4Q2AA

Wnk1: a chloride sensor via autophosphorylation
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
271
structure length
271
Chain Sequence
b'KAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKAVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase WNK1
publication title Chloride Sensing by WNK1 Involves Inhibition of Autophosphorylation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 66
structure length 271
sequence length 271
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4q2aA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4q2aA01
4BCKA 4GV1A 4GFGA 1GZKA 5F95A 5C8KA 4QMPA 2RGPA 3GCUA 3LFSA 4FV8A 5JN2A 3GXLA 2R4BA 4CTCA 4R7BA 3R02A 4NCTC 2X6DA 1VZOA 4FSNA 2R3KA 4EOSA 4RFMA 4S34A 3R2BA 3LAUA 4DG0E 4FZFB 3OC1A 4EBVA 5CF6A 3H9RA 4NL0A 3H4JA 3IKAA 3F3ZA 4FICA 3QQLA 2J6MA 4G3GA 3BYSA 4IQ6A 4P2KA 2E2BA 5KBRA 5AR2A 4IC8A 2CKEA 3VRYA 3KRLA 1FOTA 2JFMA 4O7SA 3EQRA 3TUCA 4FEWA 4FTJA 1FVVA 1H4LA 2E9PA 3IS5A 4ACHA 4I41A 4F7SA 3IPHA 3V8WA 4XCUA 3NUUA 4RFZA 1PMNA 3R8VA 4OTWA 4EWQA 3QBNA 3R1SA 3G2FA 3QWJA 4XP2A 2WO6A 2BHHA 2Z7QA 3D15A 2GNLA 4LYNA 4BKJA 1HCLA 3AT4A 3BLHA 3E8CA 3E7OA 5HTBA 4XG6A 4ZY4A 4BDDA 4I5PA 2JAMA 2GPHA 1ZMUA 4NM3A 4ZXTA 5IQCA 3UNKA 3LMIA 3OBGA 4FOBA 4IEBA 4FTLA 3QZIA 3KK8A 3Q4CA 2F57A 4CT1A 5IDPA 2EXCX 4O7NA 3IDPA 2WTCA 3U4UA 2VNWA 2BDJA 4KINA 3QTWA 3RWQA 5ETAA 2H9VA 4MD8E 3E7VA 5HCXA 5GIOE 1KE8A 3DK6A 4I23A 4M69A 5D1JA 4F0GA 3UOHA 4PPBA 4UB7A 3R71A 4FOCA 4YC3A 2EUFB 3HYHA 3GU6A 4KD1A 3LJ1A 4I24A 4HGLA 4MXOA 2C1AA 3W8QA 5KUPA 3KQ7A 2C0OA 3R7IA 1YKRA 4O6LA 4BF2A 4QPAA 3Q5IA 3G6GA 5AIKA 2I0VA 4IB5A 3QTUA 4JDIA 3EFKA 3UE4A 4FG9A 4E3CA 4DCAA 2R3HA 4KIQA 3FC1X 4ZZMA 4F9CA 1X8BA 1Y57A 2GMXA 3QD3A 4JQ7A 3VQHA 4O91A 4U7ZA 4F6UA 1MUOA 4EUTA 1QPEA 1V0BA 2LAVA 1V0OA 4D5KA 4E1ZA 3DPKA 3LQ3A 1QL6A 4ANOA 4UX9A 4NH1A 4IVDA 2Y0AA 4AFEA 5CZHA 3LZBA 3W32A 4YZCA 3NUNA 2BZIB 4FKWA 4G1WA 4PTGA 4FNXA 2XIKA 3BZ3A 4WO5A 3RAIA 3CY3A 4TZRA 2BRBA 3DDPA 4TY1A 4U79A 3HDNA 5FXSA 3GOKA 3TXOA 5KMOA 5DEYA 2REIA 3UIXA 4E6CA 4CFXA 4GKHA 4L42A 4BDHA 3RPOA 3MB7A 5LWNA 4EOOA 3QUEA 4CMUA 3DBDA 3EN6A 2CKQA 5AR7A 3SD0A 2QOQA 4BYJA 2KTYA 2X4ZA 4CMOA 4BCIA 4G3CA 1ZOGA 2XKCA 2VN9A 5L2TA 3DZOA 1YXUA 4DFLA 2JAVA 3Q3BA 4WUAA 5D7AA 5EHOA 1G8SA 3FI8A 2WHBA 3ZTXA 3K5UA 3ZC5A 3GUBA 2IVSA 2ZB1A 3QRKA 5DR9A 4L00A 3MH1A 3GB2A 5JKGA 1WBSA 5EH0A 4LUDA 3CJFA 5IH6A 2PZ5A 3O50A 5HO8A 3RAWA 3N4VA 2W1ZA 4GRBA 1TQMA 2ZVAA 5CQUA 3ZEPA 3JVSA 2XP2A 3FHRA 5JZNA 4RVTA 2C3JA 2RF9A 4QTDA 4V01A 2UW0A 2BDFA 2QONA 5M4CA 3UNZA 3HUCA 5JZJA 5C8NA 3RK5A 1ZXEA 1U5QA 4QMYA 4O0UA 5BMMA 4J1RA 2VWWA 3SAYA 4C58A 4G17A 3AD6A 3GCVA 5GJGA 5FWKK 3WF8A 4IANA 5EDRA 4FG7A 2G15A 2XK6A 3E62A 3SVVA 5E9EA 1V1KA 4K18A 4EZ7A 1YHWA 5AM6A 5LVPA 4O38A 2C5VA 4ZZOA 4MTAA 5M51A 2A4LA 3D5VA 3DBFA 5B2MA 4BN1A 1Y91A 3JR1A 4KSQA 4UMRA 4ZMEA 3VF9A 2VWUA 4RC2A 5L2IA 4GK2A 2VX0A 4AF3A 2NPQA 3JUHA 3OW3A 3O2MA 3ZONA 5DPVA 4GT3A 1T45A 4AT5A 1ZMWA 1R0PA 5LMAA 1OVEA 4QTAA 3W2RA 4YMJA 1YWRA 5FDPA 4XYFA 5AV4A 5DYJA 3QQKA 3CD3A 2UW6A 4L7SA 3KEXA 4CFFA 4TYJA 4M7IA 3DTCA 4YO6A 5HG9A 4A9YA 3DK7A 3OWJA 1RJBA 4WNKA 2OZAA 5E8SA 2G2FA 3ENHA 5BVEA 4AZTA 1Q5KA 5ICPA 5IPJA 3KRJA 3O8PA 4WBBB 5CU0A 2HWOA 4MF1A 2C5OA 3HMMA 4FTKA 2ITYA 2UZEA 4MQ2A 3F5GA 3OS3A 3OTUA 2QCSA 3P7CA 4JDJA 4RLLA 4C8BA 1PMVA 3P1AA 4BIBA 4C4HA 4JAJA 1URCA 2YERA 3TIZA 4L3PA 2ZMCA 4A9RA 1BMKA 3O7LD 4X2KA 1ZYDA 2PZYA 3RHKA 2QNJA 3S3IA 3W2SA 3EN7A 3KVXA 4F99A 5LMKC 2C6EA 2IZUA 1DI8A 2XKFA 3RM7A 3HAVA 2GNFA 3CEKA 3E8EA 2YLEA 1DS5A 4EOLA 4O86A 3RP9A 3PSCA 3NIEA 1SYKA 3KN5A 4IM3A 3GC9A 3O96A 4FX3A 2IZTA 2ITPA 1WCCA 2XIRA 4RJ3A 3FXWA 3E88A 3QCXA 3TTJA 3VBWA 2B9FA 3L8XA 1Q4LA 3OBJA 4DFNA 5JRSA 1JKSA 4F4PA 2GTMA 3TG1A 3NX8A 2VGOA 3G9NA 4R3CA 3EQDA 4JQ8A 1WBPA 4BI2A 3LXKA 1NVSA 4W4YA 3UDBA 3HV4A 3EL7A 4F9YA 1BLXA 2XYNA 4MXYA 3EQFA 3SDJA 2VU3A 4D2SA 3O7LB 2W4KA 4PX6A 2WQOA 5EM6A 5BQ0A 4OTFA 3HMIA 3KCKA 3KF4A 3RZBA 4F1OA 2UW4A 1XH5A 3FQSA 3MY5A 1E1XA 3PY0A 4TXCA 3MVHA 4U97A 3D0EA 3T9TA 5CAOA 3ID6C 4U80A 3FZOA 2YHVA 4JL9A 1OL7A 4USDA 1ZAOA 4AGDA 5LQFA 5CNNA 2HY0A 3TZ7A 2YIRA 3NYOA 5LARA 2GQRA 4QP3A 4N0SA 2JKQA 3BBTB 3NNVA 3V5TA 5CTPA 2J5EA 4XG7A 4RZVA 4FV7A 4HCVA 3UZPA 5LOHA 3DFCB 2QKRA 3FY0A 3KL8A 4QT1A 1YDTE 4PL5A 3UVRA 4BTFA 1Z9XA 3BYUA 3DQXA 4IE9A 4JBQA 4L3JA 4PPAA 1XR1A 4X0MA 4H1MA 4D2WA 3G33A 5I9XA 5I9YA 2I0YA 4ASEA 4DT9A 2UUEA 1LUFA 3R9HA 5J9YA 2OGVA 4FT3A 1B6CB 4L46A 4RIWB 1SVGA 4TT7A 4DGGA 3FI3A 5J7HA 3JYAA 4ZSEA 3DDQA 2XYUA 2PE0A 3UODA 5DRBA 3BYOA 5E8YA 3KXNA 4EUUA 3AT2A 3BYVA 4G31A 2GS2A 5CNOA 5IA3A 2IJMA 3D94A 3UYTA 4WA9A 4C4GA 4EZ3A 3D5XA 3UMWA 2Y4IC 4LOQA 1YVJA 4AOIA 2FSTX 4JG7A 2KULA 5CEKA 3VW8A 1YW2A 1UVRA 3LLAA 3ORMA 2OJFE 5IG1A 4NIFB 4W8EA 3DB8A 3F5UA 3TNWA 3I79A 2Q83A 2R3OA 5JFXA 5JH6A 3TIYA 2QOBA 2YFXA 4DFXE 3A99A 3IECA 3GENA 2UW7A 5CANA 4TYHB 4GCJA 2XUUA 5EW8A 5TOZA 2X7FA 1JBPE 3R2YA 3R8MA 3BWJA 2OIBA 3PJ3A 4AW5A 3AC5A 5AIRA 5DRDA 2ZV9A 3MFTA 1XBCA 2PMIA 2O64A 4YTHA 4JS8A 2ZB0A 4X3FA 3GI3A 4DEGA 1Y6BA 4ARKA 2PPQA 4OT6A 3BI6A 4CFWA 2QOKA 1ZOHA 4OBOA 5CZIA 5DGZA 4Y5QA 4JG6A 5M56A 5FTGA 4LV8A 1ZRZA 2W1HA 3Q9YA 3OEFX 3U55A 3Q53A 5HVKA 3S2PA 3QKKA 1WVYA 4UWCA 3TCPA 4PNIA 4G3EA 3DY7A 4B7TA 2QOHA 3DBQA 3DK3A 2Y9QA 4O0TA 4XBUA 5HESA 4O22A 2UV2A 4MHAA 4IM0A 4QP4A 5KX8A 1JPAA 3LFDA 4DYMA 4LG4A 1CMKE 2X2MA 3BPRA 2RFEA 3ULIA 3PG1A 3H9FA 2F49A 1H00A 3NR9A 3RINA 1IA8A 3KMWA 1B39A 3HV6A 4BCJA 1U59A 3C51A 4J53A 2C5XA 5HE3A 1LR4A 4EH6A 2Z7RA 4O1OA 4YTIA 4DH8A 5IZFA 2PVJA 2X7OA 3DFAA 1LPUA 1VR2A 4AQCA 4QTBA 3TEIA 3NCGA 4D2PA 3O0GA 4FVQA 4RIXB 5AR5A 3BU6A 1U4DA 3ETAA 4F64A 2F2UA 5I9ZA 3KXXA 5FP5A 4DLIA 3KXMA 3LHJA 4C35A 5KHXA 3FLSA 3UG1A 2O8YA 5HLPA 4EH7A 2AC5A 4P7EA 5AUTA 5CSPA 3A62A 5HNIX 3DKFA 2RG5A 1APME 2BMCA 4RWJA 3H0YA 4F9WA 3TNHA 1BUHA 4FTQA 2YCQA 3VQUA 3I6UA 4J98A 4D4SA 3Q32A 2X7GA 3H9OA 2X8EA 1JSVA 2ETRA 5J95A 2EXMA 2NRYA 4MNEA 4XV1A 5FG8A 3GEQA 3P7AA 4BCNA 3RHXA 4DA5A 2XA4A 4GT4A 3W2QA 4GJ3A 5IQBA 3VS2A 4FTAA 4FGBA 3TUBA 4PDYA 2B9HA 2W06A 4QPMA 5HNBA 4EOMA 3JXWA 1OB3A 2R3PA 4YZNA 2BKKA 4G3DA 4WHZA 3ZSIA 5EW3A 5TR6A 5CEOA 4D0WA 4TTHB 4ANQA 4KIKA 2GNHA 1JSUA 4O82A 3QAME 2ITVA 3Q4ZA 4FV6A 4JR3A 2CGXA 5HU3A 2B0QA 2OICA 1YQJA 1DAYA 2AC3A 2QURA 4ZY5A 3PFQA 4D28A 4ALUA 4JBPA 3AD5A 3FAAA 4PL3A 5EYKA 1OITA 2WZJA 4DH3A 3L9PA 5CALA 5AV0A 5BUIA 3PLAE 4N6ZA 4E5BA 4BHNA 3C4FA 2CNUA 1I44A 2ZM4A 4FTNA 4O7YA 1PHKA 4NCTA 3P23A 4D4RA 5HVJA 1U54A 4CCUA 5B2KA 4CFUA 4NTSA 3G6HA 5DVRA 1BI8A 2Y4PA 3R30A 4I5MA 2AUHA 1BKXA 2XS0A 3T9IA 1R1WA 2WNTA 1PMUA 3PRFA 5CASA 3PZEA 2HENA 2J5FA 2C6LA 4FNZA 4RT7A 3TV4A 3BE2A 4GL9A 3R0TA 5FTOA 5TF9A 4UBAA 2JKOA 3I81A 2BROA 4O0YA 5LCKA 4FEXA 4FV2A 4FZDB 4YJPA 2PZIA 3OMVA 3EL8A 4DH1A 3FZSA 4OTIA 4MVFA 4GK3A 1W0XC 3ZXTA 1BYGA 1O6YA 2P4IA 3E8NA 3DA6A 3QTRA 2PMNX 5AP0A 4ZJJA 4LGDA 5D41A 3B8RA 3D83A 3VUIA 3SRVB 1JSTA 3JY0A 2E9UA 4WD5A 2IZSA 2XCHA 3K5VA 5GJDA 2W96B 4FV9A 3UVPA 4D2VA 4DINA 1PYXA 2OJ9A 4KS7A 5EOBA 3AD4A 4GEOA 4RJ5A 4UMTA 3VUMA 3NSZA 3BEAA 3BCEA 3QLGA 4YP8A 3VUKA 4BI0A 5K4IA 4RX7A 4C37A 2OO8X 4FSUA 3MPTA 4L6QA 4YR8A 3QCQA 2BTSA 5CF8A 3I60A 3SW7A 3AQVA 2ZV2A 4D4YA 2V55A 4KIOA 4FKSA 4GFOA 5FRIA 3FMKA 3R04A 1IAHA 4LRKA 4R1YA 2YABA 3LOKA 3ACJA 3IDBA 3TDWA 4CLJA 4YPDA 4XNEA 5EI8A 1J91A 2WTJA 3K3JA 2C47A 3FMMA 2R3QA 5E1EA 1ZYCA 4QMWA 4ZTQA 5HG5A 3ZLSA 4FV5A 4YU2A 2OJIA 2WXVA 5EYDA 4M13A 2ZV8A 3V8TA 3ZH8A 3ZO2A 4HOKA 1U46A 4E6DA 5LJJA 3NPCA 2JIVA 5EQEA 5GHVA 4BGGA 3T3UA 3HMNA 1Z57A 3B2TA 2XRWA 1KOBA 3SQQA 3WILA 4MBLA 4MX9A 3C4WA 4RJ6A 3U51A 4GH2A 2Y6OA 3QQHA 4EHEA 5AA8A 2XJ1A 4NJ3A 2WGJA 4IDVA 3SXSA 4BBFA 4LMNA 1M7NA 4YUQA 4QRCA 4E6AA 5I5ZA 3L8PA 3F61A 1LEZA 4FYNA 1VYWA 3QHWA 4WRSA 3OHTA 3RK9A 3ZLWA 1ZYJA 4G3FA 4F1MA 4C36A 5IDNA 3R1YA 3I0OA 3FI4A 4BWXA 3DU8A 3QXPA 3F7WA 3BRBA 2DUVA 2JDSA 3BHTA 3NMUF 3HRCA 3I7CA 1P5EA 4CRSA 5BYYA 3HV3A 1Z5MA 3P78A 3OCBA 3HAMA 5L2WA 2C5YA 2YIQA 4R3RA 3LPBA 4TNDA 2UVZA 3TJCA 1XJDA 2PVLA 4BWPA 4OR5A 1SZMA 2OH4A 3QC4A 3VBYA 4E4LA 5F20A 2YM7A 3WBLA 3MH3A 2C6IA 2G1TA 2WEVA 3U8WA 5HTCA 4CGAA 3QTQA 1R78A 3RBWA 3A7JA 2W1FA 1NVQA 2GHLA 4ZMFA 2OXYA 4LL0A 3VO3A 4DC2A 5IEVA 5A4CA 5L2SA 5DT3A 4RSSA 5E8VA 3DT1A 1P14A 1PXOA 2GNJA 3IW4A 4PMMA 2C6TA 3KK9A 4F7NA 5CEQA 4MD7E 3F5XA 4HGTA 4J97A 5CVHA 4XOYA 3VRZA 3O8UA 4E73A 3FLZA 5LMBA 3IW7A 2R3NA 3R7VA 3F9NA 4RJ7A 4CD0A 1OIYA 4NTTA 3COKA 3FY2A 2ZM1A 4FVRA 2I40A 4F7JA 2Z7LA 1YDRE 4F1TA 4M0YA 1ATPE 5K3YA 3LFCA 5M55A 4RQVA 3LJ0A 4C4JA 4FV4A 1BX6A 5DEWA 3FI2A 5CS6A 3FSKA 3RK7A 4O7ZA 4QQ5A 4CFVA 4I92A 3RMFA 2Z8CA 1REKA 3QQFA 2VAGA 3QYWA 4J7BA 4G6LA 2EWAA 2VUWA 1UKHA 2QO7A 4F0FA 4YZDA 3FYKX 3BQRA 3GQLA 1B38A 1G5SA 4DF3A 2QLUA 2YJRA 1YXSA 2VWZA 3MVMA 3MVJA 4KRDA 5AP7A 4BRXA 3A4PA 4P5QA 4IWPA 2Z02A 2WTVA 2WTDA 1IA9A 1H1WA 3EIDA 4DBXA 4CVAA 3R7OA 2WQMA 3A61A 5CXHA 2EXEA 3FV8A 3UOLA 4TW9A 3HZTA 4RWIA 3R8PA 5HOAA 4WOVA 4BZOA 2PE1A 5FQDC 2BZJA 2HCKA 2RL5A 4PMSA 3D7TA 3HDMA 4MCVA 2RG6A 5DR2A 2VTIA 4D5HA 3N4TA 2BZKB 4D1SA 3A4OX 3QALE 1JVPP 4FKGA 4I6BA 3KVWA 4FE2A 4DG2E 2AYPA 5DT4A 4WIHA 3SXFA 4EK6A 4WG4A 3ZS5A 3WZEA 2C5NA 4F63A 1ZYLA 4AG8A 4C59A 3QHRA 4XMOA 4AT4A 3II5A 2CN5A 2R3FA 2XNBA 2B54A 3OUNB 4M69B 4X6RA 2ZM3A 2YIWA 2WTIA 3PWYA 3LFQA 2HK5A 4EWHA 1K9AA 3A7GA 4ZSJA 1ND4A 4PMTA 4ZLYA 3M2WA 3Q5ZA 3CBLA 3DXPA 2GCDA 1XO2B 1MRUA 1H1SA 3IO7A 1UKIA 1NA7A 3LCSA 4BI1A 5LMKA 3OXTA 3FUPA 3QYZA 4AE6A 4FSMA 4AW0A 4R7HA 3I6WA 3QC9A 2R3IA 4CV8A 4TYGA 4MWIA 5L6PA 4MD9E 3MH2A 1YHSA 1GZNA 2W9ZB 4L67A 4N57A 1SM2A 2CPKE 3E93A 3ZM4A 2PVMA 2YM5A 4JJRA 4PV0A 4QMZA 1Q8TA 4UMQA 3ALNA 3AMYA 5JT2A 1NT2A 4YHFA 4HVIA 4JVGA 1O6LA 5ETFA 3GC8A 3ENMA 5ACBC 3NS9A 3R73A 4QMMA 1O9UA 4FODA 3ZRLA 4X3JA 5IUGA 3QA8A 3MFUA 3GC7A 4NM5A 3QZFA 1WVXA 3IW8A 5C27A 3PPJA 1FQ1B 3R00A 3V5JA 3O51A 3V51A 3TACA 3ZU7A 3F3TA 2E9NA 1ZZ2A 5AP1A 1QPDA 5FM3A 3R9NA 3UPZA 3TV7A 4USFA 4ZS4A 4CCBA 2C30A 2JIIA 3ODZX 4BIEA 4CSVA 4JRNA 4NYEA 3HGKA 2VO7A 2VWXA 4BBMA 2V5QA 3HUBA 4MK0A 3Q6UA 5FBNC 3D2KA 3S95A 4KUJA 5A14A 4AN3A 4BTMA 1YI3A 1PXIA 4GYGA 3QX2A 4Y95A 2Y6MA 4FF8A 4XUFA 4DEBA 3OROA 5HIBA 1GIIA 3CSVA 3VHKA 4RGJA 4H3PA 1UWJA 2XZSA 1IASA 5KMNA 3IDCA 1KWPA 3MSSA 1WBWA 3EWHA 3IONA 1GJOA 4UEUA 2PVFA 1IAJA 5EOLA 4BGHA 3D5UA 1YWNA 2C4GA 3TZ8A 4ANSA 3C0HA 3EZRA 3QUDA 3JS2A 3OTVA 3MWUA 5EHLA 3LFNA 3PYYA 2XIYA 1FVTA 1OL6A 4MWHA 2HOGA 5AUYA 2IPXA 3PWDA 2PVYA 3AG9A 2CNQA 4AOJA 4IACA 1WBNA 3EMGA 1CTPE 3EYGA 4YJSA 3FMHA 5M4FA 2E9OA 2XNNA 2ITWA 4G16A 4BFMA 5ANDA 2LGCA 2Q0NA 2IO6A 1YI6A 4XP3A 3G51A 5KZIA 3N9XA 4FIFA 1M14A 4AT3A 2P55A 3PXKA 3DQWA 4QP1A 5IUHA 3C4XA 4FKQA 4IDTA 3EN5A 3VBXA 4AN9A 4U40A 4NW6A 5CU6A 3QD4A 3PIZA 2BR1A 2W5AA 1KE5A 4YHTA 1Y8YA 4Y73A 5HE0A 2RFSA 2X81A 4HZSA 5L6WL 1Q62A 2IVTA 5DE2A 4QP8A 4FKUA 1XKKA 1IEPA 3KB7A 4NZWB 3FC2A 5D12A 2GNIA 4O2ZA 5J87A 3IOKA 5HHWA 3CQEA 1YOJA 2W1EA 2XM9A 3IGGA 3V5QA 1OIUA 3KREA 2WIPA 2WMTA 3FZPA 3OT8A 3S4QA 2IWIA 2BIKB 4ERWA 4CG8A 2OK1A 5EK7A 4XV2A 2OZAB 3ATSA 3ZFYA 3ET7A 3JPVA 1IR3A 1PRYA 4HCTA 2P3GX 3LXPA 2XKEA 4AS0A 4R7IA 1S9IA 5IQEA 4CXAA 2PSQA 5DOSA 5EYCA 2B55A 5A6OA 3VS4A 3WF9A 3S00A 3FJQE 3CXWA 4IAYA 1OPKA 4U8ZA 2J4ZA 4YGAA 3TKUA 3DB6A 3H10A 2B9JA 5CAQA 2RIOA 2FYSA 4FK6A 3R7YA 4QMNA 5ANKA 4WSYA 1UV5A 4NU1A 3ORLA 5CX9A 2GTNA 2BHEA 3M42A 3PA4A 4Q5HA 3VHEA 3BHYA 4C61A 1Y6AA 3N4UA 3LCTA 5H8BA 1M2QA 3OFMA 3C50A 3VC4A 3RPSA 1A9UA 3V5WA 4DH5A 4FC0A 3PLSA 4QMSA 3NUXA 4IAKA 2OXDA 3UVQA 1Q8UA 2SRCA 4RLKA 4FT5A 2J9MA 3LQ5A 3K54A 4IBMA 1YOMA 1UA2A 4KB8A 3D7ZA 3TDVA 3TT0A 4E5WA 5C26A 4EKKA 2J51A 1R0EA 2W7XA 3PJ2A 3UPXA 1L8TA 3NDMA 3DKCA 2W1DA 4PL4A 4YJVA 2GFCA 1F5QA 1TQIA 4QTCA 4WG5A 3UMXA 5BUJA 3F7ZA 2PL0A 3OVVA 4LRMA 2ETKA 3QU0A 4CYJA 1Q61A 4ID7A 3KN6A 3GFEA 4FKOA 4FT9A 3BLQA 3SGCA 2XNEA 3PP0A 3COIA 2Q0BA 3ZO1A 2QC6A 3HV5A 5HX6A 4G2FA 4PUZA 3LVPA 2UZNA 4MEDA 5CEIA 4X2NA 4S30A 4BCPA 5JFVA 3MIYA 3ERKA 2VWIA 3BEGA 3V5LA 3OWKA 4NW5A 2X4FA 5M06A 3VIDA 4EEVA 3CR0A 1Q3WA 3OOMA 4U0IA 5FBOA 3WZUA 2UZLA 4RVLA 4UV0A 5CI6A 4U42A 2Z2WA 1Q97A 3C5UA 4TN6A 1W98A 4BDKA 3A7IA 5C03A 2PMLX 2QU6A 5CU2A 4PP9A 4BDBA 2VTOA 3ACKA 3NGAA 4HPTE 4I0TA 4EYJA 5KMKA 3TZ9A 1JOWB 3EQGA 4ITHA 4EK5A 3FE3A 1BI7A 4NT4A 1XQZA 4RX9A 5F9EA 3FSFA 4AU8A 3KULB 4OTHA 5JEBA 4YNOA 4AN2A 4B99A 1SNUA 3D9VA 1XH9A 2XBAA 4I1ZA 3PVUA 4I22A 4QO9A 4C2VA 2RFNA 3CTJA 2I0HA 4QOXA 1W84A 5A4EA 2H6DA 2CKPA 4YJRA 3C1XA 3ZZEA 4HVHA 3MIAA 4E7WA 4CG9A 3OD6X 2XCKA 3FL5A 3LCKA 3NWWA 1H1RA 2PU8A 4RZWA 4DGMA 1O6KA 5KZ0A 1KE7A 2YAAA 3OY1A 4O0WA 4ZTNA 2OJJA 2WOTA 5HORA 5L4QA 4FSTA 2XK4A 2W4JA 2JDRA 4NUSA 2BZHB 3MN3A 4IVCA 5KBQA 5I9VA 4YURA 1OBDA 2CLXA 4FZ6A 4L45A 4EBWA 4NM0A 4OTQA 2ITNA 4QTEA 4EH2A 4Z7HA 3OWPA 5T3QA 3CKXA 1ERKA 4IHPA 1F3MC 2WELA 2VRXA 3DNDA 3KXZA 3QRUA 5AAEA 2BAJA 2C3IB 4C2WA 4EHVA 2I0EA 3COMA 2VTPA 2F2CB 2WTKB 3FMJA 3OUKA 4BICA 5DN3A 4H05A 4FSZA 2RSVA 1Q3DA 4JAIA 4QYEA 3VS3A 3KXGA 4IZYA 3DKOA 4ZTLA 1M2PA 4DE4A 2V62A 5E91A 2ZDTA 3NUSA 3TZMA 1RW8A 5FLFA 4QMTA 2PUIA 1QPJA 2NO3A 2JEDA 3LFAA 4TWOA 5FXQA 2WU7A 5KMIA 5GINE 4Y8DA 4AZEA 3TWJA 3JY9A 2CCIA 4PQNA 1A06A 3QTZA 4QMLA 2PVNA 3UO5A 3EQHA 5I3RA 1OL2A 2YA9A 2W99B 4JLCA 3F5PA 4ACMA 4J71A 5FDXA 1XH8A 2B9IA 4Y46A 4FIEA 2ITQA 3V6RA 2XEYA 4TYEA 3PVGA 2DQ7X 4LM5A 3W18A 4JT3A 3UO6A 4CZTA 5AJQA 2QOCA 4E5AX 4IVBA 3ZXZA 3QGWA 1Q24A 4L52A 2A1AB 4NKSA 4P4CA 3FQEA 3A7FA 2QOOA 4BDAA 2CSNA 3FZRA 4XJ0A 5DBXA 3DGKA 4EQCA 4H58A 1J3HA 1F0QA 4XG3A 2OXXA 2ZYBA 1OPLA 4EJ7A 2I7QA 5M07A 2JDTA 3VBVA 5M44A 3MH0A 5E8TA 3VULA 4Z3VA 2P0CA 4FV3A 4UMPA 2IVVA 2Y7JA 4RQKA 4AP7A 3U9CA 5AR4A 3U6JA 1H24A 1HOWA 4F9AA 2WQBA 4ZS0A 4KABA 4Y83A 2IZRA 3P4KA 2WKMA 1UNLA 2UZDA 3BHHA 3QGYA 1VYZA 3Q9WA 3VWAA 3WZKA 1OM1A 3DLSA 3R63A 3ZO4A 5C01A 5HX8A 2BRGA 3QTXA 4EK3A 2G2HA 2YIYA 3G0EA 1CSNA 3COHA 4FIGA 4TNBA 2BRMA 4FIJA 3P86A 4KBCA 3NVMB 2YITA 2OU7A 1JNKA 3E3PA 3BWFA 3HMPA 2RKUA 5LVMA 4I94A 2O3PA 4O7RA 5I0BA 3LCDA 3AMBA 2UW5A 5CU4A 4Z16A 5IEYA 2P2IA 3CP9A 3FXXA 3ROYA 5EM8A 3F3VA 4AUAA 4AZSA 4YJQA 5J5TA 1G3NA 1WBVA 2CGWA 3I4BA 4LGGA 4U41A 5F94A 5HZNA 4ASDA 5AP3A 3RI1A 3CY2A 2IW8A 4N6YA 1GNGA 2IVUA 3NEWA 1JAMA 3KRWA 4HJOA 2JKKA 4I3ZA 3Q4UA 2QVSE 3LW0A 5IA2A 1W7HA 4M67A 5BYZA 1YWVA 2GHMA 1U54B 4EOQA 2A19B 4WUNA 3QL8A 5CI7A 2H34A 3P5KA 3PE1A 4FKVA 1OL5A 4BIDA 1R3CA 4A7CA 4RA4A 5EQPA 1KSWA 4L01A 5HE2A 5AV1A 1ZZLA 2ZDUA 3CLYA 4HNFA 5E7RA 3A60A 3R9OA 4KBKA 4YZBA 4UMUA 2ZJWA 2CKOA 4U45A 4OTDA 3GCQA 3FLWA 1E9HA 3IQ7A 4R3PA 5L2QA 4EI4A 3WARA 3RAKA 4OTRA 4JX7A 4W4VA 3VW6A 3ELJA 3NUAA 5K5NA 3LFEA 4JG8A 5D11A 5EFQA 4BR3A 5GZAA 5KMMA 2PTKA 5H2UA 3RALA 1STCE 2VD5A 4IAZA 5I9UA 4U3YA 4XOZA 2CGVA 2VTQA 4K33A 5B2LA 4AA5A 4ANLA 3CPBA 4TYHA 1FPUA 3EQCA 1YXVA 4J8MA 3TKHA 4K2RA 3NVKI 3E63A 5E92A 3R1QA 5AX9A 2YAKA 3NYXA 4BDFA 4H36A 3R22A 3VJNA 4M97A 5HG8A 3WF5A 3G15A 2G2IA 4EOKA 4O7LA 1Q41A 1XWSA 2B7AA 1Q8YA 4M84A 2QR8A 4EHZA 4O7TA 4AOTA 5JGDA 4TWNA 1BL6A 4BKZA 3AT3A 4L68A 3R8ZA 4FTOA 4YZ9A 4C3RA 3W55A 4A4OA 2CJMA 1M17A 4N70A 4HYHA 5H8GA 3ZSGA 1J7LA 3AC4A 2O65A 4FT0A 4RVMA 4JX3A 2H8HA 3ZHPC 2YCFA 4E6QA 4QMQA 1KV1A 1QCFA 2QLQA 2GS6A 4EH9A 2QQ7A 4ALWA 2XRUA 2JDVA 4XG4A 3CGOA 3Q9ZA 3NRMA 3CE3A 4LRJA 2PUNA 3LLTA 4I5CA 2NP8A 1EH4A 3DTWA 4IZ5A 4YC8A 4BL1A 2R3LA 4D1ZA 3FZ1A 3GOPA 4MBJA 3UTOA 3MS9A 1YRPA 2C0IA 1FINA 2YDKA 4OTGA 3WYXA 5JK3A 3SA0A 1J1CA 3DCVA 5DG5A 3HRFA 2F7XE 3ORXA 4IB0A 3PPKA 4JI9A 2B1PA 4IX6A 3L9LA 5B7VA 2YIXA 1OUYA 5A3XA 4NK9A 2OWBA 3GVUA 4IB1A 3ITZA 5E1SA 3VBTA 4FBXA 4GG5A 4RIXA 1Q99A 4C34A 1YHVA 4I5HA 5HD4A 4YBKA 3ALOA 3PUPA 4B9DA 5CEMA 3GCSA 3EYHA 5L3AA 3PPZA 2B53A 4TRLA 4BKYA 4X21A 3OOGA 4FVPA 1RQQA 1PYEA 3W8LA 2R0IA 5B0XA 4X7QA 2GSFA 5HCYA 3CTQA 3UZRA 5AR8A 4O84A 4KKEA 2ZMDA 4DITA 2XNMA 3M11A 3MV5A 4DGLC 5CXZA 4OBQA 3KC3A 4O0RA 4O0XA 3FPQA 4B8MA 2W1GA 3T8OA 3NIZA 3ODYX 4IXPA 2PULA 1H08A 4OGRA 4DAWA 5I9WA 2OKRA 1KE9A 2XK8A 3QWKA 5J9LA 3E5AA 5AM7A 2XB7A 2R7BA 5D10A 2A0CX 4EORA 4AWIA 2BUJA 3HP5A 5HBJA 4R6VA 3R7GA 4XG8A 4W4WA 5IKWA 3QRTA 4I4EA 2CGUA 4IWOA 3WF7A 3P9JA 5IMXA 3MYGA 4I0SA 4EH4A 2VTLA 4XG2A 2X1NA 4MXXA 5ETIA 3T3VA 3VS1A 3N51A 3FZTA 5M08A 3V01A 4BDCA 2JITA 2PVHA 4AACA 4OW8A 2WMWA 2FUMA 1OMWA 4WNPA 5ANOA 3SOCA 2YISA 4PNKA 3F88A 4PPCA 1T46A 4BHZA 4QP7A 3BBWA 3BU3A 4UWYA 3ROCA 5L6OA 2YM6A 4UALA 4FUYA 2OF4A 2G9XA 4IZAA 3HLLA 3CS9A 5CSWA 5HCZA 2G01A 4EH5A 1ZOEA 4QQCA 4GS6A 5HD7A 5IA4A 3QKMA 4XS2A 2ZAZA 1H28A 3OWLA 2C69A 3WIGA 1PXKA 3QA0A 3KF7A 1DAWA 3QZHA 3SHEA 4U43A 4FKTA 4V05A 4XH6A 2OSCA 2QR7A 3EN9A 4KWPA 4G5PA 3RZFA 4Z55A 1XH4A 4CFNA 2JLDA 4ZJIA 4XLIA 3U6IA 5AX3A 1OKVA 3ZM9A 4CZYB 4KAOA 3NAXA 3EH9A 5ANGA 4YTFA 4GG7A 4IADA 5CYIA 2XBJA 5K5XA 5GIPE 3AC3A 4QMOA 2VTNA 4R77A 2WEIA 3SW4A 4KSPA 3TTIA 1H27A 3CGFA 3I5ZA 3RNIA 4QP6A 2OIDA 1FMOE 3A8WA 4YLLA 3PJ1A 2ITTA 2ITOA 2FSOX 2V22A 4P5ZA 4PY1A 2ITXA 2QI8A 3W1FA 3Q6WA 4RIOA 3H3CA 3SRVA 2XKDA 3RVGA 3NNXA 3EKKA 3FMDA 4ITIA 3MFRA 4LL5A 4YSMA 1FMKA 3D7TB 2FSLX 5HU9A 5CT7A 5I3OA 3R9DA 2WMVA 2YJSA 5AEPA 2OF2A 4FSRA 4CEGA 3DOGA 5F4NA 2VTSA 1TQPA 2PE2A 2O0UA 1OPJA 1FGKA 1ZLTA 2FB8A 2CMWA 5EI2A 2WTKC 2WMQA 4IAAA 3A8XA 4M15A 4WT6A 3ORPA 3FHIA 5JFWA 4Q9ZA 3ZDIA 4ZP5A 3EB0A 4O7VA 4DTBA 2ESMA 4RRVA 2CCHA 4JXFA 5EI6A 3TNQB 5M53A 5CAPA 5EYMA 4ASZA 3R8LA 4C33A 2R3MA 1DI9A 4HYUA 3GU4A 2XF0A 4G6NA 2WPAA 4N4SA 4IVAA 5BMSA 4USEA 3NUPA 3PJ8A 4M12A 4DFYA 5AP5A 3BHVA 4DEDA 3V6SA 2GHGA 4E93A 5AP2A 4YSJA 3QD2B 4UXLA 5FGKA 3KXHA 2YLFA 4PMPA 1AGWA 4FUXA 2WMRA 4L9IA 3VVHA 2F7ZE 3V3VA 5HIEA 2YM4A 4JRVA 3W33A 2CN8A 4S33A 3U4WA 4CT2A 3GCPA 3NAYA 3BIZA 3NW7A 4R5YA 2ITUA 4NFMA 2JC6A 3VJOA 4ACCA 3VNTA 5C4LA 4QMXA 2UZOA 4B4LA 1XHAA 4A4XA 2BFYA 3HP2A 3CD8A 3HNGA 3IW6A 4BTKA 3AC8A 2PY3A 3E92A 2PK9A 4FI1A 5J1VA 4RX8A 4M68A 2IW6A 2QKWB 2C1BA 4W9XA 4OAUC 1CKIA 3D5WA 5LVLA 4BZDA 1CDKA 2VX3A 3CIKA 3CQWA 3GP0A 1IRKA 3BV2A 3DBCA 4EHGA 4WG3A 3QQGA 3VUTA 4DFBA 3EJ1A 3R21A 4IFCA 2YM8A 3GC0A 5HEZA 4YJUA 2BIYA 4JIKA 4TL0A 4YZMA 3LJ2A 3NLBA 4ZSGA 3DAJA 5DR6A 4UY9A 3F3UA 5CQWA 4O7WA 1SNXA 2WU6A 1TKIA 1WAKA 5AAFA 4BY9E 3REPA 2HXQA 2QD9A 4C0TA 5CLPA 3MESA 2I6LA 2OZOA 5KCVA 4LQMA 5CVFA 4E4NA 5HICA 4KKHA 5HLNA 4RX5A 4WKQA 4M8TA 3ZOSA 3IK3A 3KKVA 4EC8A 4L8MA 3THBA 4I6HA 3K3IA 3EKNA 2C0TA 3O8TA 3PXRA 4GVJA 5CAUA 1VEBA 3RTPA 2J0MB 4J8NA 4EKLA 3MA6A 5EHYA 4IFGA 2GQSA 3PY1A 4RIYA 5IQDA 4U5JA 2YN8A 2Y8OA 4FTMA 1J7IA 1PXNA 3S0OA 2UW8A 2HWPA 3KRXA 2Y4IB 2YWVA 1KOAA 2ONLC 2QO2A 4EK8A 4G5JA 3Q2MA 4A9TA 2J0KA 5JGBA 5EM7A 2OW3A 3FKOA 1U5RA 2BALA 2BVAA 3HL7A 4IJPA 1IG1A 3OCSA 4WNMA 2GDOA 4AAAA 4BTJA 4D1XA 4ZLOA 5C1QB 4W9WA 1OL1A 5E8XA 2JFLA 2WQNA 5HLWA 4GUBA 4QQTA 4CLIA 3W2OA 4AA0A 3FLYA 3DS6A 2XH5A 2DYLA 3KRRA 4KNBA 3FKNA 4FSYA 4EQMA 1WMKA 3FLNC 3MPMA 4BDGA 3HKOA 3PVBA 4PF4A 1KV2A 4F65A 2UZVA 4L7FA 5EKNA 3IGOA 3L9NA 5CT0A 1PY5A 4BWKA 4V0GA 3QCYA 4H3QA 4UZDA 3DJ5A 3MY1A 1OKYA 3OP5A 4GVAA 2WOUA 3MB6A 5H8EA 3ZCLA 3VF8A 5J7BA 5LWMA 2GFSA 3D4QA 3QLFA 3VAPA 2HZ0A 3W16A 3G0FA 2RFDA 2A27A 4XBRA 4Q5EA 5HKMA 1Q8ZA 2R0UA 3ULZA 3OXZA 3PXZA 4EOIA 3R6XA 3FXZA 3U54A 3ZSHA 3F66A 3W2CA 4FA2A 4HZRA 4LGHA 3S1HA 1UU7A 5ANEA 4DN5A 3AGLA 4XG9A 2R5TA 5A6NA 4FGRA 5AMNA 3EQBA 4DEHA 3BGZA 4HYSA 4WSQA 4O0SA 3WZDA 3RCDA 4D2TA 3VS7A 5IH4A 3LKMA 3B2WA 3M1SA 4PWNA 5HGIA 3RM6A 4DFZE 3DAKA 5KO1A 4C02A 4CMTA 4LMUA 4DT8A 3ZRMA 2JGZA 3V8SA 3HMOA 3BU5A 2J0LA 5IQFA 3FLQA 4QYYA 4EH3A 3EN4A 4BDJA 4YTCA 5LVNA 2BAQA 1KUTA 3MI9A 5HBEA 3VN9A 1MRVA 3WOWA 5E90A 2BPMA 4M3QA 2UZTA 4ASXA 3SKCA 3UQGA 3UOKA 2BRNA 3WF6A 4NJDA 4Y5HA 1H01A 3UJGA 5CY3A 3BELA 2VNYA 4BDIA 4KBAA 4LFIA 4OAVB 4FIHA 3C4CA 1M2RA 3MJ2A 4EC9A 4EH8A 1PMEA 4TYIA 4DFUA 1PXJA 3R8UA 3DBEA 3OT3A 4TPTA 5IA5A 3HECA 2UZBA 4GU9A 3DJ6A 3ZUVA 4S2ZA 3TKIA 4CFMA 5IA1A 1LP4A 4FK3A 2Z60A 1JQHA 4PRJA 3VUDA 3PZHA 1WVWA 3LE6A 4I21A 5A4QA 4JOAA 2HZ4A 2W1CA 4HVGA 2WMXA 4GUEA 1YDSE 5K4JA 3MTLA 4E20A 4MF0A 1TVOA 2VV9A 2HIWA 4KRCA 4A06A 4AW2A 3G5DA 5AP4A 3GQIA 5HIDA 4ZZNA 3SG8A 4JNWA 4R78A 3O17A 3Q9XA 4FSWA 1H1QA 2ERKA 3C9WA 4Z9LA 2J7TA 2WTWA 3AC1A 3O71A 3QTIA 5E8UA 1MQ4A 2PMOX 4ANMA 1P4OA 3RPYA 5BX0A 5CWZA 5M09A 4BCGA 3BQCA 2QO9A 4S32A 3E3BX 2XIXA 3FMNA 2VTAA 2J90A 4FKRA 4FR4A 4LOOA 5ITAA 4W8DA 2HELA 3V5PA 2YZAA 3I1AA 4B6LA 1REJA 4XRJA 4GYIA 4X2JA 3CJGA 4NEUA 2VTRA 4X2GA 2NNWB 1W83A 2BFXA 4BVUA 5JFSA 2HAKA 3H30A 4FTRA 4DBNA 4AXAA 4TKSA 4DG3E 5IA0A 2J0JA 3VS0A 1M52A 1YXTA 3ORZA 4YJTA 2J50A 5IISA 3C4ZA 4RA5A 5TE0A 4ACDA 4QP2A 3AC2A 5FEDA 4XV3A 3ZFMA 4MXZA 4K9YA 2X2LA 3E64A 3UGCA 2VTMA 4GFMA 4QMVA 4NKAA 1OGUA 4NWMA 5K0KA 1OIQA 4WRGA 2IW9A 4DH7A 5DHJA 3CCNA 3F3WA 2BAKA 4EJNA 2W1IA 5A4LA 4IWDA 4RFYA 4NSTA 3PA3A 5DNRA 4HVDA 4XP0A 5AWMA 1AD5A 3PP1A 5J1WA 4YO4A 4FEUA 3OZ6A 3FWQA 3POZA 2JIUA 3EFWA 5CU3A 5E8ZA 4CNHA 4EOPA 5J5SA 5KKRB 1DM2A 4RMZA 3ANRA 3TNPC 3ATTA 4BCHA 2YCRA 2YCSA 1OECA 2XK9A 3KGAA 4FZAB 4QPSA 4BCMA 5J79A 5KHWA 3PJCA 4GKIA 4O6EA 3C5IA 4YBJA 2FH9A 3LMGA 4B0GA 5LCJA 3CTHA 1OZ1A 3KY2A 4OT5A 4YJNA 4IB3A 3PRIA 2PVKA 2QOFA 1R39A 5BVNA 1WFCA 4AZFA 1URWA 3F82A 3HVCA 1NXKA 5J8IA 2UZUE 3ZFXA 5JQ5A 2WAJA 1SVHA 3Q4TA 3AMAA 2JDOA 3H0ZA 1PXMA 2R2PA 4ONAA 3KA0A 1GIHA 4YHJA 2W05A 3PXFA 4HW7A 2ACXA 2VO3A 3GU7A 3HA6A 3I7BA 4FSQA 2W17A 1P4FA 4F70A 3QCSA 4D55A 4MBIA 3ZYAA 4MXAA 3WI6A 4OLIA 5L8JA 4J52A 4Z7GA 5A9UA 4JQEA 3KMUA 4A4LA 1E1VA 3MTFA 5BUEA 3DKGA 1UWHA 4F6WA 3NW5A 5G1XA 5T6KA 4IMYA 4RVKA 4LV5A 5FEEA 2WMUA 3QXOA 4L43A 3NYNA 4D58A 3RCJA 3BYMA 5FD2A 3Q96A 5HO7A 3EHAA 5CSXA 3MW1A 2R64A 4DHFA 3P0MA 2XNOA 4JR7A 5AR3A 1FBNA 3R1NA 1MRYA 4F09A 3CPCA 4FKPA 4YPSA 2QG7A 3FL4A 3L9MA 3MBLA 4U6RA 4GW8A 2VTTA 4C4FA 5EDPA 3FQHA 2YDJA 4PDPA 3HEGA 3LFBA 2XEZA 2XNPA 1Y8GA 4BCOA 5FEQA 3QUPA 4QNAA 3PSBA 4AE9A 5DFPA 4X3FB 1SVEA 3RWPA 5IQHA 3MDYA 5AUWA 2QOLA 3HX4A 4IW0A 2PYWA 2B4SB 5DLSA 2FVDA 2WMSA 3PY3A 1WZYA 2HY81 3G90X 4FTTA 2WIHA 3SV0A 2QHMA 3UIUA 5HTIA 2X6EA 3OEZA 2HXLA 4UWBA 2GNGA 3FBVA 3ZLYA 4PDOA 2QU5A 3C0IA 2QG5A 3KFAA 4FYOA 4C57A 4DLJA 3ZO3A 4ZK5A 2X8IA 1FVRA 5EDQA 3W10A 1J7UA 3ZBFA 5IQAA 1V0PA 4IX4A 2FO0A 2JD5A 3HRBA 3ORKA 2W0JA 2BTRA 3KMMA 1VJYA 4CKIA 3DXNA 2X0GA 3R7UA 5E4HA 3LQ8A 1XBAA 2ZOQA 2WQEA 1ZWSA 3MY0A 1K3AA 4FTUA 4IX3A 1BL7A 3U87A 4APPA 4EL9A 3UQCA 4A9SA 2VGPA 3FKLA 4MNFA 5C4KA 4QD6A 3MFSA 4II5A 4KA3A 2X9FA 4FKJA 5L8KA 3D14A 4MH7A 4LUEA 3EZVA 2R9SA 3LM5A 4C4IA 3DAEA 1UNHA 2P2HA 5IU2A 5CF4A 3TV6A 4CZUA 1QPCA 5A54A 1W8CA 4YLKA 4IZ7A 4XRLA 5IF1A 2PUPA 4JBOA 2J0IA 4L3LA 3CQUA 5DIAA 2OJGA 4AA4A 4ZTMA 2OH0E 2HW7A 2R7IA 2R3GA 5BVDA 4DTAA 4KS8A 2XJ0A 4FKLA 2V7AA 5K0XA 1S9JA 3KULA 4MNEB 1OKZA 5A46A 5AUUA 4GMYA 1GY3A 2WB8A 4O27B 3RPVA 2W5HA 1UNGA 3K2LA 5BYLA 5CSHA 1RE8A 4UZHA 5GNKA 4JBVA 3ANQA 4K0YA 1UU3A 3QTSA 4M0ZA 5T68A 4D2RA 5IMEA 1XH6A 4IWQA 1OUKA 4IC7A 4ZSLA 3P08A 5HNGA 4I93A 5CEPA 3I0QA 4FZ7A 4MKCA 4V04A 4E4XA 4NFNA 5HQ0A 4Y85A 2YWPA 3WYYA 4AZVA 4IAFA 5BVOA 4D9TA 4ERKA 2OFVA 3DLZA 4KIKB 2YACA 1ZY5A 1GOLA 4O81A 1UU8A 1MQBA 3LCOA 4HCUA 2UW9A 3JVRA 3QQJA 3SLSA 3SOAA 4BGQA 2EU9A 2ITZA 3UQFA 1OKWA 4O96A 3VS5A 3OW4A 2WD1A 4XX9A 3U9NA 3FEGA 3QX4A 4FKIA 3BKBA 4UYAA 4O83A 2EVAA 3R01A 4BBEA 3IOPA 4TWCA 1L3RE 4BB4A 3LXLA 3CC6A 3SXRA 4HGSA 5C8MA 4F7LA 3PG3A 5AADA 2XIZA 2X39A 3OCGA 4FNWA 1GZOA 4ZTRA 5FM2A 5IQIA 4RC3A 4K11A 4W4XA 5GJFA 2J2IB 4RIWA 5GZ8A 3VUGA 2HZNA 5DWRA 5AUXA 2PZRA 3PTGA 3IG7A 2VTJA 3LFFA 4GIHA 4WBOA 5AV3A 5HO6A 5M4IA 3E8DA 4J95A 5IH5A 4GIIA 3PIYA 3UC4A 4ZAUA 4HYIA 2C68A 2XK7A 2C3LA 4AGCA 2CDZA 3BX5A 5CENA 5IEXA 4I20A 4ZEGA 1PW2A 4YNEA 4R8QA 3U6HA 4PTEA 3HV7A 2UW3A 4MYGA 4NIFA 4C38A 4ITJA 3PXQA 4RWKA 4O1PA 5GZ9A 1M7QA 4E26A 5AP6A 2VWYA 3LIJA 3RNYA 2F9GA 3A2CA 5KE0A 3DZQA 1YI4A 3CKWA 3PA5A 5K9IA 2WFYA 4IAIA 3F2NA 3EQPA 2IN6A 2VWBA 3EOCA 2Z7SA 1WBOA 4FTCA 5DH3A 2O63A 4RPVA 2WMBA 2F7EE 4BDEA 5FTQA 3AOXA 1NY3A 4CYIA 2X2KA 2VX1A 1JKLA 4FG8A 4K1BA 2P33A 3HA8A 4H1JA 2OFUA 4O2PA 3UO4A 3ZEWA 5H3QA 3ZMMA 4FEQA 4ZY6A 4D4VA 2OBJA 4H39A 4QP9A 2ETMA 4MAOA 2PVRA 1I09A 3EFJA 2JBPA 3BV3A 4FL2A 5DT0A 4B8LA 3F2RA 3GBZA 4DEEA 1JWHA 4FIIA 3DV3A 1AQ1A 2VO0A 5HI2A 3SC1A 3F2AA 2QHNA 3P7BA 3MGYA 4EYMA 4AX8A 2IG7A 4ENXA 3RKBA 2F4JA 4L53A 3BGQA 5C9CA 3PE2A 3DNEA 5TO8A 4ACGA 5KNJA 3C0GA 4KIPA 3ORTA 5M57A 5ETCA 3TNIA 4EOJA 3MVLA 4FV1A 2CHLA 3AGMA 3PIXA 1OBGA 1PJKA 5CVGA 2HYYA 3B8QA 2NRUA 4E8AA 4F08A 5KMJA 3QZGA 3F69A 4FEVA 2X8DA 5IUIA 4DTKA 5EG3A 2DS1A 2XM8A 2VZ6A 4QMUA 4A9UA 1GAGA 5E8WA 4PP7A 1HCKA 5DI1A 2PHKA 3ZBXA 2ONLA 4G34A 2W9FB 3NCZA 1GZ8A 4OBPA 3ORIA 1RDQE 4QQJA 4O21A 2W4OA 4IIRA 5JMSA 5JSMA 4R1VA 3OXIA 3WE4A 3UP7A 4FT7A 4KKGA 2C6OA 4YLJA 4EZ5A 4R5SA 2EB3A 4FTIA 3EQIA 1GIJA 3RGFA 4AGUA 4GSBA 4ZSAA 3UIBA 1H0WA 4D9UA 3OF0A 4RC4A 3QKLA 4U3ZA 1PXLA 1PF8A 5CF5A 4I6QA 3UP2A 4IM2A 4G9CA 4YC6A 4OTPA 5FUTA 3C7QA 3MJ1A 2X9EA 3TL8A 4FNYA 4O0VA 5KKRC 4QNYA 2XJ2A 1SMHA 1XH7A 3NNUA 4J96A 4OUCA 4Q9SA 4FL1A 3LM0A 2A2AA 2BDWA 4MXCA 3RAHA 3WIKA 3BLRA 1H0VA 3QRJA 3EFLA 4BCFA 4C3FA 5EQYA 5BPYA 2XK3A 3GU8A 3TM0A 5AFVA 4F6SA 2VTHA 3P79A 4PTCA 4C4EA 1P2AA 3L1SA 4K6ZA 2B52A 4MQ1A 4RG0A 3NYVA 1CM8A 3G9LX 3Q52A 3QFVA 3ZUUA 1H26A 4UXQA 5BVKA 1K2PA 4P90A 3BGPA 4J99A 4LI5A 4C62A 3DJ7A 4CV9A 4JDKA 5KMLA 3O23A 4CKJA 1J1BA 2V0DA 3NW6A 2BRHA 3R83A 2VO6A 1H1PA 2YEXA 3OY3A 3LXNA 3NNWA 2V7OA 5ANIA 4C7TA 5LXMA 2BILB 4NM7A 4L44A 1MP8A 5CSVA 4F9BA 3R28A 4K8AA 5M4UA 2QODA 4BCQA 4BZNA 2GS7A 3PVWA 2ERZE 5DMZA 2VWVA 5ACKA 3ZZWA 2YM3A 2H96A 3BHUA 3UG2A 5AAGA 2W5BA 1NW1A 4S31A 4IH8A 3NUYA 3D2IA 3GGFA 4GK4A 3C4EA 2CNVA 4ALVA 2PUUA 2JKMA 3PXYA 2EB2A 4Q2AA 4RWLA 3FMLA 1ZMVA 3SX9A 4DCEA 1G8AA 4X2FA 1H8FA 4AGWA 2O2UA 4CQEA 3ZDUA 1PKDA 1KE6A 4CTBA 5AUZA 3WZJA 3QQUA 4QYFA 4GJ2A 3UBDA 5TKDA 1ZARA 2R3RA 5TT7A 4JIAA 2OLCA 1H25A 3TN8A 1UU9A 3IW5A 5JGAA 2E9VA 4XHKB 4DEIA 4AW1A 5IQGA 1LEWA 2BCJA 3FYJX 4HPUE 3QD0A 4G6OA 2C3KA 2HZIA 5F1ZA 3ZRKA 2GU8A 3ZLXA 2OIQA 5BNJA 4X3FC 3F6XA 4EK4A 3MPAA 2FGIA 3UNJA 4GU6A 1NVRA 4LOPA 3TJDA 2DWBA 4FV0A 2GQGA 3PSDA 4XLVA 1PXPA 4APCA 5JQ8A 1ZY4A 4UYNA 4I0RA 3POOA 5JRQA 5DA3A 4AFJA 3RPRA 4BC6A 3L8SA 5BVWA 2BKZA 4HGEA 2R3JA 1H07A 5HBHA 3FPMA 3ZC6A 3DXQA 4DEAA 3SG9A 2PZPA 4I4FA 4QYGA 3TI1A 5CAVA 2FSMX 2XNGA 3BE9A 2YZLA 2CLQA 2WMAA 2O5KA 3C13A 4XV9A 5EW9A 2PWLA 5BVFA 4U9AA 2C6KA 3QRIA 4U81A 5D7VA 3GU5A 5J9ZA 4XEYA 3ORNA 3V04A 3R9RA 4TWPA 4EONA 1YOLA 5EM5A 3AXWA 5HG7A 1CKPA 1XBBA 2UVYA 3E87A 1Q8WA 4QYHA 5L8LA 4PDSA 1PKGA 4I6FA 5ANJA 3VBQA 2C6DA 4RIYB 3RJCA 4CRLA 3GNIB 4WNOA 2OG8A 3UC3A 5FP6A 3W2PA 3UIMA 4G9RA 1JKKA 1YXXA 3GT8A 3OCTA 1CKJA 5HVYA 3Q04A 1OIRA 3OG7A 3WE8A 1FGIA 5H9BA 2ZV7A 4ZLZA 3VUHA 4X6QC 2I1MA 3UZTA 3I5NA 1WBTA 4ZIMA 4ZJVA 5A4TA 1W82A 4EQUA 4RJ8A 3Q2JA 4Y72A 2HW6A 4ANBA 4JDHA 4HVSA 3UYSA 3UOJA 4FMQA 4ANNA 4BYIA 1JLUE 4ZTSA 3PDTA 3QF9A 4ENYA 2JBOA 2YDIA 4IX5A 4CKRA 2UZWE 4IJ9A 5D9HA 4C3PA 4CQGA 3LMHA 4H3BA 4V0GB 4E4MA 2OI4X 5FXRA 4ZOGA 4M14A 4U44A 3MA3A 3NZ0A 2XMYA 3R7EA 4GT5A 4FL3A 4M66A 5AA9A 5AV2A 4UN0C 3Q60A 3FDNA 2UVXA 1ZYSA 4K77A 2FA2A 3VS6A 3A7HA 4AZWA 4ORKA 3KCFA 3FMEA 4D0XA 5AUVA 1A48A 3GFWA 3KU2A 5HE1A 1JKTA 5G6VA 3TUDA 4A07A 5EKOA 4DGOA 5LVOA 5I4NA 3L8VA 1QMZA 4YJOA 1OI9A 4RBLA 2QOIA 4F0IA 4ZTHA 3ZUTA 4HNIA 4RJ4A 2C6MA 2XVDA 4DGNA
chains in the Genus database with same CATH superfamily
4BCKA 4GV1A 4GFGA 1GZKA 5F95A 5C8KA 4QMPA 2RGPA 3GCUA 3LFSA 4FV8A 5JN2A 3GXLA 2R4BA 4CTCA 4R7BA 3R02A 4NCTC 2X6DA 1VZOA 4FSNA 2R3KA 4EOSA 4RFMA 4S34A 3R2BA 3LAUA 4DG0E 4FZFB 3OC1A 4EBVA 5CF6A 3H9RA 4NL0A 3H4JA 3IKAA 3F3ZA 4FICA 3QQLA 2J6MA 4G3GA 3BYSA 4IQ6A 4P2KA 2E2BA 5KBRA 5AR2A 4IC8A 2CKEA 3VRYA 3KRLA 1FOTA 2JFMA 4O7SA 3EQRA 3TUCA 4FEWA 4FTJA 1FVVA 1H4LA 2E9PA 3IS5A 4ACHA 4I41A 4F7SA 3IPHA 3V8WA 4XCUA 3NUUA 4RFZA 1PMNA 3R8VA 4OTWA 4EWQA 3QBNA 3R1SA 3G2FA 2X0PA 3QWJA 4XP2A 2WO6A 2BHHA 2Z7QA 3D15A 2GNLA 4LYNA 4BKJA 1HCLA 3AT4A 3BLHA 3E8CA 3E7OA 5HTBA 4XG6A 4ZY4A 4BDDA 4I5PA 2JAMA 2GPHA 1ZMUA 4NM3A 4ZXTA 5IQCA 3UNKA 3LMIA 3OBGA 4FOBA 4IEBA 4FTLA 3QZIA 3KK8A 3Q4CA 2F57A 4CT1A 5IDPA 2EXCX 4O7NA 3IDPA 2WTCA 3U4UA 2VNWA 2BDJA 4KINA 3QTWA 3RWQA 5ETAA 2H9VA 4MD8E 3E7VA 5HCXA 5GIOE 1KE8A 3DK6A 4I23A 4M69A 5D1JA 4F0GA 3UOHA 4PPBA 4UB7A 3R71A 4FOCA 4YC3A 3VONA 2EUFB 3HYHA 3GU6A 4KD1A 3LJ1A 4I24A 4HGLA 4MXOA 2C1AA 3W8QA 5KUPA 3KQ7A 2C0OA 3R7IA 1YKRA 4O6LA 4BF2A 4QPAA 3Q5IA 3G6GA 5AIKA 2I0VA 4IB5A 3QTUA 4AQKA 4JDIA 3EFKA 3UE4A 4FG9A 4E3CA 4DCAA 2R3HA 4KIQA 3FC1X 4ZZMA 4F9CA 1X8BA 1Y57A 2GMXA 3QD3A 4JQ7A 3VQHA 4O91A 4U7ZA 4F6UA 1MUOA 4EUTA 1QPEA 1V0BA 2LAVA 1V0OA 5BV3A 4D5KA 4E1ZA 3DPKA 3LQ3A 1QL6A 4ANOA 4UX9A 4NH1A 4IVDA 2Y0AA 4AFEA 5CZHA 3LZBA 3W32A 1OGYA 4YZCA 3NUNA 2BZIB 4FKWA 4G1WA 4PTGA 4FNXA 2XIKA 3BZ3A 4WO5A 3RAIA 3CY3A 4TZRA 2BRBA 3DDPA 4TY1A 4U79A 3HDNA 5FXSA 3GOKA 3TXOA 5KMOA 5DEYA 2REIA 3UIXA 4E6CA 4CFXA 4GKHA 4L42A 4BDHA 3RPOA 3MB7A 5LWNA 4EOOA 3QUEA 4CMUA 3DBDA 3EN6A 2CKQA 5AR7A 3SD0A 2QOQA 4BYJA 2KTYA 2X4ZA 4CMOA 4BCIA 4G3CA 1ZOGA 2XKCA 2VN9A 5L2TA 3DZOA 1YXUA 3NFGB 4DFLA 2JAVA 3Q3BA 4WUAA 5D7AA 5EHOA 1G8SA 3FI8A 2WHBA 3ZTXA 3K5UA 3ZC5A 3GUBA 2IVSA 2ZB1A 3QRKA 5DR9A 4L00A 3MH1A 3GB2A 5JKGA 1WBSA 5EH0A 4LUDA 3CJFA 5IH6A 2PZ5A 3O50A 5HO8A 3RAWA 3N4VA 2W1ZA 4GRBA 1TQMA 2ZVAA 5CQUA 3ZEPA 3JVSA 2XP2A 3FHRA 5JZNA 4RVTA 2C3JA 2RF9A 4QTDA 4V01A 2UW0A 2BDFA 2QONA 4AXDA 5M4CA 3UNZA 3HUCA 5JZJA 5C8NA 3RK5A 1ZXEA 1U5QA 4QMYA 4O0UA 5BMMA 4J1RA 2VWWA 3SAYA 4C58A 4G17A 3AD6A 3GCVA 5GJGA 5FWKK 3WF8A 4IANA 5EDRA 4FG7A 2G15A 2XK6A 3E62A 3SVVA 5E9EA 1V1KA 4K18A 4EZ7A 1YHWA 5AM6A 2XAMA 5LVPA 4O38A 2C5VA 4ZZOA 4MTAA 5M51A 2A4LA 3D5VA 3DBFA 5B2MA 4BN1A 2ZFYA 1Y91A 3JR1A 4KSQA 4UMRA 4ZMEA 3VF9A 2VWUA 4RC2A 5L2IA 4GK2A 2VX0A 4AF3A 2NPQA 3JUHA 4I6LA 3OW3A 3O2MA 3ZONA 5DPVA 4GT3A 1T45A 4AT5A 1ZMWA 1R0PA 5LMAA 1OVEA 4QTAA 3W2RA 4YMJA 1YWRA 1TFFA 5FDPA 4XYFA 5AV4A 5DYJA 3QQKA 3CD3A 2UW6A 4L7SA 3KEXA 4CFFA 4TYJA 4M7IA 3DTCA 4YO6A 5HG9A 4A9YA 3DK7A 3OWJA 1RJBA 4WNKA 2OZAA 5E8SA 2G2FA 3ENHA 5BVEA 4AZTA 1Q5KA 5ICPA 5IPJA 3KRJA 3O8PA 4WBBB 5CU0A 2HWOA 4MF1A 2C5OA 3HMMA 4FTKA 2ITYA 2UZEA 4MQ2A 3F5GA 3OS3A 3OTUA 2QCSA 3P7CA 4JDJA 4RLLA 4C8BA 1PMVA 3P1AA 4BIBA 4C4HA 4JAJA 1URCA 2YERA 3TIZA 4L3PA 2ZMCA 4A9RA 1BMKA 3O7LD 4X2KA 1ZYDA 2PZYA 3RHKA 2QNJA 3S3IA 3W2SA 3EN7A 3KVXA 4F99A 5LMKC 2C6EA 2IZUA 1DI8A 2XKFA 3RM7A 3HAVA 2GNFA 3CEKA 3E8EA 2YLEA 1DS5A 4EOLA 4O86A 3RP9A 3PSCA 3NIEA 1SYKA 3KN5A 4IM3A 3GC9A 3O96A 4FX3A 2IZTA 4QDVA 2ITPA 1WCCA 2XIRA 4RJ3A 3FXWA 3E88A 3QCXA 3TTJA 3VBWA 2B9FA 3L8XA 1Q4LA 3OBJA 4DFNA 5JRSA 1JKSA 4F4PA 2GTMA 3TG1A 3NX8A 2VGOA 3G9NA 4R3CA 3EQDA 4JQ8A 1WBPA 4BI2A 3LXKA 1NVSA 4W4YA 3UDBA 3HV4A 3EL7A 4F9YA 1BLXA 2XYNA 4MXYA 3EQFA 3SDJA 2VU3A 4D2SA 3O7LB 2W4KA 4PX6A 2WQOA 5EM6A 5BQ0A 4OTFA 3HMIA 3KCKA 3KF4A 3RZBA 4F1OA 2UW4A 1XH5A 3FQSA 3MY5A 1E1XA 3PY0A 4TXCA 3MVHA 4U97A 3D0EA 3T9TA 5CAOA 3ID6C 4U80A 3FZOA 2YHVA 4JL9A 1OL7A 4USDA 1ZAOA 4AGDA 5LQFA 5CNNA 2HY0A 3TZ7A 2YIRA 3NYOA 5LARA 2GQRA 4QP3A 4N0SA 2JKQA 3BBTB 3NNVA 3V5TA 5CTPA 2J5EA 4XG7A 4RZVA 4FV7A 4HCVA 3UZPA 5LOHA 3DFCB 2QKRA 3FY0A 3KL8A 4QT1A 1YDTE 4PL5A 3UVRA 4BTFA 1Z9XA 3BYUA 3DQXA 4IE9A 4JBQA 4L3JA 4PPAA 1XR1A 4X0MA 4H1MA 4D2WA 3G33A 1W2DA 5I9XA 5I9YA 2I0YA 4ASEA 4DT9A 2UUEA 1LUFA 3R9HA 5J9YA 2OGVA 4FT3A 1B6CB 4L46A 4RIWB 1SVGA 4TT7A 4DGGA 3FI3A 5J7HA 3JYAA 4ZSEA 3DDQA 2XYUA 2A98A 2PE0A 5DRBA 3BYOA 5E8YA 3UODA 3KXNA 4EUUA 3AT2A 3BYVA 4G31A 2GS2A 5CNOA 5IA3A 2IJMA 3D94A 3UYTA 4WA9A 4C4GA 4EZ3A 3D5XA 3UMWA 2Y4IC 4LOQA 1YVJA 4AOIA 2FSTX 4JG7A 2KULA 5CEKA 3VW8A 1YW2A 1UVRA 3LLAA 3ORMA 2OJFE 5IG1A 4NIFB 4W8EA 3DB8A 3F5UA 3TNWA 3I79A 2Q83A 2R3OA 5JFXA 5JH6A 3TIYA 2QOBA 2YFXA 4DFXE 3A99A 3IECA 3GENA 2UW7A 5CANA 4TYHB 4GCJA 2XUUA 5EW8A 5TOZA 2X7FA 1JBPE 3R2YA 3R8MA 3BWJA 2OIBA 3PJ3A 4AW5A 3AC5A 5AIRA 5DRDA 2ZV9A 3MFTA 1XBCA 2PMIA 2O64A 4YTHA 4JS8A 2ZB0A 4X3FA 3GI3A 4DEGA 1Y6BA 4ARKA 2PPQA 4OT6A 3BI6A 4CFWA 2QOKA 1ZOHA 4OBOA 5CZIA 5DGZA 4Y5QA 3UDTA 4JG6A 5M56A 5FTGA 4LV8A 1ZRZA 2W1HA 3Q9YA 3OEFX 3U55A 3Q53A 5HVKA 3S2PA 3QKKA 1WVYA 4UWCA 3TCPA 4PNIA 4G3EA 3DY7A 4B7TA 2QOHA 3DBQA 3DK3A 2Y9QA 4O0TA 4XBUA 5HESA 4O22A 2UV2A 4MHAA 4IM0A 4QP4A 5KX8A 1JPAA 3LFDA 4DYMA 4LG4A 1CMKE 2X2MA 3BPRA 2RFEA 3ULIA 3PG1A 3H9FA 2F49A 1H00A 3NR9A 3RINA 1IA8A 3KMWA 1B39A 3HV6A 4BCJA 1U59A 3C51A 4J53A 2C5XA 5HE3A 1LR4A 4EH6A 2Z7RA 4O1OA 4YTIA 4DH8A 5IZFA 2PVJA 2X7OA 3DFAA 1LPUA 1VR2A 4AQCA 4QTBA 3TEIA 3NCGA 4D2PA 3O0GA 4FVQA 4RIXB 5AR5A 3BU6A 1U4DA 3ETAA 4F64A 2F2UA 5I9ZA 3KXXA 5FP5A 4DLIA 3KXMA 3LHJA 4C35A 5KHXA 3FLSA 3UG1A 2O8YA 5HLPA 4EH7A 2AC5A 4P7EA 5AUTA 5CSPA 3A62A 5HNIX 3DKFA 2RG5A 1APME 2BMCA 4RWJA 3H0YA 4F9WA 3TNHA 1BUHA 4FTQA 2YCQA 3VQUA 3I6UA 4J98A 4D4SA 3Q32A 2X7GA 3H9OA 2X8EA 1JSVA 2ETRA 5J95A 2EXMA 2NRYA 4MNEA 4XV1A 5FG8A 3GEQA 3P7AA 4BCNA 3RHXA 4DA5A 2XA4A 4GT4A 3W2QA 4GJ3A 5IQBA 3VS2A 4FTAA 4FGBA 3TUBA 4PDYA 2B9HA 2W06A 4QPMA 5HNBA 4EOMA 3JXWA 1OB3A 2R3PA 4YZNA 2BKKA 4G3DA 4WHZA 3ZSIA 5EW3A 5TR6A 5CEOA 4D0WA 4TTHB 4ANQA 4KIKA 2GNHA 1JSUA 4O82A 3QAME 2ITVA 3Q4ZA 4FV6A 4JR3A 2CGXA 5HU3A 2B0QA 2OICA 1YQJA 1DAYA 2AC3A 2QURA 4ZY5A 3PFQA 4D28A 4ALUA 4JBPA 3AD5A 3FAAA 4PL3A 5EYKA 1OITA 2WZJA 4DH3A 3L9PA 5CALA 5AV0A 5BUIA 3PLAE 4N6ZA 4E5BA 4BHNA 3C4FA 2CNUA 1I44A 2ZM4A 4FTNA 4O7YA 1PHKA 4NCTA 3P23A 4D4RA 5HVJA 1U54A 3PFYA 4CCUA 5B2KA 4CFUA 4NTSA 3G6HA 5DVRA 1BI8A 2Y4PA 3R30A 4I5MA 2AUHA 1BKXA 2XS0A 3T9IA 1R1WA 2WNTA 1PMUA 3PRFA 5CASA 3PZEA 2HENA 2J5FA 2C6LA 4FNZA 4RT7A 3TV4A 3BE2A 4GL9A 3R0TA 5FTOA 5TF9A 4UBAA 2JKOA 3I81A 2BROA 4O0YA 5LCKA 4FEXA 4FV2A 4FZDB 4YJPA 2PZIA 3OMVA 3EL8A 4DH1A 3FZSA 4OTIA 4MVFA 4GK3A 1W0XC 3ZXTA 1BYGA 1O6YA 2P4IA 3E8NA 3DA6A 4JMQA 3QTRA 2PMNX 5AP0A 4ZJJA 4LGDA 5D41A 3B8RA 3D83A 3VUIA 3SRVB 1JSTA 3JY0A 2E9UA 4WD5A 2IZSA 2XCHA 3K5VA 5GJDA 2W96B 4FV9A 3UVPA 4D2VA 4DINA 1PYXA 2OJ9A 4KS7A 5EOBA 3AD4A 4GEOA 4RJ5A 4UMTA 3VUMA 3NSZA 3BEAA 3BCEA 3QLGA 4YP8A 3VUKA 4BI0A 5K4IA 4RX7A 4C37A 2OO8X 1ST4A 4FSUA 3MPTA 4L6QA 4YR8A 3QCQA 2NYAA 2BTSA 5CF8A 3I60A 3SW7A 3AQVA 2ZV2A 4D4YA 2V55A 4KIOA 4FKSA 4GFOA 5FRIA 3FMKA 3R04A 1IAHA 4LRKA 4R1YA 2YABA 3LOKA 3ACJA 3IDBA 3TDWA 4CLJA 4YPDA 4XNEA 5EI8A 2XANA 1J91A 2WTJA 3K3JA 2C47A 3FMMA 2R3QA 5E1EA 1ZYCA 4QMWA 4ZTQA 5HG5A 3ZLSA 4FV5A 4YU2A 2OJIA 2WXVA 5EYDA 4M13A 2ZV8A 3V8TA 3ZH8A 3ZO2A 4HOKA 1U46A 4E6DA 5LJJA 3NPCA 2JIVA 5EQEA 5GHVA 4BGGA 3T3UA 1VLRA 3HMNA 1Z57A 3B2TA 2XRWA 1KOBA 3SQQA 3WILA 4MBLA 4MX9A 3C4WA 4RJ6A 3U51A 4GH2A 2Y6OA 3QQHA 4EHEA 5AA8A 2XJ1A 4AAYA 4NJ3A 2WGJA 4IDVA 3SXSA 4BBFA 4LMNA 1M7NA 4YUQA 4QRCA 4E6AA 5I5ZA 3L8PA 3F61A 1LEZA 4FYNA 1VYWA 3QHWA 4WRSA 3OHTA 3RK9A 3ZLWA 1ZYJA 4G3FA 4F1MA 4C36A 5IDNA 3R1YA 3I0OA 3FI4A 4BWXA 3DU8A 3QXPA 3F7WA 3BRBA 2DUVA 2JDSA 3BHTA 3NMUF 3HRCA 3I7CA 1P5EA 4CRSA 5BYYA 3HV3A 1Z5MA 3P78A 3OCBA 3HAMA 5L2WA 2C5YA 2YIQA 4R3RA 3LPBA 4TNDA 2UVZA 3TJCA 1XJDA 2PVLA 4BWPA 4OR5A 1SZMA 2OH4A 3QC4A 3VBYA 4E4LA 5F20A 2YM7A 3WBLA 3MH3A 2C6IA 2G1TA 2WEVA 3U8WA 5HTCA 4CGAA 3QTQA 1R78A 3RBWA 3A7JA 2W1FA 1NVQA 2GHLA 4ZMFA 2OXYA 4LL0A 3VO3A 4DC2A 5IEVA 5A4CA 5L2SA 5DT3A 4RSSA 5E8VA 3DT1A 1P14A 1PXOA 2GNJA 3IW4A 4PMMA 2C6TA 3KK9A 4F7NA 5CEQA 4MD7E 3F5XA 4HGTA 4J97A 5CVHA 4XOYA 3VRZA 3O8UA 4E73A 3FLZA 5LMBA 3IW7A 2R3NA 3R7VA 3F9NA 4RJ7A 4CD0A 1OIYA 4NTTA 3COKA 3FY2A 2ZM1A 4FVRA 2I40A 4F7JA 2Z7LA 1YDRE 4F1TA 4M0YA 1ATPE 5K3YA 3LFCA 5M55A 4RQVA 3LJ0A 4C4JA 4FV4A 1BX6A 5DEWA 3FI2A 5CS6A 3FSKA 3RK7A 4O7ZA 4QQ5A 4CFVA 4I92A 3RMFA 2Z8CA 1REKA 3QQFA 2VAGA 3QYWA 4J7BA 4G6LA 2EWAA 2VUWA 1UKHA 2QO7A 4F0FA 4YZDA 3FYKX 3BQRA 3GQLA 4LV7A 1B38A 1G5SA 4DF3A 2QLUA 2YJRA 1YXSA 2VWZA 3MVMA 3MVJA 4KRDA 5AP7A 4BRXA 3A4PA 4P5QA 4IWPA 2Z02A 2WTVA 2WTDA 1IA9A 1H1WA 3EIDA 4DBXA 4CVAA 3R7OA 2WQMA 3A61A 5CXHA 2EXEA 3FV8A 3UOLA 4TW9A 3HZTA 4RWIA 3R8PA 5HOAA 4WOVA 4BZOA 2PE1A 5FQDC 2BZJA 2HCKA 2RL5A 4PMSA 3O5AA 3D7TA 3HDMA 4MCVA 2RG6A 5DR2A 2VTIA 4D5HA 3N4TA 2BZKB 4D1SA 3A4OX 3QALE 1JVPP 4FKGA 4I6BA 3KVWA 4FE2A 4DG2E 2AYPA 5DT4A 4WIHA 3SXFA 4EK6A 4WG4A 3ZS5A 3WZEA 2C5NA 4F63A 1ZYLA 4AG8A 4C59A 3QHRA 4XMOA 4AT4A 3II5A 2CN5A 2R3FA 2XNBA 2B54A 3OUNB 4M69B 4X6RA 2ZM3A 2YIWA 2WTIA 3PWYA 3LFQA 2HK5A 4EWHA 4F78A 1K9AA 3A7GA 4ZSJA 1ND4A 4PMTA 4ZLYA 3M2WA 3Q5ZA 3CBLA 3DXPA 2GCDA 1XO2B 1MRUA 1H1SA 3IO7A 1UKIA 1NA7A 3LCSA 4BI1A 5LMKA 3OXTA 3FUPA 3QYZA 4AE6A 4FSMA 4AW0A 4R7HA 3I6WA 3QC9A 2R3IA 4CV8A 4TYGA 4MWIA 5L6PA 4MD9E 3MH2A 1YHSA 1GZNA 2W9ZB 4L67A 4N57A 1SM2A 2CPKE 3E93A 3ZM4A 2PVMA 2YM5A 4O4BB 4JJRA 4PV0A 4QMZA 1Q8TA 4UMQA 3ALNA 3AMYA 5JT2A 1NT2A 4YHFA 3BL9A 4HVIA 4JVGA 1O6LA 5ETFA 3GC8A 3ENMA 5ACBC 3NS9A 3R73A 4QMMA 1O9UA 4FODA 3ZRLA 4X3JA 5IUGA 3QA8A 3MFUA 3GC7A 4NM5A 3W0SA 3QZFA 1WVXA 3IW8A 5C27A 3PPJA 1FQ1B 3R00A 3V5JA 3O51A 3V51A 3TACA 3ZU7A 3F3TA 2E9NA 1ZZ2A 5AP1A 1QPDA 5FM3A 3R9NA 3UPZA 3TV7A 4USFA 4ZS4A 4CCBA 2C30A 2JIIA 3ODZX 4BIEA 4CSVA 4JRNA 4NYEA 3HGKA 2VO7A 2VWXA 4BBMA 2V5QA 3HUBA 4MK0A 3Q6UA 5FBNC 3D2KA 3S95A 4KUJA 5A14A 4AN3A 4BTMA 1YI3A 1PXIA 4GYGA 3QX2A 4Y95A 2Y6MA 4FF8A 4XUFA 4DEBA 3OROA 5HIBA 1GIIA 3CSVA 3VHKA 4RGJA 2IF8A 1UWJA 2XZSA 1IASA 4H3PA 3IDCA 1KWPA 3MSSA 5KMNA 1WBWA 3EWHA 3IONA 1GJOA 4UEUA 2PVFA 1IAJA 5EOLA 4BGHA 3D5UA 1YWNA 2C4GA 3TZ8A 4ANSA 3C0HA 3EZRA 3QUDA 3JS2A 3OTVA 3MWUA 5EHLA 3LFNA 3PYYA 2XIYA 1FVTA 1OL6A 4MWHA 2HOGA 5AUYA 2IPXA 3PWDA 2PVYA 3AG9A 2CNQA 4AOJA 4IACA 1WBNA 3EMGA 1CTPE 3EYGA 4YJSA 3FMHA 5M4FA 2E9OA 2XNNA 2ITWA 4G16A 4BFMA 5ANDA 2LGCA 2Q0NA 2IO6A 1YI6A 4XP3A 3G51A 5KZIA 3N9XA 4FIFA 1M14A 4AT3A 2P55A 3PXKA 3DQWA 4QP1A 5IUHA 3C4XA 4FKQA 4IDTA 3EN5A 3VBXA 4AN9A 4U40A 4NW6A 5CU6A 3QD4A 3PIZA 2BR1A 2W5AA 1KE5A 4YHTA 1Y8YA 4Y73A 5HE0A 2RFSA 2X81A 4HZSA 5L6WL 1Q62A 2IVTA 5DE2A 1W2FA 4QP8A 4FKUA 1XKKA 1IEPA 3KB7A 4NZWB 3FC2A 5D12A 2GNIA 4O2ZA 5J87A 3IOKA 5HHWA 3CQEA 1YOJA 2W1EA 2XM9A 3IGGA 3V5QA 1OIUA 3KREA 2WIPA 2WMTA 3FZPA 3OT8A 3S4QA 2IWIA 2BIKB 4ERWA 4CG8A 2OK1A 5EK7A 4XV2A 2OZAB 3ATSA 3ZFYA 3ET7A 3JPVA 1IR3A 1PRYA 4HCTA 2P3GX 3LXPA 2XKEA 4AS0A 4R7IA 1S9IA 5IQEA 4CXAA 2PSQA 5DOSA 5EYCA 2B55A 5A6OA 3VS4A 3WF9A 3S00A 3FJQE 3CXWA 4IAYA 1OPKA 4U8ZA 2J4ZA 4YGAA 3TKUA 3DB6A 3H10A 3KIOC 2B9JA 5CAQA 2RIOA 2FYSA 4FK6A 3R7YA 4QMNA 5ANKA 4WSYA 1UV5A 4NU1A 3ORLA 5CX9A 2GTNA 2BHEA 3M42A 3PA4A 4Q5HA 3VHEA 3BHYA 4C61A 1Y6AA 3N4UA 3LCTA 5H8BA 1M2QA 3OFMA 3C50A 3VC4A 3RPSA 1A9UA 3V5WA 4DH5A 4FC0A 3PLSA 4QMSA 2XAOA 3NUXA 4IAKA 2OXDA 3UVQA 1Q8UA 2SRCA 4RLKA 4FT5A 2J9MA 3LQ5A 3K54A 4IBMA 1YOMA 1UA2A 4KB8A 3TYKA 3D7ZA 3TDVA 3TT0A 4E5WA 5C26A 4EKKA 3W0MA 2J51A 1R0EA 2W7XA 3PJ2A 3UPXA 1L8TA 3NDMA 3DKCA 2W1DA 4PL4A 4YJVA 2GFCA 1F5QA 1TQIA 4QTCA 4WG5A 3UMXA 5BUJA 3F7ZA 2PL0A 3OVVA 4LRMA 2ETKA 3QU0A 4CYJA 1Q61A 4ID7A 3KN6A 3GFEA 4FKOA 4FT9A 3BLQA 3SGCA 2XNEA 3PP0A 3COIA 2Q0BA 3ZO1A 2QC6A 3HV5A 5HX6A 4G2FA 4PUZA 3LVPA 2UZNA 4MEDA 5CEIA 4X2NA 4S30A 4BCPA 5JFVA 3MIYA 3ERKA 2VWIA 3BEGA 3V5LA 3OWKA 4NW5A 2X4FA 5M06A 3VIDA 4EEVA 3CR0A 1Q3WA 3OOMA 4U0IA 5FBOA 3WZUA 2UZLA 4RVLA 4UV0A 5CI6A 4U42A 2Z2WA 1Q97A 3C5UA 4TN6A 1W98A 4BDKA 3A7IA 5C03A 2PMLX 2QU6A 5CU2A 4PP9A 4BDBA 2VTOA 3ACKA 3NGAA 4HPTE 4I0TA 4EYJA 5KMKA 3TZ9A 1JOWB 3EQGA 4ITHA 4EK5A 3FE3A 1BI7A 4NT4A 1XQZA 4RX9A 5F9EA 3FSFA 4AU8A 3KULB 4OTHA 5JEBA 4YNOA 4AN2A 4B99A 1SNUA 3D9VA 1XH9A 2XBAA 4I1ZA 3PVUA 4I22A 4QO9A 4C2VA 2RFNA 3CTJA 2I0HA 4QOXA 1W84A 5A4EA 2H6DA 2CKPA 4YJRA 3C1XA 3ZZEA 4HVHA 3MIAA 4E7WA 4CG9A 3OD6X 2XCKA 3FL5A 3LCKA 3NWWA 1H1RA 2PU8A 4RZWA 4DGMA 1O6KA 5KZ0A 1KE7A 2YAAA 3OY1A 4O0WA 4ZTNA 2OJJA 2WOTA 5HORA 5L4QA 4FSTA 2XK4A 2W4JA 2JDRA 4NUSA 2BZHB 3MN3A 4IVCA 5KBQA 5I9VA 4YURA 1OBDA 2CLXA 4FZ6A 4L45A 4EBWA 4NM0A 4OTQA 2ITNA 4QTEA 4EH2A 4Z7HA 3OWPA 5T3QA 4BJJB 3CKXA 1ERKA 4IHPA 1F3MC 2WELA 2VRXA 3DNDA 3KXZA 3QRUA 5AAEA 3W0QA 2BAJA 2C3IB 4C2WA 4EHVA 2I0EA 3COMA 2VTPA 2F2CB 2WTKB 3FMJA 3OUKA 4BICA 5DN3A 4H05A 4FSZA 2RSVA 1Q3DA 4JAIA 4QYEA 3VS3A 3KXGA 4IZYA 3DKOA 4ZTLA 1M2PA 4DE4A 2V62A 5E91A 2ZDTA 3NUSA 3TZMA 1RW8A 5FLFA 4QMTA 2PUIA 1QPJA 2NO3A 2JEDA 3LFAA 4TWOA 5FXQA 2WU7A 5KMIA 5GINE 4Y8DA 4AZEA 3TWJA 3JY9A 4DDIA 2X0OA 2CCIA 4PQNA 1A06A 3QTZA 4QMLA 2PVNA 3UO5A 3EQHA 5I3RA 1OL2A 2YA9A 2W99B 4JLCA 3F5PA 4ACMA 4J71A 5FDXA 1XH8A 2B9IA 4Y46A 4FIEA 2ITQA 3V6RA 2XEYA 4TYEA 3PVGA 2DQ7X 4LM5A 3W18A 4JT3A 3UO6A 4CZTA 5AJQA 2QOCA 4E5AX 4IVBA 3ZXZA 3QGWA 1Q24A 4L52A 2A1AB 4NKSA 4P4CA 3FQEA 3A7FA 2QOOA 4BDAA 2CSNA 3FZRA 4XJ0A 5DBXA 3DGKA 2AEGA 4EQCA 4H58A 1J3HA 1F0QA 4XG3A 2OXXA 2ZYBA 1OPLA 4EJ7A 2I7QA 5M07A 2JDTA 3VBVA 3BLAA 5M44A 3MH0A 5E8TA 3VULA 4Z3VA 2P0CA 4FV3A 4UMPA 2IVVA 2Y7JA 4RQKA 4AP7A 3U9CA 5AR4A 3U6JA 1H24A 1HOWA 4F9AA 2WQBA 4ZS0A 4KABA 4Y83A 2IZRA 3P4KA 2WKMA 1UNLA 2UZDA 3BHHA 3QGYA 1VYZA 3Q9WA 3VWAA 3WZKA 1OM1A 3DLSA 3R63A 3ZO4A 5C01A 5HX8A 2BRGA 3QTXA 4EK3A 2G2HA 2YIYA 3G0EA 1CSNA 3COHA 4FIGA 4TNBA 2BRMA 4FIJA 3P86A 4KBCA 3NVMB 2YITA 2OU7A 1JNKA 3E3PA 3BWFA 3HMPA 2RKUA 5LVMA 4I94A 2O3PA 4O7RA 5I0BA 3LCDA 3AMBA 2UW5A 5CU4A 3W0OA 4Z16A 5IEYA 2P2IA 3CP9A 3FXXA 3ROYA 5EM8A 3F3VA 4AUAA 4AZSA 4YJQA 5J5TA 1G3NA 1WBVA 2CGWA 3I4BA 4LGGA 4U41A 5F94A 5HZNA 4ASDA 5AP3A