A 3Q32A 3DBCA 3EN6A 4DH1A 5C03A 4CZTA 4H36A 4E7WA 3BELA 2GMXA 3QTIA 5AP0A 3BWFA 4BCJA 2RL5A 4BWPA 4C62A 4O6LA 3RP9A 5HG7A 3NUXA 4MWHA 5FGKA 4FTQA 3ALOA 1W98A 2B9JA 4GK4A 2JFLA 5FQDC 1IAJA 2HW7A 4CG8A 1A06A 4FVRA 4FZDB 4CLIA 5CZIA 1ZAOA 4E8AA 5DFPA 3UIBA 2G2IA 1P5EA 3PLSA 3ZO3A 3LCKA 4RSSA 4YJUA 3UDBA 2H9VA 2WTKC 4GVAA 2GFCA 3FDNA 4ASZA 1PXJA 3PIXA 3WF6A 3BPRA 4O0TA 4LRJA 1TVOA 4DGMA 5CQWA 4C59A 4ITIA 5CVFA 3JY0A 2VWIA 2ZFYA 4BTFA 3PJ1A 2BFYA 2UW4A 3UBDA 1FOTA 3OD6X 3ML1A 5M4IA 3V51A 4M66A 5E8XA 5DBXA 2QOIA 3CKXA 5HVYA 4FK3A 4C57A 4JR3A 5GNKA 2Z7SA 3ZC6A 2ZV8A 4MXCA 4F7SA 4KB8A 2ZM3A 4AA5A 1WFCA 3QKKA 5GZ8A 5M51A 5C8NA 3IK3A 5J87A 3CQEA 3BCEA 3TZ9A 2WELA 4UWCA 4FTRA 2Z02A 3S4QA 3G9LX 3NS9A 4L7FA 4CRLA 3GGFA 2CNQA 3EQRA 4I6QA 4L6QA 4FIGA 5JKGA 4MNEA 4GFMA 2LAVA 5HTCA 4DG0E 1J7LA 4YO6A 4FE2A 3IECA 2YDIA 1WCCA 4MBLA 5CSXA 2WGJA 1J7UA 2YIWA 3Q96A 2C6KA 2W1GA 1M2QA 4H1JA 4LFIA 3ZXTA 4C3PA 2J0KA 1H1RA 3TDWA 4G6NA 4G5PA 3TWJA 5HD7A 1PXLA 1ZYSA 4KABA 3KF4A 2PVJA 4BVUA 3OEZA 1L3RE 3R7IA 4ONAA 1U54A 1XH5A 4YHFA 4RA5A 2AYPA 4JG8A 1RW8A 1ZWSA 1S9IA 2PZYA 5BMSA 1WBSA 2JDSA 2YWVA 2OW3A 2R7IA 4MD9E 4W8DA 5HIBA 1KE5A 5T3QA 2C68A 5CSWA 4BDDA 1URCA 3UDSA 4XCUA 3RK9A 3QCQA 2YITA 3AT2A 3U6HA 4CRSA 1H25A 4D2WA 3LCTA 3IDBA 3NYNA 3OEFX 3OHTA 4XLIA 5AJQA 5HX6A 4KIQA 1H1QA 1OBGA 5BYLA 1VEBA 4FV4A 5JH6A 4IWQA 4U40A 5IQGA 5GIOE 3NCZA 1OKVA 2ZV9A 4X3FA 4USDA 4I5MA 5HE0A 4EQCA 4I21A 1OL2A 3L8SA 4APPA 2KULA 4E4NA 2ITWA 2F7ZE 4EHVA 4FA2A 2CSNA 4ZSGA 2VGOA 1MP8A 4ACHA 5AX3A 2LGCA 4FVPA 1PW2A 3JR1A 3EMGA 5CVHA 2XIRA 5CASA 3A8XA 2ITNA 4FTCA 5DT0A 5K4IA 4FSRA 5L2IA 3UDZA 4BKJA 5CEMA 4QDEA 3F5UA 2XJ2A 1W2CA 1BKXA 3WZUA 4ANQA 2XYNA 3QC9A 2ITUA 3PXYA 1Q8TA 3KREA 2BRNA 3NRMA 3E8DA 5AV2A 4M3QA 3ROCA 2YM4A 5E8WA 2J0MB 2JEDA 4EHZA 3FMLA 5EI2A 3VBXA 1KE8A 2OBJA 3TI1A 3UYSA 3JS2A 2RGPA 3FZSA 3NWWA 5HLPA 3G5DA 1GY3A 4KBCA 4RFMA 4AA4A 3NVKI 2J6MA 4TYHB 4WNPA 5K5NA 2VU3A 2W5AA 4HGTA 3ZYAA 3T8OA 2BRMA 3FWQA 4M84A 4EEVA 5LOHA 3FLSA 5EOBA 5CF8A 3HP5A 5LCKA 4I1ZA 5LVPA 4CMTA 5FXRA 4AW2A 3B8RA 4AOIA 3FQEA 4QO9A 4O96A 3TN8A 3D15A 3ULZA 4NW5A 3HMMA 4OAVB 5M08A 2XKDA 3VUTA 3EQHA 3BEAA 1GIHA 5BVOA 1Q99A 4CXAA 2EB2A 3BE2A 5D12A 3PY1A 3V5TA 1QPJA 4U0IA 3DY7A 5BNJA 2XM8A 3MVJA 5DWRA 3KCKA 2UW0A 3NW7A 4PUZA 2IW6A 4GT5A 3NFFB 4EK6A 2PUUA 3PPZA 3GQIA 3E8CA 4HCVA 2O0UA 4X2FA 4IHPA 4XG3A 5EI8A 3RVGA 4BDGA 2GSFA 1R0PA 2A2AA 2QO9A 5CWZA 5IA0A 2I1MA 5K5XA 4BJJA 4BIEA 3R71A 5FBNC 4MAOA 3UE4A 4I41A 1YRPA 3DKFA 5CY3A 3VQUA 4YZBA 2ITZA 4ALVA 4QYHA 4UZHA 2GQSA 5E4HA 2BZIB 5B2LA 4NYEA 5D10A 3KRXA 2C30A 3V5JA 4D28A 3UC3A 1QMZA 3FMDA 3Q52A 5CNNA 3QTZA 4GUBA 2WMTA 2I0YA 1TZDA 4LGDA 1BYGA 3D83A 4WHZA 4EL9A 3SAYA 4DT9A 1U5QA 3I81A 2ACXA 3QTXA 4XV3A 4IDTA 3PVBA 3OROA 2XANA 4FEVA 3ZSHA 4L3LA 4BHZA 4O4EA 3AOXA 4TN6A 2UVYA 1OL5A 3KRWA 3P23A 4BCOA 3I0OA 3EFKA 4A7CA 5HD4A 4TYEA 3HX4A 1MQ4A 3CJFA 4G17A 4RZWA 2G1TA 5EG3A 2BCJA 2NRYA 4NTTA 5JRSA 3EKKA 3RINA 4M8TA 4FSTA 3AGLA 1KUTA 3Q5IA 1A48A 4IZYA 3LFEA 5CAUA 4D2RA 3NSZA 5BPYA 4RJ7A 5L8JA 4ANNA 4FV7A 4IB1A 5HG8A 4CEGA 2IO6A 2RF9A 2IZRA 2W96B 4QMMA 4RT7A 4C33A 4DFUA 3AC1A 4YC8A 4R1VA 1YKRA 2X1NA 4IZAA 3TZ7A 3LCSA 4O4DA 4O0RA 4RLKA 3FLQA 2PE1A 3OT3A 3GC0A 3L8PA 3BBWA 2GHMA 1RE8A 2IZSA 3OWKA 4M12A 5F4NA 2XALA 1OVEA 4WSQA 4F7LA 5EK7A 3PXKA 3QXOA 3NUYA 2CKPA 3FMJA 1TQIA 3HZTA 5F9EA 2XNOA 3GC8A 3QYZA 4U97A 2BROA 2VWBA 4UXLA 4JNWA 4IB0A 2I40A 4JDHA 3QCSA 3REPA 3ANRA 3MIYA 2WU6A 4BF2A 3MTLA 5EKNA 4RBLA 3S3IA 5DVRA 3VBYA 3R9RA 5DIAA 4TPTA 4LQMA 5M4FA 3TNPC 3H0YA 2UZDA 3MTFA 1DAYA 2BRBA 4DYMA 5ETCA 3EB0A 1PY5A 3PA4A 4J97A 3DBQA 3O23A 3EQIA 2J0JA 4FL1A 2BZHB 1ZZLA 3G6HA 4RWLA 1ST0A 5AP7A 4FSZA 4XBUA 1W2FA 4RJ3A 4QQTA 4D5KA 2P33A 2C0TA 3LLAA 4HVSA 3A7IA 3R8LA 2GS7A 2QG7A 3MH1A 2HELA 2FSTX 2P2IA 4TKSA 3GU6A 4ZY6A 2Y4IB 5C27A 4CKIA 4DH8A 2X0PA 5J79A 4G31A 2JIIA 3PYYA 1PKGA 3BL9A 5K0KA 5A4LA 4IDVA 2ZVAA 4M0ZA 2XIXA 4C4JA 3VVHA 5FDPA 4L3PA 2UZLA 2GTNA 3RKBA 3TCPA 4X6QC 4BCQA 4USFA 2ZV2A 4L68A 4M67A 4TNBA 3ETAA 3R7EA 3VULA 3VC4A 4TL0A 3DXPA 4N70A 2CGWA 3VW8A 4FNXA 4E93A 4ANOA 3RPRA 3CPCA 3KF7A 3U4UA 3AG9A 4MBIA 4HJOA 3V5PA 4D2PA 4OAUC 4AP7A 4EHGA 1U59A 3MGYA 3ACKA 3HKOA 5EW3A 4IVCA 3UTOA 2WMSA 3LAUA 4FOBA 4YNEA 1U4DA 4AZWA 1NVRA 4C35A 4DEBA 5KKRB 2UW7A 2YABA 2CNVA 3TYKA 4FV8A 4GIIA 4FV5A 4JDKA 3FMMA 4NSTA 4UEUA 1H8FA 5D41A 1U5RA 3IONA 4BCIA 4Z7HA 2GNJA 4J7BA 5BVDA 4JDJA 3ENMA 3A4OX 3NNVA 3TG1A 3S0OA 3DZQA 3D5VA 1SVGA 5AX9A 5CEOA 1XR1A 3M11A 4NWMA 5E8ZA 3BLQA 4FTIA 2JDRA 3NUNA 4CMOA 4ZOGA 2UZOA 3HRFA 4DF3A 3ZEWA 4BI2A 3JXWA 3O8TA 2ITXA 3TKHA 4HYIA 4L9IA 1OUYA 2B4SB 2CLQA 4BWXA 4YUQA 4O86A 3BWJA 3RWQA 3DAKA 4UYAA 3PSCA 4PMTA 5AV3A 1G3NA 2GHGA 1PYEA 3QRKA 4C36A 3S00A 3DK6A 2BVAA 4G5JA 3EJ1A 1P2AA 3QWKA 1UNHA 5IU2A 5ANDA 4PF4A 2B7AA 4I3ZA 5AA9A 4BCHA 3HL7A 2JIUA 3MPAA 4NKSA 5H8EA 3VW6A 4E4XA 3CY3A 3QX4A 5FDXA 3C50A 4FGBA 4PP7A 3FSFA 3D2IA 4ZLZA 1H00A 4R8QA 4C3RA 5KKRC 2PZRA 2ITOA 4DFLA 3QQKA 4X2JA 4F9YA 1O6LA 2OXDA 2QQ7A 3ODYX 4TYHA 3CEKA 4FV1A 2QO2A 4FIIA 3W2RA 4QD6A 3C5UA 2VZ6A 4B8LA 2OLCA 3QTQA 3NYXA 4WA9A 4G16A 5GJDA 3WZDA 4AXAA 4O7LA 2VWVA 5IA5A 3IOPA 5C4LA 3BU3A 2QOBA 2YAKA 3DAJA 4QYYA 4AZSA 2VAGA 2X0GA 3OFMA 4DFXE 3MH2A 3TTJA 2XNBA 3ZRKA 3RBWA 5CANA 1KOAA 2YIXA 3AT3A 3QU0A 3OOMA 4ITHA 5CX9A 2OJJA 3MY5A 1PMVA 2C6IA 3N4UA 3FY0A 3LFDA 5AIKA 4ENXA 3F5PA 3GU5A 4OTHA 1F3MC 3KVXA 4O6EA 4FNZA 5DR6A 5HE1A 3COIA 2AC3A 4F9AA 3VUIA 4RIOA 4ZJVA 4PPAA 5DYJA 2C6OA 3R73A 2R3LA 4S2ZA 3PVWA 4O0VA 1J3HA 1PYXA 2QONA 4GSBA 4OTFA 5E1EA 4A4XA 3A7FA 4E5BA 3ZZEA 2VX1A 2GQRA 1UU7A 3V5WA 1H28A 1XH8A 2HY0A 3Q5ZA 2YWPA 3QBNA 3QGYA 4O0YA 1ZY5A 3NIEA 3U54A 3H9RA 4AOTA 4QYGA 2B9IA 4IBMA 4DITA 2HENA 4AAAA 1JWHA 4B7TA 3DDPA 2BUJA 3TTIA 3ZBXA 4MF1A 4FZ6A 3E88A 3LQ8A 4KRDA 5AUXA 2WTIA 4PNIA 4BDFA 3I4BA 1XBBA 3A7JA 1M2PA 2X39A 4NM5A 3PXRA 4FKQA 4KWPA 2W1IA 4NU1A 5EFQA 4ZTNA 3W10A 3SA0A 4AS0A 5DE2A 4MXOA 2HIWA 2I6LA 3EN5A 3FZTA 5LMBA 3GCSA 1RJBA 5HBJA 2DQ7X 4IAKA 4O22A 4O4FA 1QCFA 2XAOA 5CEIA 4BDKA 2IPXA 4PY1A 4A9SA 3BLAA 4K0YA 4DGGA 3N4VA 3E92A 4ZTHA 4PPBA 2WMBA 1FVTA 1ERKA 5AP1A 3DOGA 2GPHA 3W2QA 5B7VA 1XJDA 2J0LA 2YCFA 3ZZWA 3O51A 2WMRA 5AMNA 1OIQA 3F5GA 1DS5A 5M09A 1AGWA 4QMUA 4D4SA 2I0HA 3KCFA 3CP9A 3FBVA 4IAYA 3C0IA 4PPCA 4S31A 3QQLA 2BHHA 1I44A 5EKOA 5JRQA 4PRJA 5HZNA 2ZB1A 2FSMX 2WIPA 3WOWA 4ACDA 4Y73A 3SGCA 3L9NA 4MNFA 4CTCA 3EHAA 3D5WA 1EH4A 3CGFA 2YDKA 3C4FA 4QMVA 4NCTA 2JKKA 1V1KA 2YCQA 5JSMA 3OY3A 4RQKA 4FL2A 3OCBA 4CCBA 1M52A 4G6LA 4MXYA 4IWPA 4W9XA 5D9HA 1H07A 4AX8A 2X9FA 4C7TA 1P14A 2FSOX 2WNTA 2SRCA 2P55A 3VAPA 2JKOA 3DTWA 2F4JA 4DCEA 2EWAA 3IKAA 3PY0A 4AW1A 3VJOA 4HOKA 3ZFXA 3R8VA 3KFAA 2C5NA 4I6BA 3T9IA 3UYTA 1Q61A 4WG4A 4O0XA 5A46A 3GBZA 3W0NA 1B6CB 2IN6A 1YXUA 1PJKA 5HO8A 2VTPA 4Y72A 4PL4A 4O4BB 5JN2A 3ZFMA 2VUWA 4NM7A 2ITQA 3C4CA 3W8LA 2C5XA 4QP8A 3ZHPC 2PUPA 1IRKA 4M7IA 1FMKA 2WPAA 4NTSA 3PP1A 4UBAA 3V5QA 5KBRA 4WBOA 4UALA 4CFFA 4FODA 2PUNA 5BVNA 3PLAE 3OMVA 3E62A 3R8PA 2HZ0A 2Y6OA 3UVRA 5HTBA 4XV2A 3U8WA 1LEZA 2GCDA 3LVPA 4F0IA 4IM3A 2WTCA 3TIZA 3FEGA 3II5A 3UOHA 2A27A 2W9ZB 4IJ9A 5AP6A 5IDNA 2W1DA 3AMYA 4J71A 2OK1A 4ZY5A 4CQEA 5AUVA 3PJ2A 2ONLC 4BCGA 5HO6A 1XH4A 3F3WA 3O17A 3EQFA 3OZ6A 3QD2B 4QNAA 2XZSA 2R3PA 2KTYA 5LWMA 2X0QA 5DRBA 4KIOA 2FUMA 5AA8A 5FEDA 4IM0A 4QP3A 1R0EA 4DH7A 3F66A 4QPSA 4R1YA 4YJNA 4F70A 3PG1A 4PTGA 3ZO4A 3UOJA 5CYIA 3ZXZA 5I9VA 1DI9A 1KE9A 1OKWA 4X0MA 3HYHA 4QQJA 4Y46A 3TNQB 4DINA 4DH5A 1ZYCA 3FI8A 2Q83A 3TZMA 3JVRA 2QHNA 5TF9A 2UVZA 4JL9A 5A54A 2YERA 3ODZX 5F1ZA 4Y5QA 4FNWA 5C9CA 2OJGA 3TKUA 5HQ0A 4RVLA 4I5PA 4GYIA 1FPUA 2R3OA 4U6RA 4FZ7A 3VHKA 4JQEA 4F63A 4F1MA 2F7EE 4IAFA 5K0XA 3RPVA 4H39A 2OXXA 2XH5A 3BKBA 2UW3A 4OTDA 4GMYA 4OTPA 4AGCA 5AV1A 5HG5A 3PY3A 3C4EA 3QTWA 3ZLXA 3QLFA 4AZTA 4CZUA 4BR3A 3FC1X 2WTVA 3MA3A 3A62A 1ZARA 4WIHA 5CXHA 3BZ3A 4XP2A 2WB8A 3NW5A 1OL6A 4MYGA 4DFZE 5CEPA 4FV3A 1BMKA 2WOUA 3PJ8A 3TUCA 4RC3A 5IMXA 2ETRA 2W1EA 2WO6A 1ZRZA 3LW0A 2HXQA 3VBWA 4BKZA 5HU9A 2C6DA 2CCHA 4XH6A 2AQXA 5IA1A 2R3IA 3QQJA 1Z9XA 4TYJA 3ID6C 1YHVA 3HV7A 5AUTA 1SMHA 1APME 3A99A 3GQLA 3R63A 3P5JC 1W0XC 1ZLTA 2JITA 4FT9A 4A9YA 3MFTA 2R3QA 3ZOSA 3R21A 3CD8A 2YEXA 3KN6A 3PRFA 3SLSA 2V62A 4EC9A 4LDTA 2E9VA 3H9OA 4UMQA 3NEWA 4IADA 2W0JA 2YA9A 3OWPA 4GU6A 2F2CB 4P5QA 4YJQA 4L7SA 2W7XA 4EBVA 4E6AA 4JAJA 3MJ2A 2XKFA 2R0IA 3BLHA 3PZHA 4QNYA 4EH3A 2OIDA 4KS8A 2WU7A 2XRUA 4MKCA 4OTRA 4ZJJA 4K77A 3PDTA 5FBOA 4JBVA 4ZSJA 3W2OA 2G2FA 3PFYA 2GNLA 3HDMA 4O7ZA 2WMWA 1O6KA 3LM5A 4K18A 4C37A 4WBBB 5IH4A 1XH6A 3PSBA 5AP3A 3FKOA 3W2PA 4ORKA 4IB3A 2A4LA 5JQ8A 3PRIA 4QP1A 4YLKA 3IW4A 2WFYA 3TEIA 3F9NA 3LJ0A 2EUFB 4CZYB 3I7CA 1JPAA 2H8HA 3PTGA 3BYOA 4IACA 4RC4A 5E1SA 5A14A 1GOLA 4DBNA 5DMZA 3W0QA 2VWUA 3P7BA 3UVPA 5IUHA 3KIOC 2VX3A 2YM3A 3CE3A 2PMLX 3LFSA 4K2RA 2P0CA 2QOQA 2WQMA 3MYGA 4YZCA 4DTAA 3ACJA 3ORNA 4BZDA 2W06A 5D7VA 2V22A 3O71A 1HOWA 5IQBA 3E8NA 2QR7A 5K9IA 3AC3A 2WTJA 1K9AA 3UNKA 4AXEA 2HYYA 1YWRA 4CG9A 1KOBA 3Q04A 1GZOA 3HDNA 2CKQA 3NVMB 4IX4A 4J99A 4IFGA 4V04A 2J4ZA