4C58A

Structure of gak kinase in complex with nanobody (nbgak_4)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
307
structure length
267
Chain Sequence
DFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEKYSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-G-associated kinase
publication title Structure of cyclin G-associated kinase (GAK) trapped in different conformations using nanobodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 75
structure length 267
sequence length 307
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c58A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c58A01
4FNZA 5HIEA 5FLFA 3W32A 4PX6A 3PA5A 3R04A 2XRWA 3HX4A 4CYJA 1WBOA 4ZTHA 5CAVA 3UPZA 1OECA 2CHLA 3C1XA 4M69A 5JN2A 5FUTA 2W1ZA 4NM7A 3Q9YA 5IQCA 4CMOA 4ZJIA 5D10A 2R3LA 3DZOA 4FMQA 3ORZA 2UZLA 4PQNA 4OGRA 3WF8A 4IHPA 2OXDA 3VBVA 2DQ7X 3PY0A 4IZAA 4K8AA 4IQ6A 4M7IA 3VBQA 3NPCA 4GRBA 3VJOA 4F63A 5BVOA 3D2KA 1OL5A 3PPZA 4O7SA 2C4GA 3BU3A 4HGLA 3JVSA 4YGAA 4IW0A 4JQ7A 3D15A 4YTFA 4Q2AA 3G51A 3IS5A 5DNRA 5IQAA 3A7HA 4WNPA 4JG7A 4RMZA 2C1BA 2BAQA 2W9FB 4GS6A 2RL5A 5C01A 1VYZA 4IDVA 3SA0A 1WZYA 3NW6A 2WTIA 3GBZA 2PU8A 1WCCA 2GNIA 3GT8A 4O0UA 2EB3A 2A27A 4U6RA 4DG0E 3G15A 3CPBA 3SRVA 3O96A 3F3ZA 3D5WA 3IECA 3Q5IA 4CCBA 1ND4A 2CKPA 4GH2A 4BY9E 4KBAA 4J7BA 4F1OA 3ZONA 4F9CA 2Y6OA 5M07A 2CNUA 2Z2WA 3BPRA 3DT1A 4D0WA 3CP9A 4DLIA 3LCKA 3F7ZA 5TO8A 2IVSA 3VUHA 4QMNA 2BRHA 4BZDA 1OITA 4MCVA 4QMLA 3IW7A 4UZDA 3ZSHA 2G9XA 4GG7A 1JKTA 3WZJA 4OAUC 4P7EA 1RW8A 2QOQA 4JI9A 4LL0A 4Z16A 3S1HA 2RIOA 5L2TA 4QNYA 4WNOA 5GHVA 2P3GX 5J1WA 4UX9A 3GU4A 4O7LA 1H25A 3RAKA 3R8MA 3U54A 1TQPA 5IZFA 4NIFA 2UW6A 5KBQA 2VO3A 2ZB1A 3IGGA 3BIZA 3IO7A 3O50A 2HOGA 4U9AA 3CJGA 4RX5A 4RIYB 2J0LA 5E8WA 3RVGA 3W8LA 3FWQA 2NNWB 4D58A 5CXZA 4GUBA 4C4FA 3R63A 5CZIA 1YI6A 1ZY4A 2NRUA 5EDRA 5IPJA 4G3CA 3LJ1A 4M67A 3ITZA 2F7XE 2C69A 2PVFA 4XV1A 4UEUA 5EW3A 2VTPA 2F9GA 4M12A 5L2QA 2WMSA 4AT5A 2JD5A 4FKVA 3UQFA 4DGGA 3DAJA 2QU6A 3FLNC 4U41A 4HVSA 5HLPA 3V8WA 3TV6A 2C47A 1PMVA 2E9VA 3FY2A 3RP9A 2J5FA 3C50A 3TJDA 4XOYA 4Y83A 2W1FA 1KE7A 2VU3A 2A2AA 4JRNA 4CG8A 2X9EA 2H34A 2V62A 3HDMA 4KABA 4UMQA 2LAVA 2IWIA 4O0RA 5CT0A 5HGIA 3POOA 4WG4A 2BRNA 3ET7A 4C59A 2FUMA 2XM9A 3OF0A 4NW6A 4GT5A 4AN2A 2GNHA 4FVRA 3MY1A 3OBJA 4TYIA 5J9YA 4TTHB 4DC2A 3EFWA 5CEIA 4L3PA 4DBNA 3QKLA 1QPJA 4QPAA 5KKRB 4P2KA 3UG2A 4C37A 2XEYA 3D94A 1WBNA 1RQQA 4FTIA 3A4PA 2HWPA 3VUMA 3CD8A 3NAXA 4GYIA 5EDPA 5K4IA 1T46A 5LCKA 3ZUTA 4AZWA 3WYXA 1E9HA 4OTPA 3H9OA 1FINA 5IMEA 5CF6A 1Q24A 3F5UA 5BVKA 5T3QA 3DA6A 4Y73A 4YZBA 4EH3A 3U9CA 3FAAA 3KC3A 5CSXA 5ACBC 3ROYA 1PMNA 4RLKA 5GZ8A 3Q04A 5M4UA 3BHHA 3B8QA 1H07A 4WD5A 1J7UA 3FZTA 4I93A 4JOAA 3KULA 4BCGA 5HD7A 4WUAA 3JR1A 1OM1A 3OT8A 2YERA 3NYNA 4I5MA 4ORKA 3COMA 4M15A 3A7GA 2B9FA 3DLZA 3VO3A 4X3FA 1FVVA 3A7IA 3DJ5A 2X4FA 4FKTA 5ANGA 4CTCA 1ERKA 4FTOA 5DEYA 3ZO2A 5AP4A 1WBPA 3VHEA 3QD4A 2R7IA 2GNGA 3QA8A 3MYGA 4QMYA 4XYFA 4S31A 5HE0A 3UQGA 2VWXA 2G2HA 2F7EE 1MRYA 3ZDUA 4AAAA 3RTPA 4X6QC 1BKXA 2BFYA 3QYZA 2O2UA 2UZDA 3POZA 3TT0A 2QLQA 4C0TA 1CTPE 2R3NA 5D12A 2PMOX 2GTNA 5GZ9A 2GHMA 4EZ5A 2C6LA 3HUCA 4HW7A 4I94A 3HL7A 3Q2JA 2ITZA 4RFMA 3RALA 3GU6A 4C62A 2Y6MA 4U79A 1W8CA 1Y91A 3A7FA 3QFVA 4GU6A 4U45A 3MFRA 4S34A 5GIPE 3GI3A 3ZFYA 4AU8A 5CSHA 4YTCA 3GC9A 1G8SA 3Q96A 2UW4A 3QALE 4NW5A 4FUYA 3BU5A 3V5WA 2R4BA 4BCMA 4YZDA 4Y72A 3LVPA 4ANMA 4PV0A 1ATPE 1AQ1A 2AC3A 4MNFA 4IACA 1B38A 3D14A 3RK9A 3FQHA 3LPBA 5I4NA 1J7LA 4EJ7A 4KNBA 1MQBA 4EKLA 3AT2A 3HMOA 1Q8WA 4H1MA 4D2WA 4O7WA 2C5YA 3V5TA 3QXOA 3LQ8A 5HCYA 1H24A 2PZPA 4WG3A 3QRJA 4K18A 4BIDA 3N4UA 3D7ZA 1IR3A 4UV0A 3OHTA 3K3JA 3LFSA 4UMUA 2HYYA 5JZJA 3PG1A 2XYUA 2XYNA 1MUOA 4G5PA 4BVUA 2BUJA 3QQKA 5IA2A 5BVWA 4UYAA 4XP3A 3W18A 1U54B 2GNLA 4TYHA 3VS1A 3EN9A 4MXXA 5A4LA 3ZM4A 4IEBA 4QQTA 3KK8A 2PMLX 4C61A 5AIKA 3SD0A 3NUAA 3NYVA 2YDJA 1WFCA 4ARKA 2OKRA 3VNTA 1YWVA 3CQWA 2X4ZA 2QONA 3OOGA 5B0XA 4BIBA 3IDBA 4KB8A 2Y0AA 4DFUA 3FYJX 4GFMA 4JBQA 2OZAB 4I6BA 3MFUA 2PY3A 5DVRA 5EQYA 3B8RA 3S2PA 2UZWE 3UIXA 4I3ZA 4F9AA 5CTPA 4BKZA 1Y57A 5A6OA 2IN6A 4PDSA 1PYEA 3FXWA 1ZZ2A 3FPMA 2JIVA 2VWWA 3KL8A 4I6HA 5HKMA 4PL4A 5CU0A 4IMYA 5DN3A 4J97A 2C0OA 2JGZA 4CNHA 4XG2A 4QYFA 4AG8A 3COKA 4ZTMA 4J1RA 2RG5A 4WRSA 4DGLC 4IC8A 4G31A 2OWBA 3KRWA 3GEQA 3TTJA 1H08A 1JBPE 4YJOA 3T9TA 5IA4A 4TYJA 3FMDA 1FMKA 3VHKA 5IMXA 4ALWA 2X7OA 4XV9A 4AT4A 4L67A 4RLLA 1ZXEA 2WQEA 3TV7A 3WILA 2GS6A 3G9LX 3UC4A 1FOTA 4BCJA 4U8ZA 1OPLA 3JY9A 4LUDA 4AP7A 4F0IA 3R7VA 4NWMA 3PRFA 5EYDA 2J2IB 4M68A 1XH4A 5EFQA 3S00A 4C02A 2W1HA 4QYEA 2QR7A 1G5SA 3TNIA 1YXUA 4BCNA 4D9TA 2B0QA 3CC6A 3MBLA 4YC8A 5H8EA 4D2TA 4DTAA 1F0QA 4XH6A 4FL2A 2DS1A 2QO2A 3Q53A 2J9MA 5IQHA 3DXQA 4FEWA 4Y5HA 3E8CA 1Z9XA 3R1SA 4RVTA 3ZSGA 3Q4ZA 2J7TA 3QWKA 3OBGA 4G3GA 5CENA 2YM7A 3R8VA 4ACHA 3DBCA 3QTUA 4GK3A 3HAMA 4ZIMA 2XBJA 3W8QA 4E73A 2PUPA 1SNXA 3DLSA 5CQUA 2J6MA 3T9IA 2V5QA 2VWUA 3DKOA 4TWOA 5E8SA 3PSDA 2GCDA 4K2RA 3VUIA 4TYEA 2PZYA 3DV3A 4XHKB 3CS9A 4A9TA 2W4OA 5HCZA 2Z60A 4Y8DA 5D9HA 5KMMA 2ZB0A 2AUHA 4FL1A 3SVVA 4YHFA 1U59A 3H0ZA 3UG1A 4RVKA 1UWJA 5CAUA 4IB1A 1W98A 1KUTA 3K5UA 4E6DA 3OEZA 3WF9A 2GS2A 3MFSA 4FKUA 2OZOA 3FI4A 5DOSA 3AMAA 4A9SA 2Y8OA 4FZ7A 4IX3A 5HBJA 2CCHA 3ZXTA 4FGRA 3ZOSA 4BCKA 5K9IA 3LLAA 4O21A 3O17A 2YEXA 3QZGA 4CGAA 1Z57A 4H1JA 3NVMB 2VO7A 3O8UA 3V6SA 5J8IA 1SVEA 4RFYA 4YZNA 2CN5A 3QCXA 4AFEA 4AX8A 1GY3A 3PJ3A 4KINA 4BCFA 4CXAA 1M7QA 3MY0A 4FC0A 5CAQA 4R8QA 1UU3A 4AN3A 4D1SA 2ONLA 3EOCA 3MY5A 3TN8A 1IRKA 4OT5A 4AW0A 4DH3A 1H8FA 4MBJA 5M55A 4DE4A 5M53A 1YOMA 4M69B 2W17A 1JAMA 2OFUA 4EK6A 2YZLA 4H3PA 4BCPA 1MRVA 4IAZA 5EOBA 1UU9A 2C5OA 3OXIA 4UXLA 1JLUE 3V8TA 1UV5A 4EL9A 4L42A 2I6LA 2VTSA 3FQEA 5DEWA 3KVWA 4FX3A 4TWNA 5FM3A 5G1XA 4EOIA 3U8WA 3NUPA 1NT2A 3EFKA 3EN4A 2A4LA 1NA7A 1Q61A 4BB4A 1JNKA 2FO0A 3LM0A 3BHYA 4LGHA 2V0DA 5L8LA 3FQSA 5AUVA 1SM2A 4AA4A 2IW6A 3R8ZA 4TWCA 2HENA 4U97A 4WRGA 1X8BA 1W0XC 2BZKB 4LOOA 3NW7A 2I0VA 1PYXA 4RIWA 5H2UA 4C36A 5DRBA 5AAFA 4QTDA 5HEZA 4UN0C 3I0OA 4EWHA 4PPAA 2G15A 4UYNA 3CSVA 2XIRA 3KRJA 4MBIA 4BI2A 5T68A 2JDTA 2XS0A 4YHJA 5E8TA 4AGUA 3KRRA 5JRSA 3SRVB 3M11A 4F0GA 1V1KA 2ETKA 3K2LA 4JJRA 1UA2A 3HRCA 3IKAA 5AP6A 4LGDA 2C0IA 2VUWA 4G34A 4E6QA 2GNJA 4F7JA 2B53A 2B9HA 4LM5A 3KRLA 4EC8A 3A62A 5HTBA 1HCKA 3H3CA 3UZTA 5KNJA 1FQ1B 4D0XA 3PSBA 3R9NA 5IH5A 4NFNA 5FD2A 3WIGA 4CKRA 4O0YA 3F3TA 2W96B 5AV1A 3Q2MA 2WQMA 1PKGA 4MNEA 4N4SA 1I09A 3R30A 4R5YA 5EG3A 2ITWA 4PTGA 5HG8A 4H05A 5CI7A 2WOTA 2YIXA 5AR8A 3QA0A 3VS5A 4IVDA 2UZOA 3C5IA 3S4QA 2VGPA 4C2WA 5LWNA 4Y85A 2PUIA 3CBLA 3A60A 5A9UA 3SG9A 2XNBA 4BDBA 3HP5A 1P2AA 4WNMA 1ZYDA 4JG6A 4QP1A 4NIFB 4O6LA 1KSWA 1PXMA 1YKRA 2X2MA 2XNEA 3LXLA 3D7TA 4DGMA 1H1WA 2C6MA 4QYHA 2I0YA 3ZUUA 4MEDA 4M3QA 4FK6A 3UNZA 5CU2A 3NGAA 2JBOA 2CMWA 2WGJA 3EYGA 1M2PA 3KU2A 5HBEA 3ZSIA 4QMQA 4YU2A 1ZMUA 3Q3BA 5KZIA 5CASA 5GINE 3DK3A 4KA3A 3QQUA 4Z55A 3PXYA 4MYGA 4WSYA 2EUFB 4EH6A 4E6AA 2GFSA 4WIHA 2J0MB 5IA1A 4FTJA 4C4GA 2BZHB 2FSLX 3ORNA 4CFMA 3BHTA 5EM7A 1AD5A 5LVPA 3LXKA 3GCSA 3NNVA 4OT6A 2OG8A 3MH2A 4LQMA 4QD6A 4FYNA 4ZSLA 4YJPA 5AP7A 4DLJA 5E9EA 1VYWA 3UYSA 2WIHA 5AX3A 2WMWA 1WMKA 4GT3A 4FTLA 4PDOA 3FHIA 1NVQA 3QLGA 5AV0A 4AW2A 3R7IA 3BGZA 2GS7A 2H9VA 4ZEGA 3U6IA 2WOUA 3BEAA 4ALUA 5K5XA 3DCVA 3TWJA 3ZO1A 3D9VA 3KXHA 4FI1A 4LMNA 2B54A 4N0SA 4IB3A 4GV1A 4QOXA 3UOLA 2JDOA 4NEUA 4X2NA 3UYTA 2OJGA 4RJ8A 3CKWA 5M06A 4AA0A 3BYOA 3MH3A 3BV2A 4RGJA 1G8AA 5IQGA 2REIA 1ZYCA 2ZV8A 1O6KA 2RFNA 3RPRA 3Q4TA 5F20A 2QNJA 2YA9A 3PVBA 1ZZLA 3RZBA 4DH7A 4PMPA 5HNBA 2VV9A 2O3PA 4RJ6A 2C3LA 4IWOA 3VJNA 4D4VA 5AP5A 5HG5A 4IAFA 4NM5A 5E1EA 2PVNA 4BDEA 3BYVA 3AXWA 3IOPA 2QURA 4FF8A 4GSBA 4IM2A 4RIXA 2ZOQA 4KSQA 4M84A 4O27B 4USFA 5AP2A 5HLWA 5CSVA 1Q8UA 5EQEA 4FK3A 4L7FA 5D41A 1H28A 2XK9A 4S33A 2Y4IB 4FSTA 4NH1A 3DJ7A 5TOZA 2GSFA 3VBXA 5IQEA 2YCSA 3HGKA 4LG4A 2BDJA 2HIWA 3QQHA 3Q5ZA 3KK9A 5JFXA 5FG8A 2ITPA 3EN6A 2YJRA 3FMKA 2WEVA 4IXPA 4X3FB 2IZSA 4IC7A 5C27A 4F70A 4IX4A 3II5A 3NRMA 4HNFA 5A4CA 5A4TA 4W9XA 4L44A 5JSMA 1YDRE 4TXCA 4MKCA 2EB2A 5BX0A 3BGPA 3UPXA 4DCAA 1R1WA 2YN8A 4IAYA 4FZDB 3HRBA 4W4XA 4HVGA 5C1QB 2ITXA 3HUBA 2I40A 2CKQA 3RCJA 5AP1A 2HXLA 2WXVA 2UW3A 4TT7A 3RBWA 3RINA 3O8PA 1DS5A 4G3EA 3ENMA 3CIKA 1R0PA 1PXPA 3HZTA 3LAUA 2ZM3A 4NM3A 2B7AA 3DPKA 4JLCA 2XF0A 3ZLSA 3HDNA 5LJJA 2ZV7A 2Q83A 4RWKA 4E4XA 4ZZOA 4J53A 4GKIA 5HVKA 1GAGA 2W06A 3ID6C 3BHUA 5HZNA 1V0BA 3G5DA 1GOLA 3QRKA 3P0MA 3OWPA 4V04A 3JXWA 2YFXA 1UNGA 3SOCA 2WQOA 3FSKA 5L8KA 4FV9A 2VNYA 3KXNA 5HVYA 4EJNA 5LVOA 4LL5A 2PE0A 3RKBA 5AP0A 5M08A 3FZPA 2ITNA 5LMKC 1L8TA 4ANNA 2VTHA 3PJCA 3MA3A 5IUGA 1LEZA 3D5XA 3OW3A 2QU5A 3C0GA 3MVJA 2C5XA 3BWJA 5ANIA 4CYIA 3LFEA 2IW8A 5K4JA 2WTWA 3ORPA 4LI5A 4ACGA 4D2RA 4QMTA 3MESA 4L9IA 3PIXA 2UW5A 3F5GA 3VW6A 4AQCA 3QAME 2QG5A 4C57A 4TYHB 4L6QA 3R21A 3TNWA 3DB6A 1F3MC 2ZVAA 4U0IA 1OZ1A 4EOPA 5JFVA 2WFYA 3Q9ZA 5CLPA 3Q9XA 4JQ8A 5HVJA 3CY3A 2I0HA 3TIYA 4IWDA 2EU9A 3I4BA 4L68A 3C5UA 2RSVA 4RIOA 5TT7A 3LFAA 3SW4A 5I9YA 3NX8A 5HNGA 1OBDA 4ACMA 5A14A 3FL5A 2RG6A 4QP7A 4RJ3A 3NLBA 4RC4A 4F9BA 2C3KA 5FRIA 4YLKA 3VUKA 3FZOA 3PWDA 3QZHA 2VTOA 5F1ZA 2F7ZE 4FKPA 1W82A 3BLQA 3IW5A 1M14A 5HESA 2PVJA 3A8XA 4EONA 4FZAB 5BMMA 5L8JA 2OLCA 2IJMA 3PXFA 3QCSA 3M42A 2O8YA 2OU7A 3GVUA 2OGVA 4HGSA 4ZZNA 3FLWA 2C6DA 4EZ7A 3GFEA 3ZH8A 1OKWA 3AC8A 4FV7A 4HPUE 4LGGA 3VWAA 5DHJA 4FKSA 4U3ZA 3SQQA 3ZC6A 3MH1A 1TKIA 4I21A 5A3XA 2WTDA 4IBMA 3TXOA 3R2YA 2SRCA 5M4FA 4CQEA 1URWA 4QMPA 5HU9A 2ZDTA 4YZCA 1H01A 4AACA 1PXNA 2ACXA 4OR5A 2YM5A 1PW2A 3ZUVA 2WB8A 3R02A 5CVGA 2YIWA 3P4KA 3U87A 3NCZA 3OCSA 3JY0A 5F9EA 2RGPA 3FMEA 3QYWA 4RFZA 5DR6A 1PHKA 4ANOA 3R7UA 1XBCA 1YDSE 2O64A 3LXPA 2Q0BA 5AV4A 2UW7A 3TUCA 3HV6A 2F49A 4B8LA 3OEFX 1NXKA 4XCUA 3F5PA 5CEQA 4CFXA 3LE6A 4AZTA 2JC6A 2Z7SA 4ZSAA 2QO7A 3NYXA 3DBDA 2PWLA 2BR1A 4W4YA 4GJ3A 3EFJA 4AGDA 4ENXA 3OVVA 4DBXA 3IPHA 4ZTQA 2XK7A 2LGCA 4IH8A 2O65A 2X8DA 3KN5A 2NPQA 3L8SA 1AGWA 4FTUA 4KIQA 5LARA 4CSVA 3ZRLA 4FT3A 3W10A 5AEPA 3N4VA 5I5ZA 3F7WA 4W4VA 4HPTE 3IK3A 2ERKA 3QTIA 5HE3A 5JFWA 4IB5A 4PTCA 3UO4A 2X9FA 3GC0A 4X0MA 3UTOA 3OD6X 2CNQA 3DB8A 1LP4A 3VBTA 4F6WA 3H10A 4GIHA 3NNWA 2BKKA 3DKGA 4FZ6A 4Y5QA 3RI1A 2CGVA 4XLVA 4CFNA 2R0IA 4L46A 4EUUA 4FKWA 4WSQA 3W2QA 4CT1A 1QPCA 2HW6A 2ZMCA 1YHSA 3EQBA 3NWWA 4F9YA 5L4QA 4R7BA 2JLDA 4XG6A 1CDKA 3AD6A 3O7LB 2ITOA 3EQGA 2VTJA 4M0YA 1REJA 4N70A 3R7EA 4CQGA 3ORKA 2R2PA 3ORMA 3HNGA 1DI8A 4HZSA 4DTBA 3I5ZA 2E2BA 3WZUA 1GZNA 3MWUA 2R3KA 5CNOA 5IG1A 4OTFA 3DBQA 4OTHA 4WNKA 2BPMA 4IZ5A 3AOXA 4OTDA 4UMPA 5J5TA 1M17A 3QTXA 1FGIA 3ETAA 4RQKA 3W2SA 4DG3E 4EHZA 4XJ0A 3NIEA 3UZPA 3E8NA 4DEEA 4F7LA 4MX9A 2W5AA 2QHMA 2IZTA 2RKUA 3QCQA 4FIIA 4MXOA 3P08A 4U42A 3FLSA 4RWLA 1Y8GA 3OUKA 4YJRA 3SG8A 2C5NA 3ANRA 3EZVA 4ANSA 2CLQA 4V0GA 2HAKA 2WTVA 4GK2A 4BWPA 4BCOA 4EHVA 4MF1A 3KB7A 3HMMA 2VX0A 3MW1A 3E8DA 3O2MA 3VS3A 4RC3A 2CCIA 4EKKA 4ZLZA 5M09A 2PE2A 3T3VA 4M97A 1U5RA 3FMHA 1SYKA 4FUXA 4KIKA 3EIDA 4QYGA 4UALA 5KCVA 3U6JA 2PULA 3LQ5A 4BRXA 1PY5A 5CF8A 1VJYA 5K0XA 2AYPA 2GNFA 2W5HA 3FKNA 5EYCA 2IW9A 3RWQA 5C8NA 4FSNA 4I24A 4RIWB 3HA8A 2G2FA 4HJOA 4FIFA 4RIXB 5IA0A 3LFCA 3ZMMA 2UZEA 1UKIA 5J79A 2YIQA 2E9UA 3FLYA 4X2JA 1PXIA 1YDTE 4G6NA 3TCPA 5GJGA 3D4QA 3DZQA 4DYMA 5IQIA 3D5UA 3KXGA 2XUUA 4XG3A 5CSPA 1KE8A 2EXMA 4RX9A 2ITUA 3QGYA 1YXXA 4F6SA 1Q99A 3RCDA 3QHRA 4DITA 1DM2A 2CNVA 3KEXA 2UZUE 4BYIA 3GGFA 3OC1A 4XUFA 2ERZE 4GT4A 2UZBA 1XBBA 2PVRA 4B4LA 4ZTSA 4BDGA 4HVHA 4RWJA 5IDPA 3KXMA 4FYOA 5CALA 1H27A 3GFWA 4YUQA 2GQSA 2UV2A 3AC5A 2WTCA 4MNEB 3C4XA 3VULA 2H96A 3FUPA 4L53A 4U43A 5KUPA 2Y7JA 3PXKA 3KMMA 4M8TA 3RPVA 3AC3A 4UXQA 4CD0A 2WIPA 4ONAA 2F2UA 4AE6A 3L8VA 4JR3A 4YC3A 3TZ7A 4XRJA 3D7TB 2BILB 3U4UA 3VW8A 5I9WA 1LUFA 4JAJA 3R22A 5KE0A 4H39A 3REPA 3RM6A 4EHEA 5DMZA 1O6LA 1U4DA 4W8EA 4IB0A 2O63A 2CGWA 4FE2A 2C1AA 4ITIA 4IVBA 1ZLTA 5LMAA 4PDYA 4G1WA 5L2SA 4KKEA 3MVLA 5CYIA 2J5EA 2X81A 4X2GA 5GNKA 2CKEA 2WELA 3NS9A 3F2RA 5CWZA 4YBKA 2YISA 3PP1A 2XM8A 5E8YA 3E87A 1BLXA 2H6DA 5J9ZA 1KV2A 2GTMA 1XKKA 5E8ZA 1XR1A 5H3QA 3KCKA 4EZ3A 5ANEA 3L8XA 4QP4A 1GIIA 4A9RA 4G5JA 2OFVA 4PF4A 4NZWB 3I60A 4JDKA 3FC2A 2XZSA 2UVYA 4IWPA 3RNYA 3SGCA 4AE9A 3AD5A 3G0FA 2ZAZA 3QQGA 3DDQA 4GG5A 4J71A 1XH9A 3UMXA 4E7WA 3NR9A 5K0KA 2J0IA 3UNJA 4DHFA 4NL0A 2WU6A 1OL6A 5AWMA 5HG9A 4QTBA 4AUAA 4EC9A 3HV5A 2J50A 2W1CA 3R1NA 2DYLA 3FMMA 4E5BA 4C38A 2HW7A 1U46A 3H9RA 4II5A 2YDKA 2OICA 5KMIA 5E92A 3VAPA 3KXXA 4AGCA 3CR0A 4QQJA 4PMSA 5DG5A 5M44A 4FT9A 3GB2A 1GZ8A 3GU5A 4HYSA 5LVLA 2X7FA 3GU8A 5H8GA 5BVNA 3I7CA 3BZ3A 5HICA 4EOLA 3WYYA 4C3FA 1XJDA 4DT9A 4PL3A 2XKCA 4O96A 5DPVA 2J4ZA 3ACKA 3BYSA 3ODYX 5I0BA 5LVMA 5AJQA 4Q9ZA 3S95A 2PVYA 3OFMA 4FKOA 5J87A 5BNJA 1Q62A 3UIMA 5HQ0A 2X2LA 1W83A 2G2IA 3IDCA 4WHZA 4UZHA 3ZBFA 4D4YA 3DY7A 3EQHA 1YXTA 2P4IA 3F88A 4YLLA 2NO3A 4FOCA 3PLSA 4CV8A 2HXQA 3ZLWA 3V8SA 1GZKA 5I9VA 5AUWA 3P7BA 2WMAA 4DEIA 4LV8A 3QF9A 3DFAA 3P9JA 3EB0A 3QU0A 4HVIA 2HCKA 4JAIA 3UGCA 5L3AA 4RZVA 1NY3A 1M7NA 2OIQA 3VRZA 4FV6A 4O7TA 2OH0E 3SX9A 2YM8A 1S9IA 4FG7A 4FSWA 2FA2A 2CGXA 4E4LA 3ANQA 4G6LA 4M0ZA 3L9LA 3UO5A 4ZLYA 3W2OA 2J0JA 2GQRA 2XJ1A 5BVDA 4X7QA 4EI4A 5EHOA 4QT1A 2PVMA 2IPXA 4J52A 1CKJA 4C3RA 3FI2A 4RJ7A 2ZV2A 2UZNA 4D4RA 1PMEA 1ZOGA 3BBTB 5CEPA 4C34A 1CKPA 4ALVA 2X0GA 4BTMA 4C3PA 4I0TA 1DI9A 3EH9A 5FTOA 3H9FA 1PXJA 4I5PA 5FXSA 4QPSA 4FT7A 5EOLA 4RPVA 3PPKA 1JSVA 3I6WA 1OVEA 1XHAA 3V6RA 2BTRA 5B7VA 4CFUA 2Q0NA 2OXXA 4X3JA 3FKLA 2QOBA 3KKVA 4YJUA 5J95A 4QTCA 2VWBA 4LV5A 3V5JA 3Q9WA 1FVRA 2Z7LA 3NUYA 2BAJA 3KRXA 4Q5HA 1B39A 2BIKB 3SXSA 5HD4A 4AA5A 2QOLA 1UKHA 2C3IB 3EQIA 2W1DA 1Q3DA 3CKXA 3O7LD 4QMZA 4RA4A 4XP2A 5D7VA 4E20A 4FV8A 4RA5A 4ANLA 4S2ZA 2C6EA 4O7ZA 3EJ1A 1XWSA 4OBPA 4PL5A 4QP2A 4DFBA 4IZ7A 1ZARA 3HMPA 3R9HA 3UO6A 3CD3A 3TG1A 3LCOA 3L1SA 4RC2A 1YXSA 4O91A 5CI6A 3FL4A 5DGZA 2Z7RA 4YNOA 2W4KA 4IVAA 4BYJA 4W9WA 2OK1A 2P0CA 3ZLXA 5IH4A 3ZBXA 3EN5A 3OWKA 1RJBA 5HTIA 3CTQA 5F95A 3O51A 2VTRA 3KQ7A 3MGYA 3SAYA 2JIIA 4B99A 3TDWA 3E64A 4ZJJA 4C7TA 2PE1A 4CFFA 3A7JA 3C0HA 2A1AB 4LRMA 4G9RA 4IAKA 3MV5A 5BVEA 2RFSA 4DN5A 3NW5A 2QG7A 3LLTA 2CN8A 2UVXA 4FR4A 1A06A 1SMHA 2IVVA 2YIYA 2VTQA 3ENHA 3QC4A 5DLSA 3SC1A 3ZFMA 4D55A 5J1VA 5EDQA 3O23A 3G6GA 3UVPA 3QL8A 4BZOA 5JEBA 4NK9A 5HOAA 3ORTA 1H4LA 1WAKA 3V04A 1REKA 5EM8A 2WMUA 2JKMA 2PHKA 2P2HA 5EW9A 5EYMA 3F3WA 5HU3A 2FH9A 3COIA 4X6RA 3RZFA 4N57A 2RFDA 3LM5A 4R1VA 3PPJA 4KRCA 3NCGA 4OAVB 1PXOA 5IQFA 3ACJA 4BGGA 2VX1A 2GDOA 4JDHA 1J1CA 2BIYA 2WTKC 3WZEA 3FXXA 3IG7A 1MP8A 3U51A 3QUPA 3FHRA 4F65A 1SVHA 3JVRA 5CVHA 5ANDA 4FSRA 1BL6A 1E1XA 3TNPC 5H9BA 1VEBA 1LEWA 4PRJA 4FSQA 5HO7A 4OUCA 1ZYJA 2WNTA 4EYJA 3L8PA 3W2CA 1PRYA 3WI6A 3ODZX 1WVWA 3ERKA 4IJPA 4GVJA 5KBRA 4O0VA 5KMKA 4ZMEA 5D11A 4KD1A 5AV3A 2NRYA 2A19B 3ZO3A 1IASA 4GW8A 5CF4A 2YACA 2BDFA 4OBQA 5I3OA 3LMGA 3FI8A 4HGTA 2HY0A 4FL3A 1R39A 3CE3A 2YM6A 4BHZA 3T3UA 4F6UA 4CFVA 2QQ7A 2VAGA 3I0QA 4IE9A 4C4IA 4DEGA 5ICPA 2YHVA 4O7RA 3PZEA 3Q52A 2BHHA 4FVQA 4UMTA 5CU6A 5JMSA 2R3PA 3UQCA 3QCYA 1Q5KA 4FKGA 4EOKA 4B0GA 3OG7A 3FC1X 4Y95A 3FMNA 1NVSA 1YRPA 4FG9A 1MQ4A 2VTAA 4HCTA 4FIEA 4I6FA 4NKSA 3GOPA 4O0WA 4YLJA 3VS4A 1DAYA 3GXLA 4CMUA 2CLXA 4ERWA 4FV5A 1IA8A 4ERKA 2FSOX 4TL0A 5HTCA 5I9UA 1QMZA 5LWMA 3EL7A 5AUXA 3LJ2A 2ZMDA 3VS6A 4FV4A 4ZY5A 2YM3A 3FKOA 3UIBA 3EQFA 3PWYA 4DT8A 4MHAA 4KKHA 2IVUA 3MH0A 3P79A 4A4LA 2UW8A 4KAOA 2YLFA 2B55A 5BMSA 5FTGA 2PTKA 3F6XA 3R8LA 1M2QA 3OROA 3A8WA 3G6HA 2ITYA 3AC2A 5BYLA 4BDKA 4KBCA 4RG0A 4WBOA 5KMLA 3KREA 1CMKE 2PVKA 3NUSA 3R7GA 4QMWA 2PK9A 3G0EA 4P4CA 4YNEA 3VBWA 2OW3A 3OOMA 1BMKA 3TJCA 5HX8A 5LMKA 4E5WA 4BGQA 4WT6A 1WBVA 3ORLA 4XBRA 1OL7A 3F2AA 2YAAA 1SNUA 3C7QA 4FSYA 4ITHA 3C0IA 5IQDA 4CLJA 4JRVA 5A54A 3H4JA 4KRDA 4D5KA 3NSZA 4G9CA 3P86A 4PY1A 4ZJVA 2OJ9A 4E4MA 3OY3A 4LYNA 4F7NA 4MAOA 4G2FA 3OXTA 3SXRA 3V5LA 5EK7A 5LCJA 3QWJA 2UUEA 3RGFA 4FEXA 3R01A 3AT4A 3MDYA 5FXRA 1JQHA 4C35A 2PMIA 2EXEA 4PNIA 2JAVA 4MD9E 4CG9A 4YJNA 1IEPA 4ANQA 3PUPA 4BR3A 4ASEA 2CKOA 2R3FA 4RZWA 5T6KA 1YWNA 5KMOA 3IW4A 2B52A 4R5SA 3RM7A 3H30A 4TW9A 4BHNA 4USEA 2W5BA 1QPDA 1S9JA 4V0GB 4CMTA 3FYKX 3W1FA 4NU1A 2V22A 3DKFA 4BTKA 4GU9A 2QOHA 4GYGA 4DINA 3FMJA 4DF3A 4KIKB 4OTQA 3JUHA 4CRLA 4QTAA 4I5HA 3B2TA 2ITQA 2X8IA 3PIZA 3V01A 4EH8A 4JIAA 5DT4A 1BUHA 4LOQA 5J9LA 4O82A 3QUDA 4FKLA 3RAWA 3FV8A 3TNHA 2P55A 3R28A 2WMTA 4FEQA 4KS7A 3THBA 4BF2A 3ZCLA 5DA3A 1JVPP 1R0EA 4ANBA 4CZTA 4D9UA 2IZUA 4APPA 4S32A 3DNEA 5EKOA 4AW1A 1WVXA 3BV3A 3E7OA 4MK0A 3NUUA 1OUKA 3F66A 5LVNA 5ITAA 3OTUA 1P4FA 2JITA 3ZM9A 2GHLA 5HIDA 2H8HA 2FYSA 3F61A 4ZOGA 5AM7A 2XP2A 2Y4PA 3SKCA 1Y6AA 2X39A 4CCUA 1XH6A 2WMQA 4DH5A 4J95A 4CV9A 3MIAA 4FT5A 3U55A 3ORIA 3Q6WA 2VRXA 2C68A 5CX9A 3R00A 3HAVA 5KX8A 2UW0A 5KHWA 4F08A 3F5XA 4Z3VA 4BN1A 5CAOA 1UWHA 2JIUA 4L00A 4PPBA 3R9DA 1GJOA 5KMJA 4QP6A 4QP8A 4FTNA 3UOJA 3H0YA 2W9ZB 3DK7A 5EQPA 3PXRA 3RPSA 2NP8A 3A2CA 4Q9SA 1J1BA 3EMGA 5BQ0A 3VQHA 4O6EA 2UVZA 3PA3A 4MH7A 2XVDA 3EHAA 3HVCA 3P7CA 3PJ2A 3CQUA 5E91A 2BAKA 2QKWB 3P5KA 5BYZA 2EVAA 3R7YA 3LFDA 4E4NA 2J51A 2YM4A 2FVDA 3E93A 1UU7A 1LR4A 4IANA 4MD8E 3R9OA 4EORA 1FPUA 1Q41A 1H26A 2X6EA 4AOTA 2E9OA 3WOWA 2C0TA 4BICA 3W2RA 3C4FA 3AQVA 2X7GA 5CU3A 3ZEPA 1A9UA 3CY2A 4GIIA 5IEVA 4YJTA 4FTQA 4PMMA 2XA4A 3O71A 3QQLA 1RDQE 4ACCA 4RRVA 4F09A 5BUEA 4IWQA 1XQZA 2BALA 5HO6A 2WMXA 1YI3A 3DQWA 4G17A 5HHWA 5CXHA 1KOBA 3MB7A 4UBAA 4JBPA 1APME 3JS2A 3I5NA 3QTZA 2E9PA 5D1JA 3FZ1A 4J98A 5HI2A 1KOAA 1ZRZA 2V7AA 3ZC5A 3ZYAA 3K5VA 2BFXA 4AOIA 4Z7HA 5E90A 4IX5A 5M51A 4J8NA 1Q8ZA 1OPJA 4R77A 2ETMA 3EQCA 4NSTA 3PFQA 4B8MA 5AUUA 4MBLA 4M13A 1V0OA 4PP7A 4FNYA 5L6PA 3B2WA 5FP5A 4EQUA 4BBFA 4KUJA 2PVHA 4LFIA 3OXZA 4DH8A 4QMUA 2B1PA 5KKRC 3BE2A 5AAGA 3FJQE 4F64A 4ZMFA 2WU7A 1W84A 4NCTC 4JDJA 2OSCA 4YO4A 4ZTNA 2XK3A 3NUNA 3BHVA 5E8VA 4GK4A 1KE9A 3HP2A 5EI2A 2OF2A 4TWPA 3ZU7A 1GIJA 1HCLA 4Y46A 4ZSEA 1XH7A 3QRTA 1Z5MA 1ZYSA 3LCDA 4V01A 3LFFA 3FEGA 5CZHA 3LJ0A 5JRQA 1NW1A 3AG9A 4LMUA 4AN9A 2G1TA 5JQ8A 3F3VA 2HELA 5CVFA 3OP5A 2C6KA 5AAEA 4ZTRA 3M1SA 3QRIA 5C4KA 1H1SA 3E88A 5EI6A 3MPAA 4Q5EA 3W2PA 4AZEA 4DGNA 5AV2A 3TZMA 5LMBA 4NYEA 3R6XA 3WF7A 3L9MA 4FTAA 4F9WA 4L7SA 1GZOA 3LMIA 2VTMA 3IQ7A 1ZOEA 4IVCA 3EFLA 4K1BA 3DQXA 3RAHA 4I41A 3VN9A 2PZRA 5B2MA 1U5QA 1YHVA 3LZBA 3PE1A 4LOPA 4ZS4A 3F9NA 4R78A 3FE3A 5AMNA 2FGIA 4XP0A 3MSSA 4FIJA 4ID7A 2R0UA 3ZDIA 4CRSA 5FDPA 5HIBA 2WD1A 4D4SA 1F5QA 3F3UA 3ZFXA 1CSNA 5B2LA 3SLSA 3QX4A 4DFLA 2BDWA 2QOCA 2VWVA 4HVDA 1E1VA 4YBJA 4YHTA 2W1GA 4ZK5A 5GZAA 4FNXA 4NUSA 5JK3A 4ZS0A 3KGAA 4XG7A 3HEGA 4G3FA 4F99A 5ANOA 3COHA 4DEAA 5ACKA 1M52A 3VBYA 5GJFA 3UOHA 1BL7A 2HK5A 1QL6A 4WA9A 1XBAA 3OT3A 4GFGA 4XOZA 5E1SA 4YJQA 2QO9A 1OGUA 4AFJA 1WBTA 3RMFA 3I1AA 4XRLA 4BCHA 4WUNA 2QHNA 2I1MA 5M4IA 3R9RA 2BKZA 4XG4A 3GUBA 3ZRMA 5FTQA 4FG8A 2OH4A 4MXYA 4RT7A 3BQRA 3RNIA 3KVXA 1IAHA 2EXCX 3HV4A 4R7HA 4AOJA 4X2FA 2VD5A 4G3DA 4TN6A 1K3AA 5JGAA 3KCFA 5AUZA 4F0FA 4FODA 4PP9A 1O6YA 2YWPA 3L9NA 2X6DA 3HV3A 4NM0A 4UMRA 5I9XA 2C6OA 3VRYA 3UP7A 5IISA 3D2IA 4FV3A 4YP8A 4BWXA 5A6NA 5BPYA 3GC8A 2WMBA 1BYGA 5FEDA 4UY9A 3OUNB 4R3PA 2PUNA 3QD3A 4E8AA 1TQIA 5DH3A 5IKWA 1GNGA 3OW4A 3N9XA 4L8MA 3OCGA 3IONA 4CFWA 4G6OA 1ZMVA 3PY1A 2XKEA 2R3QA 3Q60A 2VTNA 3D5VA 4MXCA 3SV0A 3UJGA 5FGKA 5DT3A 2ESMA 1K9AA 2XKDA 3K54A 2JKOA 3SDJA 4FGBA 4NT4A 4D2VA 2PZ5A 3U9NA 4BDHA 2XJ2A 3S0OA 3FDNA 2QLUA 5DYJA 4LUEA 3MPMA 4AZFA 2XMYA 4O7NA 3EN7A 3N51A 1G3NA 2OO8X 4PTEA 1TVOA 4QO9A 3PLAE 1EH4A 3VVHA 2VGOA 4YZMA 4EBWA 2VZ6A 4NTTA 4O1OA 3QZFA 4HYIA 5CT7A 3F82A 3TKIA 3O8TA 1RE8A 3QTRA 2W7XA 4U80A 1NVRA 1OIUA 3TDVA 3QC9A 2OF4A 4MQ1A 4XBUA 3C4CA 5JFSA 5AADA 4KIOA 4QP3A 3TV4A 4E93A 5CSWA 3TZ8A 2CSNA 5JGBA 4RJ5A 3OTVA 3ULZA 5A4EA 1P5EA 5EKNA 5ETFA 1M2RA 3QUEA 4HYHA 4FEVA 4HCVA 4PPCA 5DE2A 3N4TA 2XH5A 4JQEA 4J8MA 5CNNA 2OIDA 3DNDA 3I79A 4BDFA 5EM6A 5F4NA 5HBHA 4I23A 4QTEA 5JKGA 2R9SA 2YZAA 5FWKK 3BLRA 3NMUF 3JPVA 3E92A 4IAAA 4JBVA 3MJ2A 4AF3A 3GC7A 4M66A 4FZFB 3ALOA 3RK7A 2VO0A 4BDJA 3KMUA 3QXPA 4XG8A 4BIEA 5AUTA 5KMNA 2QD9A 2ITVA 3HLLA 3DXPA 1UNHA 2AC5A 2VWYA 3DAKA 3UIUA 4B6LA 1KE5A 2JFLA 1XH8A 3AGLA 4IZYA 4RJ4A 5IDNA 1UU8A 2YAKA 3HV7A 5H8BA 4CEGA 4EOJA 2A0CX 4GUEA 4Z7GA 5LXMA 4NKAA 2QR8A 2WQBA 4EQCA 5A4QA 2XRUA 4YZ9A 5IA3A 1ZOHA 3G33A 4D1ZA 1WBSA 2BRBA 3PVGA 3R1YA 5BUIA 4XS2A 3NNXA 4IADA 3F2NA 3QQJA 2IVTA 5FP6A 3BLHA 1IA9A 5AR4A 4YTIA 2BHEA 2R3HA 4FKJA 3V5QA 3HKOA 2W1EA 3LXNA 4FTTA 3WF5A 5J7HA 1OUYA 1T45A 2F57A 3MVHA 3AT3A 3NZ0A 3UMWA 5CF5A 3NAYA 4O0TA 3ZRKA 1QPEA 3PY3A 3UBDA 3KMWA 1J91A 1TQMA 3G2FA 4MXZA 4XEYA 4BBEA 5AFVA 4CZYB 5ETAA 1B6CB 4QP9A 3A99A 4YJSA 5CU4A 5E8UA 5EI8A 3VUDA 4FIHA 4E3CA 5DFPA 4P5ZA 1R3CA 2VTLA 1K2PA 3MTLA 3QQFA 1OKZA 3VIDA 3W16A 3ZS5A 5AM6A 3GP0A 2ZDUA 5HCXA 5J7BA 4U44A 2CPKE 2ITTA 3BGQA 5TKDA 2ZYBA 4FKQA 2F4JA 3TKUA 4BDCA 4D5HA 4NTSA 5BUJA 5IEYA 4MTAA 4V05A 3BX5A 2DWBA 3LFQA 2QKRA 4G16A 1Q97A 3RPOA 3TZ9A 5D7AA 1V0PA 5CEOA 4IJ9A 3QD0A 3ZZEA 3Q6UA 3ATTA 1ZYLA 5FDXA 1VR2A 3P1AA 3C51A 3BU6A 5GJDA 1O9UA 1ZAOA 2WQNA 3ZLYA 2WTJA 4H3QA 4BL1A 3GU7A 3P23A 3ZXZA 2XK4A 4NFMA 3ALNA 5EH0A 1YHWA 4L01A 4MD7E 3BYUA 4BDAA 4J99A 4JIKA 4N6YA 2PPQA 3EKKA 4JX3A 4RVMA 3TKHA 5CAPA 3UC3A 3PE2A 3QKKA 1Q8TA 4QPMA 3OMVA 4KBKA 1STCE 2V55A 1IAJA 5FQDC 4XV2A 3U6HA 2PYWA 3KF4A 3C13A 4X2KA 2JDVA 3BBWA 4K77A 4IM3A 3CTHA 3RHKA 2GHGA 4RWIA 4FTMA 4XLIA 2R3JA 4BTJA 4RQVA 5TR6A 3R83A 3AD4A 3Q32A 4BI0A 4PNKA 5HE2A 3UE4A 4JVGA 5IEXA 3BEGA 3BI6A 4O0XA 5M4CA 4BZNA 2PUUA 2XIZA 4A4XA 4A7CA 1JOWB 1Y8YA 1CM8A 4FTRA 3MVMA 4R3CA 4GKHA 3TI1A 3IW6A 1L3RE 4USDA 4O7VA 3LCTA 3PVWA 3HMIA 4C4HA 4CZUA 3EL8A 4OTWA 3NNUA 2PZIA 2QODA 4ZY6A 4EH4A 5IH6A 1URCA 2YDIA 3UODA 5L2WA 1H1QA 2R64A 3OY1A 4DG2E 2GU8A 3QTWA 2R5TA 5C26A 3RHXA 3RPYA 3MPTA 3KN6A 4IFCA 4K11A 4ZXTA 4WBBB 4I4FA 2JKKA 4YC6A 3FZSA 1BI7A 4EH9A 4O2ZA 3RWPA 2C30A 4WO5A 4C4JA 1W7HA 3EWHA 4QQ5A 3LMHA 4HGEA 2WZJA 4TZRA 4XMOA 2JFMA 5AR7A 4RVLA 1HOWA 2WHBA 3WZDA 3DJ6A 4HZRA 1JKLA 4EK4A 4YTHA 2XNOA 2C6TA 3A4OX 1JKKA 5DWRA 3LKMA 2BTSA 1JWHA 4IIRA 1OMWA 3E8EA 4CLIA 4I0RA 2PL0A 4AZVA 3SOAA 4B7TA 5HNIX 3FPQA 4KS8A 1FBNA 1YXVA 4ZP5A 5DT0A 3BELA 2ZM4A 4QMOA 4JG8A 5FEQA 1I44A 3RK5A 4ENYA 3DK6A 4TNDA 4FIGA 4FSUA 2KTYA 4L3JA 3C9WA 4MF0A 3RJCA 1JKSA 2O5KA 3PP0A 4TKSA 3R71A 5B2KA 2X2KA 3CLYA 3FMLA 4ZSGA 4FICA 3WARA 4OW8A 4DH1A 3A61A 3F69A 4L3LA 2R3RA 2B9IA 4QQCA 2OJJA 2YIRA 4ITJA 4F1MA 5AIRA 4MQ2A 4R3RA 5IQBA 4YURA 4OTIA 2ZJWA 3ZTXA 4E26A 3QD2B 4FA2A 3WIKA 3WF6A 2W1IA 5FM2A 4FEUA 4O0SA 4IAIA 5IU2A 2XCHA 1SZMA 2YCRA 4F1TA 4O7YA 3G9NA 3VF9A 5JGDA 4UB7A 3E5AA 2GQGA 3R7OA 1JPAA 4JT3A 3ROCA 4FBXA 4KSPA 2QOOA 4DEBA 1DAWA 3KF7A 1JSUA 1H1RA 2XCKA 3RAIA 4K0YA 3TIZA 4EH5A 5DRDA 3C4EA 5AR2A 3PRIA 4U5JA 3E62A 3MB6A 2VWIA 3DDPA 4J96A 3DBFA 1H1PA 2GMXA 3K3IA 5FBNC 3TTIA 3QLFA 4DA5A 3DKCA 3TEIA 3LFNA 4X21A 4DEDA 3D83A 3OCTA 4IFGA 4RX8A 1OB3A 4TPTA 4XNEA 1CKIA 3HMNA 2I7QA 2Y4IC 3MFTA 5HORA 2RF9A 4KKGA 3DS6A 4AWIA 2XB7A 4JNWA 2OIBA 3MIYA 4ASZA 3AMBA 1Y6BA 2WAJA 5CANA 2C6IA 4GL9A 3KFAA 4ZSJA 4C8BA 3QRUA 2ETRA 4UWYA 4X3FC 4EOSA 2C3JA 4ZY4A 3UZRA 4A4OA 3DGKA 2WO6A 1H00A 4RSSA 2R3GA 2XKFA 3KY2A 3L9PA 4FV1A 3QKMA 2XK6A 4S30A 4XV3A 5ANJA 4EHGA 2Z02A 3GNIB 2BCJA 2JKQA 1BI8A 1XO2B 3HA6A 5K5NA 2P2IA 3GCVA 4I5CA 3ATSA 1Q3WA 3HYHA 3LHJA 4FKRA 4FTCA 2WPAA 2OBJA 4N6ZA 2J90A 3D0EA 3PXQA 4Z9LA 3QGWA 3GENA 4W8DA 4K6ZA 3R0TA 3TNQB 3LCSA 3BKBA 2BZJA 2WMVA 4O83A 4BI1A 4E6CA 4RIYA 1PMUA 2JAMA 1H0VA 3GCPA 3MA6A 3QHWA 5ETIA 4AT3A 4KIPA 4O81A 3EQRA 1ZY5A 5AR3A 3IDPA 3MS9A 5CQWA 3E3PA 3OCBA 2XIYA 4YPDA 4HYUA 5LOHA 2W0JA 5EHYA 3ZO4A 3GOKA 4DGOA 5HX6A 2G01A 5A46A 4JX7A 5CY3A 5K3YA 3W55A 2YCQA 2XNNA 5JZNA 3M2WA 1OPKA 2QC6A 4U40A 4H58A 2B9JA 4GMYA 4E1ZA 3I81A 1LPUA 4DCEA 3V5PA 3O0GA 4PMTA 4A07A 3BE9A 5L6OA 3TL8A 4R1YA 4BDDA 2XNPA 5TE0A 3ZHPC 4MXAA 2R3IA 4YPSA 5JH6A 3LW0A 1P4OA 2XBAA 4TNBA 4O2PA 5BVFA 2V7OA 5GIOE 3DAEA 4EOOA 5AA9A 5EM5A 5KZ0A 4PWNA 3Q4CA 4EOMA 4FSMA 3FLZA 1YOJA 4RBLA 4B9DA 4FOBA 3C4ZA 5JT2A 3KXZA 2R3OA 1OIYA 2HZ0A 3GCUA 5L6WL 5AUYA 4QMMA 4A9YA 1BX6A 3P78A 4FT0A 4ZLOA 1VZOA 4GEOA 1UVRA 1SVGA 2IO6A 2OI4X 3DFCB 3LOKA 1FVTA 4NCTA 4BCIA 3PG3A 2HY81 3DTWA 3DOGA 3UNKA 2EWAA 4YSJA 3SW7A 4QMXA 4ASDA 4EK3A 4BDIA 3EQDA 3CCNA 2VO6A 4I1ZA 2X1NA 4OBOA 4KWPA 2R7BA 4JS8A 4FNWA 3QTQA 2VTIA 3NIZA 4FSZA 4BWKA 1FMOE 4D2PA 2KULA 3MN3A 2VTTA 5ANKA 5M56A 4EEVA 5JQ5A 3WE8A 5TF9A 2PMNX 4DFXE 5KO1A 4UWBA 5C4LA 4JL9A 3CXWA 3DBEA 1QCFA 2YCFA 4YMJA 4U3YA 4R7IA 3R8PA 1JSTA 4UWCA 4DTKA 2QVSE 3BQCA 4WG5A 2UZVA 3R1QA 4CVAA 3LQ3A 3VC4A 2Z8CA 4MWHA 4H36A 3VUTA 2RFEA 3UVRA 1KV1A 4I4EA 4PUZA 2WMRA 3GQIA 5AA8A 4BFMA 4EUTA 4BKYA 1YWRA 4D1XA 2VNWA 4EH7A 5DBXA 4ZAUA 1OKVA 4OLIA 4P5QA 2JDSA 2W99B 3V51A 4DFZE 4C2VA 4I20A 5DI1A 3VS0A 3CGOA 4F4PA 4I92A 4JDIA 4O1PA 3R2BA 5C8MA 2OJFE 5HE1A 3OWJA 5I9ZA 1YVJA 2W05A 3UOKA 1ZWSA 4C4EA 1WVYA 3G90X 3PJ8A 3W33A 3E63A 3ORXA 3C4WA 3VS2A 2VN9A 1IG1A 3PZHA 2JBPA 3NDMA 3PIYA 3AC1A 5E7RA 5G6VA 1MRUA 4WKQA 5C8KA 2B4SB 4ACDA 3NVKI 4EK5A 3AMYA 5HO8A 2QCSA 5EHLA 2OXYA 2YABA 1Q4LA 4BGHA 3TACA 1OIRA 3PYYA 4W4WA 4A9UA 4D28A 2CGUA 2R3MA 2PVLA 2XK8A 2E9NA 3FSFA 3I7BA 1R78A 4E5AX 4LRKA 4HOKA 1A48A 3QBNA 2YJSA 4APCA 1P14A 2VWZA 4CKIA 4NJ3A 3PDTA 2QOKA 4I0SA 3MI9A 3NEWA 4L43A 4LRJA 3OS3A 4FVPA 5LQFA 4AW5A 3NUXA 4O86A 2BRMA 4FKIA 4O84A 5HG7A 4EOQA 3ZEWA 3V3VA 2QI8A 3IOKA 4H3BA 5HLNA 2O0UA 4IM0A 3GQLA 2BRGA 3FXZA 3VUGA 5DIAA 3CPCA 2BVAA 2J0KA 4DFNA 3KA0A 4DEHA 1U54A 2XEZA 4EQMA 1OBGA 1FGKA 4XG9A 1YOLA 4MWIA 4ASXA 3DU8A 1J7IA 3BRBA 2P33A 2W4JA 1GIHA 4ZZMA 5IF1A 3AGMA 2FB8A 5KHXA 4U81A 5EYKA 2FSTX 2BMCA 2YLEA 4M14A 4EBVA 4F7SA 1YI4A 2ONLC 2F2CB 5FEEA 2UZTA 5AR5A 4BKJA 3ULIA 5E4HA 2I0EA 4AXAA 3FI3A 4OTRA 1YW2A 2JDRA 2YITA 2X8EA 4C58A 5IA5A 5M57A 3KULB 2GPHA 2Z7QA 4BC6A 3NYOA 3R8UA 3CJFA 2OZAA 3Q4UA 3EYHA 3LIJA 3WBLA 1Q8YA 2XIKA 4RX7A 3OWLA 4FTKA 3CEKA 4I6QA 3E3BX 4U7ZA 5C03A 5IUIA 2CJMA 3MTFA 5DR9A 3PTGA 4QYYA 2HZ4A 4YR8A 2WTKB 3S3IA 4YSMA 2IZRA 1PF8A 1OL1A 4L52A 2WEIA 2HZIA 3EQPA 4TRLA 3P7AA 3TUBA 3TM0A 3HRFA 4P90A 3QTSA 4EH2A 5L2IA 3HECA 4EWQA 5AX9A 3FY0A 3GCQA 5F94A 3PXZA 3UVQA 3UDBA 2HZNA 4O22A 1KWPA 3QZIA 4GFOA 4QNAA 4K33A 4ZTLA 4I22A 2WKMA 4CKJA 1YQJA 3CQEA 3LFBA 3FZRA 4WOVA 5FXQA 1OIQA 4A06A 3TUDA 5CS6A 2BZIB 4MVFA 3WE4A 2XJ0A 1H0WA 3CGFA 5I3RA 4GJ2A 5E8XA 4YO6A 5FBOA 4PDPA 3PVUA 1J3HA 3MJ1A 1WBWA 1PKDA 2PSQA 3IGOA 4GCJA 4C33A 3DTCA 1ZMWA 2VX3A 4BCQA 1PXLA 3SXFA 1KE6A 5C9CA 4BBMA 3BWFA 2FSMX 4GVAA 3BCEA 3UP2A 4AZSA 4EYMA 4XX9A 4NJDA 3JYAA 4QMSA 4TY1A 3EZRA 3AC4A 4HNIA 4CT2A 5J5SA 4IDTA 2CDZA 3EKNA 2DUVA 1PXKA 2BROA 3PA4A 4JR7A 4L45A 4O38A 5EW8A 2ZM1A 2XNMA 2QOIA 4AGWA 2XIXA 1UNLA 1OL2A 1OI9A 4FV2A 5IUHA 3CTJA 3BYMA 4QMVA 3VF8A 3SHEA 4QRCA 3VQUA 3OZ6A 1PJKA 2YWVA 4DFYA 2XNGA 5DR2A 5AP3A 5CEKA 4TYGA 3WZKA 2ZV9A 4JBOA 4D2SA 2JEDA 3T8OA 3FLQA 3E7VA 2OJIA 4YJVA 4AS0A 5BYYA 4HCUA 3ZZWA 3IW8A 1XH5A 3DXNA 4EK8A 1OKYA 2C5VA 2QOFA 2UW9A 5ETCA 2HWOA 3FBVA 4K9YA 4OTGA 4R6VA 3I6UA 3R73A 4DAWA 3ELJA 3VS7A 4CTBA 2IG7A 4IX6A 4BTFA 3PJ1A 4JXFA 4FV0A 2GFCA 3QX2A 3PSCA 3U4WA 5CEMA 2Y9QA
chains in the Genus database with same CATH superfamily
4FNZA 5HIEA 5FLFA 3W32A 4PX6A 3PA5A 3R04A 2XRWA 3HX4A 4CYJA 1WBOA 4ZTHA 5CAVA 3UPZA 1OECA 2CHLA 3C1XA 4M69A 5JN2A 5FUTA 2W1ZA 4NM7A 3Q9YA 5IQCA 4CMOA 4ZJIA 5D10A 2R3LA 3DZOA 4FMQA 3ORZA 2UZLA 3UDZA 4PQNA 4OGRA 3WF8A 4IHPA 2OXDA 3VBVA 2DQ7X 3PY0A 4IZAA 4K8AA 4IQ6A 4M7IA 3VBQA 3NPCA 4GRBA 3VJOA 4F63A 5BVOA 4AXFA 3D2KA 1OL5A 3PPZA 4O7SA 2C4GA 3BU3A 4HGLA 3JVSA 4YGAA 4IW0A 4JQ7A 3D15A 4YTFA 4Q2AA 3G51A 1ST0A 2XANA 3IS5A 5DNRA 5IQAA 3A7HA 4WNPA 4JG7A 4RMZA 2C1BA 2BAQA 2W9FB 4GS6A 2RL5A 5C01A 1VYZA 4IDVA 3SA0A 1WZYA 3NW6A 2WTIA 3GBZA 2PU8A 1WCCA 2GNIA 3GT8A 4O0UA 2EB3A 2A27A 4U6RA 4DG0E 3G15A 3CPBA 3SRVA 3O96A 3F3ZA 3D5WA 3IECA 3Q5IA 4CCBA 1ND4A 2CKPA 4GH2A 4BY9E 4KBAA 4J7BA 4F1OA 3ZONA 4F9CA 2Y6OA 5M07A 2CNUA 2Z2WA 3BPRA 3DT1A 4D0WA 3CP9A 4DLIA 3LCKA 3F7ZA 5TO8A 2IVSA 3VUHA 4QMNA 2BRHA 4BZDA 1OITA 4MCVA 4QMLA 3IW7A 4UZDA 3ZSHA 2G9XA 4GG7A 1JKTA 3WZJA 4OAUC 4P7EA 1RW8A 2QOQA 4JI9A 4LL0A 4Z16A 3S1HA 2RIOA 5L2TA 4QNYA 4WNOA 5GHVA 2P3GX 5J1WA 4UX9A 3GU4A 4O7LA 1H25A 3RAKA 3R8MA 3U54A 1TQPA 5IZFA 4NIFA 2UW6A 5KBQA 2VO3A 2ZB1A 3IGGA 3BIZA 3IO7A 3O50A 2HOGA 4U9AA 3CJGA 4RX5A 4RIYB 2J0LA 3BL7A 4QDVA 5E8WA 3RVGA 3W8LA 3FWQA 2NNWB 4D58A 5CXZA 4GUBA 4C4FA 3R63A 5CZIA 1YI6A 1ZY4A 2NRUA 5EDRA 5IPJA 4G3CA 3LJ1A 4M67A 3ITZA 2F7XE 2C69A 2PVFA 4XV1A 4UEUA 5EW3A 2VTPA 2F9GA 2A98A 4M12A 2WMSA 5L2QA 4AT5A 2JD5A 4FKVA 3UQFA 4DGGA 3DAJA 2QU6A 3FLNC 4U41A 4HVSA 5HLPA 3V8WA 3TV6A 2C47A 1PMVA 2E9VA 3FY2A 3RP9A 2J5FA 3C50A 3TJDA 4XOYA 4Y83A 2W1FA 1KE7A 2VU3A 2A2AA 4JRNA 4CG8A 2X9EA 2H34A 2V62A 3HDMA 4KABA 4UMQA 2LAVA 2IWIA 4O0RA 5CT0A 5HGIA 3POOA 4WG4A 2BRNA 3ET7A 4C59A 2FUMA 2XM9A 3OF0A 4NW6A 4GT5A 4AN2A 2GNHA 4FVRA 4QDEA 3MY1A 3OBJA 4TYIA 5J9YA 4TTHB 4DC2A 3EFWA 5CEIA 3W0PA 2ZFYA 4L3PA 4DBNA 3QKLA 1QPJA 4QPAA 5KKRB 4P2KA 3UG2A 4C37A 2XEYA 3D94A 4LV7A 1WBNA 1RQQA 4FTIA 3A4PA 2HWPA 3VUMA 3CD8A 3NAXA 4GYIA 5EDPA 5K4IA 1T46A 5LCKA 3ZUTA 4AZWA 3WYXA 1E9HA 4OTPA 3H9OA 1FINA 5IMEA 5CF6A 1Q24A 3F5UA 5BVKA 5T3QA 3DA6A 4Y73A 4YZBA 4EH3A 3U9CA 3FAAA 3KC3A 5CSXA 5ACBC 3ROYA 1PMNA 4RLKA 5GZ8A 3Q04A 5M4UA 3BHHA 3B8QA 1H07A 4WD5A 1J7UA 3FZTA 4I93A 4JOAA 3KULA 4BCGA 5HD7A 4WUAA 3JR1A 1OM1A 3OT8A 2YERA 3NYNA 4I5MA 4ORKA 3COMA 4M15A 3A7GA 2B9FA 3DLZA 3VO3A 4X3FA 1FVVA 3A7IA 3DJ5A 2X4FA 4FKTA 5ANGA 4CTCA 1ERKA 4FTOA 5DEYA 3ZO2A 5AP4A 1WBPA 3VHEA 3QD4A 2R7IA 2GNGA 3QA8A 3MYGA 4QMYA 4XYFA 4S31A 5HE0A 3UQGA 2VWXA 2G2HA 2F7EE 1MRYA 3ZDUA 4AAAA 3RTPA 4X6QC 1BKXA 2BFYA 3QYZA 2O2UA 2UZDA 3POZA 3TT0A 2QLQA 4C0TA 1CTPE 2R3NA 5D12A 2PMOX 2GTNA 5GZ9A 2GHMA 4EZ5A 2C6LA 3HUCA 4HW7A 4I94A 3HL7A 3Q2JA 2ITZA 4RFMA 3RALA 3GU6A 4C62A 2Y6MA 4U79A 1W8CA 1Y91A 3A7FA 3QFVA 4GU6A 4U45A 3MFRA 4S34A 5GIPE 3GI3A 3ZFYA 4AU8A 5CSHA 4YTCA 3GC9A 1G8SA 3Q96A 2UW4A 3QALE 4NW5A 4FUYA 3BU5A 3V5WA 2R4BA 4BCMA 4YZDA 4Y72A 3LVPA 4ANMA 4PV0A 1ATPE 1AQ1A 2AC3A 4MNFA 4IACA 1B38A 3D14A 3RK9A 3FQHA 3LPBA 5I4NA 1J7LA 4EJ7A 4KNBA 1MQBA 1W2CA 4EKLA 3AT2A 3HMOA 1Q8WA 4H1MA 4D2WA 4O7WA 2C5YA 3V5TA 3QXOA 3LQ8A 5HCYA 1H24A 2PZPA 4WG3A 3QRJA 4K18A 4BIDA 3N4UA 3D7ZA 1IR3A 4UV0A 3OHTA 3K3JA 3LFSA 4UMUA 2HYYA 5JZJA 3PG1A 2XYUA 2XYNA 1MUOA 4G5PA 4BVUA 2BUJA 3QQKA 5IA2A 5BVWA 4UYAA 4XP3A 3W18A 1U54B 2GNLA 4TYHA 3VS1A 3EN9A 4MXXA 4DHZA 5A4LA 3ZM4A 4IEBA 4QQTA 3KK8A 2PMLX 4C61A 5AIKA 3SD0A 3NUAA 3NYVA 2YDJA 1WFCA 4ARKA 2OKRA 3VNTA 1YWVA 3CQWA 2X4ZA 2QONA 3OOGA 5B0XA 4BIBA 3IDBA 4AQKA 4KB8A 2Y0AA 4DFUA 3FYJX 4GFMA 3BLAA 4JBQA 2OZAB 4I6BA 3MFUA 2PY3A 5DVRA 5EQYA 3B8RA 3S2PA 2UZWE 3UIXA 4I3ZA 4F9AA 5CTPA 4BKZA 1Y57A 5A6OA 2IN6A 4PDSA 1PYEA 3FXWA 1ZZ2A 3FPMA 2JIVA 2VWWA 3KL8A 4I6HA 5HKMA 4PL4A 5CU0A 4IMYA 5DN3A 4J97A 2C0OA 2JGZA 4CNHA 4XG2A 4QYFA 4AG8A 3COKA 4ZTMA 4J1RA 2RG5A 4WRSA 4DGLC 4IC8A 4G31A 2OWBA 3KRWA 3GEQA 3TTJA 1H08A 1JBPE 4YJOA 3T9TA 5IA4A 4TYJA 3FMDA 1FMKA 3VHKA 5IMXA 4ALWA 2X7OA 4XV9A 4AT4A 4AXCA 4L67A 4RLLA 1ZXEA 2WQEA 3TV7A 3WILA 2GS6A 3G9LX 3UC4A 4O4EA 1FOTA 4BCJA 4U8ZA 1OPLA 3JY9A 4LUDA 4AP7A 4F0IA 3R7VA 4NWMA 3PRFA 5EYDA 2J2IB 4M68A 1XH4A 5EFQA 3S00A 4C02A 2W1HA 4QYEA 2QR7A 1G5SA 3TNIA 1YXUA 4BCNA 4D9TA 2B0QA 3CC6A 3MBLA 4YC8A 5H8EA 4D2TA 4DTAA 1F0QA 4XH6A 4FL2A 2DS1A 2QO2A 3Q53A 2J9MA 5IQHA 3DXQA 4FEWA 4Y5HA 3E8CA 1Z9XA 3R1SA 4RVTA 3ZSGA 3Q4ZA 2J7TA 3QWKA 3OBGA 4G3GA 5CENA 2YM7A 3R8VA 4ACHA 3DBCA 3QTUA 4GK3A 3HAMA 4ZIMA 2XBJA 3W8QA 4E73A 2PUPA 1SNXA 3DLSA 5CQUA 2J6MA 3T9IA 2V5QA 2VWUA 3DKOA 4TWOA 5E8SA 3PSDA 2GCDA 4K2RA 3VUIA 4TYEA 2PZYA 3DV3A 4XHKB 3CS9A 4A9TA 2W4OA 5HCZA 2Z60A 4Y8DA 5D9HA 5KMMA 2ZB0A 2AUHA 4FL1A 3SVVA 4YHFA 1U59A 3H0ZA 3UG1A 4RVKA 1UWJA 5CAUA 4IB1A 1W98A 1KUTA 3K5UA 4E6DA 3OEZA 3WF9A 2GS2A 3MFSA 4FKUA 2OZOA 3FI4A 5DOSA 3AMAA 4A9SA 4O4CA 2Y8OA 4FZ7A 4IX3A 5HBJA 2CCHA 3ZXTA 4FGRA 3ZOSA 4BCKA 5K9IA 3LLAA 4O21A 3O17A 2YEXA 3QZGA 4CGAA 1Z57A 4H1JA 3NVMB 2VO7A 3O8UA 3V6SA 5J8IA 3VONA 1SVEA 4RFYA 4YZNA 2CN5A 3QCXA 4AFEA 4AX8A 1GY3A 3PJ3A 4KINA 4BCFA 4CXAA 1M7QA 3MY0A 4FC0A 5CAQA 4R8QA 1UU3A 4AN3A 4D1SA 2ONLA 3EOCA 3MY5A 3TN8A 1IRKA 4OT5A 4AW0A 4DH3A 1H8FA 4MBJA 5M55A 4DE4A 5M53A 1YOMA 4M69B 2W17A 1JAMA 2OFUA 4EK6A 2YZLA 4H3PA 4BCPA 1MRVA 4IAZA 5EOBA 1UU9A 2C5OA 3OXIA 4UXLA 1JLUE 3V8TA 1UV5A 4EL9A 4L42A 2I6LA 2VTSA 3FQEA 5DEWA 3KVWA 4FX3A 4TWNA 5FM3A 5G1XA 4EOIA 3U8WA 3NUPA 1NT2A 3EFKA 3EN4A 3O5AA 3NFFB 2A4LA 1NA7A 1Q61A 4BB4A 1JNKA 2FO0A 3LM0A 3BHYA 4LGHA 2V0DA 5L8LA 3FQSA 5AUVA 1SM2A 4AA4A 2IW6A 3R8ZA 4TWCA 2HENA 4U97A 4WRGA 1X8BA 1W0XC 2BZKB 4LOOA 3NW7A 2I0VA 1PYXA 4RIWA 5H2UA 4C36A 5DRBA 5AAFA 4QTDA 5HEZA 4UN0C 3I0OA 4EWHA 4PPAA 2G15A 4UYNA 3CSVA 2XIRA 3KRJA 4MBIA 4BI2A 5T68A 2JDTA 2XS0A 4YHJA 5E8TA 4AGUA 3KRRA 5JRSA 3SRVB 3M11A 4F0GA 1V1KA 2ETKA 3K2LA 4JJRA 1UA2A 3HRCA 3IKAA 5AP6A 4LGDA 2C0IA 2VUWA 4G34A 4E6QA 2GNJA 4F7JA 2B53A 2B9HA 4LM5A 3KRLA 4EC8A 3A62A 5HTBA 1HCKA 3H3CA 3UZTA 5KNJA 1FQ1B 4D0XA 3PSBA 3R9NA 5IH5A 4NFNA 5FD2A 3WIGA 4CKRA 4O0YA 3F3TA 2W96B 5AV1A 3Q2MA 2WQMA 1PKGA 4MNEA 4N4SA 1I09A 3R30A 4R5YA 5EG3A 2ITWA 4PTGA 5HG8A 4H05A 5CI7A 2WOTA 2YIXA 5AR8A 3QA0A 3VS5A 4IVDA 2UZOA 2XALA 3C5IA 3S4QA 2VGPA 4C2WA 5LWNA 4Y85A 2PUIA 3CBLA 3A60A 5A9UA 3SG9A 2XNBA 4BDBA 3HP5A 1P2AA 4WNMA 1ZYDA 4JG6A 4QP1A 4NIFB 4O6LA 1KSWA 1PXMA 1YKRA 2X2MA 2XNEA 3LXLA 3D7TA 4DGMA 1H1WA 2C6MA 4QYHA 2I0YA 3ZUUA 4MEDA 4M3QA 4FK6A 3UNZA 5CU2A 3NGAA 2JBOA 2CMWA 2WGJA 3EYGA 1M2PA 3KU2A 5HBEA 3ZSIA 4QMQA 4YU2A 1ZMUA 3Q3BA 5KZIA 5CASA 5GINE 3DK3A 4KA3A 3QQUA 4Z55A 3PXYA 4MYGA 4WSYA 2EUFB 4EH6A 4E6AA 2GFSA 4WIHA 2J0MB 5IA1A 4FTJA 4C4GA 2BZHB 2FSLX 3ORNA 4CFMA 3BHTA 5EM7A 1AD5A 5LVPA 3LXKA 3GCSA 3NNVA 4OT6A 2OG8A 3MH2A 4LQMA 4QD6A 4FYNA 4ZSLA 4YJPA 5AP7A 4DLJA 5E9EA 1VYWA 3UYSA 2WIHA 5AX3A 2WMWA 1WMKA 4GT3A 4FTLA 4PDOA 3FHIA 1NVQA 3QLGA 5AV0A 4AW2A 3R7IA 3BGZA 2GS7A 2H9VA 4ZEGA 3U6IA 2WOUA 3BEAA 4ALUA 5K5XA 3DCVA 3TWJA 3ZO1A 3D9VA 3KXHA 4FI1A 4LMNA 2B54A 4N0SA 4IB3A 4GV1A 4QOXA 3UOLA 2JDOA 4NEUA 4X2NA 3UYTA 2OJGA 4RJ8A 3CKWA 5M06A 4AA0A 3BYOA 3MH3A 3BV2A 4RGJA 1G8AA 5IQGA 2REIA 1ZYCA 2ZV8A 1O6KA 2RFNA 3RPRA 3Q4TA 5F20A 2QNJA 2YA9A 3PVBA 1ZZLA 3RZBA 4DH7A 4PMPA 5HNBA 2VV9A 2O3PA 4RJ6A 2C3LA 4IWOA 3VJNA 4D4VA 5AP5A 5HG5A 4IAFA 4NM5A 5E1EA 2PVNA 2X0OA 4BDEA 3BYVA 3AXWA 3IOPA 2QURA 4FF8A 4GSBA 4IM2A 4RIXA 2ZOQA 4KSQA 4M84A 4O27B 4USFA 5AP2A 5HLWA 5CSVA 1Q8UA 5EQEA 4FK3A 4L7FA 5D41A 1H28A 2XK9A 4S33A 2Y4IB 4FSTA 4NH1A 3DJ7A 5TOZA 2GSFA 3VBXA 5IQEA 2YCSA 3HGKA 4LG4A 2BDJA 2HIWA 3QQHA 3Q5ZA 3KK9A 5JFXA 5FG8A 2ITPA 3EN6A 2YJRA 3FMKA 2WEVA 4IXPA 4X3FB 2IZSA 4IC7A 5C27A 4F70A 4IX4A 3II5A 3NRMA 4HNFA 5A4CA 5A4TA 4W9XA 4L44A 5JSMA 1YDRE 4TXCA 4MKCA 2EB2A 5BX0A 3BGPA 3UPXA 4DCAA 1R1WA 2YN8A 4IAYA 4FZDB 3HRBA 4W4XA 4HVGA 5C1QB 2ITXA 3HUBA 2I40A 2CKQA 3RCJA 5AP1A 2HXLA 2WXVA 2UW3A 4TT7A 3RBWA 3RINA 3O8PA 1DS5A 4G3EA 3ENMA 3CIKA 1R0PA 1PXPA 3HZTA 3LAUA 2ZM3A 4NM3A 2B7AA 3DPKA 4JLCA 2XF0A 3ZLSA 3HDNA 3ML1A 5LJJA 2ZV7A 2Q83A 4RWKA 4E4XA 4ZZOA 4J53A 4GKIA 5HVKA 1GAGA 2W06A 3ID6C 3BHUA 5HZNA 1V0BA 3G5DA 1GOLA 3QRKA 3P0MA 3OWPA 4V04A 3JXWA 2YFXA 1UNGA 3SOCA 2WQOA 3FSKA 5L8KA 4FV9A 2VNYA 3KXNA 4F78A 5HVYA 4EJNA 5LVOA 4LL5A 2PE0A 3RKBA 5AP0A 5M08A 3FZPA 2ITNA 5LMKC 1L8TA 4ANNA 2VTHA 3PJCA 3MA3A 5IUGA 1LEZA 3D5XA 3OW3A 2QU5A 3C0GA 3MVJA 4FRFA 2C5XA 3BWJA 5ANIA 4CYIA 3LFEA 2IW8A 5K4JA 2WTWA 3ORPA 4LI5A 4ACGA 4D2RA 4QMTA 3MESA 4L9IA 3PIXA 2UW5A 3F5GA 3VW6A 4AQCA 3QAME 2QG5A 4C57A 4TYHB 4L6QA 3R21A 3TNWA 3DB6A 1F3MC 2ZVAA 4U0IA 1OZ1A 4EOPA 5JFVA 2WFYA 3Q9ZA 5CLPA 3Q9XA 4JQ8A 5HVJA 3CY3A 2I0HA 3TIYA 4IWDA 2EU9A 3I4BA 4L68A 3C5UA 2RSVA 4RIOA 5TT7A 3LFAA 3SW4A 5I9YA 4AAYA 3NX8A 5HNGA 1OBDA 4ACMA 5A14A 3FL5A 2RG6A 4QP7A 4RJ3A 3NLBA 4RC4A 4F9BA 2C3KA 5FRIA 4YLKA 3VUKA 3FZOA 3PWDA 3QZHA 2VTOA 5F1ZA 2F7ZE 4FKPA 1W82A 3BLQA 3IW5A 1M14A 5HESA 2PVJA 3A8XA 4EONA 4FZAB 5BMMA 5L8JA 2OLCA 2IJMA 3PXFA 3QCSA 3M42A 2O8YA 2OU7A 3GVUA 2OGVA 4HGSA 4ZZNA 3FLWA 2C6DA 1ST4A 4EZ7A 3GFEA 3ZH8A 1OKWA 3AC8A 4FV7A 4HPUE 4LGGA 3VWAA 1G8JA 5DHJA 4FKSA 4U3ZA 3SQQA 3ZC6A 3MH1A 1TKIA 4I21A 5A3XA 2WTDA 4IBMA 3TXOA 3R2YA 2SRCA 5M4FA 4CQEA 1URWA 4QMPA 5HU9A 2ZDTA 4YZCA 1H01A 4AACA 1PXNA 2ACXA 4OR5A 2YM5A 1PW2A 3ZUVA 2WB8A 3R02A 5CVGA 2YIWA 3P4KA 3U87A 3NCZA 3OCSA 3JY0A 5F9EA 2RGPA 3FMEA 3QYWA 4RFZA 5DR6A 1PHKA 4ANOA 3R7UA 1XBCA 1YDSE 2O64A 3LXPA 2Q0BA 5AV4A 2UW7A 3TUCA 3HV6A 2F49A 4B8LA 3OEFX 1NXKA 4XCUA 3F5PA 5CEQA 4CFXA 3LE6A 4AZTA 3W0RA 2JC6A 2Z7SA 4ZSAA 2QO7A 3NYXA 1XMMA 3DBDA 2PWLA 2BR1A 4W4YA 4GJ3A 3EFJA 4AGDA 4ENXA 3OVVA 2XAMA 3IPHA 4ZTQA 4DBXA 2XK7A 2LGCA 4IH8A 2O65A 2X8DA 3KN5A 2NPQA 3L8SA 1AGWA 4FTUA 4KIQA 5LARA 4CSVA 3ZRLA 4FT3A 3W10A 5AEPA 3N4VA 5I5ZA 3F7WA 4W4VA 4HPTE 3IK3A 2ERKA 3QTIA 5HE3A 5JFWA 4IB5A 4PTCA 3UO4A 2X9FA 3GC0A 4X0MA 3UTOA 3OD6X 2CNQA 3DB8A 1LP4A 3VBTA 4F6WA 3H10A 4GIHA 3NNWA 2BKKA 3DKGA 4FZ6A 4Y5QA 3RI1A 2CGVA 4XLVA 4CFNA 2R0IA 4L46A 4EUUA 4FKWA 4WSQA 3W2QA 4CT1A 1QPCA 2HW6A 2ZMCA 1YHSA 3EQBA 3NWWA 4F9YA 5L4QA 4R7BA 2JLDA 4XG6A 1CDKA 3AD6A 3O7LB 2ITOA 3EQGA 2VTJA 4M0YA 1REJA 4N70A 3R7EA 4CQGA 3ORKA 4DHIB 2R2PA 3ORMA 3HNGA 1DI8A 4HZSA 4DTBA 3I5ZA 2E2BA 3WZUA 1GZNA 3MWUA 2R3KA 5CNOA 5IG1A 4OTFA 2NYAA 3DBQA 4OTHA 4WNKA 2BPMA 4IZ5A 3AOXA 4OTDA 2AEGA 4UMPA 5J5TA 1M17A 3QTXA 1FGIA 3ETAA 4RQKA 3W2SA 4DG3E 4EHZA 4XJ0A 3NIEA 3UZPA 3E8NA 4DEEA 4F7LA 4MX9A 2W5AA 2QHMA 2IZTA 2RKUA 3QCQA 4FIIA 4MXOA 3P08A 4U42A 3FLSA 4RWLA 1Y8GA 3OUKA 4YJRA 3SG8A 2C5NA 3ANRA 3EZVA 4ANSA 2CLQA 4V0GA 2HAKA 2WTVA 4GK2A 4BWPA 4BCOA 4EHVA 4MF1A 3KB7A 3HMMA 2VX0A 3MW1A 3E8DA 3O2MA 3VS3A 4RC3A 2CCIA 4EC9A 4EKKA 4ZLZA 5M09A 2PE2A 3T3VA 4M97A 1U5RA 3FMHA 1SYKA 4FUXA 4KIKA 3EIDA 4QYGA 4UALA 5KCVA 3U6JA 2PULA 3LQ5A 2IEWA 4BRXA 1PY5A 5CF8A 1VJYA 5K0XA 2AYPA 2GNFA 2W5HA 3FKNA 5EYCA 2IW9A 3RWQA 5C8NA 4FSNA 4I24A 4RIWB 3HA8A 2G2FA 4HJOA 4FIFA 4RIXB 5IA0A 3LFCA 3ZMMA 2UZEA 1UKIA 5J79A 2YIQA 2E9UA 3FLYA 4X2JA 1PXIA 1YDTE 4G6NA 3TCPA 5GJGA 3D4QA 3DZQA 4DYMA 5IQIA 3D5UA 3KXGA 2XUUA 4XG3A 5CSPA 1KE8A 2EXMA 4RX9A 2ITUA 3QGYA 1YXXA 4F6SA 1Q99A 3RCDA 3QHRA 4DITA 1DM2A 2CNVA 3KEXA 2UZUE 4BYIA 3GGFA 3OC1A 4XUFA 2ERZE 4GT4A 2UZBA 1XBBA 2PVRA 4B4LA 4ZTSA 4BDGA 4HVHA 4RWJA 5IDPA 3KXMA 4FYOA 5CALA 1H27A 3GFWA 4YUQA 2GQSA 2UV2A 3AC5A 2WTCA 4MNEB 3C4XA 3VULA 2H96A 3FUPA 4L53A 4U43A 5KUPA 2Y7JA 2X0QA 3PXKA 3KMMA 4M8TA 4DDIA 3RPVA 3AC3A 4UXQA 4CD0A 2WIPA 4ONAA 2F2UA 4AE6A 3L8VA 4JR3A 4YC3A 3TZ7A 4XRJA 3D7TB 2BILB 3U4UA 3VW8A 1W2FA 1LUFA 5I9WA 4JAJA 3R22A 5KE0A 4H39A 3REPA 3RM6A 4EHEA 5DMZA 1O6LA 1U4DA 4W8EA 4IB0A 2O63A 2CGWA 4FE2A 2C1AA 4ITIA 4IVBA 1ZLTA 5LMAA 4PDYA 4G1WA 5L2SA 4KKEA 3MVLA 5CYIA 2J5EA 2X81A 4X2GA 5GNKA 4MUQA 2CKEA 2WELA 3NS9A 3F2RA 5CWZA 4YBKA 2YISA 3PP1A 2XM8A 5E8YA 3E87A 1BLXA 2H6DA 5J9ZA 1KV2A 2GTMA 1XKKA 5E8ZA 1XR1A 5H3QA 3KCKA 4EZ3A 5ANEA 3L8XA 4QP4A 1GIIA 4A9RA 4G5JA 2OFVA 4PF4A 4NZWB 3I60A 4JDKA 3FC2A 2XZSA 2UVYA 4IWPA 3RNYA 3SGCA 4AE9A 3AD5A 3G0FA 2ZAZA 3QQGA 3DDQA 4GG5A 4J71A 1XH9A 3UMXA 4E7WA 3NR9A 5K0KA 2J0IA 3UNJA 4DHFA 4NL0A 2WU6A 1OL6A 2X0PA 5AWMA 4QTBA 5HG9A 4AUAA 3HV5A 2J50A 2W1CA 3R1NA 2DYLA 3FMMA 4E5BA 4C38A 2HW7A 1U46A 3H9RA 4II5A 2YDKA 2OICA 5KMIA 5E92A 3VAPA 3KXXA 4AGCA 3CR0A 4QQJA 4PMSA 5DG5A 5M44A 4FT9A 3GB2A 1GZ8A 3GU5A 4HYSA 5LVLA 2X7FA 3GU8A 5H8GA 5BVNA 3I7CA 3BZ3A 5HICA 4EOLA 3WYYA 4C3FA 1XJDA 4DT9A 4PL3A 2XKCA 4O96A 5DPVA 2J4ZA 3ACKA 3BYSA 3ODYX 5I0BA 5LVMA 5AJQA 4Q9ZA 3S95A 2PVYA 3OFMA 4FKOA 5J87A 5BNJA 1Q62A 3UIMA 5HQ0A 2X2LA 1W83A 2G2IA 3IDCA 4WHZA 4UZHA 3ZBFA 4D4YA 3DY7A 3EQHA 1YXTA 2P4IA 3F88A 4YLLA 2NO3A 4FOCA 3PLSA 4CV8A 2HXQA 3ZLWA 3V8SA 1GZKA 5I9VA 5AUWA 3P7BA 2WMAA 4DEIA 4LV8A 3QF9A 3DFAA 3P9JA 1G8KA 3EB0A 3QU0A 4HVIA 2HCKA 4JAIA 3UGCA 5L3AA 4RZVA 1NY3A 1M7NA 2OIQA 3VRZA 4FV6A 4O7TA 2OH0E 3SX9A 2YM8A 1S9IA 4FG7A 4FSWA 2FA2A 2CGXA 4E4LA 3AKLA 3ANQA 4G6LA 4M0ZA 3L9LA 3UO5A 4ZLYA 4AXDA 3W2OA 2J0JA 2GQRA 2XJ1A 5BVDA 4X7QA 4EI4A 5EHOA 4QT1A 2PVMA 2IPXA 4J52A 1CKJA 4C3RA 3FI2A 4RJ7A 2ZV2A 2UZNA 4D4RA 1PMEA 1ZOGA 3BBTB 5CEPA 4C34A 1CKPA 4ALVA 2X0GA 4BTMA 4C3PA 4I0TA 1DI9A 3EH9A 5FTOA 3H9FA 1PXJA 4I5PA 5FXSA 4QPSA 4FT7A 5EOLA 4RPVA 3PPKA 1JSVA 3I6WA 1OVEA 1XHAA 3V6RA 2BTRA 5B7VA 4CFUA 2Q0NA 2OXXA 4X3JA 3FKLA 2QOBA 3KKVA 4YJUA 5J95A 4QTCA 2VWBA 4LV5A 3V5JA 3Q9WA 1FVRA 2Z7LA 3NUYA 2BAJA 3KRXA 4Q5HA 1B39A 2BIKB 3SXSA 5HD4A 4AA5A 2QOLA 1UKHA 2C3IB 3EQIA 2W1DA 1Q3DA 3CKXA 3O7LD 4QMZA 4RA4A 4XP2A 5D7VA 4E20A 4FV8A 4RA5A 4ANLA 4S2ZA 2C6EA 4O7ZA 3EJ1A 1XWSA 4OBPA 4PL5A 4QP2A 4DFBA 4IZ7A 1ZARA 3P5JC 3HMPA 3R9HA 3UO6A 3CD3A 3TG1A 3W0MA 3LCOA 3L1SA 4RC2A 1YXSA 4O91A 5CI6A 3FL4A 5DGZA 2Z7RA 4YNOA 2W4KA 4IVAA 4BYJA 4W9WA 2OK1A 2P0CA 3ZLXA 5IH4A 3ZBXA 3EN5A 3OWKA 1RJBA 5HTIA 3CTQA 5F95A 3UDSA 3O51A 2VTRA 3KQ7A 3MGYA 3SAYA 2JIIA 4B99A 3TDWA 3E64A 4ZJJA 4C7TA 2PE1A 4CFFA