3FMDA

Crystal structure of human haspin with an isoquinoline ligand
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
329
structure length
329
Chain Sequence
KGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase haspin
publication title Crystal Structure of Human Haspin with an Isoquinoline ligand
rcsb
source organism Homo sapiens
total genus 112
structure length 329
sequence length 329
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fmdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fmdA01
2B1PA 2CPKE 5HVJA 4N57A 3FKNA 5EW8A 4X3JA 2YZLA 4EOQA 3GXLA 3QTSA 4EHEA 3EFWA 3LQ8A 5ACBC 4A9YA 4QT1A 4ZAUA 3BGQA 2XKFA 5HG9A 2Y4PA 2YITA 3V5WA 3EN6A 3QYZA 5EM8A 5KNJA 3OG7A 4M68A 2H9VA 3EQCA 1H4LA 3VRZA 4FZFB 3BZ3A 2B55A 3Q52A 2PUIA 3ENHA 3EWHA 2XNPA 4BDJA 4F64A 3IQ7A 4K33A 2ZJWA 3EZRA 3BE9A 3E93A 4FICA 2A19B 4I4EA 1W83A 4RWIA 5M53A 3ZUVA 5HE2A 3KMUA 3KXMA 1PMUA 3LE6A 3EKNA 2R0IA 4KSQA 4XV2A 5ANIA 5LVPA 3CLYA 3JY0A 2NPQA 4ZOGA 3DK6A 1JKTA 2QU6A 1CM8A 5E8ZA 2YAKA 4RIOA 3BHVA 3KXHA 4J53A 4ZJIA 1VYWA 3HAVA 4GEOA 5GHVA 5HG5A 4M69A 5CVFA 5JT2A 1IEPA 2WD1A 4BB4A 2C6IA 4UN0C 5JGDA 3QUEA 3Q4CA 4IXPA 4M84A 1REJA 4RIXB 3I1AA 5KBRA 2PZYA 2PHKA 1E1XA 5E92A 4Z16A 5HICA 5I5ZA 3PTGA 4F1MA 4CYJA 4P5QA 5FP6A 1I09A 3FI4A 1OITA 3H9OA 4RC3A 4C38A 4IW0A 4CZTA 3AGMA 4EH2A 5CXHA 3VVHA 2VO3A 2C3IB 2YJSA 2IW8A 3P5KA 3SV0A 4X0MA 3EN9A 3T9TA 3TNHA 4HCVA 5DA3A 3L8XA 5JN2A 3LCDA 1PXJA 3RCDA 4FL1A 3NX8A 3K3JA 5JK3A 5FDXA 3HGKA 3HRFA 5D7VA 4DG0E 3VIDA 4ENYA 4UXLA 5IH5A 4YSMA 4DEEA 2V55A 3E62A 3HX4A 3I79A 2QNJA 5FGKA 4HZSA 4IAIA 3REPA 2IZUA 2R3IA 4QYFA 3IG7A 5BPYA 4KWPA 5CEPA 4K11A 5GIOE 3E8CA 3U6HA 2CMWA 1SM2A 4A07A 1UNHA 3CSVA 2Z02A 5IISA 2PK9A 4OTHA 3CY3A 2CKEA 4IWDA 5L2QA 3THBA 3CR0A 4MVFA 4ACCA 4CRLA 3CEKA 5G6VA 5A4TA 3HP2A 3H9FA 1FGIA 1IRKA 1PMVA 3DT1A 4YPDA 4RPVA 4O6LA 3C7QA 4JBVA 2X8DA 1X8BA 4XX9A 3EHAA 3I6WA 3NR9A 2FGIA 4M3QA 4BVUA 1A48A 4C58A 4BKZA 2R4BA 4E5AX 4WG4A 2ZAZA 5JZNA 3UYSA 2PTKA 4G17A 2JIUA 2X7GA 3W2CA 4YUQA 5CASA 4FKPA 2UZEA 3MY5A 2FSLX 4PDOA 1YHVA 3R04A 4E6AA 5M4IA 1OPKA 3BE2A 2HY81 3R22A 3COIA 4B8MA 3PPKA 3FUPA 3VULA 1GZNA 4NEUA 2IVUA 4RQKA 2J2IB 1PXKA 3IW5A 4U40A 4X3FA 3F5GA 3Q9XA 4GVAA 5H2UA 1A06A 3HV6A 4GYIA 4LGGA 4M0YA 5LMBA 3UQCA 3JR1A 1YI4A 4BCJA 4OTRA 5J9YA 3UZPA 2G15A 1ND4A 5LVOA 3DK3A 4AOJA 3EYGA 2XMYA 4CV9A 3DOGA 3R9RA 5LOHA 3DTCA 3LLAA 4ASEA 4RG0A 4U45A 3N4UA 1GIIA 3NUPA 5CT7A 4HVGA 5C4KA 3NW6A 3F5XA 3R7YA 2OO8X 5L6OA 5EDRA 4YJPA 3C51A 3PJCA 4I1ZA 4QOXA 5JH6A 3A60A 5CEMA 5IDPA 3O8PA 4MHAA 4P4CA 2LAVA 2WTKC 3PJ8A 5J95A 1BLXA 2VD5A 4AX8A 3Q4TA 4S30A 5E90A 3Q3BA 4O7VA 2JKQA 2CKQA 4FOBA 4EWHA 3RI1A 3DJ5A 5LXMA 2CLQA 2FH9A 4QMSA 4YLJA 3GQLA 5IQCA 3LIJA 4EOMA 4ACDA 2XZSA 5D11A 5H8EA 1XBAA 4R7BA 2G2IA 4GIIA 1BI8A 1OUKA 4MKCA 4OTPA 3V8SA 4BI2A 3VS7A 4EOPA 5A14A 4MWHA 3WIGA 3HAMA 2ITXA 2Y6OA 3Q5IA 1XBBA 4MXAA 3C1XA 4UMQA 2QLUA 2R7BA 3HYHA 4AZSA 4CFFA 2W5HA 3LKMA 1H07A 2C3KA 4IHPA 3S4QA 4CD0A 5HORA 4GL9A 4MQ1A 4FNXA 3FE3A 4CT2A 5I0BA 1KV2A 4ASXA 4IM3A 3KRWA 4DITA 3VUDA 4F6WA 4NCTA 3KXNA 1M2RA 2XIKA 3CPCA 4ERKA 4L3LA 1E9HA 4TYEA 3BKBA 3FV8A 2OKRA 3IGGA 5E7RA 4FVQA 5HG7A 3SRVB 4U79A 2JFLA 2JIIA 3NWWA 4WRGA 5AR2A 5GZ9A 3ZH8A 4QO9A 4CSVA 1OKWA 1OL5A 2RKUA 4D9TA 5CT0A 4FTOA 4AGCA 1CKJA 4D2WA 5IA1A 4CG9A 2ITUA 2HYYA 4FKRA 4NFNA 3TJDA 2QO2A 3DLZA 2R5TA 3O71A 4FEQA 4FIEA 3G90X 3DU8A 3LJ1A 4N0SA 5DOSA 3UP7A 4BTFA 4HPTE 3HA8A 4CTBA 4DEGA 5J1VA 4HYIA 4MBIA 1UWJA 2BRMA 3CKWA 3FZPA 4KRDA 5EHLA 3ZYAA 3KVXA 4XBRA 1OL1A 3QD0A 5IA5A 3TZ7A 4AZTA 3K5UA 1ZZ2A 1JLUE 1GJOA 3IK3A 4W8EA 4AAAA 4V0GA 1Y91A 3OTUA 4XG2A 2VTLA 4BWPA 4PMPA 3VBWA 4PP7A 1S9IA 4IB5A 4BC6A 4ANSA 3UMWA 3R30A 3PVGA 4YC3A 4ITHA 4IVDA 1BI7A 5E8UA 4CT1A 1FMOE 4TL0A 5FM2A 4O7LA 5AEPA 3UC4A 2QOQA 2PL0A 3V5PA 2OGVA 2QKWB 4QP9A 2OFUA 1Q8TA 1Y8GA 2YZAA 4FMQA 4QMPA 4CLJA 1B6CB 2C1AA 2QODA 4S31A 3MJ2A 4AGUA 4PWNA 4QPAA 4RWJA 1MRVA 4EQCA 3BYMA 5CWZA 4EZ3A 3EIDA 2FSMX 2XYNA 3WARA 4JAIA 3E64A 3OHTA 4TNBA 3SKCA 4XG8A 4IAZA 2ITNA 4D5KA 3TTIA 5HBEA 3B2WA 3M1SA 1GY3A 3L9NA 4JDIA 4MXOA 4Y5HA 5DGZA 5L6WL 4QP2A 2VUWA 4G6OA 4C59A 4LYNA 4O86A 5BYLA 5KKRB 2B9IA 2WMXA 3EQDA 3V5QA 2XKDA 4YO4A 4KD1A 2X4ZA 5IF1A 4AU8A 5CAOA 3EN5A 4XP2A 3TACA 4U81A 5EM6A 1Z5MA 2ERKA 4ZSLA 2B52A 4UEUA 3U4WA 2BHEA 2BIYA 4QMMA 3RK9A 4RIWB 3H9RA 4W8DA 3W8QA 3POZA 4Z7GA 5EW9A 3F2NA 4I3ZA 4CLIA 2PVKA 3IW7A 4HOKA 4D0XA 2P33A 4FKWA 4RLLA 3DKGA 5D7AA 1DS5A 4X6RA 3PY0A 5TR6A 3ROCA 4P5ZA 4CQGA 3PDTA 3RWPA 4R3PA 3ZDIA 3GGFA 3QZFA 3EN4A 4XG9A 5IMXA 2XP2A 1BYGA 5AP5A 4BDCA 2UW4A 3V51A 2QG7A 3CTQA 4A4XA 3KXGA 1E1VA 4RX9A 3PP0A 4XCUA 4C57A 1TQIA 4D2VA 4U7ZA 3IDCA 2OI4X 2GS2A 3CP9A 3QHRA 3ZUTA 4L00A 5KZ0A 4L67A 1ZYJA 3ZZWA 4DBXA 2VNWA 4Z7HA 4FG8A 4TW9A 1T46A 4TYHB 3WZJA 2VWZA 3P7BA 2UZBA 3ACJA 3TIZA 5AX9A 5IA2A 2PVNA 2WOUA 4OTDA 3D7TB 4YU2A 4BCMA 4BYIA 3WE8A 4O83A 4FE2A 2CGWA 3V5TA 3TL8A 3N51A 3UG2A 4D4YA 2C6TA 3JY9A 3DFCB 3SOCA 3NYXA 5CLPA 2C5NA 4D58A 4XG4A 4FG7A 4EK4A 5CALA 3BRBA 4J98A 4ZLOA 2NRYA 2ESMA 3NEWA 3C0HA 4JS8A 3W2PA 4GSBA 4O21A 4FKQA 5HHWA 4B8LA 2CGXA 5CQUA 3SDJA 2QOHA 5J5SA 2HY0A 3F69A 4F9YA 2W9FB 5BYZA 3OY1A 3O7LB 3PJ3A 4FV7A 4CMTA 2LGCA 3Q9ZA 4R6VA 4FIFA 2ITQA 2RG6A 3FAAA 3OF0A 4FTIA 4BWKA 5AX3A 5IQEA 3FC2A 2OZAA 3RZFA 4D2PA 2GNJA 2H6DA 4JNWA 5AP1A 4F7JA 3ELJA 3PA4A 5F95A 5IG1A 5CEIA 1W8CA 2RSVA 4MNEB 2VO6A 4IZ7A 3W33A 1J1CA 2RGPA 3GEQA 4IZAA 2CLXA 1R0PA 1J3HA 2IZRA 4O1OA 4GJ2A 3RAKA 3RM6A 3DQWA 2C69A 2QR7A 3FMLA 3S3IA 4DEDA 2YDKA 3FZSA 5EW3A 5J9LA 5JFSA 1M7NA 1ZZLA 4HPUE 2UVZA 3NCZA 4PDPA 2Y8OA 3MIAA 4L01A 5M4UA 3HEGA 4IANA 5B7VA 3D2KA 3M11A 2G9XA 1OI9A 5HVKA 1XR1A 3GBZA 4OTIA 5J7HA 5LWMA 2WMWA 5AUXA 5IEVA 3RCJA 3E7OA 3JVRA 4QPSA 4QTCA 3CD3A 2OJFE 3ZFYA 4B9DA 2VO0A 5DI1A 4TN6A 2W1DA 4C33A 5EOLA 4FK6A 3R2BA 5IDNA 3ORLA 3QCSA 4TWCA 4AF3A 4EI4A 4F7NA 4KINA 3F82A 4OT6A 3WYYA 2GSFA 1H1QA 5F94A 4TYGA 3MVLA 4QTAA 2W5BA 3W55A 1MP8A 2UZDA 3W10A 3HNGA 2QOKA 4ITIA 3NUNA 3P4KA 3RHKA 4AGWA 3DFAA 3ODYX 2AYPA 1ZYDA 3EQGA 5C27A 1NA7A 4JQ8A 2BFXA 4HZRA 4I22A 4XS2A 2OH4A 1JQHA 4A06A 4H1MA 2Z7RA 2QHMA 2BFYA 2OG8A 3DKOA 3R9NA 2BAKA 1Q97A 4DGMA 3NSZA 4P7EA 3LM0A 1H00A 5FG8A 3GUBA 3VS3A 4BI0A 3Q9WA 3T8OA 2ZV2A 4JR7A 4DT8A 3KK9A 3RAHA 3LJ0A 3HZTA 3U55A 3UQGA 2V22A 1YDTE 5KKRC 3UZTA 4NM7A 4XMOA 3VBVA 4AACA 1JAMA 4BCIA 2FB8A 2RG5A 4MXCA 3Q2MA 4FSZA 4L53A 4MXYA 4FTJA 2OJGA 5KE0A 4DH5A 4HW7A 3BHHA 2UZVA 3NVMB 1VZOA 5HCXA 4NU1A 3FY2A 3TCPA 4NTSA 3MPMA 4QMVA 3UNKA 5IU2A 3IW4A 4KABA 5KMOA 2ZMCA 1W0XC 5IQBA 4FIHA 4L42A 2UZUE 1W84A 5FQDC 4EONA 1MRUA 3II5A 2C0IA 4EBVA 4IJ9A 5AAGA 3UYTA 4E3CA 4CFNA 1ZLTA 2FSOX 2JLDA 3ITZA 1U46A 4FEUA 3R7IA 4QMYA 5FUTA 5LVMA 4R5YA 4WD5A 3SQQA 4BTJA 4EL9A 4QMZA 2UV2A 4QMTA 2GTMA 4OGRA 3QTRA 4JG8A 2BRBA 3P78A 5EKOA 3QFVA 2X2LA 3CE3A 4XOZA 5CEQA 4U44A 4EYMA 2B0QA 1GZKA 4FTLA 2J0LA 2W1FA 4RC4A 3TEIA 5CAQA 5E4HA 2I0YA 1ERKA 3PWDA 2HAKA 3VW8A 4EWQA 5B0XA 4DLJA 1XBCA 4XG7A 4O7YA 4FK3A 4FV5A 4EOKA 4XG3A 4EQMA 4RIXA 4EK8A 5DEYA 4NT4A 2O0UA 5GJFA 1J1BA 3LFFA 3FBVA 2JFMA 2FSTX 4F4PA 3EJ1A 3PVWA 4D28A 2JITA 4S34A 4BDIA 5IA3A 3LXKA 3KA0A 3WYXA 1YXVA 4GT3A 3WF8A 4MWIA 2BDWA 1PJKA 2BAQA 2P3GX 5DHJA 3QCQA 3V6RA 2PMLX 3UQFA 2J51A 3MGYA 3NVKI 4JDKA 4WSYA 2WZJA 5DWRA 5BNJA 4H3QA 5EG3A 3COMA 3KCFA 2FYSA 4CFWA 5DR2A 3EB0A 4GFOA 4BCFA 2CNUA 3B8QA 3RINA 3UTOA 3F3VA 3F2RA 2GTNA 3VWAA 2JBPA 3UMXA 3TI1A 2QCSA 5CU6A 1YXUA 3NIZA 4AZWA 2HZIA 3DB8A 3KRJA 3MS9A 3QTUA 4FTNA 4FV9A 4FOCA 3PE2A 2E9UA 3PY1A 4FT7A 4RMZA 3JUHA 3NIEA 4FIIA 4YPSA 4DGNA 4QMXA 4YO6A 4XRJA 4M7IA 5A4EA 2VWVA 1V1KA 3IO7A 1ZOHA 2R3PA 4FV0A 4NJ3A 4M12A 3MTLA 3VJNA 4WIHA 2GFCA 4LRJA 2VNYA 1FINA 2JBOA 2JKKA 3U9CA 5KBQA 4KS8A 5CTPA 1O6LA 3UO5A 4FV3A 4AT5A 3V8WA 4E4XA 2ITOA 4MD9E 5K5XA 2ERZE 2XIRA 1H08A 3G9NA 3LCOA 3R1YA 3ZDUA 1YHSA 2PUUA 2CKOA 3LFBA 4O2ZA 3R0TA 4FTRA 4JBOA 3ZLYA 2WHBA 3DXNA 3KEXA 1Q24A 2WTJA 4ZTRA 4EZ7A 2VGOA 3FQHA 3QTZA 2EXCX 2QU5A 1O9UA 5AIRA 2IW9A 1Q8ZA 4MBLA 2IG7A 4D9UA 4BCQA 2E9NA 3V04A 1MRYA 3H10A 5EQYA 4AFJA 4JVGA 1HCLA 1QPDA 4YJQA 1FBNA 2Q0NA 3A4OX 4WKQA 5CI7A 2WO6A 4PL5A 3I4BA 4I0TA 4FNYA 4QRCA 3GQIA 3QD4A 3QKMA 1PXOA 1UNLA 4RFZA 3UIXA 3O8UA 4RVMA 3OXZA 4MAOA 3WOWA 3QTXA 4ID7A 4CXAA 5HO7A 4NKAA 3S95A 2QOLA 3QQFA 1ZY5A 4ZZNA 4QP6A 3NMUF 4DGGA 5DR9A 4FEXA 3NUUA 3PA3A 2YWVA 4BDKA 3QD3A 1Z9XA 4GVJA 4EBWA 3OEFX 5IMEA 5AM7A 4N70A 5T6KA 3R9HA 5C8KA 3B2TA 4YTCA 3E3PA 4CVAA 2XIZA 3VW6A 1XH7A 4YTIA 4EQUA 2XUUA 4IX4A 4KIKB 2C6OA 5ICPA 3R9OA 5JFWA 3AD4A 3FKOA 4JLCA 3R1NA 3WF6A 5IEYA 3OBJA 4FV2A 3OXTA 4QQCA 3QL8A 4EH4A 4YZNA 3QTWA 4MK0A 4O2PA 4QYEA 2P4IA 5F9EA 1H26A 2I40A 2J9MA 1U5QA 3AC5A 4CKIA 5AWMA 4J7BA 2GNFA 4G5PA 1U4DA 1HCKA 5BVEA 4ACGA 3S00A 1R39A 4TZRA 5CANA 3TKIA 1QCFA 1GNGA 5CF4A 1UU3A 3E3BX 4EKKA 3FWQA 1ZAOA 3O7LD 4L44A 3AMAA 4HCTA 4FSRA 3QC9A 2XK9A 1RJBA 3PSCA 4YJRA 4ALUA 2X9FA 1PMNA 3LLTA 3ID6C 1H24A 5IKWA 2IVSA 2G2FA 2QURA 2YISA 3GU4A 4NW6A 4YJNA 4DFLA 2AC5A 4E5BA 1OB3A 2ZDTA 3NDMA 3VHKA 3ZM4A 4FTQA 3GC9A 4YJVA 3UDBA 4DTKA 1XHAA 2O65A 3H4JA 3RPOA 2JC6A 3PXFA 3NUSA 3LFDA 4IFCA 5TE0A 1H1PA 4QMQA 4BCPA 3C13A 3SD0A 4DG2E 3KF7A 5BVNA 4FC0A 5CEOA 3MA6A 4RLKA 4WSQA 1GAGA 3VJOA 5AJQA 4XJ0A 5HU3A 4AFEA 4Y85A 4AZFA 1OECA 4CFUA 4QNAA 5DMZA 1G3NA 5AV0A 4ZY5A 4YLLA 4H3PA 5CI6A 2OLCA 1XJDA 4PRJA 5DT4A 5CAPA 3BLRA 1IAHA 3VS0A 4XV3A 3GCQA 3OWJA 4L6QA 4XLVA 2RIOA 4TTHB 1M17A 4YBJA 1Q8YA 4FZDB 1ZY4A 4GK2A 2W4OA 3P79A 3QX4A 4RIYB 3E5AA 3ETAA 3Q4UA 5KMKA 1SZMA 3QU0A 2QO9A 4DA5A 5JGBA 2OZOA 2WELA 2P55A 4DHFA 5BX0A 3T3VA 2QVSE 3GI3A 3QBNA 2DWBA 4MF1A 4O96A 2XVDA 3ZEWA 1AD5A 5AR5A 2VU3A 2PZRA 1WBSA 4NKSA 4BYJA 2B9HA 3O0GA 2BHHA 5H8BA 3RPSA 5F20A 2F2UA 4ZTHA 4BZNA 3U51A 3WF9A 4D4SA 5A4CA 1ZMUA 1OKYA 2WMBA 4TRLA 4XYFA 2O64A 4R1YA 3DDQA 5TT7A 2QC6A 3P23A 5AP4A 1VR2A 4ZSEA 4G3FA 3RNYA 3WIKA 4NUSA 5AUUA 2G1TA 2PWLA 2OK1A 4TWOA 1WVYA 2YERA 3OEZA 4RJ7A 4YTHA 4ANOA 4CNHA 2XK3A 4XH6A 3H30A 2UUEA 3ZUUA 3TDWA 2VWXA 3HVCA 2EXEA 1WBWA 4LMNA 2F9GA 4M13A 3VUHA 3KREA 3ACKA 3KMMA 4WNMA 1XQZA 5HIDA 4DT9A 4GYGA 3VUIA 2Y0AA 4FGBA 3EN7A 4DC2A 4FSNA 3ZC6A 4RFYA 2IO6A 1QL6A 4C34A 3UG1A 3CXWA 3MH0A 2OIDA 1V0PA 3EL8A 4RIWA 2ZV7A 4RQVA 4DH3A 2WEIA 4AA5A 3PE1A 4FT3A 4CCBA 4GIHA 3AC2A 3JXWA 4IVCA 3SOAA 3G0FA 5AUTA 3FXXA 2OW3A 3MFTA 1Q62A 4AW2A 2WIHA 3GFEA 2J0JA 4HGLA 2UW0A 2CN5A 3PXRA 3ZSGA 3G0EA 4FZ7A 5I9XA 5M07A 4E4LA 1K2PA 2R2PA 5BVKA 3VQUA 4CTCA 3D7ZA 4O7TA 4FKLA 4PY1A 2GNGA 3PIYA 2ETRA 3OCGA 1S9JA 3MH3A 2OBJA 3ZHPC 4AZEA 4D1XA 4C35A 3M2WA 3EKKA 1Q8UA 4FSUA 4FSQA 4X2JA 2EB3A 4ZS0A 3ZO3A 1UVRA 3TV4A 4MXZA 3RHXA 4FR4A 4CQEA 4L68A 4FGRA 4R3CA 5CF5A 5E9EA 3FQSA 4TYHA 4E93A 2VTQA 3R8ZA 1UU9A 4JX7A 1QPEA 3LOKA 5T68A 1J7LA 2XJ0A 3LMIA 1MUOA 2GNHA 3D7TA 5E8VA 4EHVA 2ZDUA 4ZXTA 2HWPA 3GCPA 5C03A 3TG1A 2YHVA 2WQEA 4EK6A 4GK3A 4G31A 3LHJA 2C6MA 3FDNA 4PNIA 4E26A 5GNKA 3CQUA 3FC1X 1ZYCA 4I0RA 5JQ8A 4RZVA 4UBAA 1CKIA 3LFSA 4BWXA 4YHFA 3DTWA 3ERKA 4C2VA 5G1XA 1YW2A 2QOFA 5IA4A 4AXAA 3LFAA 5ETAA 2YJRA 1DAWA 3D94A 3MB6A 4GT4A 3VNTA 3ZSIA 5IQIA 3UOKA 5HNBA 1U5RA 5IQHA 3QHWA 3WI6A 4QMNA 5K4IA 2WQBA 3PY3A 3SXSA 3GU8A 1BUHA 3O2MA 2C0OA 2HWOA 3AQVA 2UZWE 4I6FA 2PVYA 4NH1A 4QTDA 2QKRA 5AR7A 5ETCA 5EYDA 3OWPA 2J4ZA 4JIKA 4DEIA 5HU9A 4K9YA 4BDDA 3UODA 4KSPA 1RW8A 3OWLA 3ALNA 3DLSA 2JIVA 4FT0A 3VF8A 4HCUA 3BI6A 4FKGA 2BTSA 5CU2A 2CGUA 1H0VA 3RPRA 3EZVA 4BCGA 3ANRA 2WTVA 4FL3A 5IQFA 2PMIA 3VBTA 2WNTA 2FO0A 5BMSA 1CKPA 4AUAA 4BBEA 2VX1A 2VWBA 5HD7A 2QHNA 5C9CA 4C4IA 4DH7A 4J99A 1OKZA 3IKAA 3FZRA 4O7SA 3FI3A 3N4TA 3QGYA 4G1WA 2JDVA 3GP0A 2XNMA 4FIGA 2R3GA 4YR8A 3O8TA 3TNWA 2RFEA 4GU6A 3DQXA 4QMUA 3W2OA 4EEVA 5A9UA 4BKJA 4LQMA 4KKGA 5B2MA 1ZMWA 4BI1A 4GS6A 3QALE 4R7HA 1ZOEA 2C47A 4OTGA 4Z9LA 3BQCA 5LMAA 4CCUA 1PXLA 5LMKC 4AN2A 1JPAA 2QOIA 4ZZMA 2XKEA 4V01A 4F0FA 1Q3WA 4E6QA 2XK4A 4XUFA 2WGJA 3Q32A 4IQ6A 4II5A 3TT0A 2YEXA 4ALVA 4NM3A 4I92A 3T3UA 4EOIA 5EI8A 5AP3A 4PL4A 1Z57A 3F9NA 4U41A 3D9VA 4W9XA 1M2PA 5HIEA 4I93A 5IQAA 3I0OA 3LFCA 1PHKA 2XEZA 4I21A 1A9UA 2X8EA 5KMLA 5EQPA 2C6EA 3UVQA 4BDGA 4F09A 5CSHA 1KE7A 3ZO1A 5BVOA 4GV1A 4C3FA 2E9VA 5TOZA 5IUIA 3EYHA 3L8PA 2R3HA 4R3RA 4A4LA 4C4EA 2BDFA 3DV3A 2BROA 4L45A 5BUIA 4BDAA 2ZVAA 4U0IA 1Q99A 3HLLA 4W9WA 3KXXA 3ZSHA 2BZIB 1OZ1A 3PP1A 5HE3A 4B6LA 5B2LA 1H01A 2HZ4A 3KRXA 4HYHA 3MBLA 4OUCA 1TQPA 4MQ2A 5I4NA 5HE0A 3A8WA 3HV7A 3QQHA 2VTHA 3I60A 4M8TA 2HCKA 3DS6A 1B38A 4ANBA 2G01A 1G5SA 2VN9A 3PXKA 4YJSA 2W1GA 3KL8A 4IZYA 1NY3A 3NNXA 3QKKA 2C6LA 3V3VA 4QTBA 4AOIA 3MB7A 3PJ2A 5J7BA 4Q9SA 2HW6A 3EFLA 4G5JA 4XEYA 4FKOA 3G2FA 4U97A 5CSXA 4AE9A 4WNOA 1OIUA 3OD6X 5J87A 2J90A 3FLQA 2BRNA 5L2IA 4B4LA 2BILB 2X2MA 1SVEA 2VTAA 3OBGA 4FVPA 3F5PA 4S32A 3R83A 4BFMA 5LWNA 4BY9E 3V5JA 2VGPA 4MD8E 2X1NA 4E73A 4IM0A 4F1TA 4DCEA 2A0CX 4AA0A 4KNBA 1OPJA 3QWJA 4MXXA 2YM3A 4ZTLA 3SC1A 4F1OA 3MV5A 3SA0A 4PPAA 4EC8A 4GU9A 4YURA 3F66A 3MSSA 4G9RA 3WILA 1UKIA 2VTMA 3EQHA 1LR4A 3F88A 4EYJA 4NM5A 2J7TA 4G6LA 2BRGA 3O96A 4DTAA 1GIJA 2CGVA 3OTVA 3U6IA 3I7BA 1BMKA 3AC8A 4G2FA 4KBAA 4ZEGA 3NNUA 3EL7A 3BIZA 3ANQA 3E8DA 4CZUA 1NW1A 3NW5A 1RQQA 3DJ6A 5I9UA 3HMIA 4A9TA 2O63A 3GCUA 5BVDA 2IZTA 3FMJA 3T9IA 2QG5A 3ORPA 4U42A 4F7SA 4OTWA 3DBDA 4O1PA 3QTIA 4LGHA 2BRHA 5FDPA 4HGTA 3WZUA 2XH5A 4R1VA 4WNPA 3QYWA 4WT6A 4JL9A 3RMFA 4DCAA 2Q0BA 4E5WA 4C4GA 2BZHB 3AMBA 2R7IA 3CY2A 5FXQA 2X81A 3VUTA 4X2GA 3UE4A 5A4LA 2F7EE 4FODA 4KRCA 4YGAA 3EQBA 2PYWA 2C30A 4U8ZA 4PMTA 3JS2A 3ZLXA 5AADA 2VWWA 4BDBA 5M51A 2GHGA 3MA3A 3ZC5A 2XF0A 4FKUA 3H0YA 3R00A 1LEZA 2OXXA 4A7CA 1FMKA 5F1ZA 3D4QA 3FI2A 3I5NA 5AP0A 3W32A 4FKIA 1ZARA 4L52A 3LXLA 1WBPA 3TUBA 1KSWA 5EM5A 1OGUA 3UIUA 3ZRMA 4U9AA 1Y8YA 2YCQA 4I5PA 4F9WA 4JBPA 4KIQA 1WBTA 4IB1A 3R8LA 4AG8A 3QD2B 4LUEA 3PXYA 1FOTA 4AGDA 2PVJA 1DAYA 1OL2A 4W4WA 4WG5A 5EKNA 2UW5A 4EH9A 4QQJA 3R8UA 3LQ3A 5DPVA 5L8JA 5DBXA 3LM5A 2HENA 2JKMA 3ZXZA 4NYEA 3UJGA 2GHMA 4BHNA 3QLGA 2FVDA 4OLIA 4XNEA 1YWVA 4JDJA 4XV9A 4D1ZA 2IJMA 3BELA 5HD4A 4LRKA 2IWIA 2BTRA 2OIBA 3VS1A 5CNOA 5EH0A 3AC4A 1P2AA 1CSNA 3IECA 2WIPA 3C9WA 3CJGA 2Z8CA 4OW8A 3LMHA 2ZM4A 5M09A 1SNUA 2J5EA 3PYYA 2EXMA 2W1ZA 4AWIA 5EQEA 5CAVA 5D9HA 1NT2A 1OBGA 3Q60A 5GJDA 1REKA 2J0KA 3BV2A 4HNIA 3JYAA 2X8IA 3WZDA 1UKHA 1QPCA 1LPUA 2YACA 3ORXA 4MYGA 2VTJA 2XRUA 1WVXA 3E88A 4KIKA 1OIYA 4IDTA 4QQTA 4FUXA 3GCVA 4UALA 5FD2A 3HUBA 4NW5A 4FI1A 3GC0A 3KVWA 3UOJA 5CSWA 3QUPA 3QF9A 4FT5A 4CYIA 3G33A 4I6QA 3DNEA 1BX6A 5AM6A 4D2SA 4JQEA 4IX3A 3KKVA 4F9AA 2BKKA 4E8AA 3GT8A 4UMTA 4LM5A 5HOAA 2EU9A 4CG8A 5IQDA 4C8BA 1FPUA 2WU7A 3LFEA 4Q2AA 4UY9A 4YZCA 3LCSA 2BKZA 2B53A 2R3FA 5I9ZA 4DE4A 1KV1A 4BGGA 1KWPA 3WF5A 3ULZA 4RC2A 2F7ZE 4IH8A 5LCJA 3BPRA 4Q9ZA 2X2KA 3IS5A 3SVVA 4P90A 2RF9A 3RK5A 4F6UA 2YIRA 2HXQA 4ENXA 2R9SA 4EOJA 2HZ0A 5KMMA 2WTWA 1F3MC 4ANQA 3Q5ZA 1UA2A 2F4JA 2YM4A 3C4WA 4YLKA 3RWQA 4D4RA 5FXRA 3S0OA 3G15A 3LW0A 3GFWA 5HZNA 4JQ7A 4FL2A 4M14A 5C8NA 4F7LA 2EWAA 4UYAA 3FXZA 3QQUA 4EH3A 2PY3A 3W8LA 4BKYA 2X9EA 4FZAB 4BIEA 2R3QA 3F3WA 4IWQA 2JDOA 4RA4A 5CX9A 2C0TA 5JGAA 1YQJA 2W4JA 3IGOA 4TNDA 2XS0A 3PJ1A 4L43A 4AN3A 4IEBA 5LMKA 4QPMA 2AC3A 3KU2A 4YP8A 3M42A 4YZDA 5FRIA 2I1MA 4I5HA 5E1EA 5EHOA 5CVHA 3KRRA 4USDA 5EI6A 3AD6A 2OIQA 5K0KA 3RKBA 4DFZE 1JWHA 3OOMA 1IASA 3PRFA 4FTMA 4APPA 3NUYA 3AT4A 4GFGA 4EK3A 1SVHA 1TQMA 3FMKA 4XRLA 3LCTA 3GU6A 4GUBA 1BKXA 3U9NA 1P14A 1JSVA 4F0IA 4USFA 4J1RA 4RX5A 3ZMMA 1XH6A 1KUTA 4HYSA 3OOGA 3QC4A 4Q5HA 4ASZA 1OBDA 1P4OA 3IW8A 2GQRA 3KRLA 4DG3E 2GNIA 3CC6A 3MJ1A 4G16A 5AUZA 4ACMA 1F5QA 4RVTA 4O7RA 4K18A 2X7FA 4HNFA 1WBOA 3OC1A 3OWKA 4DH8A 3CQWA 2XRWA 5E8SA 4BCNA 4I5CA 3KGAA 3D14A 2JD5A 3DNDA 3R7EA 4E6CA 2IVVA 5E8WA 1YOMA 3GENA 2PZPA 4ZTQA 4DYMA 2IPXA 3R7VA 2ZM1A 3MESA 3MPTA 2PZIA 2W1CA 5DFPA 5HBJA 3Q53A 4FZ6A 3P7AA 3VN9A 4YHTA 4RJ3A 3HMPA 4GMYA 2VTOA 3ZBXA 1LP4A 4WA9A 3FLSA 2VRXA 3GC7A 2CCHA 3A62A 5DVRA 2R3LA 2PE1A 1UU8A 2QLQA 4ZTSA 5HLWA 5L2WA 2HIWA 3A7FA 4GG5A 4GRBA 3BEGA 2BDJA 1ZYSA 2V62A 3OW4A 4BL1A 2CNVA 5EK7A 2XNBA 3P9JA 4UWBA 4IZ5A 2WOTA 5JFXA 3ODZX 5DEWA 3B8RA 4NM0A 3PFQA 4E7WA 3TNQB 4P2KA 5EDPA 2W17A 3PVUA 4LL5A 5BUEA 5J8IA 3BYOA 3RVGA 3R8VA 4H3BA 2WTCA 3C0GA 5L3AA 4YJUA 5FBOA 3BYSA 2F57A 3G51A 3F7WA 3MW1A 4ORKA 1WBNA 2YAAA 3ZEPA 4PDYA 2QI8A 1UWHA 1YKRA 1O6YA 3F7ZA 1JSTA 2YCRA 2W5AA 1V0BA 5H9BA 2YLEA 3C4XA 3L1SA 4PX6A 4ZTNA 2GQSA 3PSBA 1FVTA 2UW9A 5DG5A 1I44A 3VAPA 4BBFA 2JDSA 4C02A 3R7UA 3SG8A 2PE2A 3LAUA 5BUJA 5AFVA 4DFUA 4FX3A 5HNGA 3AOXA 4EK5A 5GIPE 4IBMA 4Y8DA 1URWA 4I4FA 1DI9A 1YDRE 4RSSA 2W4KA 4MBJA 5HVYA 3HMNA 3C4EA 2A2AA 3GOKA 5FLFA 3ZLSA 3TWJA 1G8AA 4O84A 5I3RA 2F49A 2W05A 3FYKX 4JRNA 5KHXA 3O50A 4U5JA 4MH7A 4UMPA 4I5MA 4MTAA 1URCA 5A6NA 2GDOA 5J79A 2XIXA 1XKKA 3VQHA 2IZSA 4KIOA 2VWUA 1WFCA 3QRTA 4A9SA 3DDPA 4F9CA 3MH1A 4A9UA 4CV8A 4QMOA 1M14A 1YHWA 1R78A 2CDZA 2P2HA 1M2QA 2XK7A 3FPMA 4CKJA 3MVJA 4F6SA 3K3IA 1U54B 3OT8A 2Y7JA 3CBLA 3F6XA 4M97A 5CF8A 3TKUA 3PVBA 3QZHA 4IX5A 4BGHA 4FEWA 4E1ZA 4O27B 4RFMA 5CVGA 4X2KA 1WAKA 2V0DA 1W7HA 3HV5A 2UVXA 3SHEA 4HVSA 1Q41A 3QQLA 4DH1A 4O7WA 2ITWA 2YIXA 2V7AA 4QYYA 4J97A 4C36A 3MH2A 4JAJA 3ZO2A 3NLBA 5CSPA 2Z2WA 3DA6A 3I0QA 4GFMA 5ANOA 3KC3A 2B54A 1R3CA 4JRVA 4K0YA 4LG4A 4C7TA 4IAFA 3TJCA 4XHKB 4DGLC 5CEKA 1SVGA 3FSKA 3O17A 4F9BA 1YI3A 1Q3DA 1W98A 2XNEA 1JKSA 2YIWA 3LFQA 3VUKA 4ZIMA 4EOSA 2CKPA 3COKA 3Q9YA 3VUMA 2P2IA 2A4LA 5AV1A 3UO4A 3L9PA 5EFQA 3BBTB 3G9LX 4WG3A 4FV1A 3A2CA 1EH4A 2PE0A 3F2AA 2CSNA 4I24A 5JSMA 2SRCA 1PF8A 3PXZA 2ZV9A 2C3JA 4R8QA 2UZTA 4OBOA 4JDHA 4B0GA 3D5WA 4O82A 5JZJA 3MFUA 5F4NA 4ALWA 4KBCA 4UX9A 3SW7A 4WRSA 5BVFA 2GNLA 3D5UA 4JG7A 4WBOA 4U80A 5EOBA 3SRVA 3OCBA 2W9ZB 4Q5EA 2QD9A 3QXPA 4RJ5A 4DEHA 2ACXA 4ZS4A 1MQ4A 2XJ1A 4WO5A 4EHGA 3A99A 5DT3A 5CS6A 3AT3A 3HECA 4FSTA 2WB8A 4RWKA 4O7NA 4F08A 3FEGA 4F70A 2HZNA 3FJQE 4W4VA 1SNXA 1XO2B 4FT9A 4IX6A 5HI2A 1ZRZA 4UZDA 4AQCA 3C4CA 3WE4A 1PKDA 3WBLA 4ANLA 3ZONA 4MD7E 1OPLA 1WCCA 3EQPA 5HLPA 5CY3A 3NYOA 5KMIA 2WMSA 2XIYA 4QP4A 2ZMDA 4HYUA 3TIYA 4BRXA 4AT3A 5LVLA 1LEWA 3AXWA 3LZBA 3R63A 4FKSA 4ZZOA 3PLAE 4RJ8A 2BZKB 3OUNB 3ORTA 4C61A 4HVDA 1YDSE 5CNNA 3S2PA 2JAMA 4NTTA 3FLYA 2CJMA 4AS0A 3COHA 5EYMA 2GU8A 3DY7A 5JEBA 3NAYA 4TWNA 4IAAA 3SX9A 4QD6A 4V05A 3FI8A 5DE2A 5M06A 3KN6A 2XA4A 3NYNA 1FGKA 3P08A 1WVWA 2C68A 5JQ5A 2ZB0A 3O51A 5KMJA 2IW6A 3TZMA 4GH2A 1BL6A 3QQJA 3ZOSA 4FYOA 4JOAA 4CEGA 5AMNA 2CCIA 2PPQA 1VEBA 4LV5A 2C5XA 4XOYA 3NUAA 4DTBA 2YDJA 3DZOA 3ORIA 4R78A 4YJOA 3NRMA 4LL0A 4C4HA 4EUTA 1XH8A 1OMWA 2X7OA 2XBAA 3ET7A 3MVMA 5BYYA 2BIKB 2EB2A 3EMGA 3QRJA 4OT5A 2WQNA 4UXQA 5KCVA 4BTMA 2O5KA 1JNKA 3FZ1A 3CIKA 4PMMA 4RZWA 3AG9A 3D0EA 3NPCA 3VUGA 4FEVA 2QOCA 4L7SA 5DRDA 3NCGA 3UGCA 4AE6A 4F99A 1NVSA 2W99B 2ITTA 4AN9A 4C3RA 3NNWA 5EM7A 4ACHA 2REIA 2WFYA 3P7CA 5A4QA 3RJCA 3GC8A 4I41A 3ATTA 3RP9A 4XBUA 3UVRA 5M4CA 4CMUA 3L9MA 4X21A 1P5EA 4IC7A 3MY0A 3V5LA 4LRMA 5AUWA 3NUXA 3DKCA 5LQFA 4EZ5A 3VBXA 3S1HA 4YMJA 1J7IA 3RK7A 3QWKA 2UZLA 3A61A 1GZ8A 4DGOA 4O81A 2BR1A 2XK6A 3R9DA 2A27A 3QX2A 4O91A 4H36A 4BTKA 3IONA 1OKVA 5L8KA 1ZOGA 5LCKA 3UPZA 3P86A 5IPJA 4EOOA 5ANJA 4IWPA 5L2SA 3AD5A 4J52A 4RVLA 2PVMA 1KE8A 3V6SA 3DCVA 2UW8A 3A7GA 3OCTA 4RWLA 4R5SA 2H34A 4AP7A 1QMZA 5AAEA 5BQ0A 3C50A 4R77A 3D15A 5DN3A 2KTYA 5HO6A 3SXRA 3L8SA 3ZLWA 4APCA 1H0WA 2XNGA 4BGQA 3W1FA 5EDQA 5HX8A 2WKMA 4O38A 4TWPA 2Z7LA 5ITAA 1VJYA 4XLIA 3BV3A 5HLNA 1IA9A 4QYGA 1R0EA 2H96A 2JKOA 4ZTMA 3U54A 4OAVB 4PPBA 3KN5A 4TXCA 2QO7A 3G5DA 4PUZA 4U6RA 5KO1A 4WUNA 2C5OA 4IB0A 3I6UA 2RL5A 3DBFA 4MX9A 3EH9A 4D0WA 4NK9A 5A6OA 3VO3A 5A54A 1PY5A 2VTTA 1GIHA 1APME 3EQFA 3OVVA 3BU5A 1VYZA 4JXFA 4NIFB 3QTQA 1OIQA 4EH7A 2ITVA 4LUDA 3PZEA 3I81A 3W16A 3ZU7A 2VTSA 1YXXA 4F65A 3ZO4A 1PXPA 3PWYA 5EYKA 3DXPA 2B7AA 4I6BA 4NWMA 2OICA 3DPKA 4MNEA 4Y72A 5CU4A 4LV8A 5FEQA 5CENA 1PKGA 4LFIA 4RGJA 3ZZEA 1IA8A 4BICA 3MN3A 3W2SA 3JVSA 2OJJA 5L6PA 5L8LA 1OM1A 3IPHA 3TV7A 4C4FA 4H05A 3QZGA 3TXOA 3UP2A 5M08A 3BGZA 1Q5KA 2VX3A 3FHRA 3POOA 2Z7QA 4EH6A 1YXTA 4FV6A 1GZOA 1K3AA 4ZJVA 3RAIA 2R64A 5I9WA 3FMEA 2YCFA 3QLFA 1CMKE 3I5ZA 2ITPA 3CKXA 4W4YA 4A4OA 4D55A 5HKMA 5D1JA 4EJNA 3P1AA 5CXZA 4X2FA 4N4SA 5BMMA 3ZCLA 1DI8A 4Y95A 3ZM9A 3BCEA 3FMHA 3PPZA 3Q4ZA 4UWCA 4ITJA 4NSTA 2PMOX 5KZIA 3PRIA 2R3JA 3LVPA 3RGFA 3BBWA 1KE6A 3PA5A 2X4FA 2WMUA 2GQGA 4OBQA 2YIYA 3ZXTA 2DYLA 3LFNA 4YBKA 3MWUA 1MQBA 3H0ZA 3AC1A 4FTAA 3NW7A 2W06A 5CSVA 4HVHA 2R3KA 5TKDA 1PRYA 1IG1A 2XBJA 3CD8A 4IMYA 2XCKA 3RBWA 2PVHA 3RM7A 3TV6A 2C6DA 2UZNA 2OF4A 2YDIA 4DLIA 2ITYA 2OXYA 4DFNA 2DUVA 3UOLA 3DBEA 2R3RA 4CGAA 4J71A 4EJ7A 3PXQA 5C01A 2XK8A 4RJ4A 2Q83A 5DYJA 2R3OA 2DQ7X 3PLSA 4PTGA 3A7HA 3MYGA 4W4XA 5DR6A 4MF0A 3QRUA 4G9CA 4TPTA 1YWRA 4IDVA 4CFMA 3DXQA 4YNOA 3HRBA 3ENMA 2XEYA 3D5VA 4RVKA 3A4PA 3UNJA 5GZ8A 1ZXEA 3JPVA 4PDSA 2C5YA 3ULIA 5HTBA 5HTIA 4DEAA 2W96B 3KMWA 1H1WA 3MTFA 2DS1A 1W82A 3VF9A 4DBNA 1KE9A 4FTTA 3IOKA 5ANDA 5HCZA 5E8YA 2GPHA 2RFDA 5B2KA 4DF3A 4DFBA 3QRKA 3VHEA 4EOLA 3KQ7A 5ANGA 4O6EA 3FMDA 3RZBA 4BR3A 4UZHA 3KULB 4UV0A 3OW3A 1ATPE 4D5HA 2C5VA 5H3QA 3MDYA 4DEBA 5LARA 5HBHA 4O0WA 3CGOA 2GFSA 3C5UA 3KF4A 2OU7A 4NZWB 3TTJA 4AA4A 1JKLA 1CDKA 4ZJJA 1JOWB 3QAME 3UVPA 3R2YA 4UMUA 3QGWA 3KCKA 4JG6A 5AP2A 4IFGA 5FXSA 4BDHA 3C4ZA 5KX8A 5IUGA 5JRSA 4H1JA 4XP3A 1PYXA 1YVJA 4K6ZA 1ZYLA 3FQEA 4ANNA 3E63A 3EOCA 3FL4A 2I0HA 3ZRLA 5CZIA 1G8SA 4C37A 2PZ5A 4EORA 3GCSA 2C6KA 2Y9QA 3R1SA 1WBVA 2ZB1A 3R8PA 3Q96A 5J5TA 5K9IA 3BHYA 1WMKA 2PVLA 2XKCA 5HX6A 3UOHA 4I94A 2YLFA 4YNEA 5M44A 4N6ZA 2EUFB 2BVAA 4DINA 5J9ZA 1Y6AA 3EQIA 5FTGA 2IVTA 4FSMA 4U3YA 1NVQA 4I20A 2VV9A 2W1EA 5IQGA 4GKIA 4HVIA 4Y46A 5CZHA 4X6QC 1J91A 3HA6A 2J0MB 3FYJX 2NRUA 3ORKA 4K2RA 3KXZA 4M69B 4PTCA 5E91A 4M15A 2GHLA 4R7IA 1OVEA 2X6DA 2OJ9A 4ZY4A 3AGLA 3OS3A 2WMTA 4QTEA 5LJJA 3RAWA 2NNWB 5I3OA 4GG7A 1OIRA 4GUEA 3W2RA 5AA9A 1H28A 4GK4A 2WAJA 4FNZA 2GS6A 3R7OA 4O0XA 2IN6A 3FLZA 4WBBB 2KULA 3FZOA 2WMRA 2F2CB 3R6XA 4RBLA 3VBYA 5DIAA 2W7XA 4E4NA 4V04A 3OP5A 4BDFA 2ONLC 4AOTA 4IJPA 4O0TA 1JKKA 3VS5A 4RA5A 3ATSA 5HTCA 2B4SB 1PXNA 3FL5A 3LCKA 5FBNC 3VS4A 5IZFA 2YN8A 1P4FA 2ZM3A 3HRCA 2YCSA 2BCJA 5AR3A 2I7QA 4D1SA 4BZOA 1YI6A 4PTEA 2C3LA 3ORZA 5AR8A 4OTFA 2OSCA 4FTKA 5C8MA 4C62A 2HK5A 3TKHA 4O0UA 2A1AB 2AUHA 5HQ0A 5AUVA 1M7QA 1XWSA 3F3TA 2HELA 5AV2A 1BL7A 2NP8A 4GW8A 4ARKA 3FLWA 5I9YA 3R71A 2UW7A 4G3DA 5CU0A 4GT5A 4JT3A 3BU6A 1PYEA 4ZMEA 3C4FA 3DB6A 2XCHA 4ERWA 3D83A 4FKTA 1TVOA 1KOBA 1UNGA 1NVRA 2VZ6A 3F61A 4FF8A 3MVHA 2ZOQA 4WNKA 3RNIA 3G6GA 2Z7SA 1KE5A 3BGPA 3PUPA 1YRPA 2OWBA 4BCOA 4EH5A 4GKHA 1FVRA 3DAEA 3K2LA 2Z60A 1H25A 2HXLA 3NAXA 3Q6UA 4FTUA 3MIYA 4FYNA 5DNRA 3VC4A 2QOBA 2P0CA 3GU5A 5EI2A 5IH6A 4BCKA 3CTJA 2PU8A 1U54A 4G3GA 3LQ5A 5JRQA 3IW6A 4IM2A 4AW1A 4EC9A 1B39A 1YWNA 2GS7A 4FKVA 4I0SA 4OAUC 3CTHA 3LXNA 4I23A 3FMNA 3FLNC 4QP8A 4ZY6A 5FEEA 3G6HA 5M57A 5IA0A 1JSUA 3C0IA 4H39A 3U4UA 4BDEA 5ACKA 4XG6A 4L9IA 4LOOA 4X3FB 4J95A 4CMOA 4KKEA 3QA0A 1Y57A 4IADA 4KAOA 2VTPA 1OUYA 4NFMA 3CPBA 1STCE 5ANEA 4FA2A 4U3ZA 4J96A 4B7TA 1ZMVA 3FKLA 2RFNA 5FTQA 4TKSA 5FEDA 3SXFA 4N6YA 2J50A 5D12A 3TUDA 2OXDA 4Y5QA 1UV5A 4BZDA 2WTIA 4KIPA 2YA9A 3DBQA 3ZTXA 3NGAA 4ANMA 4KKHA 5D41A 3ROYA 4JI9A 2W1IA 2B9JA 5CQWA 2O8YA 2R3MA 1FVVA 3R28A 1RE8A 4ASDA 4M67A 3PIXA 2YFXA 4YSJA 2PVRA 4H58A 4ZSAA 2O3PA 4B99A 4IVAA 3HDNA 3RALA 5E8XA 3MFSA 1PW2A 2C1BA 4KA3A 3R73A 1NXKA 2JAVA 1K9AA 2V5QA 3FHIA 5AIKA 4MCVA 2E9PA 4ZK5A 4F0GA 4OR5A 3V8TA 3Q04A 5M4FA 1IAJA 2GMXA 3HV3A 4HGSA 3WF7A 5DRBA 4CZYB 1M52A 4Y83A 3FZTA 4TYIA 3OROA 3RPYA 4YJTA 4ZLZA 2F7XE 5E1SA 4ZMFA 4KB8A 4UWYA 4FBXA 1U59A 2VAGA 4IVBA 3BEAA 3ALOA 5AA8A 2X6EA 3HUCA 5C4LA 2ITZA 2O2UA 1GOLA 4I6HA 3VS2A 4ZSJA 2VWIA 4YTFA 5HNIX 5K4JA 2JDTA 3QQKA 4PQNA 3MPAA 3SLSA 4C4JA 5L4QA 2ZV8A 3HDMA 1LUFA 2E9OA 3AMYA 4XP0A 4CFXA 1QPJA 4D4VA 4IIRA 4BN1A 2PUNA 3U87A 2VTRA 4RIYA 5BVWA 5AR4A 2BALA 2R0UA 1T45A 1R1WA 1YOLA 3IDBA 4JX3A 1AGWA 3OFMA 5HG8A 2J6MA 3SGCA 3W2QA 1ZWSA 4HJOA 3DBCA 2OF2A 3OMVA 3GU7A 4KUJA 2PVFA 3QRIA 1FQ1B 4D2RA 4DN5A 1OL6A 4USEA 3R8MA 2WTDA 3AC3A 3BHTA 4G34A 5JMSA 1KOAA 3QCXA 2BPMA 3CS9A 3V01A 4BCHA 4EH8A 3A8XA 4FKJA 2JEDA 1XH9A 1WZYA 2BUJA 3QA8A 5DH3A 4AZVA 4E6DA 4QP3A 5AP6A 4JBQA 3CJFA 5HO8A 2HOGA 5KUPA 4O0YA 2OH0E 4X7QA 2YM8A 4MNFA 4YZ9A 4V0GB 2Y4IB 3ZBFA 3IDPA 4JR3A 3HP5A 1PXMA 2WMQA 3BQRA 2WEVA 3ZFXA 3CGFA 3R01A 3UC3A 3U6JA 5AAFA 2WU6A 4PNKA 1H27A 5TF9A 3HMOA 3R02A 4L46A 2QR8A 2VTIA 2EVAA 1OL7A 4IAKA 3H3CA 3BU3A 4EHZA 4NL0A 3U8WA 3FSFA 4PP9A 2PSQA 2W0JA 4RRVA 4FG9A 5GJGA 3R1QA 3WZEA 3MFRA 2VX0A 3QUDA 5I9VA 4E4MA 3F3UA 4UYNA 4EKLA 4MEDA 2QONA 3ORMA 5ETFA 4BIBA 3QXOA 3C5IA 3TDVA 3BLHA 3OY3A 3A7IA 3BX5A 1CTPE 4TYJA 4YC6A 3GB2A 5T3QA 3QQGA 4GCJA 4ZSGA 5AV3A 4FIJA 3FXWA 4LOPA 3NZ0A 2BMCA 4FUYA 4C0TA 2XNOA 1Q61A 4L7FA 4BHZA 3LXPA 1L8TA 4OTQA 3RTPA 4O0SA 2BZJA 4BBMA 4RX7A 4QYHA 5CYIA 3UNZA 5AV4A 4X2NA 3TNIA 3GOPA 3KB7A 3O23A 3E87A 3TZ9A 2RFSA 2W1HA 3VRYA 5JKGA 5E8TA 2WXVA 4FV8A 4CKRA 3TUCA 3TM0A 2VWYA 4QMWA 4O0VA 1SYKA 3OCSA 2XB7A 4FSWA 4RJ6A 3UIMA 1V0OA 4QP1A 3TNPC 4C2WA 1DM2A 2J0IA 4YHJA 1XH5A 4QP7A 5C26A 2B9FA 3FMMA 5IUHA 2NO3A 1H1RA 2WMVA 2WQOA 4FV4A 2ETKA 4C3PA 5CF6A 5M55A 4D2TA 3Q2JA 4LI5A 1XH4A 3CCNA 3NNVA 3QKLA 3LJ2A 2CHLA 4G6NA 4PL3A 4YZBA 4DAWA 3OXIA 4QMLA 3IOPA 2FUMA 4X3FC 4XV1A 3TZ8A 5K5NA 1PXIA 4ONAA 5ETIA 3Q6WA 2PUPA 4PPCA 4ZLYA 1IR3A 2BAJA 4YZMA 4F63A 2V7OA 5FWKK 3ZFMA 4PV0A 3DJ7A 3ZRKA 2G2HA 3AT2A 4NJDA 4JJRA 3NS9A 2R3NA 3DGKA 5GINE 4PMSA 5GZAA 2YM7A 3D2IA 4QQ5A 3E8NA 3QCYA 3HMMA 4U43A 2WQMA 2XYUA 4AT4A 5A3XA 3W18A 3PIZA 3NYVA 4K8AA 5KMNA 4IAYA 2JGZA 4TT7A 3A7JA 4YC8A 4CFVA 4NIFA 2H8HA 4UB7A 3BHUA 4L3JA 2PMNX 5FM3A 2QQ7A 3VS6A 5FTOA 5HGIA 4A9RA 3L8VA 4M66A 2J5FA 4KS7A 2I6LA 3DAJA 2ETMA 2ONLA 2FA2A 3HV4A 3BWJA 3DKFA 4WOVA 5CU3A 4FVRA 4E20A 3WZKA 4IC8A 1J7UA 2OFVA 3K5VA 5ANKA 5TO8A 3DZQA 1F0QA 2GCDA 2PULA 4JIAA 1Q4LA 5CAUA 2VTNA 3RPVA 4AW0A 4GJ3A 2XNNA 3LPBA 3BYUA 1Q8WA 2X39A 3D5XA 3GNIB 3F3ZA 4PF4A 5HE1A 5JFVA 2I0VA 3PG1A 3E7VA 3BWFA 1SMHA 2XJ2A 2CNQA 5DT0A 2I0EA 2OZAB 2X0GA 4DFXE 2WPAA 3PSDA 3KFAA 4NCTC 4WUAA 3CQEA 5M56A 4K77A 4Z55A 1L3RE 3QZIA 1HOWA 3N9XA 1AQ1A 4EUUA 5A46A 3PG3A 4FTCA 4ZP5A 4LGDA 4S2ZA 4CRSA 2CN8A 3BLQA 5FP5A 3FPQA 3VBQA 5H8GA 4UMRA 2ZYBA 4J8NA 3DAKA 3KY2A 3P0MA 3OUKA 3HKOA 3R21A 3UPXA 4O22A 1H8FA 1JVPP 2OJIA 4KBKA 3DK7A 4RX8A 4G3EA 3ORNA 1UU7A 3EQRA 4OBPA 3FY0A 3UIBA 5C1QB 4O7ZA 2YM6A 3KK8A 3L9LA 4DFYA 3BYVA 4J8MA 4QNYA 2XM9A 3OZ6A 3R7GA 1H1SA 2E2BA 3F5UA 3EFJA 4LMUA 5HESA 4HGEA 5D10A 2YWPA 3PZHA 2Y4IC 2QOOA 4S33A 3LMGA 4FSYA 4RT7A 3MI9A 2HW7A 3SAYA 4G3CA 2UW6A 3SW4A 3EFKA 3MY1A 5DLSA 5HIBA 5LVNA 4FNWA 3E8EA 3PPJA 5IEXA 4O0RA 4IB3A 4TY1A 2UW3A 4IWOA 1O6KA 2C4GA 5K0XA 1JBPE 2WMAA 4Y73A 5J1WA 2YABA 4BIDA 4K1BA 3N4VA 2Y6MA 1RDQE 3TN8A 4M0ZA 3ZS5A 5EHYA 4AW5A 4IE9A 3HL7A 3UBDA 5KHWA 2UVYA 5K3YA 4L8MA 5AP7A 1Y6BA 3SG9A 4WHZA 3UO6A 2WTKB 3I7CA 4IACA 5IH4A 5HCYA 3K54A 4LOQA 1YOJA 5AUYA 4BF2A 4L3PA 5HEZA 5EYCA 2JDRA 1TKIA 2UZOA 3E92A 3KULA 1YXSA 1PMEA 2XM8A 5L2TA 2YM5A 3UZRA 2VO7A 3OT3A 4Z3VA 2YIQA 3GVUA
chains in the Genus database with same CATH superfamily
2B1PA 2CPKE 5HVJA 4N57A 3FKNA 5EW8A 4X3JA 2YZLA 4EOQA 3GXLA 3QTSA 4EHEA 3EFWA 3LQ8A 5ACBC 4A9YA 4QT1A 4ZAUA 3BGQA 2XKFA 5HG9A 2Y4PA 2YITA 3V5WA 3EN6A 3QYZA 5EM8A 5KNJA 3OG7A 4M68A 2H9VA 3EQCA 1H4LA 3VRZA 4AXFA 4FZFB 3BZ3A 2B55A 3Q52A 2PUIA 3ENHA 3EWHA 2XNPA 4O4CA 4BDJA 3IQ7A 4K33A 4F64A 2ZJWA 3EZRA 3BE9A 3E93A 4FICA 2A19B 4I4EA 1W83A 4AXDA 4RWIA 5M53A 3ZUVA 5HE2A 3KMUA 3KXMA 1PMUA 3LE6A 3EKNA 2IF8A 2R0IA 4KSQA 4XV2A 5ANIA 3CLYA 3JY0A 2NPQA 4ZOGA 3DK6A 1JKTA 2QU6A 1CM8A 5E8ZA 2YAKA 4RIOA 3BHVA 3KXHA 4J53A 4ZJIA 1VYWA 3HAVA 4GEOA 5GHVA 5HG5A 4M69A 5CVFA 5JT2A 1IEPA 2WD1A 4BB4A 2C6IA 4UN0C 5JGDA 3QUEA 3Q4CA 4IXPA 4M84A 1REJA 4RIXB 3I1AA 5KBRA 2PZYA 2PHKA 1E1XA 5E92A 4Z16A 5HICA 5I5ZA 3PTGA 4F1MA 4CYJA 4P5QA 5FP6A 1I09A 3FI4A 1OITA 3H9OA 4RC3A 4C38A 4IW0A 4CZTA 3AGMA 4EH2A 5CXHA 3VVHA 2VO3A 2C3IB 2YJSA 2IW8A 3P5KA 3SV0A 4X0MA 3EN9A 3T9TA 3TNHA 4HCVA 5DA3A 3L8XA 5JN2A 3LCDA 1PXJA 3RCDA 4FL1A 3NX8A 3K3JA 5JK3A 5FDXA 3HGKA 3HRFA 5D7VA 4DG0E 3VIDA 4ENYA 4UXLA 5IH5A 4YSMA 4DEEA 2V55A 3E62A 3HX4A 3I79A 2QNJA 5FGKA 4HZSA 4IAIA 3REPA 2IZUA 2R3IA 4QYFA 3IG7A 5BPYA 4KWPA 5CEPA 4K11A 5GIOE 3E8CA 3U6HA 2CMWA 1SM2A 4A07A 1UNHA 3CSVA 2Z02A 5IISA 2PK9A 4OTHA 3CY3A 2CKEA 4IWDA 5L2QA 3BLAA 3THBA 3CR0A 4MVFA 4ACCA 4CRLA 3CEKA 5G6VA 5A4TA 3HP2A 3H9FA 1FGIA 1IRKA 1PMVA 3DT1A 4YPDA 4RPVA 4O6LA 3C7QA 4JBVA 2X8DA 1X8BA 4XX9A 3EHAA 3I6WA 3NR9A 2FGIA 4M3QA 4BVUA 1A48A 4C58A 4BKZA 2R4BA 4E5AX 4WG4A 2ZAZA 5JZNA 3UYSA 2PTKA 4G17A 2JIUA 2X7GA 3W2CA 4YUQA 5CASA 4FKPA 2UZEA 3MY5A 2FSLX 4O4DA 1YHVA 3R04A 4PDOA 4E6AA 5M4IA 1OPKA 3BE2A 2HY81 3R22A 3COIA 4B8MA 3PPKA 3FUPA 3VULA 1GZNA 4NEUA 2IVUA 4RQKA 2J2IB 1PXKA 3IW5A 4U40A 4X3FA 3F5GA 3Q9XA 4GVAA 5H2UA 1A06A 3HV6A 4GYIA 4LGGA 4M0YA 5LMBA 3UQCA 3JR1A 1YI4A 3TMOA 4BCJA 4OTRA 5J9YA 3UZPA 2G15A 1ND4A 5LVOA 3DK3A 4AOJA 3EYGA 2XMYA 4CV9A 3DOGA 3R9RA 5LOHA 3DTCA 3LLAA 4ASEA 4RG0A 4U45A 3N4UA 1GIIA 3NUPA 5CT7A 4HVGA 5C4KA 3NW6A 3F5XA 3R7YA 2OO8X 5L6OA 5EDRA 4YJPA 3C51A 3PJCA 4I1ZA 4QOXA 5JH6A 3A60A 5CEMA 5IDPA 3O8PA 4MHAA 4P4CA 2LAVA 2WTKC 3PJ8A 5J95A 1BLXA 2VD5A 4AX8A 3Q4TA 4S30A 5E90A 3Q3BA 4O7VA 2JKQA 2CKQA 4FOBA 4EWHA 3RI1A 3DJ5A 5LXMA 2CLQA 2FH9A 4QMSA 4YLJA 3GQLA 5IQCA 3LIJA 4EOMA 4ACDA 2XZSA 5D11A 5H8EA 1XBAA 4R7BA 2G2IA 4GIIA 1BI8A 1OUKA 4MKCA 4OTPA 3V8SA 4BI2A 3VS7A 4EOPA 5A14A 4MWHA 3WIGA 3HAMA 2ITXA 2Y6OA 3Q5IA 1XBBA 4MXAA 3C1XA 4UMQA 2QLUA 2R7BA 3HYHA 4AZSA 4CFFA 2W5HA 3LKMA 1H07A 2C3KA 4IHPA 3S4QA 4CD0A 5HORA 4GL9A 4MQ1A 4FNXA 3FE3A 4CT2A 5I0BA 1KV2A 4ASXA 4IM3A 3KRWA 4DITA 3VUDA 4AAYA 4F6WA 4NCTA 3KXNA 1M2RA 2XIKA 3CPCA 4ERKA 4L3LA 1E9HA 4TYEA 3BKBA 3FV8A 2OKRA 3IGGA 5E7RA 4FVQA 5HG7A 3SRVB 4U79A 2JFLA 2JIIA 3NWWA 4WRGA 5AR2A 5GZ9A 3ZH8A 4QO9A 4CSVA 1OKWA 1OL5A 2RKUA 4D9TA 5CT0A 4FTOA 4AGCA 1CKJA 4D2WA 5IA1A 4CG9A 2ITUA 2HYYA 4FKRA 4NFNA 3TJDA 2QO2A 3DLZA 2R5TA 3O71A 4FEQA 4FIEA 3G90X 3DU8A 3LJ1A 4N0SA 5DOSA 3UP7A 3W0SA 4BTFA 4HPTE 3HA8A 4CTBA 4DEGA 5J1VA 4HYIA 4MBIA 1UWJA 2BRMA 3CKWA 3FZPA 4KRDA 5EHLA 3ZYAA 3KVXA 4XBRA 1OL1A 3QD0A 5IA5A 3TZ7A 4AZTA 3K5UA 1ZZ2A 1JLUE 1GJOA 3IK3A 4W8EA 4AAAA 4V0GA 1Y91A 3OTUA 4XG2A 2VTLA 4BWPA 4PMPA 3VBWA 4PP7A 1S9IA 2IEWA 4IB5A 4BC6A 4ANSA 3UMWA 3R30A 3PVGA 4YC3A 4ITHA 2AQXA 1BI7A 4IVDA 5E8UA 4CT1A 1FMOE 4TL0A 5FM2A 4O7LA 5AEPA 3UC4A 2QOQA 2PL0A 3V5PA 2OGVA 4AXEA 2QKWB 4QP9A 2OFUA 1Q8TA 1Y8GA 2YZAA 4FMQA 4QMPA 4CLJA 1B6CB 2C1AA 2QODA 4S31A 3MJ2A 4AGUA 4PWNA 4QPAA 4RWJA 1MRVA 4EQCA 3BYMA 5CWZA 4EZ3A 3EIDA 2FSMX 2XYNA 3WARA 4JAIA 3E64A 3OHTA 4TNBA 3SKCA 4XG8A 4IAZA 2ITNA 4D5KA 3TTIA 5HBEA 3B2WA 3M1SA 1GY3A 3L9NA 4JDIA 4MXOA 4Y5HA 4O4BB 5DGZA 5L6WL 4QP2A 2VUWA 4G6OA 4C59A 4LYNA 4O86A 5BYLA 5KKRB 2B9IA 2WMXA 3EQDA 3V5QA 2XKDA 4YO4A 4KD1A 2X4ZA 5IF1A 4AU8A 5CAOA 3EN5A 4XP2A 3TACA 4U81A 5EM6A 1Z5MA 2ERKA 4ZSLA 2B52A 4UEUA 3U4WA 2BHEA 2BIYA 4QMMA 3RK9A 4RIWB 3H9RA 4W8DA 3W8QA 3POZA 4Z7GA 5EW9A 3F2NA 4I3ZA 1W2FA 4CLIA 2X0OA 2PVKA 3IW7A 4HOKA 4D0XA 2P33A 4FKWA 4RLLA 3DKGA 5D7AA 1DS5A 4X6RA 3PY0A 5TR6A 3ROCA 4P5ZA 4CQGA 3PDTA 3RWPA 4R3PA 3ZDIA 3GGFA 3QZFA 3EN4A 4XG9A 5IMXA 2XP2A 1BYGA 5AP5A 4BDCA 2X0QA 2UW4A 4BJJA 3V51A 2QG7A 3CTQA 4A4XA 3KXGA 1E1VA 4RX9A 3PP0A 4XCUA 4C57A 1TQIA 4D2VA 4U7ZA 3IDCA 2OI4X 2GS2A 3CP9A 3QHRA 3ZUTA 1G8KA 4L00A 5KZ0A 4L67A 1ZYJA 3ZZWA 4DBXA 2VNWA 4Z7HA 4FG8A 4TW9A 1T46A 4TYHB 3WZJA 2VWZA 3P7BA 2UZBA 3ACJA 3TIZA 5AX9A 5IA2A 3TYKA 2PVNA 2WOUA 4OTDA 3D7TB 4YU2A 4BCMA 4BYIA 3WE8A 4O83A 4FE2A 2CGWA 3V5TA 3TL8A 3N51A 4QDEA 3UG2A 4D4YA 2C6TA 3JY9A 3DFCB 3SOCA 3NYXA 5CLPA 2C5NA 4D58A 4XG4A 4FG7A 4EK4A 5CALA 3BRBA 4J98A 4ZLOA 2NRYA 2ESMA 3NEWA 3C0HA 4JS8A 3W2PA 4GSBA 4O21A 4FKQA 5HHWA 4B8LA 2CGXA 5CQUA 3SDJA 2QOHA 5J5SA 2HY0A 3F69A 4F9YA 2W9FB 5BYZA 3OY1A 3O7LB 3PJ3A 4FV7A 4CMTA 2LGCA 3Q9ZA 4R6VA 4FIFA 2ITQA 2RG6A 3FAAA 3OF0A 4FTIA 4BWKA 5AX3A 5IQEA 3FC2A 2OZAA 3RZFA 4D2PA 2GNJA 2H6DA 4JNWA 5AP1A 4F7JA 3ELJA 4DDGA 3PA4A 5F95A 5IG1A 5CEIA 1W8CA 2RSVA 4MNEB 2VO6A 4IZ7A 3W33A 1J1CA 2RGPA 3GEQA 4IZAA 2CLXA 1R0PA 1J3HA 2IZRA 4O1OA 4GJ2A 3RAKA 3RM6A 3DQWA 2C69A 2QR7A 3FMLA 3S3IA 4DEDA 2YDKA 3FZSA 5EW3A 5J9LA 5JFSA 1M7NA 1ZZLA 4HPUE 2UVZA 3NCZA 4PDPA 2Y8OA 3MIAA 4L01A 5M4UA 3HEGA 4IANA 5B7VA 3D2KA 3M11A 2G9XA 1OI9A 5HVKA 1XR1A 3GBZA 4OTIA 5J7HA 5LWMA 2WMWA 5AUXA 5IEVA 3RCJA 3E7OA 3JVRA 4QPSA 4QTCA 3CD3A 2OJFE 3ZFYA 4B9DA 3AKKA 2VO0A 5DI1A 4TN6A 2W1DA 4C33A 5EOLA 4FK6A 3R2BA 5IDNA 3ORLA 3QCSA 4TWCA 4AF3A 4EI4A 4F7NA 4KINA 3F82A 4OT6A 3WYYA 2GSFA 1H1QA 5F94A 4TYGA 3MVLA 4QTAA 2W5BA 3W55A 1MP8A 2UZDA 3W10A 3HNGA 2QOKA 4ITIA 3NUNA 3P4KA 3RHKA 4AGWA 3DFAA 3ODYX 2AYPA 1ZYDA 3EQGA 5C27A 1NA7A 4JQ8A 2BFXA 4HZRA 4I22A 4XS2A 2OH4A 1JQHA 4A06A 4H1MA 2Z7RA 2QHMA 2BFYA 2OG8A 3DKOA 3R9NA 2BAKA 1Q97A 4DGMA 3NSZA 4P7EA 3LM0A 1H00A 5FG8A 3GUBA 3VS3A 4BI0A 3Q9WA 3T8OA 2ZV2A 4JR7A 4DT8A 3KK9A 3RAHA 3LJ0A 3HZTA 3U55A 3UQGA 2V22A 1YDTE 5KKRC 3UZTA 4NM7A 4XMOA 3VBVA 4AACA 1JAMA 4BCIA 2FB8A 2RG5A 4MXCA 3Q2MA 4FSZA 4L53A 4MXYA 4FTJA 2OJGA 5KE0A 4DH5A 4HW7A 3BHHA 2UZVA 3NVMB 1VZOA 5HCXA 4NU1A 3FY2A 3TCPA 4NTSA 3MPMA 4QMVA 3UNKA 5IU2A 3IW4A 4KABA 5KMOA 2ZMCA 1W0XC 5IQBA 4FIHA 4L42A 2UZUE 1W84A 5FQDC 4EONA 1MRUA 3II5A 2C0IA 4EBVA 4IJ9A 5AAGA 3UYTA 4E3CA 4CFNA 1ZLTA 2FSOX 2JLDA 3ITZA 1U46A 4FEUA 3R7IA 4QMYA 5FUTA 5LVMA 4R5YA 4DHIB 4WD5A 3SQQA 4BTJA 4EL9A 4QMZA 2UV2A 4QMTA 2GTMA 4OGRA 3QTRA 4JG8A 2BRBA 3P78A 5EKOA 3QFVA 2X2LA 3CE3A 4XOZA 5CEQA 4U44A 4EYMA 2B0QA 1GZKA 4FTLA 2J0LA 2W1FA 4RC4A 3TEIA 5CAQA 5E4HA 2I0YA 1ERKA 3PWDA 2HAKA 3VW8A 4EWQA 5B0XA 4DLJA 1XBCA 4XG7A 4O7YA 4FK3A 4FV5A 4EOKA 4XG3A 4EQMA 4RIXA 4EK8A 5DEYA 4NT4A 2O0UA 5GJFA 1J1BA 3LFFA 3FBVA 2JFMA 2FSTX 4F4PA 3EJ1A 3PVWA 4D28A 2JITA 4S34A 4BDIA 5IA3A 3LXKA 3KA0A 3WYXA 1YXVA 4GT3A 3WF8A 4MWIA 2BDWA 1PJKA 2BAQA 2P3GX 5DHJA 3QCQA 3V6RA 2PMLX 3UQFA 2J51A 3MGYA 3NVKI 4JDKA 4WSYA 2WZJA 5DWRA 5BNJA 4LV7A 4H3QA 5EG3A 3COMA 3KCFA 2FYSA 4CFWA 5DR2A 3EB0A 4GFOA 4BCFA 2CNUA 3B8QA 3RINA 3UTOA 3F3VA 3F2RA 2A98A 2GTNA 3VWAA 2JBPA 3UMXA 3TI1A 2QCSA 5CU6A 1YXUA 3NIZA 4AZWA 2HZIA 3DB8A 3KRJA 3MS9A 3QTUA 4FTNA 4FV9A 4AXCA 4FOCA 3PE2A 2E9UA 3PY1A 4FT7A 4RMZA 3JUHA 3NIEA 4FIIA 4YPSA 4DGNA 4QMXA 4YO6A 4XRJA 4M7IA 5A4EA 2VWVA 1V1KA 3IO7A 1ZOHA 2R3PA 4FV0A 4NJ3A 4M12A 3MTLA 3VJNA 4WIHA 2GFCA 4LRJA 2VNYA 1FINA 2JBOA 2JKKA 3U9CA 5KBQA 4KS8A 5CTPA 1O6LA 3UO5A 4FV3A 4AT5A 3V8WA 3KIOC 4E4XA 2ITOA 4MD9E 5K5XA 2ERZE 2XIRA 1H08A 3G9NA 3LCOA 3R1YA 3ZDUA 1YHSA 2PUUA 2CKOA 3LFBA 4O2ZA 3R0TA 4FTRA 4JBOA 3ZLYA 2WHBA 3DXNA 3KEXA 1Q24A 2WTJA 4ZTRA 4EZ7A 2VGOA 3FQHA 3QTZA 2EXCX 2QU5A 1O9UA 5AIRA 1ST4A 2IW9A 1Q8ZA 4MBLA 2IG7A 4D9UA 4BCQA 2E9NA 3V04A 1MRYA 3H10A 5EQYA 4AFJA 4JVGA 1HCLA 1QPDA 4YJQA 1FBNA 2Q0NA 3A4OX 4WKQA 5CI7A 2WO6A 4PL5A 3I4BA 4I0TA 4FNYA 4QRCA 3GQIA 3QD4A 3QKMA 1PXOA 1UNLA 4RFZA 3UIXA 3O8UA 4RVMA 3OXZA 4MAOA 3WOWA 3QTXA 4ID7A 4CXAA 5HO7A 4NKAA 3S95A 2QOLA 3QQFA 1ZY5A 4ZZNA 4QP6A 3NMUF 4DGGA 5DR9A 4FEXA 3NUUA 3PA3A 2YWVA 4BDKA 3QD3A 1Z9XA 4GVJA 4EBWA 3OEFX 5IMEA 5AM7A 4N70A 5T6KA 3R9HA 5C8KA 3B2TA 4YTCA 3E3PA 4CVAA 3UDSA 2XIZA 3VW6A 1XH7A 4YTIA 4EQUA 2XUUA 4IX4A 4KIKB 2C6OA 5ICPA 3R9OA 5JFWA 3AD4A 3FKOA 4JLCA 3R1NA 3WF6A 5IEYA 3OBJA 4FV2A 3OXTA 4QQCA 3QL8A 4EH4A 4YZNA 3QTWA 4MK0A 4O2PA 4QYEA 2P4IA 5F9EA 1H26A 2I40A 2J9MA 1U5QA 3AC5A 4CKIA 5AWMA 4J7BA 2GNFA 4G5PA 1U4DA 1HCKA 5BVEA 4ACGA 3S00A 1R39A 4TZRA 5CANA 3TKIA 1QCFA 1GNGA 5CF4A 1UU3A 3E3BX 4EKKA 3FWQA 1ZAOA 3O7LD 4L44A 3AMAA 4HCTA 4FSRA 3QC9A 2XK9A 1RJBA 3PSCA 4YJRA 4ALUA 2X9FA 1PMNA 3LLTA 3ID6C 1H24A 5IKWA 4QDVA 2IVSA 2G2FA 2QURA 2YISA 3GU4A 4NW6A 4YJNA 4DFLA 2AC5A 4E5BA 1OB3A 2ZDTA 3NDMA 3VHKA 3ZM4A 4FTQA 3GC9A 4YJVA 3UDBA 4DTKA 1XHAA 2O65A 3H4JA 3RPOA 2JC6A 3PXFA 3NUSA 3LFDA 4IFCA 5TE0A 1H1PA 4QMQA 4BCPA 3C13A 3SD0A 4DG2E 3KF7A 5BVNA 4FC0A 5CEOA 3MA6A 4RLKA 4WSQA 1GAGA 3VJOA 5AJQA 4XJ0A 5HU3A 4AFEA 4Y85A 4AZFA 1OECA 4CFUA 4QNAA 5DMZA 1G3NA 5AV0A 4ZY5A 4YLLA 4H3PA 5CI6A 2OLCA 1XJDA 4PRJA 5DT4A 5CAPA 3BLRA 1IAHA 3VS0A 4XV3A 3GCQA 3OWJA 4L6QA 4XLVA 2RIOA 4TTHB 1M17A 4YBJA 1Q8YA 4FZDB 1ZY4A 4GK2A 2W4OA 3P79A 3QX4A 4RIYB 3E5AA 3ETAA 3Q4UA 5KMKA 1SZMA 3QU0A 2QO9A 4DA5A 5JGBA 2OZOA 2WELA 2P55A 4DHFA 5BX0A 3T3VA 2QVSE 3GI3A 3QBNA 2DWBA 4MF1A 4O96A 2XVDA 3ZEWA 1AD5A 5AR5A 2VU3A 2PZRA 1WBSA 4NKSA 4BYJA 2B9HA 3O0GA 2BHHA 5H8BA 3RPSA 5F20A 2F2UA 4ZTHA 4BZNA 3U51A 3WF9A 4D4SA 5A4CA 1ZMUA 1OKYA 2WMBA 4TRLA 4XYFA 2O64A 4R1YA 3DDQA 5TT7A 2QC6A 3P23A 5AP4A 1VR2A 4ZSEA 4G3FA 3RNYA 3WIKA 4NUSA 5AUUA 2G1TA 2PWLA 2OK1A 4TWOA 1WVYA 2YERA 3OEZA 4RJ7A 4YTHA 4ANOA 4CNHA 2XK3A 4XH6A 3H30A 2UUEA 3ZUUA 3TDWA 2VWXA 3HVCA 2EXEA 1WBWA 4LMNA 2F9GA 4M13A 3VUHA 3KREA 3ACKA 3KMMA 4WNMA 1XQZA 5HIDA 4DT9A 4GYGA 3VUIA 2Y0AA 4FGBA 3EN7A 4DC2A 4FSNA 3W0QA 3ZC6A 4RFYA 2IO6A 1QL6A 4C34A 3UG1A 3CXWA 3MH0A 2OIDA 1V0PA 3EL8A 4RIWA 2ZV7A 4RQVA 4DH3A 2WEIA 4AA5A 3PE1A 4FT3A 4CCBA 4GIHA 3AC2A 3JXWA 4IVCA 3SOAA 3G0FA 5AUTA 3FXXA 2OW3A 3MFTA 1Q62A 4AW2A 2WIHA 3GFEA 2J0JA 4HGLA 2UW0A 2CN5A 3PXRA 3ZSGA 3G0EA 4FZ7A 5I9XA 5M07A 4E4LA 1K2PA 2R2PA 5BVKA 3VQUA 4CTCA 3D7ZA 4O7TA 4FKLA 4PY1A 2GNGA 3PIYA 2ETRA 3OCGA 1S9JA 3MH3A 3VONA 2OBJA 3ZHPC 4AZEA 4D1XA 4C35A 3M2WA 3EKKA 1Q8UA 4FSUA 4FSQA 4X2JA 2EB3A 4ZS0A 3ZO3A 1UVRA 3TV4A 4MXZA 3RHXA 4FR4A 4CQEA 4L68A 4FGRA 4R3CA 5CF5A 5E9EA 3FQSA 4TYHA 4E93A 2VTQA 3R8ZA 1UU9A 4JX7A 1QPEA 3LOKA 5T68A 1J7LA 2XJ0A 3LMIA 1MUOA 2GNHA 3D7TA 5E8VA 4EHVA 2ZDUA 4ZXTA 2HWPA 3GCPA 5C03A 3TG1A 2YHVA 2WQEA 4EK6A 4GK3A 4G31A 3LHJA 2C6MA 3FDNA 4PNIA 4E26A 5GNKA 3CQUA 3FC1X 1ZYCA 4I0RA 5JQ8A 4RZVA 4UBAA 1CKIA 3LFSA 4BWXA 4YHFA 3DTWA 3ERKA 4C2VA 5G1XA 1YW2A 2QOFA 1XMMA 5IA4A 4AXAA 3LFAA 5ETAA 2YJRA 1DAWA 3D94A 3MB6A 4GT4A 3VNTA 3ZSIA 5IQIA 3UOKA 5HNBA 1U5RA 5IQHA 3QHWA 3WI6A 4QMNA 5K4IA 2WQBA 3PY3A 3SXSA 3GU8A 1BUHA 3O2MA 2C0OA 2HWOA 3AQVA 2UZWE 4I6FA 2PVYA 4NH1A 4QTDA 2QKRA 5AR7A 5ETCA 5EYDA 3OWPA 2J4ZA 4JIKA 4DEIA 5HU9A 4K9YA 4BDDA 3PFYA 3UODA 4KSPA 1RW8A 3OWLA 3ALNA 3DLSA 2JIVA 4FT0A 3VF8A 4HCUA 3BI6A 4FKGA 2BTSA 5CU2A 2CGUA 1H0VA 3RPRA 3EZVA 4BCGA 3ANRA 2WTVA 4FL3A 5IQFA 2PMIA 3VBTA 2WNTA 2FO0A 5BMSA 1CKPA 4AUAA 4BBEA 2VX1A 2VWBA 5HD7A 2QHNA 5C9CA 4C4IA 4DH7A 4J99A 1OKZA 4LDTA 3IKAA 3FZRA 4O7SA 3FI3A 3N4TA 3QGYA 4G1WA 2JDVA 3GP0A 2XNMA 4FIGA 2R3GA 4YR8A 3O8TA 3TNWA 2RFEA 4GU6A 3DQXA 4QMUA 3W2OA 4EEVA 5A9UA 4BKJA 4LQMA 4KKGA 5B2MA 1ZMWA 4BI1A 4GS6A 3QALE 4FJVA 4R7HA 3UDZA 1ZOEA 2C47A 4OTGA 4Z9LA 3BQCA 5LMAA 4CCUA 1PXLA 5LMKC 4AN2A 1JPAA 2QOIA 4ZZMA 2XKEA 4V01A 4F0FA 1Q3WA 4E6QA 2XK4A 4XUFA 2WGJA 3Q32A 4IQ6A 4II5A 3TT0A 2YEXA 4ALVA 4NM3A 4I92A 3T3UA 4EOIA 5EI8A 5AP3A 4PL4A 1Z57A 3F9NA 4U41A 3D9VA 4W9XA 1M2PA 5HIEA 4AQKA 4I93A 5IQAA 3I0OA 3LFCA 1PHKA 2XEZA 4I21A 1A9UA 2X8EA 5KMLA 5EQPA 2C6EA 3UVQA 4BDGA 4F09A 5CSHA 1KE7A 3ZO1A 5BVOA 4GV1A 4C3FA 2E9VA 5TOZA 5IUIA 3EYHA 3L8PA 2R3HA 4R3RA 4A4LA 4C4EA 2BDFA 3DV3A 2BROA 4L45A 5BUIA 4BDAA 2ZVAA 4U0IA 1Q99A 3HLLA 4W9WA 3KXXA 3ZSHA 2BZIB 1OZ1A 3PP1A 5HE3A 4B6LA 5B2LA 1H01A 2HZ4A 3KRXA 4HYHA 3MBLA 4OUCA 1TQPA 4MQ2A 5I4NA 5HE0A 3A8WA 3HV7A 3QQHA 2VTHA 3I60A 4M8TA 2HCKA 3DS6A 1B38A 4ANBA 2G01A 1G5SA 2VN9A 3PXKA 4YJSA 2W1GA 3KL8A 4IZYA 1NY3A 3NNXA 3QKKA 2C6LA 3V3VA 4QTBA 4AOIA 3MB7A 3PJ2A 5J7BA 4Q9SA 2HW6A 3EFLA 4G5JA 4XEYA 4FKOA 3G2FA 4U97A 5CSXA 3NFGB 4AE9A 4WNOA 1OIUA 3OD6X 5J87A 2J90A 3FLQA 2BRNA 5L2IA 4B4LA 2BILB 2X2MA 1SVEA 2VTAA 3OBGA 4FVPA 3F5PA 4S32A 3R83A 4BFMA 5LWNA 4BY9E 3V5JA 2VGPA 4MD8E 2X1NA 4E73A 4IM0A 4F1TA 4DCEA 2A0CX 4O4FA 4KNBA 1OPJA 3QWJA 4MXXA 2YM3A 4ZTLA 3SC1A 4AA0A 3MV5A 4F1OA 3SA0A 4PPAA 4EC8A 4GU9A 4YURA 3F66A 3MSSA 4G9RA 3WILA 1UKIA 2VTMA 3EQHA 1LR4A 3F88A 4DDIA 4EYJA 4NM5A 2J7TA 4G6LA 2BRGA 3O96A 4DTAA 1GIJA 2CGVA 3OTVA 3U6IA 3I7BA 3UDTA 1BMKA 3AC8A 4G2FA 4KBAA 4ZEGA 3NNUA 3EL7A 3BIZA 3ANQA 3E8DA 4CZUA 1NW1A 3NW5A 1RQQA 3DJ6A 5I9UA 3HMIA 4A9TA 2O63A 3GCUA 5BVDA 2IZTA 3FMJA 3T9IA 2QG5A 3ORPA 4U42A 4F7SA 4OTWA 3DBDA 4O1PA 3QTIA 4LGHA 2BRHA 5FDPA 4HGTA 3WZUA 2XH5A 4R1VA 4WNPA 2XANA 3QYWA 4WT6A 4JL9A 3RMFA 4DCAA 2Q0BA 4E5WA 4C4GA 2BZHB 3AMBA 2R7IA 3CY2A 5FXQA 2X81A 3VUTA 4X2GA 3UE4A 5A4LA 2F7EE 4FODA 4KRCA 4YGAA 3EQBA 2PYWA 2C30A 4U8ZA 4PMTA 3JS2A 3ZLXA 5AADA 2VWWA 4BDBA 5M51A 4DHJA 2GHGA 3MA3A 3ZC5A 2XF0A 4FKUA 3H0YA 3R00A 1LEZA 2OXXA 4A7CA 1FMKA 5F1ZA 3D4QA 3FI2A 3I5NA 5AP0A 3W32A 4FKIA 1ZARA 4L52A 3LXLA 1WBPA 3TUBA 1KSWA 5EM5A 1OGUA 3UIUA 3ZRMA 4U9AA 1Y8YA 2YCQA 4I5PA 4F9WA 4JBPA 4KIQA 1WBTA 4IB1A 3R8LA 4AG8A 3QD2B 4LUEA 3PXYA 1FOTA 4AGDA 2PVJA 1DAYA 1OL2A 4W4WA 4WG5A 5EKNA 2UW5A 4EH9A 4QQJA 3R8UA 3LQ3A 5DPVA 5L8JA 5DBXA 3LM5A 2HENA 2JKMA 3ZXZA 4NYEA 3UJGA 2GHMA 4BHNA 3QLGA 2FVDA 4OLIA 4XNEA 1YWVA 4JDJA 4XV9A 4D1ZA 2IJMA 3BELA 5HD4A 4LRKA 2IWIA 2BTRA 2OIBA 3VS1A 5CNOA 5EH0A 3AC4A 1P2AA 1CSNA 3IECA 2WIPA 3C9WA 3CJGA 2Z8CA 4OW8A 3LMHA 2ZM4A 5M09A 1SNUA 2J5EA 3PYYA 1G8JA 2EXMA