4C58A

Structure of gak kinase in complex with nanobody (nbgak_4)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
307
structure length
267
Chain Sequence
DFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEKYSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of cyclin G-associated kinase (GAK) trapped in different conformations using nanobodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Cyclin-G-associated kinase
total genus 75
structure length 267
sequence length 307
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c58A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c58A01
4F6WA 2OJIA 3MH1A 4PWNA 2XF0A 4GFGA 4L67A 5EM8A 3PE2A 4DGNA 4NWMA 5HGIA 4QRCA 4R1VA 4UYAA 5CF8A 4DFUA 2IVSA 3MBLA 5FM3A 3K3IA 4PDYA 1G5SA 1SNUA 3GGFA 3VW6A 1JKLA 2ZMCA 4FZAB 3V6RA 3DK6A 3W1FA 2XKEA 4CCBA 5LMBA 4HYHA 4IWQA 1TKIA 4IX3A 1H00A 2WNTA 3BYUA 4WBBB 5CVGA 5FD2A 4AN2A 5E8WA 4D4YA 3TUDA 2EWAA 3QLGA 2GNLA 4YJSA 3SAYA 5CVHA 5CU6A 1OUYA 4H1JA 4M0YA 3QC9A 5H3QA 3A62A 3MESA 3BYOA 4C0TA 4C57A 3FE3A 2YLEA 2RG5A 2ZDTA 2DWBA 3KVWA 2C6IA 2R3RA 3ORLA 2R3JA 3IQ7A 4TTHB 1XBBA 4C58A 1REKA 3F3ZA 1XH8A 4K8AA 4E4XA 4D2SA 5AA8A 4X3JA 2HK5A 3RAIA 2BIKB 3OT8A 3I6UA 3ITZA 3MA3A 1PJKA 3TZ9A 3ZU7A 2VD5A 4C62A 4F9AA 2YA9A 2BHEA 3PIZA 4DGLC 5DH3A 3F7ZA 3HEGA 3W2RA 4YBKA 3UVRA 2OJJA 3OTUA 5IH5A 4O2PA 3ZXTA 4KB8A 5EYCA 1R1WA 2VO7A 1PXMA 1YI3A 2I6LA 2OIQA 2GHGA 3VBQA 4EUUA 3UZPA 4DEAA 3NNVA 2C5OA 3Q4TA 3UPXA 3PY0A 4M14A 1E9HA 5GZ9A 3RCJA 3VRZA 4F64A 4ZZMA 4DINA 4ZMEA 4QMTA 3UBDA 4G9RA 3UTOA 4KIQA 4YP8A 1BI7A 4GMYA 1YOLA 4YZNA 1TQPA 3TNQB 4BBFA 1SZMA 3I7BA 3O96A 4C4IA 4RWKA 1OBDA 3QQFA 2X8DA 1Q24A 5HX8A 4UXLA 3Q60A 4D1SA 2ETRA 4JX3A 4ZSEA 3OUNB 4K0YA 3G2FA 5HE0A 4BDHA 4LGDA 4BIDA 3TIYA 5D7AA 3IDBA 1RJBA 4NFNA 3U51A 4XV9A 3GCUA 1HOWA 1CMKE 4IDVA 4EC9A 1WZYA 3E88A 3KF4A 5AWMA 3FBVA 3BE2A 4YJQA 1LEZA 4OT5A 4QYHA 2BMCA 2J90A 5M08A 4M69A 3NCGA 2WMRA 3AMAA 3HP2A 3ODZX 4FV2A 3C4XA 1NVSA 4I5MA 2J9MA 3ZEPA 3ZO3A 4F63A 5BNJA 1J91A 4JQEA 2WMTA 1OKYA 3U54A 2IVVA 3F69A 5BPYA 3PXFA 1XBAA 1Q4LA 1XBCA 3DK3A 4YC8A 3UQCA 3C5IA 4J1RA 4IXPA 4X3FA 4MYGA 4RJ5A 3LFAA 5DT4A 4EHEA 4D4VA 4ASEA 2CKQA 2WMXA 4IAYA 4NW5A 2VTAA 3G33A 5JFSA 2BTSA 5M4IA 2WEVA 4TWCA 5GZAA 1OL7A 2C3JA 2OFVA 3QCQA 4LG4A 3CJFA 5JT2A 3BBTB 2OBJA 4EEVA 5JQ5A 4K6ZA 5EHOA 3OW4A 2NRUA 2YM3A 1ZRZA 2CHLA 2HWPA 4GIHA 4A7CA 4ERWA 4CG8A 2C0TA 4WIHA 1A48A 1OIYA 4RIYB 4RJ3A 1Y91A 4RWIA 3NNWA 4WT6A 1IA9A 2QODA 2Y9QA 3CJGA 3QX2A 1CTPE 4ZLZA 3LM5A 3BGPA 4FZ6A 4BDCA 5JGDA 3B2WA 4GH2A 1H1PA 1DS5A 3G0EA 4O6EA 4O0WA 4RC4A 5HOAA 4G6OA 1ZYSA 5G6VA 3DDQA 1LP4A 3G51A 3O7LD 3QKLA 5CAUA 2F7XE 5FTGA 3KMWA 5IQHA 2XNBA 5JZNA 4FSWA 5IG1A 3HRFA 1GZNA 4FTKA 4PY1A 5AV0A 4O7LA 3UG1A 4FTNA 2CCIA 3VNTA 4IANA 1KWPA 3NW7A 3I0OA 3E92A 2Q0BA 3P08A 4PTEA 1ZY4A 4F0GA 3FXXA 2JIVA 2QOBA 4TY1A 2A2AA 4ACMA 5L8KA 4BZOA 3HP5A 2XEYA 3KEXA 5L2SA 3PSCA 3LCTA 4FYNA 1GOLA 3GCQA 2I0YA 5K5XA 5M07A 2C30A 3VS4A 4NYEA 5A4QA 4XG4A 3BHTA 3I6WA 4EC8A 2QR8A 1TQIA 4ZK5A 3VJNA 1J1BA 4O0YA 3ZXZA 4WG4A 1WBWA 3AG9A 3A8XA 3DNDA 3FMEA 1YXVA 5ANEA 4DFNA 4KINA 3PYYA 1PXKA 3RNIA 5CF5A 5HVKA 3MTLA 2BCJA 4R77A 1T46A 5F1ZA 2OSCA 4QP2A 5TO8A 3FQSA 5J5TA 5CASA 3C0HA 4BI2A 2UW9A 4XOZA 2VZ6A 4J53A 3NAYA 1RDQE 5KKRB 3FXZA 1K9AA 3EFJA 2GMXA 4EJNA 1KE8A 3ZO2A 3DY7A 3RPOA 2R4BA 4W4VA 2NRYA 3TV4A 2V7AA 4FKRA 2F2UA 3AT2A 2F49A 5M57A 4DEGA 2W99B 2ZV7A 4HZSA 1OPLA 5C4KA 2A4LA 3MH0A 3QGWA 4MXCA 3Q3BA 1P5EA 4NTSA 3VC4A 3PLAE 2CN5A 3VVHA 4BVUA 4E93A 4IADA 3B8QA 3PDTA 4L52A 2OLCA 3LXNA 3NIZA 2VGPA 5HCXA 2YEXA 4M84A 4FNYA 2ITUA 2ZM3A 5BX0A 2C4GA 5EM7A 2OF2A 3R8UA 2WQEA 5DIAA 4RIXA 3EQRA 3LXPA 3GC9A 1E1XA 4FKSA 5KBQA 3R04A 4BGHA 4M68A 5HD4A 2XIXA 2XS0A 1FVRA 4G3DA 3AOXA 4Z7GA 4HPTE 3EFLA 3O71A 2BVAA 3QHWA 4L53A 4UXQA 3ZSGA 4AE9A 1L8TA 4KBCA 2R3GA 2W5AA 3ROCA 3FMNA 2ITQA 3NSZA 3HL7A 5CTPA 4QPAA 3UIUA 5CNOA 4JBVA 4BKYA 5JK3A 1SYKA 1ND4A 5K5NA 3CSVA 3Q9ZA 4PNIA 2O63A 3W33A 2PUIA 4P5ZA 3OTVA 5AUXA 5L2QA 3THBA 3BLQA 4MD7E 4FE2A 4GL9A 4HZRA 3GFWA 2IW8A 3L9NA 4PMPA 5HIDA 3ORXA 4FT0A 2XJ1A 1H0VA 2GNFA 4DTKA 2FGIA 4X2FA 2WEIA 3QFVA 5EHYA 4BTJA 3FHRA 3GFEA 4HGSA 5EI8A 1R39A 5IF1A 3UGCA 2WOTA 3FQEA 3Q04A 3PP0A 4G2FA 1P2AA 3CTQA 5DE2A 5AUUA 3ZCLA 4D1XA 3BV2A 1H07A 1E1VA 1WBNA 3RPSA 4AOIA 2XMYA 2HXQA 1YI6A 2WTJA 3SX9A 3ALNA 3Q96A 4A06A 1TVOA 3NWWA 1Q8TA 4AACA 4F65A 4MNEB 5IQEA 2ZOQA 5FGKA 3SRVB 4D2WA 3VS6A 3WZKA 3NUPA 5IDNA 2X4FA 3HZTA 4KS7A 5AP7A 2E9VA 1J7UA 3MW1A 5HLPA 3JVRA 3C5UA 2LAVA 4EWQA 5AX3A 2C3IB 3QLFA 5HG5A 2Y0AA 1G3NA 4DA5A 1ZAOA 2RFEA 5HVJA 1M14A 2VX3A 4USDA 4EH8A 2Y6MA 4CGAA 1PXIA 4WA9A 4IM0A 4QMZA 4P4CA 5CAPA 5BVKA 3KRJA 1VZOA 3UOKA 2XKDA 3V5JA 4XLVA 4B8LA 4E1ZA 4E26A 4EHVA 5AP1A 4X3FB 1O9UA 1M52A 4MWIA 5EI6A 4RLLA 4IC8A 4W9WA 1QPDA 2RSVA 2H34A 2UW6A 2E2BA 1K2PA 4AGWA 3IDCA 4QPSA 5CENA 2ERZE 3PXRA 2CNVA 4BCKA 4ACCA 2C6OA 4O0TA 3UIXA 4UWBA 5I0BA 4HJOA 3QKKA 4RWLA 4CSVA 5IQCA 4OLIA 4C2WA 5HIBA 4MAOA 1CKJA 4EH2A 5IA1A 3MI9A 3DXQA 3KC3A 3R63A 4M13A 2XK7A 1OKWA 4M12A 4I23A 3DU8A 1YHWA 4JI9A 1ZMWA 3R8PA 2B55A 3JVSA 3QRJA 5A3XA 5ANDA 5DG5A 4GKIA 4JS8A 3V3VA 4EH3A 2PVJA 3BGQA 3MVLA 3RTPA 3OXZA 3BBWA 3VBTA 5AA9A 2BKKA 4CFUA 4FSZA 1OMWA 4GW8A 3DZQA 1FMOE 2JIUA 4YO6A 3H10A 2F57A 3BYMA 4WUNA 5J7BA 3UODA 3LOKA 1YRPA 1PW2A 2YIYA 2IW9A 2HWOA 4XG3A 4AW0A 1JVPP 2G9XA 4FL2A 2UZDA 2REIA 5E8SA 3PXQA 4DEDA 4NJ3A 4O0SA 5J95A 1PRYA 3O23A 1H26A 2UZLA 3L9MA 3FL4A 3EYHA 3QTZA 2XRWA 4X2KA 4USFA 2CKPA 4AS0A 4NM7A 5C01A 4O7ZA 3SXRA 5AUWA 4FSUA 4USEA 3I5NA 4FT3A 4CYJA 3S00A 4BR3A 5IQGA 4ZJVA 3ZC5A 4AZVA 4CKIA 4I0TA 3TJDA 3UG2A 3MJ2A 3TUCA 2HIWA 4QYFA 4N0SA 5HO7A 1Z9XA 1WBVA 1KE9A 4NW6A 5BVFA 3JY9A 5DLSA 4YJOA 3RK9A 3H9RA 4M3QA 2W7XA 3G90X 3QA0A 2WTKC 2AC5A 2WOUA 4GK4A 3KRRA 4GK2A 3WBLA 4D2VA 4EUTA 1UV5A 3KN6A 3EKKA 2YACA 5I9XA 4FVQA 4LRKA 1SVHA 4BWXA 2W9ZB 4I94A 4E6DA 3KXNA 4XRJA 2BDWA 2QLQA 3MH2A 1OVEA 5IA5A 5AAGA 4C3PA 2IO6A 3AXWA 4XMOA 2HY0A 1YXUA 3IDPA 3HNGA 5M44A 1H1QA 2ZAZA 4YLKA 1J1CA 2WIHA 4KBKA 4IFGA 1AQ1A 2GQRA 3DNEA 2C3LA 3V8WA 2BKZA 5BYLA 3BQRA 4U9AA 3D9VA 5DHJA 1FMKA 3C4WA 3PZHA 2ZYBA 1JBPE 1IR3A 4XS2A 4BDEA 2YM4A 4QT1A 5EDPA 3RP9A 5C4LA 1V0OA 1X8BA 4ZS0A 2ZV8A 2XP2A 4RX7A 3UDBA 1UNLA 5CVFA 4OTGA 3WIGA 5IH6A 5M53A 4JG6A 3CQUA 2VWXA 2QKWB 3DJ7A 4FKWA 5ETCA 4GYGA 5K3YA 4LFIA 3R8LA 1H0WA 2I1MA 4RFMA 5E90A 3RK5A 4GU9A 2YITA 1NY3A 3QQHA 4X6RA 3ORIA 5A6OA 3QTXA 4KRCA 4YHTA 4AGUA 4CNHA 1CM8A 5IQAA 5EKOA 5HTBA 3DB6A 4O21A 4W4XA 4XHKB 2QO2A 4I1ZA 3N4UA 2R3NA 1W82A 1U59A 2ZB0A 4GSBA 5JFVA 3COKA 4EOQA 4G3CA 1BL7A 5C27A 5KMJA 3E64A 4I6HA 3LQ5A 3QX4A 4YO4A 3KB7A 4G34A 2ITVA 4HNFA 4K11A 4IX4A 4O0VA 4X7QA 5F20A 2OICA 4G17A 4DF3A 1Q41A 3EYGA 3PLSA 4CFFA 3FI4A 4MXZA 3IGGA 4YLJA 1VYZA 2LGCA 4IJPA 4AE6A 3VBWA 2R7BA 2JDVA 3WI6A 3TNPC 4FOBA 4I5HA 4QP3A 5KBRA 2A27A 4S32A 4DG3E 2GNGA 4OBPA 4DLIA 2JKKA 3LIJA 5HG8A 1ZYCA 3JPVA 4ANMA 3UQFA 1JKTA 3GU6A 2WZJA 5DI1A 5DT0A 4AG8A 5JKGA 2VTPA 2WIPA 3A61A 3D5XA 4RJ4A 3RKBA 3MPTA 4F6SA 4CEGA 3QRIA 4FK6A 4EI4A 3LHJA 5HLNA 2X7OA 3FWQA 1M17A 4I21A 2W1DA 3E8EA 4NCTC 3M42A 4CLJA 4I4EA 5HHWA 4PMTA 4DTAA 3DK7A 3SXSA 4WG3A 4V0GB 3TKIA 4I6QA 5AAEA 3QAME 2C0OA 4FI1A 5CZHA 5L2IA 3O51A 3WOWA 3UOJA 2JDRA 4DH7A 3MY0A 1SM2A 2W17A 3F2NA 2C6LA 3NYOA 3OS3A 5E8ZA 3D15A 5EM5A 4A4LA 4ZMFA 3POZA 2WTIA 3ZONA 3ZYAA 4WSYA 2X39A 2PK9A 1PHKA 1H28A 4X2GA 2QI8A 3QZHA 4IAFA 1UA2A 4LOOA 5FXRA 4E6AA 3N51A 3LFNA 4IVDA 2BRHA 5T3QA 2PPQA 3BYSA 3OCGA 3TCPA 5L2WA 2F9GA 2PZ5A 3P9JA 3FMMA 4B6LA 3TTJA 4Z55A 1H8FA 3KXXA 2XUUA 2X6DA 1OGUA 4LV8A 4MKCA 3PZEA 4IE9A 1FOTA 3D14A 3Q53A 1STCE 3T8OA 4GG7A 1YWNA 4F0IA 5L6PA 4TWOA 4L9IA 5EYKA 4RVTA 3Q2JA 1IG1A 2X4ZA 2GS2A 5EK7A 4JAJA 5EHLA 4GIIA 4M7IA 2PMNX 4KBAA 4A9SA 5DYJA 1ZMUA 3DGKA 3CD8A 3Q6UA 4O0XA 4U3ZA 1J7LA 1BX6A 5HCZA 4R78A 4EOKA 2GU8A 5J7HA 3ANRA 3MVMA 4FC0A 2X2KA 5IEVA 5JGAA 4EOSA 4LGHA 1S9JA 2P2IA 2YCSA 2YM5A 4MVFA 1U46A 4RJ7A 3FPMA 4DBXA 2AUHA 3KK9A 4E6QA 1OPKA 1YHSA 4YR8A 3GOPA 3OBGA 4QTAA 2E9NA 5F95A 3AC3A 3E8DA 2JKMA 3EN6A 4BCHA 4J52A 5HG7A 4JDHA 4B9DA 5DGZA 2WELA 5CEPA 3IW8A 3EFKA 5ANOA 4MCVA 2XCKA 3AGLA 4IW0A 5LMKA 2W1IA 1WBOA 3OY3A 3DV3A 3ZRLA 4AA5A 4EZ7A 3I1AA 4EONA 3OWKA 3P79A 2G15A 4HPUE 4QQ5A 3T3UA 5BUIA 3SA0A 3CBLA 5DRDA 2JKQA 2R7IA 3LCOA 4HVDA 5C8MA 3ZUVA 2VUWA 2A0CX 4XBUA 4FTJA 5CXZA 2ITYA 1Q3WA 1R0PA 3LFQA 4TN6A 3BQCA 2QO9A 3HECA 4O7WA 4BB4A 2PE1A 2RF9A 3Q4UA 2PZIA 5AJQA 4DH3A 4D4RA 5IQBA 3G6GA 2BRGA 2I0VA 3CTHA 1XJDA 3OROA 4D55A 2HXLA 2R3OA 2ZVAA 3EN9A 3WZUA 4CZYB 5B7VA 2OG8A 4U8ZA 3OXIA 3ZRMA 3BLRA 2AC3A 1M2QA 4R7HA 3KF7A 1G8SA 4UMPA 4IWPA 4O96A 4O7NA 4FICA 2X2LA 2GQGA 3OXTA 4DH1A 3V5QA 3LMIA 4Q9SA 3A7IA 3P7AA 4MF0A 3E3BX 3ORPA 1HCKA 2GTMA 1BYGA 2OXXA 3UNJA 2GNJA 4WNMA 3E8CA 4EH6A 2ZMDA 5A54A 4TNBA 2PE0A 3NUSA 4I41A 3DBCA 4L46A 4U5JA 4F09A 5D11A 4AZSA 3UVPA 3IECA 5CU2A 4X3FC 5CYIA 1ZYLA 5LVLA 2HCKA 3VUTA 4TWNA 4QMXA 3WIKA 2V7OA 3GCVA 3F88A 4X21A 2UVZA 2BDFA 4D58A 5L3AA 3D2KA 5TR6A 3HAMA 2UVXA 3DFAA 4IFCA 4PTCA 4DFXE 4ENYA 4HVGA 3HX4A 3E63A 4BCIA 4AGDA 4JRVA 5FTOA 3K54A 4M66A 4JDKA 4XG9A 2YDIA 4YJTA 1DI9A 3FLWA 3F7WA 4L68A 3QXPA 3GCPA 4CFNA 5JQ8A 5EI2A 5IH4A 3L8VA 4ZLYA 5ETAA 1WCCA 4RIWA 4BIBA 4JG8A 3E7OA 4ZTMA 1J7IA 3AD4A 2Q83A 2Z7RA 2FSLX 5GHVA 3CD3A 4L44A 4RC3A 2BZHB 3D5VA 3ORKA 4JQ7A 5E1EA 4O1OA 2JBOA 3V5LA 3GU8A 1UVRA 3AD6A 3ZSIA 5IUGA 2BRMA 2XYUA 4WRSA 2PU8A 2BHHA 1OL2A 4J97A 3AC2A 2J7TA 4IEBA 5AM7A 3P5KA 5D1JA 5FM2A 3DQWA 3W16A 4G6NA 3N4TA 5IQIA 1H27A 1PYEA 4H39A 5I9ZA 3QGYA 3PPKA 4UYNA 3LLTA 4QQJA 5CU4A 3DBEA 3OFMA 4O1PA 4E5WA 5CAVA 5CF6A 4U3YA 2CGXA 3H4JA 3GBZA 2R3MA 1UWJA 4RMZA 3RAWA 3U4WA 3UNZA 3A60A 4G9CA 5T68A 2VTJA 4MH7A 3RINA 3WZJA 4AWIA 4DCEA 3HDNA 3R7OA 4I3ZA 4II5A 3UNKA 4FNZA 4XYFA 5BVNA 4GG5A 5FTQA 5EW3A 1Y57A 3SGCA 3DBQA 3QUEA 2IPXA 1KE7A 3D7TA 4Y5HA 5HVYA 4F7JA 5BVDA 3KMUA 3BLHA 3KXGA 1XO2B 3W55A 3NAXA 4FV8A 4CMTA 1M7QA 3L9PA 3PA3A 2HZ0A 2FSTX 5KMOA 2EVAA 4ANBA 3S2PA 2WMWA 2QQ7A 3C13A 3VBYA 2UW0A 3RAKA 2IZUA 3RGFA 4K1BA 4KS8A 5AIRA 3VUGA 2WTKB 3BWJA 4OUCA 4P90A 1ZWSA 4CCUA 4H58A 4GJ2A 3PXYA 3QUPA 5FWKK 3PSBA 5LOHA 4F1TA 3ENHA 3LQ8A 4MQ1A 4J96A 3TV7A 4BDGA 4FBXA 4UMRA 2ITTA 3CPBA 3QD0A 2CCHA 4IAIA 4MXAA 4LM5A 5GNKA 2G2FA 4BKZA 3VUIA 1RE8A 4IHPA 3MFRA 4BDKA 5JEBA 3ZZEA 2JDTA 5IZFA 2VNWA 3W10A 4BDDA 1FGKA 4L3JA 3DA6A 4Z7HA 3R73A 3HKOA 1HCLA 3RCDA 4FUYA 3V51A 4C33A 3W2CA 1MP8A 1GIIA 1UNHA 1XHAA 4XJ0A 1FBNA 1G8AA 1S9IA 4LI5A 4BL1A 3VAPA 2NPQA 4BDIA 4GKHA 4FZFB 3MFTA 3OWJA 2EXCX 4R6VA 4AOJA 4JX7A 2CGUA 2WMSA 3FLNC 4ITHA 3CKXA 5JN2A 2GHLA 2XA4A 3G5DA 3NDMA 4EZ3A 3GI3A 3CY3A 4R7BA 2R9SA 4KKHA 4Y72A 4NJDA 4DCAA 2C6DA 2XKFA 2IG7A 1GZKA 5GINE 3WYYA 4U80A 3TJCA 4QTDA 4QMNA 1WVXA 4W8EA 3SVVA 4MNEA 4YZMA 4BCFA 3LFFA 1U4DA 3EN7A 4FSMA 4DN5A 3OWLA 4EKKA 5A14A 4C4GA 3ENMA 4Z3VA 2BUJA 1B39A 1Q8WA 4RQVA 4FGRA 1Y6AA 3R7YA 2VTNA 4OAUC 5HIEA 3DBDA 1QPJA 3OW3A 4U6RA 3VWAA 2VAGA 3MWUA 2J50A 4IZ5A 4AT5A 2ZJWA 5HO6A 2IZTA 3DXPA 2YERA 3KULA 2QVSE 4B99A 2C47A 1V0PA 3PPJA 3BHVA 1XR1A 4R7IA 3TG1A 1MRUA 3PP1A 5AV2A 2R3KA 2B4SB 3II5A 3F5GA 4J71A 4U79A 4D28A 3LZBA 3R6XA 4Z9LA 3OC1A 3GC7A 5A4EA 5EQPA 4IZYA 3BCEA 2R64A 3R1NA 3RZFA 3U8WA 3P86A 3R22A 3QQKA 2BILB 3ZZWA 3KMMA 3KU2A 2VX1A 3C4FA 3RJCA 1OM1A 3CS9A 2PMIA 4IWOA 3ZDUA 4APCA 5I9VA 1QPEA 3ATTA 1APME 5AM6A 5HE3A 4QP6A 5CLPA 3TI1A 3K5VA 4NTTA 4CXAA 5LJJA 3U55A 3OVVA 4EZ5A 2F7ZE 4EOIA 3PFQA 3NYVA 2J0LA 3OHTA 2KTYA 4NIFB 2OZAB 3NW6A 1H08A 5TT7A 4ZSJA 2OH4A 2XNPA 3MTFA 4ZZNA 3IW5A 3UP2A 4TYHA 3LJ0A 4WHZA 3NRMA 3K3JA 2BFXA 4TT7A 2JAMA 5AUTA 2PVMA 2OKRA 3MN3A 1GNGA 4IAZA 3GVUA 3VUMA 4QMQA 1PMVA 4XG6A 3CPCA 3Q9XA 4IZAA 3UMWA 5AEPA 1Q97A 4BGGA 4D1ZA 1MQ4A 3E8NA 2W4KA 4HGEA 4YZDA 3UYSA 2W1FA 4TPTA 4DT9A 4I0SA 4N70A 5CY3A 1KE6A 4QTCA 4ZSGA 2QOQA 4C4HA 3V5WA 3EL8A 4F0FA 5LMAA 3C4CA 4FV3A 4UB7A 2PHKA 5IA0A 4QOXA 2C6KA 3ZRKA 2BAQA 2W96B 3QTUA 3WILA 5CSPA 3EQFA 4ENXA 4X0MA 4DEEA 3FLQA 3MJ1A 4FZ7A 3E87A 3HYHA 2OXDA 4LV5A 5FXSA 4ZIMA 1Q8UA 4U44A 2XNMA 4QMYA 3ERKA 4CV9A 1DI8A 3ORMA 1FPUA 5C8NA 1JPAA 4KIKA 4E20A 3PJ3A 1DAYA 5KZ0A 3AD5A 3D7TB 3D5WA 2PVNA 3LCKA 3DCVA 3M1SA 1YHVA 1R78A 3RWQA 3VHEA 3NGAA 3VUDA 5IQFA 2X8IA 3ZH8A 3V5TA 5IISA 5HD7A 5BUEA 2J0KA 1GAGA 2YM7A 4V04A 3R02A 5DNRA 4L3LA 4AN3A 4ZTNA 3D2IA 3PXKA 4RSSA 3DPKA 3RWPA 5I9WA 1REJA 5I9YA 3QTWA 3BX5A 3P7CA 3O8UA 4A9UA 4BHNA 4JRNA 2XKCA 4L00A 3EB0A 3V04A 1JAMA 2YZLA 2W4JA 3GNIB 3ALOA 4F99A 2WGJA 4IMYA 1MUOA 2XYNA 3KA0A 4CT2A 3LMHA 3ZFXA 3OT3A 5CSWA 4EOPA 2ACXA 4XNEA 4JDIA 2HAKA 4RFYA 4I6FA 2EB3A 3LVPA 1JSTA 3ZLXA 3NMUF 4DGOA 2P0CA 3ORTA 3FY0A 3QUDA 3ZUUA 5HI2A 5AUZA 4JDJA 3TWJA 3SLSA 1PKDA 4C4JA 4KSPA 5CX9A 4ZEGA 3A7JA 4AW1A 3DS6A 3UO6A 4F9YA 3QKMA 2OIDA 3UZTA 4DEHA 1Q8ZA 4LMNA 1FINA 5EDRA 4F7LA 2KULA 1PF8A 4QNAA 2ONLC 3MFUA 2VO0A 3E93A 3D4QA 4QTBA 1Q5KA 3ZO1A 5IA2A 3CTJA 3E5AA 4MQ2A 2RFSA 5B0XA 3F61A 3RM7A 4ALVA 4IM3A 3VBVA 3EOCA 3ZMMA 4BCMA 4RG0A 2CLQA 5HE1A 4ZS4A 5FBOA 4NZWB 3COHA 3U9CA 3UO4A 4BCQA 4RLKA 4FV7A 4AP7A 5AP0A 2EUFB 1B38A 2X2MA 1OITA 4MXXA 4CZTA 4TL0A 4F4PA 2QHNA 3QF9A 2XK6A 3UVQA 3IG7A 3U6JA 4O7SA 3RK7A 1GIHA 1OBGA 4BCJA 4R3RA 3LJ2A 3FZRA 4FIGA 4B4LA 4L8MA 3WARA 2XBJA 5HBJA 4G1WA 4OR5A 4C2VA 4ZY4A 3CLYA 1W8CA 2XIYA 2ZV9A 4PL3A 4E5AX 4FIEA 4GFOA 1CSNA 3F2AA 4JR7A 2UZNA 5AMNA 2YDJA 2C5NA 5FUTA 4EKLA 3ZM4A 2UW4A 4S34A 3QD3A 4Y46A 3VRYA 3KKVA 1JLUE 5BMSA 3HV6A 3KRWA 4QMMA 5LVPA 4O81A 4FEXA 3DOGA 4KAOA 3TN8A 4BCNA 4P5QA 1WVYA 5I3RA 4O7TA 2HYYA 2J0IA 4U7ZA 3P23A 3CY2A 4ANNA 2J0MB 3NYXA 1OKVA 4A4OA 4OTFA 3UJGA 3BPRA 5H2UA 3JS2A 4DH5A 3Q4CA 5A6NA 3S0OA 2OK1A 5AIKA 3KRLA 4FSNA 5AP5A 5ETFA 3SD0A 4C34A 4QMUA 2VWZA 1H1RA 4V05A 3R30A 5AFVA 2XK3A 1Q8YA 2C1BA 3UYTA 2WU6A 5CZIA 2YZAA 4D9TA 2C6MA 3D83A 3FHIA 5IEXA 2V5QA 1LUFA 3PRFA 4GCJA 3LFCA 4FTOA 4CFXA 4JBOA 4C8BA 4O83A 2C1AA 2BTRA 5CEKA 3MVJA 2JDOA 5E8YA 4FTRA 4ZOGA 4PRJA 3ULIA 3RAHA 4Y8DA 3CGFA 4IJ9A 4TYGA 4AXAA 2O2UA 4MXYA 3QTSA 3FMKA 4ANSA 3WYXA 2WMQA 1P4FA 3FLSA 5EKNA 4HCUA 3IGOA 4BTKA 2Z2WA 4UN0C 2PZPA 2XM9A 3DFCB 3RZBA 3F5UA 1PY5A 2E9UA 5HU3A 2YCRA 4ZY6A 4WD5A 3V8SA 5BYYA 4UZHA 4YBJA 3OCTA 4FL1A 5FDXA 1JSUA 4NUSA 3FI8A 3RPYA 3JY0A 3BWFA 3NPCA 3TUBA 5HQ0A 2X81A 3ORZA 2UZUE 3I79A 3A7GA 2QOIA 5EDQA 5HE2A 3TZ7A 3TZMA 5M06A 2XJ0A 1OL1A 3PG3A 5IPJA 4RRVA 2HENA 3OZ6A 3FMDA 4JG7A 4GT5A 4Y95A 5KHWA 5AV3A 5AP4A 4K2RA 3F6XA 3BZ3A 4UV0A 3HMNA 4EQMA 2GTNA 4CG9A 3CC6A 4QMSA 5EW9A 3PIYA 4O82A 1ZOHA 2B1PA 4F08A 2OO8X 4E73A 2OJ9A 2BDJA 4GFMA 4JLCA 4BDBA 5L2TA 5M09A 2OZOA 3Q52A 3TEIA 4U41A 5HKMA 4QTEA 3KXMA 4IAKA 4RZVA 2WU7A 4TNDA 3MY1A 3QD2B 5FP6A 3QCXA 4K33A 4DLJA 4F7SA 3CGOA 1Q99A 4AT4A 2DYLA 5HX6A 3ZFYA 1B6CB 5KZIA 3JUHA 3TZ8A 3V01A 4I22A 4MF1A 3NX8A 5L8LA 1JKSA 1KOBA 3T9IA 2XIKA 4MX9A 2FUMA 3FEGA 4YJRA 4RA4A 3VW8A 1IASA 5EM6A 3SG8A 4H1MA 2EXEA 4NSTA 3CIKA 5IMXA 2P3GX 5CNNA 4IB5A 1M2PA 4R3PA 5AR2A 5LWMA 3HMMA 4C59A 2VWBA 2OI4X 3P4KA 4RFZA 5FLFA 4BBEA 3TKHA 5CEMA 1F5QA 3NUYA 5ANGA 5EW8A 4E7WA 1YWRA 3Q9WA 2GHMA 2C6TA 4HYSA 5H9BA 2O3PA 3C51A 1PXJA 4QQCA 2QLUA 4MD9E 4ANQA 2PYWA 3WZDA 3BEGA 2QOOA 3ETAA 2O64A 3NYNA 4FTQA 4BHZA 4F70A 3OMVA 2ITOA 2CSNA 2A19B 1UNGA 3CQEA 3PTGA 4IB0A 3NUUA 2QU6A 4I20A 2VTRA 4CKRA 2BZJA 5HICA 5F4NA 4GVJA 3RNYA 2YCFA 4JL9A 3MIAA 5FG8A 3DKCA 3V8TA 3R83A 4RJ8A 4EL9A 5AADA 3UP7A 2H6DA 3HVCA 4F9BA 3R71A 3P7BA 3FKLA 1PYXA 1Z5MA 2P55A 3W32A 3DB8A 2CN8A 4AA0A 4TYHB 3F5XA 4E4LA 5LXMA 3N4VA 4YSMA 2IJMA 2VNYA 2QHMA 3UZRA 4PP9A 2BR1A 2W5HA 2QONA 2WMBA 2UZEA 3IK3A 2ETKA 2P2HA 3PIXA 3POOA 4JT3A 3S4QA 5JFWA 4DG0E 4CMUA 4G5JA 2B9JA 4IVBA 3BV3A 5IMEA 3FI2A 4Z16A 4FV1A 4XH6A 2XCHA 2YN8A 4PDPA 4PPCA 1YDTE 4IX6A 5TE0A 4ASXA 3JYAA 5CAQA 2QOCA 2X7GA 3EQPA 3P0MA 3R00A 4YSJA 4ACHA 2XH5A 5EYMA 1ERKA 3H3CA 3CP9A 4OTIA 5FRIA 3WF8A 2J2IB 4J98A 2JLDA 4M0ZA 4U97A 3R7VA 3UIMA 4KIPA 3VUKA 2HZNA 4CRSA 4N6ZA 5DFPA 3MPMA 1P14A 4AW2A 1OI9A 4EK5A 2ZDUA 4O7VA 5HNIX 2E9OA 3O7LB 3SOCA 5ITAA 3COIA 3L9LA 4DFZE 4AFEA 4AGCA 4F1MA 1KOAA 3DTCA 4FX3A 2PZYA 4S2ZA 3SKCA 2UW8A 3R2YA 2HW6A 5L6WL 1CKPA 3RBWA 5K0XA 2WD1A 3EWHA 3VIDA 2QR7A 4RVKA 3KGAA 4I93A 5CQUA 4D5KA 4DGGA 3SHEA 4AZWA 4FTIA 4RBLA 4BF2A 2Z7LA 4ITIA 3SQQA 4EOLA 5HU9A 3HDMA 4Q2AA 5E4HA 1R3CA 5BVWA 1UU8A 4HVHA 2BIYA 3RM6A 1U5RA 4AZEA 4BCGA 4EORA 3T9TA 2B9IA 3V6SA 3PJ2A 2UZWE 3GUBA 4QMWA 3A8WA 2R3HA 1JWHA 5C26A 2VWWA 1Q62A 3CR0A 4APPA 2UZOA 3GU4A 4GK3A 2HZ4A 4DC2A 1Y8GA 4Q9ZA 1ZMVA 3ACJA 5ICPA 1QCFA 2YIQA 4NU1A 3QA8A 2P33A 5A46A 3OEZA 2XM8A 4P2KA 1V0BA 2CNUA 1GY3A 2I0EA 3NUAA 4FV6A 2HELA 3FDNA 4AQCA 2G2HA 3W8QA 4FKIA 3GC0A 4W9XA 2YIWA 2GPHA 4IACA 3F5PA 1H25A 4O27B 3F2RA 2UW3A 5LARA 4IWDA 4BBMA 2BAJA 3EFWA 3Q32A 4QMPA 4UMQA 3PWDA 5DWRA 1GZOA 4ERKA 3PE1A 1SMHA 5BUJA 5M51A 3EHAA 4FIJA 2FYSA 3VF8A 4MBLA 4MXOA 4JBPA 3KULB 5EYDA 3KXHA 2J4ZA 4I6BA 5LVOA 3NVMB 3SV0A 4PF4A 2JFMA 4MHAA 4XBRA 1MRYA 3C4ZA 4AUAA 2ETMA 3FQHA 2QG7A 4OTWA 4FR4A 4ALUA 5AR8A 3DKFA 3WE8A 1LR4A 5KMLA 5KMIA 2OFUA 5HBHA 4K9YA 3QYWA 4KRDA 3O17A 5H8BA 5J9ZA 2CKOA 5KX8A 4A9YA 2JEDA 4GYIA 2IZSA 5I3OA 2WTWA 5FEQA 5KMMA 4YZ9A 4BYIA 2R3QA 3HMPA 3NUNA 4QP9A 2GS6A 5KNJA 1CKIA 1H24A 4PDOA 2J5FA 3NS9A 3AMYA 3NZ0A 3O50A 4RIXB 4XV2A 2Y8OA 4OTPA 2C5XA 2R3IA 2W1EA 4NKSA 3EJ1A 5I5ZA 2B53A 3LW0A 4I24A 5FEDA 5D41A 3BHUA 5HNGA 2ITWA 4YGAA 3VULA 3BU6A 3IW6A 2VN9A 4BI1A 2OJGA 4O7YA 3EZVA 1CDKA 1KE5A 4FT5A 3GU5A 2WHBA 4WNOA 3W2OA 5EFQA 2Z7SA 1FVVA 4RC2A 1T45A 4GRBA 4IVAA 3ZEWA 4D5HA 3OD6X 4UMTA 3M2WA 1WVWA 2O65A 4BTMA 4GJ3A 4AW5A 4LRJA 3AC8A 3DTWA 4WBOA 4FSRA 4E3CA 3W2QA 1PKGA 1WFCA 4FSYA 4OTDA 4J99A 3C1XA 3VS3A 2W4OA 3IW7A 5D9HA 3NUXA 4M69B 5A4TA 3R9NA 4YURA 1AGWA 2Y4IC 3A4PA 4IDTA 3UC3A 4HCTA 4W4WA 4L43A 2I7QA 3F3VA 2WTVA 4MBIA 1M7NA 2UVYA 2XK9A 3MYGA 4H3QA 4TXCA 1YOMA 3QCYA 5AV1A 4EYMA 3L8XA 4BIEA 2X9EA 3IKAA 4KKGA 4JIKA 3CKWA 3LAUA 2H8HA 3QWJA 4P7EA 4ACGA 4FL3A 4WSQA 4BGQA 4GVAA 3ZHPC 3U6IA 2PY3A 3HLLA 4ITJA 4Y5QA 4AOTA 4ZLOA 2V62A 3OWPA 3AC4A 4EOOA 4JNWA 3HGKA 3VN9A 3UMXA 4YU2A 5FEEA 4ZY5A 5E8XA 4QP4A 4YHFA 2PULA 3O0GA 2YAKA 3FMLA 3M11A 2VTIA 1JQHA 2JITA 3R9RA 4AAAA 4FF8A 3PY1A 3OOGA 4BFMA 2PWLA 3HV7A 3HAVA 2BRBA 2YJRA 4MBJA 5J8IA 3EIDA 1L3RE 5HBEA 4NH1A 2EU9A 3FZPA 2XK4A 3WF9A 3G9LX 4L3PA 4C35A 4FEUA 2B7AA 2HOGA 5BVEA 2PUUA 2WQNA 3QRKA 3DQXA 4BC6A 4XV3A 2GFCA 3EMGA 2OF4A 1UKHA 2Z60A 4RIYA 2Z8CA 2QU5A 4XUFA 2Y7JA 2UW7A 3PJ1A 2UZBA 4FSTA 4E4NA 1IAJA 5AR5A 2QOLA 1EH4A 5KCVA 3PA5A 4EJ7A 1I44A 4FT7A 4U81A 3A4OX 4QP8A 4TYEA 3DXNA 2RKUA 2YABA 2JC6A 4RGJA 2VX0A 4NM0A 3C0IA 5EQYA 2X8EA 3O2MA 4WRGA 4O2ZA 4QP7A 4YZCA 3ODYX 3SW4A 3HA6A 3IO7A 4N4SA 3MPAA 5GJDA 2QC6A 5FP5A 4KIKB 5AP6A 3GXLA 4FV5A 4NFMA 3G15A 4J8NA 3R28A 2BROA 4ZTSA 4BN1A 5DEWA 3F3WA 4GU6A 4D0XA 3H0YA 4XG2A 1UKIA 4K77A 2OJFE 5ANJA 3ID6C 2E9PA 3BU5A 3C4EA 4G3GA 4YTFA 4EQUA 2PUNA 3LXKA 4G16A 4BY9E 3QQLA 3GENA 2FB8A 5CQWA 5E92A 3IW4A 1UU3A 4L42A 3FZ1A 5HCYA 4CFMA 3BHYA 3HV4A 4YZBA 4FV4A 4JR3A 3TDVA 2W1HA 4DYMA 2YJSA 2CMWA 2VTLA 3LE6A 5DEYA 4XEYA 3VUHA 4Y83A 3JXWA 5CU3A 3IOKA 3KFAA 2I40A 3Q9YA 4HVIA 2GNIA 5IDPA 1IAHA 4IB3A 3TL8A 3DAJA 4Y73A 1AD5A 2ZB1A 4KD1A 4CV8A 4EOJA 4TYJA 5LMKC 2UZTA 5EH0A 4QNYA 3OY1A 3BYVA 4WOVA 4L6QA 1MQBA 4XP3A 1ZXEA 2VGOA 3QTIA 1LPUA 5L8JA 2Y6OA 3I81A 3SDJA 3GP0A 5FDPA 5IEYA 3TM0A 3DZOA 3FI3A 4FKVA 1XH9A 3LQ3A 2B54A 3I4BA 4R1YA 3W8LA 2XIZA 3TACA 4JBQA 2W0JA 2JBPA 3G0FA 4ALWA 4A07A 2UW5A 2W05A 4E4MA 3FV8A 3LFBA 4M8TA 1NT2A 3EQCA 5F9EA 3DBFA 4O6LA 1KV1A 3IOPA 3QRTA 4HGLA 3FKOA 1OUKA 2WMUA 3ET7A 5KMNA 3LCDA 2RL5A 2Z7QA 3IS5A 2O0UA 2G2IA 1BKXA 3Q4ZA 3GU7A 3ZLSA 2HY81 3H30A 3Q6WA 5M4CA 3CCNA 3D7ZA 3TV6A 4PX6A 3R8MA 2ESMA 5J5SA 3IONA 4RWJA 3ANQA 5T6KA 3DLZA 5HTCA 4CZUA 1OIUA 3F9NA 3PVWA 2CKEA 4FIIA 4UMUA 2R2PA 4O7RA 4YHJA 4F9CA 5IA4A 2QKRA 4YNOA 1BI8A 2FO0A 3LCSA 3DT1A 5K4IA 4BDJA 3AC1A 2YLFA 1Q61A 3FAAA 2B9FA 3P1AA 4N57A 1O6YA 4BZNA 5IUHA 5CALA 4W8DA 2BPMA 3F3TA 2QD9A 3ZDIA 5AP2A 5CT0A 5B2MA 3S3IA 3FL5A 5D7VA 3LFDA 2XRUA 3FYJX 1MRVA 1ZLTA 4I5CA 3I5ZA 4YPDA 4ORKA 4N6YA 4MEDA 5BYZA 5E8VA 5HO8A 3OP5A 4HW7A 3WF5A 3UQGA 5CI6A 1DM2A 4TYIA 2DS1A 2OH0E 2OZAA 3CEKA 4D9UA 4FNXA 1A06A 3R01A 3LJ1A 1U5QA 2PVYA 3L8PA 4FODA 1IRKA 4FTTA 5JFXA 4PL5A 2BRNA 4V01A 2YISA 4X2NA 5ACKA 2QCSA 4CQEA 4EOMA 3HRCA 3RHKA 3VBXA 3QU0A 3UOHA 1VEBA 4C37A 1KV2A 2JD5A 2P4IA 4YC6A 4ZJIA 3LLAA 4FTLA 3TNWA 4FZDB 1I09A 2IW6A 1XWSA 5CSXA 4L45A 3B2TA 1QL6A 1ZYDA 2NO3A 5LCJA 2Q0NA 1RQQA 3TT0A 4XX9A 1XKKA 1GZ8A 4PMSA 4OTRA 1BL6A 1PMNA 1SNXA 4GT3A 2NP8A 5A4CA 2ITPA 2R0UA 2VTHA 4FTAA 2DUVA 1NVRA 3Q5ZA 4M97A 4XG8A 4XG7A 1Y8YA 4B0GA 1IEPA 4LL5A 5EQEA 3QBNA 4JVGA 2JKOA 3VQHA 3JR1A 4U45A 4FG9A 1UU9A 1UWHA 4QQTA 5HTIA 5HLWA 1WBSA 1ZOGA 3K5UA 3FKNA 3A7FA 5GJFA 2DQ7X 5KMKA 1YXXA 3BE9A 2HZIA 4X6QC 4H05A 2CNQA 1W7HA 5CXHA 3TIZA 2PVKA 1JOWB 4FEQA 4WKQA 3ZS5A 4OTQA 4M15A 4YNEA 3R21A 3TDWA 3NVKI 3EL7A 4A4XA 2XNGA 2UZVA 2WAJA 3R0TA 1H1SA 3C7QA 4HNIA 4YJNA 2OU7A 4F6UA 3HA8A 4HYIA 1BMKA 2QG5A 3MB6A 4YJPA 5HEZA 3RI1A 4C3RA 2WO6A 4NKAA 4EK8A 2W1GA 5HG9A 5FXQA 4GUBA 5G1XA 3OBJA 2W1ZA 5AAFA 3U9NA 2W1CA 3FY2A 4FIHA 4H3PA 4TZRA 4DT8A 4A9RA 3BIZA 3DLSA 2V55A 3MVHA 4DE4A 3R2BA 5E7RA 1ZZLA 4BZDA 3B8RA 3C9WA 2VO6A 5C03A 3FYKX 4LL0A 4PPAA 4RX9A 2VO3A 3NEWA 2GQSA 4FKJA 2XK8A 3I7CA 3AC5A 4ZXTA 2VU3A 3KQ7A 4LQMA 4DH8A 4E5BA 5A4LA 1BUHA 5D12A 2QNJA 4FVPA 4C4FA 5CWZA 5J1WA 1XQZA 3FLZA 4OW8A 5E91A 2QOFA 5DT3A 2F4JA 4FGBA 1H01A 5JMSA 5K0KA 4ID7A 3T3VA 2QO7A 4DFBA 1WBTA 2FH9A 4F9WA 3QD4A 3GB2A 2J0JA 3OG7A 4FKUA 4OBOA 4DEBA 3PVGA 4FKOA 4GUEA 4TWPA 5DRBA 2X6EA 1Q3DA 5J9YA 4JAIA 4KUJA 2YIRA 5DR9A 3MS9A 5HZNA 4Q5EA 3HV3A 4K18A 4OBQA 3RPVA 4YLLA 2EXMA 4RQKA 4JIAA 5DR2A 4HVSA 2IWIA 5DA3A 4PP7A 3AGMA 4QP1A 4W4YA 5C1QB 1BLXA 2XNNA 4L7FA 4U42A 3KREA 2C5VA 4F1OA 4C36A 2C0IA 3NIEA 1URCA 5I4NA 4RA5A 1W83A 1OB3A 4FTMA 4KKEA 3V5PA 5DPVA 3HRBA 4FT9A 3ZOSA 3KCFA 5L4QA 2ZV2A 3NLBA 2PTKA 5E1SA 4QMLA 3HUCA 3FZSA 3LFSA 4AX8A 5H8GA 1YVJA 5AP3A 4DBNA 3FC1X 3KVXA 3PJ8A 4I4FA 4NM3A 5TOZA 4QMVA 1R0EA 2PVRA 5KE0A 4BWKA 4CQGA 3UPZA 5DOSA 4PPBA 2Y4IB 4WG5A 3FMJA 4EQCA 4RVLA 4A9TA 4JXFA 5EOLA 3VS1A 5M4UA 1JNKA 2WKMA 2R0IA 3VO3A 5LVNA 3F3UA 4XV1A 3U6HA 2PUPA 3LXLA 5BVOA 2ITNA 4O91A 4U0IA 3ULZA 2YDKA 3K2LA 2PE2A 4I92A 1KSWA 3COMA 3VF9A 3HMOA 2CGVA 5CU0A 5HESA 3I0QA 3QCSA 4PMMA 5F94A 3ZBXA 4CFVA 2XZSA 3DJ5A 2EB2A 4LRMA 1NVQA 4JOAA 3OF0A 1QMZA 4FOCA 1O6LA 2XEZA 4NCTA 1OZ1A 3A99A 1PXPA 3DDPA 5DN3A 4TRLA 4CLIA 5JSMA 1VJYA 2FSMX 2VTSA 3ZM9A 4YUQA 5EG3A 4AA4A 4PNKA 4S33A 3DKGA 4IB1A 3TNHA 3HMIA 4EH4A 2RFNA 4L7SA 3D94A 3MSSA 4UALA 3W2PA 3ORNA 3LKMA 3FZTA 5CS6A 3E7VA 2C3KA 4FNWA 4CTBA 3NCZA 1PXOA 4CRLA 2PMLX 1OPJA 2QOKA 3GT8A 4R3CA 3P78A 3FSFA 3R7GA 4D0WA 4YMJA 2BZIB 2VTMA 2Y4PA 3UC4A 3WF6A 4NEUA 5CEQA 4HOKA 2FA2A 3GQIA 3WE4A 2CJMA 4BTFA 2C68A 3EQDA 5TKDA 4D4SA 5GIPE 3CXWA 2VWIA 3L1SA 3EN4A 2GFSA 3QQGA 5FQDC 4QMOA 3R1QA 5BQ0A 4IC7A 1TQMA 3PG1A 4FTUA 2OIBA 2X7FA 3PSDA 4J8MA 3KL8A 4DHFA 4DG2E 4YTIA 3UOLA 4KA3A 4FKQA 5B2LA 4S31A 4UEUA 2V0DA 3EN5A 3QYZA 5ANIA 3U87A 4R8QA 1XH7A 4B8MA 5CT7A 2IN6A 3CE3A 5AX9A 4WNPA 4UY9A 4G3EA 3UO5A 3S95A 5JH6A 2X1NA 2YIXA 5IUIA 2QOHA 4BICA 5CEIA 2ERKA 5JRQA 4OGRA 4AZTA 4FIFA 4RX8A 4MD8E 3NNUA 2WB8A 4CYIA 1GIJA 2FSOX 3BRBA 4M67A 2YM6A 4FYOA 3RALA 4LUDA 1YI4A 4FA2A 4HYUA 4RJ6A 1UU7A 2YM8A 5I9UA 1QPCA 3W18A 2B9HA 4DFLA 4WUAA 1GJOA 3MIYA 4IAAA 4BYJA 4YC3A 3CQWA 5DR6A 4PL4A 3UIBA 1ZZ2A 3QL8A 1YW2A 4BDFA 2J51A 4S30A 4FEVA 2YFXA 4H36A 3TKUA 3PA4A 3RHXA 4G5PA 5AR3A 3Q2MA 4ONAA 2IZRA 1YKRA 1XH4A 1Z57A 2XB7A 3O8TA 5JGBA 3R9DA 3R7EA 3AMBA 1PMUA 3BGZA 3REPA 3W2SA 2PZRA 4EK4A 3ZO4A 5H8EA 4C38A 4FKPA 1LEWA 1PMEA 4KSQA 4B7TA 3EQHA 3ZFMA 4C61A 4EWHA 3EQGA 3QWKA 2J5EA 4BI0A 5IU2A 4RIWB 1NXKA 5FBNC 3KCKA 2F7EE 4FK3A 1YQJA 2VWUA 4R5SA 5AUVA 2BZKB 4D2RA 3QZFA 4WNKA 1J3HA 4O0UA 5KHXA 3QC4A 2JIIA 3S1HA 1Y6BA 4J7BA 5EOBA 4ZTHA 2OGVA 3SW7A 2R5TA 2XBAA 4FKTA 4GV1A 4Q5HA 4YTCA 2O8YA 2ZM1A 4MWHA 4BDAA 2QURA 3EZRA 3H0ZA 3PJCA 4U40A 4XCUA 4EBWA 2WQMA 2VWVA 4AN9A 4ANLA 5KUPA 4EK3A 2XJ2A 4OAVB 4CT1A 3OEFX 4IBMA 5J87A 5C9CA 4LOPA 2BFYA 2OXYA 4RT7A 5IQDA 5LQFA 1V1KA 3PVBA 4CD0A 3SRVA 1OECA 2YAAA 2SRCA 4UBAA 4PTGA 3LM0A 3FZOA 3R9HA 2GSFA 3GC8A 5AR4A 5TF9A 3NR9A 5HORA 2WFYA 3MY5A 4FG8A 3VJOA 4HCVA 4IX5A 3ACKA 4DEIA 2G01A 3LFEA 1NW1A 2C6EA 3RMFA 4OTHA 1ZARA 4QYEA 3KXZA 4CMOA 3FSKA 3DAEA 4NL0A 1FQ1B 2J6MA 4FKGA 1OIQA 4EK6A 1O6KA 1OKZA 1U54B 4J95A 4ZTLA 4G31A 4R5YA 4FUXA 5KO1A 2XNEA 3QZIA 5E9EA 1WBPA 4CFWA 4MTAA 4ZSAA 1VYWA 4RX5A 5DVRA 3R7UA 3ZTXA 4LMUA 2AYPA 2UV2A 4XP2A 4KNBA 2O5KA 3LPBA 1OL5A 3MH3A 1H4LA 2VTQA 2WQBA 4I5PA 1SVEA 3EH9A 5E8UA 2PMOX 3G6HA 4JQ8A 5A9UA 2CGWA 4IH8A 4TW9A 2WXVA 2UUEA 3R1SA 1H1WA 4HGTA 3GOKA 4YJUA 2CPKE 2X9FA 2R3LA 1XH6A 3DKOA 4KWPA 3AT4A 2B0QA 4ZZOA 3KN5A 5M56A 1YXTA 3MGYA 4ZTQA 3OUKA 3NNXA 4RIOA 5KKRC 1OIRA 4AZFA 3PVUA 5ETIA 4LOQA 3FLYA 4V0GA 4DTBA 1SVGA 1WAKA 2R3PA 4GEOA 4UX9A 3U4UA 4XOYA 5AR7A 4UZDA 2JFLA 3PY3A 4FG7A 4ZAUA 4G3FA 3ROYA 2ITZA 4QD6A 4FV0A 4X2JA 4ZTRA 3F66A 3A7HA 3FUPA 3KY2A 3MV5A 4DAWA 5GJGA 4QO9A 3AT3A 4ZP5A 2A1AB 3QALE 3FC2A 5ANKA 4YTHA 5CEOA 4ZSLA 3QXOA 3GEQA 3PUPA 3OCBA 2YWVA 3MFSA 4IIRA 1M2RA 3Q5IA 2PVLA 4IZ7A 3GQLA 2ITXA 3D0EA 2XIRA 2H96A 3QRUA 4CTCA 5GZ8A 4PUZA 5DBXA 4FSQA 3RVGA 3BKBA 1NA7A 5JZJA 3OOMA 3UE4A 4TKSA 3VQUA 4BWPA 1WMKA 3R9OA 2B52A 3VS2A 4AU8A 4XP0A 4ZJJA 3WZEA 4WO5A 4AFJA 1YWVA 1JSVA 2VTOA 2WQOA 4DFYA 1F0QA 4NT4A 1F3MC 2VV9A 4BCPA 1JKKA 2RFDA 2Z02A 2W5BA 4C4EA 3R7IA 3HV5A 3EQIA 4XRLA 3ZLWA 5J79A 3NW5A 1FGIA 2BALA 2X0GA 3HUBA 5E8TA 4ARKA 5LCKA 3FXWA 3RPRA 3VHKA 4EH7A 5AUYA 5GIOE 3PWYA 3QQUA 4QPMA 2RG6A 4FVRA 3G9NA 2JDSA 4CVAA 4LUEA 3BEAA 2WTDA 3PRIA 3QTRA 4D2TA 1OL6A 3ELJA 3FPQA 3ZC6A 3QZGA 1YXSA 2ONLA 1W0XC 4IVCA 4LGGA 3IPHA 4ASZA 3E62A 1K3AA 2I0HA 2W06A 3TNIA 3A2CA 2WMAA 4NK9A 4G6LA 2GCDA 2WTCA 4C7TA 3I60A 3EQBA 5D10A 1IA8A 3BI6A 5HNBA 1URWA 3FJQE 5CANA 4RVMA 4L01A 3WF7A 1YDSE 1XH5A 2ZM4A 3LMGA 3E3PA 4JJRA 4MK0A 2R3FA 3MDYA 5CSVA 3MB7A 2C5YA 2RGPA 3ZSHA 2VWYA 2H9VA 1DAWA 2HW7A 3QQJA 2JGZA 4E6CA 4EHZA 4C3FA 3F82A 4NIFA 1P4OA 4YPSA 5IKWA 3SXFA 1FVTA 1ZOEA 3QHRA 2YWPA 5LWNA 4O22A 4FTCA 4I0RA 4LYNA 4ACDA 2G1TA 2JAVA 4NM5A 2WPAA 4OT6A 4Y85A 4DITA 4EYJA 5K4JA 2GDOA 3C0GA 2C69A 4O38A 3ZUTA 4D2PA 3ATSA 1ATPE 5CI7A 1W98A 3VS7A 1PXNA 2PVHA 4QYGA 4ASDA 3ZLYA 4KIOA 4ANOA 5J9LA 4F7NA 3H9FA 3N9XA 1YOJA 5CSHA 4C02A 2GNHA 3VS5A 4H3BA 5CF4A 5JRSA 3MA6A 3DJ6A 2F2CB 4RZWA 2OWBA 4EH5A 2XVDA 3D5UA 4UWYA 3ZBFA 2YCQA 4O84A 1RW8A 4E8AA 3L8SA 4FMQA 3KRXA 4U43A 5J1VA 3PPZA 2GS7A 2VRXA 3C50A 2PVFA 2CDZA 5M4FA 2BAKA 4KABA 4BKJA 1A9UA 4DGMA 1ZYJA 4EBVA 5C8KA 3BELA 3O8PA 2V22A 4IQ6A 2W9FB 3AQVA 4IM2A 4PQNA 4XLIA 3SC1A 3VS0A 3QTQA 4MNFA 4CKJA 4PV0A 3R1YA 2NNWB 4FV9A 3R8ZA 3TXOA 3FMHA 4GS6A 5M55A 4BCOA 1U54A 5K9IA 3PXZA 5ACBC 1KUTA 2RIOA 2FVDA 1YDRE 2PL0A 2IVTA 3EKNA 4QYYA 4AT3A 2PSQA 5CAOA 3R8VA 5LVMA 4RPVA 4AF3A 1PXLA 1W84A 3BHHA 2CLXA 5BMMA 4EHGA 1VR2A 2OW3A 5B2KA 5AV4A 3DAKA 3SG9A 2WMVA 3GCSA 4O86A 3SOAA 3TTIA 2YHVA 4PDSA 4GT4A 4FEWA 2XNOA 4O0RA 3OCSA 4FKLA 4YJVA 2IVUA 3KK8A 5DMZA 5IA3A 4UWCA 3BU3A 1ZY5A 2VTTA 4BRXA 5L6OA 3H9OA 4EH9A
chains in the Genus database with same CATH superfamily
4F6WA 2OJIA 3MH1A 4PWNA 2XF0A 4GFGA 4L67A 5EM8A 3PE2A 4DGNA 4NWMA 5HGIA 4AXCA 4QRCA 4R1VA 4UYAA 5CF8A 4DFUA 2IVSA 3MBLA 5FM3A 3K3IA 4PDYA 1G5SA 1SNUA 3GGFA 3VW6A 1JKLA 2ZMCA 4FZAB 3V6RA 3DK6A 3W1FA 2XKEA 4CCBA 5LMBA 4HYHA 4IWQA 1TKIA 4IX3A 1H00A 2WNTA 3BYUA 4WBBB 5CVGA 5FD2A 4AN2A 5E8WA 4D4YA 3TUDA 2EWAA 3QLGA 2GNLA 4YJSA 3SAYA 5CVHA 5CU6A 1OUYA 4H1JA 4M0YA 3QC9A 5H3QA 3A62A 3MESA 3BYOA 4F78A 4C0TA 4C57A 3FE3A 2YLEA 2RG5A 2ZDTA 2DWBA 3KVWA 2C6IA 2R3RA 3ORLA 2R3JA 3IQ7A 4TTHB 1XBBA 4C58A 1REKA 3F3ZA 1XH8A 4K8AA 4E4XA 4D2SA 5AA8A 4X3JA 2HK5A 3RAIA 2BIKB 3OT8A 3I6UA 3ITZA 3MA3A 1PJKA 3TZ9A 3ZU7A 2VD5A 4C62A 4F9AA 2YA9A 2BHEA 3PIZA 4DGLC 5DH3A 3F7ZA 3HEGA 3W2RA 4YBKA 3UVRA 2OJJA 3OTUA 5IH5A 4O2PA 3ZXTA 4KB8A 5EYCA 1R1WA 2VO7A 1PXMA 1YI3A 2I6LA 2OIQA 2GHGA 3VBQA 4EUUA 3UZPA 4DEAA 3NNVA 2C5OA 3Q4TA 3UPXA 3PY0A 4FRFA 4M14A 1E9HA 5GZ9A 3RCJA 3VRZA 4F64A 4ZZMA 2ZFYA 4DINA 4ZMEA 4QMTA 3UBDA 4G9RA 3UTOA 4KIQA 4YP8A 1BI7A 4GMYA 1YOLA 4YZNA 1TQPA 3TNQB 4BBFA 1SZMA 3I7BA 3O96A 4C4IA 4RWKA 1OBDA 3QQFA 2X8DA 1Q24A 5HX8A 4UXLA 3Q60A 4D1SA 2ETRA 4JX3A 4ZSEA 3OUNB 4K0YA 3KIOC 3G2FA 5HE0A 4BDHA 4LGDA 4BIDA 3TIYA 5D7AA 3IDBA 1RJBA 4NFNA 3U51A 4XV9A 3GCUA 1HOWA 1CMKE 4IDVA 4EC9A 1WZYA 3E88A 3KF4A 5AWMA 3FBVA 3BE2A 4YJQA 1LEZA 4OT5A 4QYHA 2BMCA 2J90A 5M08A 4M69A 3NCGA 2WMRA 3AMAA 3HP2A 3ODZX 4FV2A 3C4XA 1NVSA 4I5MA 2J9MA 3ZEPA 3ZO3A 4F63A 5BNJA 1J91A 4JQEA 2WMTA 1OKYA 3U54A 2IVVA 3F69A 5BPYA 3PXFA 1XBAA 1Q4LA 1XBCA 3DK3A 4YC8A 3UQCA 3C5IA 4J1RA 4IXPA 4X3FA 4MYGA 4RJ5A 3LFAA 5DT4A 4EHEA 4D4VA 1W2DA 4ASEA 2CKQA 2WMXA 4IAYA 4NW5A 2VTAA 3G33A 5JFSA 2BTSA 5M4IA 2WEVA 4TWCA 5GZAA 1OL7A 2C3JA 2OFVA 3QCQA 4LG4A 3CJFA 5JT2A 3BBTB 2OBJA 4EEVA 5JQ5A 4K6ZA 5EHOA 3OW4A 2NRUA 2YM3A 1ZRZA 2CHLA 2HWPA 4GIHA 4A7CA 4ERWA 4CG8A 2C0TA 4WIHA 1A48A 1OIYA 4RIYB 4RJ3A 1Y91A 4RWIA 3NNWA 4WT6A 1IA9A 2QODA 2Y9QA 3CJGA 3QX2A 1CTPE 4ZLZA 3LM5A 3BGPA 4FZ6A 4BDCA 5JGDA 3B2WA 4GH2A 1H1PA 1DS5A 3G0EA 4O6EA 4O0WA 4RC4A 5HOAA 4G6OA 1ZYSA 5G6VA 3DDQA 1LP4A 3G51A 3O7LD 3QKLA 5CAUA 2F7XE 5FTGA 3KMWA 5IQHA 2XNBA 5JZNA 4FSWA 5IG1A 3HRFA 1GZNA 4FTKA 4PY1A 5AV0A 4O7LA 3UG1A 4FTNA 2CCIA 3VNTA 4IANA 1KWPA 3NW7A 3I0OA 3E92A 2Q0BA 3P08A 4PTEA 1ZY4A 4F0GA 3FXXA 2JIVA 2QOBA 4TY1A 2A2AA 4ACMA 5L8KA 4BZOA 3HP5A 2XEYA 3KEXA 5L2SA 3PSCA 3LCTA 4FYNA 1GOLA 3GCQA 2I0YA 5K5XA 5M07A 2C30A 3VS4A 4NYEA 5A4QA 4XG4A 3BHTA 3I6WA 4EC8A 2QR8A 1TQIA 4ZK5A 3VJNA 1J1BA 4O0YA 3ZXZA 4WG4A 1WBWA 3AG9A 3A8XA 3DNDA 3FMEA 1YXVA 5ANEA 4DFNA 4KINA 3PYYA 1PXKA 3RNIA 5CF5A 5HVKA 3MTLA 2BCJA 4R77A 1T46A 5F1ZA 2OSCA 4QP2A 5TO8A 3FQSA 5J5TA 5CASA 3C0HA 4BI2A 2UW9A 4XOZA 2VZ6A 4J53A 3NAYA 1RDQE 3W0RA 5KKRB 3FXZA 1K9AA 3EFJA 2GMXA 4EJNA 1KE8A 3ZO2A 3DY7A 3RPOA 2R4BA 4W4VA 2NRYA 3TV4A 2V7AA 4FKRA 2F2UA 3AT2A 2F49A 5M57A 4DEGA 2W99B 2ZV7A 4HZSA 1OPLA 5C4KA 2A4LA 3MH0A 3QGWA 4MXCA 3Q3BA 1P5EA 4NTSA 3VC4A 3PLAE 2CN5A 3VVHA 4BVUA 4E93A 4IADA 3B8QA 3PDTA 4L52A 2OLCA 3LXNA 3NIZA 2VGPA 5HCXA 2YEXA 4M84A 4FNYA 2ITUA 2ZM3A 5BX0A 2C4GA 5EM7A 2OF2A 3R8UA 2WQEA 5DIAA 4RIXA 3EQRA 3LXPA 3GC9A 1E1XA 4FKSA 5KBQA 3R04A 4BGHA 4I6LA 4M68A 5HD4A 2XIXA 2XS0A 1FVRA 4G3DA 3AOXA 4Z7GA 4HPTE 3EFLA 3O71A 2BVAA 3QHWA 4L53A 4UXQA 3ZSGA 4AE9A 1L8TA 4KBCA 2R3GA 3BLAA 2W5AA 3ROCA 3FMNA 2ITQA 3NSZA 3HL7A 5CTPA 4QPAA 3UDZA 3UIUA 5CNOA 4JBVA 4BKYA 5JK3A 1SYKA 1ND4A 5K5NA 3CSVA 3Q9ZA 4PNIA 2O63A 3W33A 2PUIA 4P5ZA 3OTVA 5AUXA 5L2QA 3THBA 3BLQA 4MD7E 4FE2A 4GL9A 4HZRA 3GFWA 2IW8A 3L9NA 4PMPA 5HIDA 3ORXA 4FT0A 2XJ1A 1H0VA 2GNFA 4DTKA 2FGIA 4X2FA 2WEIA 3QFVA 5EHYA 4BTJA 3FHRA 3GFEA 4HGSA 5EI8A 1R39A 5IF1A 3UGCA 2WOTA 3FQEA 3Q04A 3PP0A 4G2FA 1P2AA 3CTQA 5DE2A 5AUUA 3ZCLA 4D1XA 3BV2A 1H07A 1E1VA 1WBNA 3RPSA 4AOIA 2XMYA 2HXQA 1YI6A 2WTJA 3SX9A 3ALNA 3Q96A 4A06A 2X0QA 1TVOA 3NWWA 1Q8TA 4AACA 4F65A 4MNEB 5IQEA 2ZOQA 3BL9A 5FGKA 3SRVB 4D2WA 3VS6A 3WZKA 3NUPA 5IDNA 2X4FA 3HZTA 4KS7A 5AP7A 2E9VA 1J7UA 3MW1A 5HLPA 3JVRA 3C5UA 2LAVA 3VONA 4EWQA 5AX3A 2C3IB 3QLFA 5HG5A 2Y0AA 1G3NA 4DA5A 1ZAOA 2RFEA 5HVJA 1M14A 2VX3A 4USDA 4EH8A 2Y6MA 4CGAA 1PXIA 4WA9A 4IM0A 4QMZA 4P4CA 5CAPA 5BVKA 3KRJA 1VZOA 3UOKA 2XKDA 3V5JA 4XLVA 4B8LA 4E1ZA 4E26A 4EHVA 5AP1A 4X3FB 1O9UA 1M52A 4MWIA 5EI6A 2X0PA 4RLLA 4IC8A 4W9WA 1QPDA 2RSVA 2H34A 2UW6A 2E2BA 4QDVA 1K2PA 4AGWA 3IDCA 4QPSA 5CENA 2ERZE 3PXRA 2CNVA 4BCKA 4ACCA 2C6OA 4O0TA 3UIXA 4UWBA 5I0BA 4HJOA 3QKKA 4RWLA 4CSVA 5IQCA 4OLIA 4C2WA 5HIBA 4MAOA 1CKJA 4EH2A 5IA1A 3MI9A 3DXQA 3KC3A 3R63A 4M13A 2XK7A 1OKWA 4M12A 4I23A 3DU8A 1YHWA 4JI9A 1ZMWA 3R8PA 2B55A 3JVSA 3QRJA 5A3XA 5ANDA 5DG5A 4GKIA 4JS8A 3V3VA 4EH3A 2PVJA 3BGQA 3MVLA 3RTPA 3OXZA 3BBWA 3VBTA 5AA9A 2BKKA 4CFUA 4FSZA 1OMWA 4GW8A 3DZQA 1FMOE 2XAOA 2JIUA 4YO6A 3H10A 2F57A 3BYMA 4WUNA 5J7BA 3UODA 3LOKA 1YRPA 1PW2A 2YIYA 2IW9A 2HWOA 4XG3A 4AW0A 1JVPP 2G9XA 4FL2A 2UZDA 2REIA 5E8SA 3PXQA 4DEDA 4NJ3A 4O0SA 5J95A 1PRYA 3O23A 4O4EA 1H26A 2UZLA 3L9MA 3FL4A 3EYHA 3QTZA 2XRWA 4X2KA 4USFA 2CKPA 4AS0A 4NM7A 5C01A 4O7ZA 3SXRA 5AUWA 4FSUA 4USEA 3I5NA 4FT3A 4CYJA 3S00A 4BR3A 5IQGA 4ZJVA 3ZC5A 4AZVA 4CKIA 4I0TA 3TJDA 3UG2A 4O4DA 3MJ2A 3TUCA 2HIWA 4QYFA 4N0SA 5HO7A 1Z9XA 1WBVA 1KE9A 4NW6A 5BVFA 3JY9A 1XMMA 5DLSA 4YJOA 3RK9A 3H9RA 4M3QA 2W7XA 3G90X 3QA0A 2WTKC 2AC5A 2WOUA 4GK4A 3KRRA 4GK2A 3WBLA 4D2VA 4EUTA 1UV5A 3KN6A 3EKKA 2YACA 5I9XA 4FVQA 4LRKA 1SVHA 4BWXA 2W9ZB 4I94A 4E6DA 3KXNA 4XRJA 2BDWA 2QLQA 3MH2A 1OVEA 5IA5A 5AAGA 4C3PA 2IO6A 3AXWA 4XMOA 2HY0A 1YXUA 3IDPA 3HNGA 5M44A 1H1QA 2ZAZA 4YLKA 1J1CA 2WIHA 4KBKA 4IFGA 1AQ1A 2GQRA 3DNEA 2C3LA 3V8WA 2BKZA 5BYLA 3BQRA 4U9AA 3D9VA 5DHJA 1FMKA 3C4WA 3PZHA 2ZYBA 1JBPE 1IR3A 4XS2A 4BDEA 2YM4A 4QT1A 5EDPA 3RP9A 5C4LA 1V0OA 1X8BA 4ZS0A 2ZV8A 2XP2A 4RX7A 3UDBA 1UNLA 5CVFA 4OTGA 3WIGA 5IH6A 5M53A 4JG6A 3CQUA 2VWXA 2QKWB 3DJ7A 4FKWA 5ETCA 4GYGA 5K3YA 4LFIA 3R8LA 1H0WA 2I1MA 4RFMA 5E90A 3RK5A 4GU9A 2YITA 1NY3A 3QQHA 4X6RA 3ORIA 5A6OA 3QTXA 4KRCA 4YHTA 4AGUA 4CNHA 1CM8A 5IQAA 5EKOA 5HTBA 3DB6A 4O21A 4W4XA 4XHKB 2QO2A 4I1ZA 3N4UA 4DHIB 2R3NA 1W82A 1U59A 2ZB0A 4GSBA 5JFVA 3COKA 4EOQA 4G3CA 1BL7A 5C27A 5KMJA 3E64A 4I6HA 3LQ5A 3QX4A 4YO4A 3KB7A 4G34A 2ITVA 4HNFA 4K11A 4IX4A 4O0VA 4X7QA 5F20A 2OICA 4G17A 4DF3A 1Q41A 3EYGA 3PLSA 4CFFA 3FI4A 4MXZA 3IGGA 4YLJA 1VYZA 2LGCA 4IJPA 4AE6A 3VBWA 2R7BA 2JDVA 3WI6A 3TNPC 4FOBA 4I5HA 4QP3A 5KBRA 2A27A 4S32A 4DG3E 2GNGA 4OBPA 4DLIA 2JKKA 1XMLA 3LIJA 5HG8A 1ZYCA 3JPVA 4ANMA 3UQFA 1JKTA 3GU6A 2WZJA 5DI1A 5DT0A 4AG8A 5JKGA 2VTPA 2WIPA 3A61A 3D5XA 4RJ4A 3RKBA 3MPTA 4F6SA 4CEGA 3QRIA 4FK6A 4EI4A 3W0QA 3LHJA 5HLNA 2X7OA 3FWQA 1M17A 4I21A 2W1DA 3E8EA 4NCTC 3M42A 4CLJA 4I4EA 5HHWA 4PMTA 4DTAA 3DK7A 3SXSA 4WG3A 4V0GB 3TKIA 4I6QA 5AAEA 3QAME 2C0OA 4FI1A 5CZHA 5L2IA 3O51A 3WOWA 3UOJA 2JDRA 4DH7A 3MY0A 1SM2A 2W17A 3F2NA 2C6LA 3NYOA 3OS3A 5E8ZA 3D15A 5EM5A 4A4LA 4ZMFA 3POZA 2WTIA 3ZONA 3ZYAA 4WSYA 2X39A 2PK9A 1PHKA 1H28A 4X2GA 2QI8A 3QZHA 4IAFA 1UA2A 4LOOA 5FXRA 4E6AA 3N51A 3LFNA 4IVDA 2BRHA 5T3QA 2PPQA 3BYSA 3OCGA 3TCPA 5L2WA 2F9GA 2PZ5A 3P9JA 3FMMA 4B6LA 3TTJA 4Z55A 1H8FA 3KXXA 2XUUA 2X6DA 1OGUA 4LV8A 4MKCA 3PZEA 4IE9A 1FOTA 3D14A 3Q53A 1STCE 3T8OA 4GG7A 1YWNA 4F0IA 5L6PA 4TWOA 4L9IA 5EYKA 4RVTA 3Q2JA 1IG1A 2X4ZA 2GS2A 5EK7A 4JAJA 5EHLA 4GIIA 4M7IA 2PMNX 4KBAA 4A9SA 5DYJA 1ZMUA 3DGKA 3CD8A 3Q6UA 4O0XA 4U3ZA 1J7LA 1BX6A 5HCZA 4R78A 4EOKA 2GU8A 5J7HA 3ANRA 3MVMA 4FC0A 2X2KA 5IEVA 5JGAA 4EOSA 4LGHA 1S9JA 2P2IA 2YCSA 2YM5A 4MVFA 1U46A 4RJ7A 3FPMA 4DBXA 2AUHA 3KK9A 4E6QA 1OPKA 1YHSA 4YR8A 3GOPA 3OBGA 4QTAA 2E9NA 5F95A 3AC3A 3E8DA 2JKMA 3EN6A 4BCHA 4J52A 5HG7A 4JDHA 4B9DA 5DGZA 2WELA 5CEPA 3IW8A 3EFKA 5ANOA 4MCVA 2XCKA 3AGLA 4IW0A 5LMKA 2W1IA 1WBOA 3OY3A 3DV3A 3ZRLA 4AA5A 4EZ7A 3I1AA 4EONA 3OWKA 3P79A 2G15A 4HPUE 4QQ5A 3T3UA 5BUIA 3SA0A 3CBLA 5DRDA 2JKQA 2R7IA 3LCOA 4HVDA 5C8MA 3ZUVA 2VUWA 2A0CX 4XBUA 4FTJA 5CXZA 2ITYA 1Q3WA 1R0PA 3LFQA 4TN6A 3BQCA 2QO9A 3HECA 4O7WA 4BB4A 2PE1A 2RF9A 3Q4UA 2PZIA 5AJQA 4DH3A 4D4RA 5IQBA 3G6GA 2BRGA 2I0VA 3CTHA 1XJDA 3OROA 4D55A 2HXLA 2R3OA 2ZVAA 3EN9A 3WZUA 4CZYB 5B7VA 3W0PA 2OG8A 4U8ZA 3OXIA 3ZRMA 3BLRA 2AC3A 1M2QA 4R7HA 3KF7A 1G8SA 4UMPA 4IWPA 4O96A 4O7NA 4FICA 2X2LA 2GQGA 3OXTA 4DH1A 3V5QA 3LMIA 4Q9SA 3A7IA 3P7AA 4MF0A 3E3BX 3ORPA 1HCKA 2GTMA 1BYGA 2OXXA 3UNJA 2GNJA 4WNMA 3E8CA 4EH6A 2ZMDA 5A54A 4TNBA 2PE0A 3NUSA 4I41A 3DBCA 4L46A 4U5JA 4F09A 5D11A 4AZSA 3UVPA 3IECA 5CU2A 4X3FC 5CYIA 1ZYLA 5LVLA 2HCKA 3VUTA 4TWNA 4QMXA 3WIKA 2V7OA 3GCVA 3F88A 4X21A 2UVZA 2BDFA 4D58A 5L3AA 3D2KA 5TR6A 3HAMA 2UVXA 3DFAA 4IFCA 4PTCA 4DFXE 4ENYA 4HVGA 3HX4A 3E63A 4BCIA 4AGDA 4JRVA 5FTOA 3K54A 4M66A 4JDKA 4XG9A 2YDIA 4YJTA 1DI9A 3FLWA 3F7WA 4L68A 3QXPA 3GCPA 4CFNA 5JQ8A 5EI2A 5IH4A 3L8VA 4ZLYA 5ETAA 1WCCA 4RIWA 4BIBA 4JG8A 3E7OA 4ZTMA 1J7IA 3AD4A 2Q83A 2Z7RA 2FSLX 5GHVA 3CD3A 4L44A 4RC3A 2BZHB 3D5VA 3ORKA 4JQ7A 5E1EA 4O1OA 2JBOA 3V5LA 3GU8A 1UVRA 3AD6A 3ZSIA 5IUGA 2BRMA 2XYUA 4WRSA 2PU8A 2BHHA 1OL2A 4J97A 3AC2A 2J7TA 4IEBA 5AM7A 3P5KA 5D1JA 5FM2A 3DQWA 3W16A 4G6NA 3N4TA 5IQIA 1H27A 1PYEA 4H39A 5I9ZA 3QGYA 3PPKA 4UYNA 3LLTA 4QQJA 5CU4A 3DBEA 3OFMA 4O1PA 4E5WA 5CAVA 5CF6A 4U3YA 2CGXA 3H4JA 3GBZA 2R3MA 1UWJA 4RMZA 3RAWA 3U4WA 3UNZA 3A60A 4G9CA 5T68A 2VTJA 4MH7A 3RINA 3WZJA 4AWIA 4DCEA 3HDNA 3R7OA 4I3ZA 4II5A 3UNKA 4FNZA 4XYFA 5BVNA 3O5AA 4GG5A 5FTQA 5EW3A 1Y57A 3SGCA 3DBQA 3QUEA 2IPXA 1KE7A 3D7TA 4Y5HA 5HVYA 4F7JA 5BVDA 3KMUA 3BLHA 3KXGA 1XO2B 3W55A 3NAXA 4FV8A 4CMTA 1M7QA 3L9PA 3PA3A 2HZ0A 2FSTX 5KMOA 4LV7A 2EVAA 4ANBA 3S2PA 2WMWA 2QQ7A 3C13A 3VBYA 2UW0A 3RAKA 2IZUA 3RGFA 4K1BA 4KS8A 5AIRA 3VUGA 2WTKB 3BWJA 4OUCA 4P90A 3TYKA 1ZWSA 4CCUA 4H58A 4GJ2A 3PXYA 3QUPA 5FWKK 3PSBA 5LOHA 4F1TA 3ENHA 3LQ8A 4MQ1A 4J96A 3TV7A 4BDGA 4FBXA 4UMRA 2ITTA 3CPBA 3QD0A 2CCHA 4IAIA 4MXAA 4LM5A 5GNKA 2G2FA 4BKZA 3VUIA 1RE8A 4IHPA 3MFRA 4BDKA 5JEBA 3ZZEA 2JDTA 5IZFA 2VNWA 3W10A 4BDDA 1FGKA 4L3JA 3DA6A 4Z7HA 3R73A 3HKOA 1HCLA 3RCDA 4FUYA 3V51A 4C33A 3W2CA 1MP8A 1GIIA 1UNHA 1XHAA 4XJ0A 1FBNA 1G8AA 1S9IA 4LI5A 4BL1A 3VAPA 2NPQA 4BDIA 4GKHA 4FZFB 3MFTA 3OWJA 2EXCX 4R6VA 4AOJA 4JX7A 2CGUA 2WMSA 3FLNC 4ITHA 3CKXA 5JN2A 2GHLA 2XA4A 3G5DA 3NDMA 4EZ3A 3GI3A 3CY3A 4R7BA 2R9SA 4KKHA 4Y72A 4NJDA 4DCAA 2C6DA 2XKFA 2IG7A 1GZKA 5GINE 3WYYA 4U80A 3TJCA 4QTDA 4QMNA 1WVXA 4W8EA 3SVVA 4MNEA 4YZMA 4BCFA 3LFFA 1U4DA 3EN7A 4FSMA 4DN5A 3OWLA 4EKKA 5A14A 4C4GA 3ENMA 4Z3VA 2BUJA 1B39A 1Q8WA 4RQVA 4FGRA 1Y6AA 3R7YA 2VTNA 4OAUC 5HIEA 3DBDA 1QPJA 3OW3A 4U6RA 3VWAA 2VAGA 3MWUA 2J50A 4IZ5A 4AT5A 2ZJWA 5HO6A 2IZTA 3DXPA 2YERA 3KULA 2QVSE 4B99A 2C47A 1V0PA 3PPJA 3BHVA 1XR1A 4R7IA 3TG1A 1MRUA 3PP1A 5AV2A 2R3KA 2B4SB 3II5A 3F5GA 4J71A 4U79A 4D28A 3LZBA 3R6XA 4Z9LA 3OC1A 3GC7A 5A4EA 5EQPA 4IZYA 3BCEA 2R64A 3R1NA 3RZFA 3U8WA 3P86A 3R22A 3QQKA 2BILB 3ZZWA 3KMMA 3KU2A 2X0OA 4AXDA 2VX1A 3C4FA 3RJCA 1OM1A 3CS9A 2PMIA 4IWOA 3ZDUA 4APCA 5I9VA 1QPEA 3ATTA 1APME 2XARA 5AM6A 5HE3A 4QP6A 5CLPA 3TI1A 3K5VA 4NTTA 4CXAA 5LJJA 3U55A 3OVVA 4EZ5A 2F7ZE 4EOIA 3PFQA 3NYVA 2J0LA 3OHTA 2KTYA 4NIFB 2OZAB 3NW6A 1H08A 5TT7A 4ZSJA 2OH4A 2XNPA 3MTFA 4ZZNA 3IW5A 3UP2A 4TYHA 3LJ0A 4WHZA 3NRMA 3K3JA 2BFXA 4TT7A 2JAMA 5AUTA 2PVMA 2OKRA 3MN3A 1GNGA 4IAZA 3GVUA 3VUMA 4QMQA 1PMVA 4XG6A 3CPCA 3Q9XA 4IZAA 3UMWA 5AEPA 3PUFC 1Q97A 4BGGA 4D1ZA 1MQ4A 3E8NA 2W4KA 4HGEA 4YZDA 3UYSA 2W1FA 4TPTA 4DT9A 4I0SA 4N70A 5CY3A 1KE6A 4QTCA 4ZSGA 2QOQA 4C4HA 3V5WA 3EL8A 4F0FA 5LMAA 3C4CA 4FV3A 4UB7A 2PHKA 4DHZA 5IA0A 4QOXA 2C6KA 1W2FA 3ZRKA 2BAQA 2W96B 3QTUA 3WILA 5CSPA 3EQFA 4ENXA 4X0MA 4DEEA 3FLQA 3MJ1A 4FZ7A 3E87A 3HYHA 2OXDA 4LV5A 5FXSA 4ZIMA 1Q8UA 4U44A 2XNMA 4QMYA 3ERKA 4CV9A 1DI8A 3ORMA 1FPUA 5C8NA 1G8KA 1JPAA 4KIKA 4E20A 3PJ3A 1DAYA 5KZ0A 3AD5A 3D7TB 3D5WA 2PVNA 3LCKA 3DCVA 3M1SA 1YHVA 1R78A 3RWQA 3VHEA 3NGAA 3VUDA 5IQFA 2X8IA 3ZH8A 3V5TA 5IISA 5HD7A 5BUEA 2J0KA 1GAGA 2YM7A 4V04A 3R02A 5DNRA 4L3LA 4AN3A 4ZTNA 3D2IA 3PXKA 4RSSA 3DPKA 3RWPA 5I9WA 1REJA 5I9YA 3QTWA 3BX5A 3P7CA 3O8UA 4A9UA 4BHNA 4JRNA 2XKCA 4L00A 3EB0A 3V04A 1JAMA 2YZLA 2W4JA 3GNIB 3ALOA 4F99A 2WGJA 4IMYA 1MUOA 2XYNA 3KA0A 4CT2A 3LMHA 3ZFXA 3OT3A 5CSWA 4EOPA 2ACXA 4XNEA 4JDIA 2HAKA 4RFYA 4I6FA 2EB3A 3LVPA 1JSTA 3ZLXA 3NMUF 4DGOA 3AKKA 2P0CA 3ORTA 3FY0A 3QUDA 3ZUUA 5HI2A 5AUZA 4JDJA 3TWJA 3SLSA 1PKDA 4C4JA 4KSPA 5CX9A 4ZEGA 3A7JA 4AW1A 3DS6A 3UO6A 4F9YA 3QKMA 2OIDA 3UZTA 4DEHA 1Q8ZA 4LMNA 1FINA 5EDRA 4F7LA 2KULA 1PF8A 4QNAA 2ONLC 3MFUA 2VO0A 3E93A 3D4QA 4QTBA 1Q5KA 3ZO1A 5IA2A 3CTJA 3E5AA 4MQ2A 2RFSA 5B0XA 3F61A 3RM7A 4ALVA 4IM3A 3VBVA 3EOCA 3ZMMA 4BCMA 4RG0A 2CLQA 5HE1A 4ZS4A 5FBOA 4AXEA 4NZWB 3COHA 3U9CA 3UO4A 4BCQA 4RLKA 4FV7A 4AP7A 5AP0A 2EUFB 1B38A 2X2MA 1OITA 4MXXA 4CZTA 4TL0A 4F4PA 2QHNA 3QF9A 2XK6A 3UVQA 3IG7A 3U6JA 4O7SA 3RK7A 1GIHA 1OBGA 4BCJA 4R3RA 3LJ2A 3FZRA 4FIGA 4B4LA 4L8MA 3WARA 2XBJA 5HBJA 4G1WA 4OR5A 4C2VA 4ZY4A 3CLYA 1W8CA 2XIYA 2ZV9A 4PL3A 4E5AX 4FIEA 4GFOA 1CSNA 3F2AA 4JR7A 2UZNA 5AMNA 2YDJA 2C5NA 5FUTA 4EKLA 3ZM4A 2UW4A 4S34A 3QD3A 4Y46A 3VRYA 3KKVA 1JLUE 5BMSA 3HV6A 3KRWA 4QMMA 5LVPA 4O81A 4FEXA 3DOGA 4KAOA 3TN8A 4BCNA 4P5QA 1WVYA 5I3RA 4O7TA 2HYYA 2J0IA 4U7ZA 3P23A 3CY2A 4ANNA 2J0MB 3NYXA 1OKVA 4A4OA 4OTFA 3UJGA 3BPRA 5H2UA 3JS2A 4DH5A 3Q4CA 5A6NA 3S0OA 2OK1A 5AIKA 3KRLA 4FSNA 5AP5A 5ETFA 3SD0A 4C34A 3BL7A 4QMUA 2VWZA 1H1RA 4V05A 3R30A 5AFVA 2XK3A 1Q8YA 2C1BA 3UYTA 2WU6A 5CZIA 2YZAA 4D9TA 2C6MA 3D83A 3FHIA 5IEXA 2V5QA 1LUFA 3PRFA 4GCJA 3LFCA 4FTOA 4CFXA 4JBOA 4C8BA 4O83A 2C1AA 2BTRA 5CEKA 3MVJA 2JDOA 5E8YA 4FTRA 4ZOGA 4PRJA 3ULIA 3RAHA 4Y8DA 3W0MA 3CGFA 4IJ9A 4TYGA 4AXAA 2O2UA 4MXYA 3QTSA 3FMKA 4ANSA 3WYXA 2WMQA 1P4FA 3FLSA 5EKNA 4HCUA 4QEBA 3IGOA 4BTKA 2Z2WA 4UN0C 2PZPA 2XM9A 3DFCB 3RZBA 3F5UA 1PY5A 2E9UA 5HU3A 2YCRA 4ZY6A 4WD5A 3V8SA 5BYYA 4UZHA 4YBJA