4C58A

Structure of gak kinase in complex with nanobody (nbgak_4)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
307
structure length
267
Chain Sequence
DFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEKYSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cyclin-G-associated kinase
publication title Structure of cyclin G-associated kinase (GAK) trapped in different conformations using nanobodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 267
sequence length 307
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c58A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c58A01
4BRXA 3O8TA 5EYKA 5EOLA 3PLSA 2XNOA 2OFVA 3PUPA 3DBDA 2OU7A 3OY1A 2ZDTA 4GIIA 3R2BA 2GPHA 3QXPA 4NIFB 4XJ0A 5TKDA 4EOIA 5BPYA 3T3UA 5AV4A 4BIEA 3BWJA 2R3FA 1H1RA 2YAKA 4I6FA 3W33A 4EH9A 4H05A 4ZS4A 5K5NA 4EH6A 3Q53A 3R00A 2VNYA 3EKKA 3TIZA 4EZ5A 1MRYA 4PWNA 4AA4A 1W7HA 3ANRA 2OXXA 2EB2A 3OTVA 5FG8A 4AW1A 2IVTA 3R21A 3IDPA 4P5QA 4YZBA 4E6QA 4E26A 2YITA 4TL0A 4HYIA 1UNHA 5G6VA 5J7BA 4YTIA 4ENXA 4E4XA 4IJPA 4U40A 4BHNA 2HW7A 3EQPA 5I9XA 3TM0A 2C5YA 4FV3A 2IVVA 4JRNA 4PMMA 4RJ5A 5EH0A 3VWAA 4AZSA 5KMMA 4CYIA 4U97A 4KKHA 4FX3A 5GJFA 5KZ0A 5J5SA 5LXMA 2OZAA 2C3JA 3KRRA 4MCVA 4RSSA 2JIIA 2GNHA 2SRCA 3BI6A 3NCZA 4C4FA 2Q0BA 1BLXA 3D2KA 5KMJA 2C6TA 2VWYA 3C0HA 2HWPA 4APCA 3BZ3A 2YIXA 2XF0A 4D2VA 1F0QA 3L9LA 4CKIA 2YCQA 1H1WA 2GNJA 4R8QA 4G6NA 4XLIA 4RZVA 4UXQA 5M07A 4ASXA 3VS1A 3F3ZA 3R71A 1M2RA 2NP8A 4I6BA 3GCSA 4RIXA 2Z7LA 1I09A 3R7VA 5T68A 4X2NA 2HZ4A 5DE2A 5E9EA 3N4VA 3DQWA 4O7LA 4BCKA 3POZA 1YKRA 3BGZA 5E8VA 3D5WA 3ZEPA 1Z9XA 3NNWA 2GMXA 4V0GA 1EH4A 2V22A 3BPRA 2ITWA 2UZWE 2CN5A 1R1WA 3RPYA 5JH6A 2CKQA 2QLUA 2A0CX 2X81A 5LCJA 4KSPA 4EC8A 5A9UA 2F7EE 2CKEA 5K4JA 3UOLA 1STCE 3EN7A 1H4LA 1H08A 1B6CB 4D2WA 1IA8A 4XBRA 1U54A 4AW2A 3LAUA 1XH9A 2G9XA 5KCVA 2VWIA 1J1CA 4QMPA 3F5UA 3ZRKA 4C36A 1Q3DA 4ZMEA 4FTIA 3PRIA 3V8WA 5AP7A 4ACCA 2F57A 5HVYA 4IB1A 5EKOA 4A9YA 2JDOA 2YA9A 4MVFA 4MYGA 3Q3BA 4UYAA 4D5HA 3OW3A 4B8MA 3M42A 2H9VA 3ZSIA 2UZOA 3GCUA 3KU2A 3A7JA 4I93A 4F1MA 1JKKA 2PPQA 2J9MA 3BV3A 3OT3A 4FSZA 4MNEA 5DLSA 5L6WL 3KXHA 4X2JA 2C69A 1GJOA 3R7OA 4LRJA 2PVHA 2YDKA 2P2HA 3FMJA 1U59A 5KBQA 1DAYA 3GU8A 5A6NA 1FGKA 3NUYA 3OOGA 4FEQA 4YLJA 3I0QA 5TO8A 4DBNA 3QLFA 3V51A 4QQCA 3PXKA 3QQLA 2BFXA 1Q62A 2IVSA 2WGJA 4YJUA 5H2UA 5HBEA 1MRVA 3H4JA 1H0WA 4R7BA 2CPKE 3AT4A 3CPCA 4JI9A 5I0BA 3OBJA 3G6GA 3MJ1A 3NW7A 4JS8A 4BDIA 3O8PA 3QBNA 3VUIA 5CU3A 3ZLXA 2VUWA 3R28A 2PZRA 4X2FA 3EH9A 4BN1A 5EW3A 3LMIA 4F9AA 1E1VA 4ENYA 1PXMA 3SV0A 4HVIA 1TKIA 2W1FA 2R3OA 4OTFA 3UC3A 5DHJA 5LVMA 2GQRA 4Z55A 4AW0A 3HA8A 2B9HA 4CFUA 2UW4A 2CLXA 2GHMA 4RIYB 3CTHA 3FQSA 3QX4A 4L67A 4FV4A 2QI8A 2WTIA 4Y95A 3U4WA 1UNGA 4EQUA 3UIBA 3VS7A 3V6SA 4U41A 4ORKA 3SRVA 4L68A 4DH8A 3QQHA 2WIPA 4AAAA 1M7QA 3BBTB 3V01A 2YWVA 1YDSE 4HNFA 5A46A 4YURA 4HW7A 4DAWA 4HCUA 5E90A 1LUFA 2WMXA 5HG7A 5JKGA 4PPBA 4PF4A 3ANQA 4FKPA 4FIFA 4GVAA 5BMMA 2WELA 5A4LA 3R1NA 4QPAA 4WNMA 3OT8A 3AGLA 3NS9A 5TR6A 4JT3A 5HD4A 1VJYA 2J50A 4DBXA 2YHVA 4EH3A 3IKAA 3VQHA 2VRXA 3FI3A 3RHXA 3FJQE 5AV1A 4XS2A 3G15A 1YI4A 4YJSA 4DCEA 4I6QA 4A7CA 1UKHA 4BIDA 4WSQA 2PVNA 3DJ5A 3KRJA 1P4FA 1UA2A 3MPMA 4O2PA 4OGRA 4YLLA 3R83A 4C33A 2VO7A 2ZMDA 2ONLC 1IASA 4RVKA 3IOPA 4J52A 2ACXA 2R3QA 3AT2A 2XP2A 2JAMA 3UC4A 3LM0A 3DDPA 5HU3A 4IJ9A 1Q3WA 2WTDA 3GU5A 2ITPA 3H10A 4FV0A 3TZ8A 4D2SA 1OIYA 3RZBA 4YMJA 5D10A 4EOKA 5AUVA 2VWUA 3ZH8A 4UX9A 3EMGA 5HE3A 4G3EA 4J7BA 2XVDA 4XNEA 3PSDA 3C50A 2PE2A 4AW5A 4XP3A 1OL6A 4GJ3A 4RVTA 4O0SA 3SG8A 3BYUA 4MXYA 2YERA 5E4HA 5CU0A 3HL7A 2C47A 1VZOA 4J95A 3KMUA 1NVRA 3U6JA 4M14A 3BHVA 4DFNA 3VAPA 3IONA 3DNEA 4PX6A 5EW8A 2OK1A 3FLWA 4RA5A 5D7VA 2PUIA 4S2ZA 3RK7A 2OJFE 3CBLA 2C68A 2W1HA 4FNWA 1LPUA 2XIKA 3MFTA 3QRJA 3TZ7A 3OROA 4O86A 4AFJA 3CSVA 3PG1A 1H1SA 5EM7A 3IGGA 2V7AA 3AC4A 2RGPA 1Q8TA 2C6EA 4FV7A 1OUYA 4IMYA 3NVKI 3EFKA 4AUAA 1JKSA 2FSTX 4M84A 2P55A 3KKVA 4EZ3A 5JT2A 4LOQA 2WQEA 2HZIA 5C03A 5TT7A 2YACA 3DBQA 2CGXA 4IZAA 4XRLA 4CCUA 2VWWA 3TDWA 4II5A 2W4OA 5CEIA 5M4UA 3CLYA 3MW1A 2GSFA 2PUUA 3AMAA 3IECA 3KMWA 2X4ZA 4FI1A 5AP3A 5EI8A 2VNWA 4YJRA 3FMDA 4AN2A 4ZP5A 1ZMVA 3TUCA 2WEVA 2ZM4A 4O38A 3OXTA 5DT4A 4DEBA 4DFBA 4DHFA 3HYHA 4HZRA 2W4KA 4JX7A 4YP8A 3VJOA 2R7IA 2UUEA 3QCXA 4G9CA 2Q0NA 4RIOA 4GT5A 4CMTA 2ZV9A 3ALNA 2YZLA 4DEGA 3GFWA 3FMKA 3F9NA 4PL3A 2BRHA 3BU5A 5DYJA 3WARA 5FDPA 4IX3A 3W2SA 2XBAA 5FD2A 4DFLA 2GS2A 1Y6BA 4AZEA 3EKNA 2A27A 5F1ZA 3PXQA 4IADA 1E9HA 2ONLA 3AD5A 3GGFA 4FOBA 4FVPA 4JDKA 5IA3A 4CG8A 3WZUA 4LGDA 2E9PA 1ZAOA 5EM6A 4FF8A 3ZZEA 2EVAA 2YM8A 3WIKA 2BR1A 4G5PA 4OLIA 3ROYA 1HCLA 4WRGA 2PZYA 3NCGA 2ITUA 5FGKA 2V62A 4BVUA 3NR9A 4WOVA 4XHKB 2PVLA 2HIWA 4FGRA 4PDYA 4TNDA 4I0RA 3PXRA 5AMNA 3A7FA 3LKMA 4XLVA 2J0KA 3HP2A 4WHZA 5EDQA 5IISA 4AT3A 3NGAA 1K2PA 4FV6A 3EFWA 3COHA 3H3CA 4PL4A 2QOQA 4UV0A 4F70A 1R0EA 4EYMA 3OP5A 5HIDA 3LMGA 1JAMA 3ODYX 3O7LB 3PJ8A 2OKRA 4K1BA 4BWPA 4W4YA 3D7ZA 4FVQA 4D9UA 3PJCA 2CCIA 3ID6C 4M97A 1ZYCA 1OL2A 4Y83A 5BX0A 2RFSA 5CI7A 4DEEA 4DLIA 4TRLA 5CSHA 5FEQA 4FUXA 5ACBC 3WE8A 3VS5A 4EWQA 3E87A 5JFWA 2RFEA 1XBBA 4WNPA 4RIWB 3ZONA 5C8NA 3HMMA 5KKRC 3N4TA 3RCJA 2B53A 5KBRA 5IMXA 3VIDA 4DT9A 2W5AA 5ACKA 4C4IA 1OPLA 4IVBA 3W8LA 2PVRA 2HY81 3TNWA 3TG1A 4LUEA 2ETKA 2WAJA 3G90X 3JVRA 5EYDA 1RE8A 3C0IA 2JKMA 2O64A 1PYEA 3UPXA 3LFSA 4QYGA 2HY0A 4MEDA 4AGWA 2GU8A 5FM3A 3V5QA 4U0IA 3D7TA 5HLWA 3FZOA 3HRBA 1Q8YA 3PG3A 3EL7A 5LARA 4ZZOA 2V55A 2BIKB 5FBOA 4ITIA 3RBWA 1PXKA 2YISA 1WBOA 4PUZA 2UZDA 4FTUA 4W9XA 4BTKA 2ITNA 3RAIA 4R7HA 4NEUA 3E7OA 5M4FA 2PMLX 2Z8CA 1OBGA 1SM2A 2HZNA 4MX9A 3DV3A 4JL9A 3EQBA 2BTRA 3FSKA 4K0YA 1JOWB 4WSYA 2VD5A 3QTZA 4FEXA 1T45A 3DZQA 3PTGA 4LUDA 4OR5A 5HG9A 5FQDC 3VUGA 4AF3A 3R30A 3C4ZA 4PDSA 3S3IA 1UWHA 4E6DA 1NY3A 2HYYA 2Z2WA 5EG3A 3VBVA 2CHLA 2XM8A 1ZARA 3DKOA 4IB0A 4XRJA 4JQ8A 1KOBA 2C3LA 2ZM1A 3VUTA 3VUMA 3IO7A 4Z16A 3PJ3A 4JR3A 3P7CA 5A4TA 2YM4A 2ZB0A 5I3OA 5IH5A 4KD1A 4XP0A 4CZYB 3COKA 4KB8A 1ZOHA 3F88A 3FQEA 4PRJA 1Q8WA 1P5EA 4LMUA 2ITXA 2BHEA 4DCAA 1UKIA 4OTRA 3OEZA 4XV1A 1W83A 3CC6A 2ITVA 5F4NA 5CAQA 1ZYSA 3KY2A 3DFCB 4RLLA 5FEEA 5EOBA 4UWCA 5BVEA 4NH1A 4GG7A 3U8WA 5AP1A 1YVJA 2W5BA 4ZTLA 3TTJA 3NVMB 4O21A 4XG6A 3T8OA 4BBFA 3C4EA 4IB5A 4P2KA 3U51A 2JD5A 3VN9A 4M69B 3QF9A 3H0YA 5AX9A 4AZWA 4CTBA 3ZFMA 1PMNA 4BICA 4EQMA 2IG7A 2GCDA 3CJFA 3ZM4A 1ZMUA 4CNHA 3HZTA 3L8XA 4I20A 2JDRA 4ZLZA 3QD0A 4F65A 2NRYA 4F9BA 4CQEA 4N6ZA 4S32A 2CKPA 3KK8A 3HX4A 5CAUA 4FGBA 5IG1A 5L8LA 2BDFA 4ZTRA 3R8PA 2WB8A 4MKCA 1IEPA 5J95A 3U9CA 1PKDA 1OB3A 5C9CA 3OOMA 3HA6A 2E9NA 4QYEA 4BCFA 4N0SA 1IAHA 3FV8A 1OKWA 4H36A 4WKQA 1M17A 2WMTA 3ENMA 4I0SA 4DINA 3VRZA 5AM7A 3FKNA 5IQGA 4LRKA 1WVYA 5CNOA 1JSTA 3HV7A 4R77A 2CGVA 3A4PA 1M7NA 5T3QA 4DTKA 1GAGA 3FMLA 3M1SA 5IZFA 2W1ZA 2KTYA 3GQLA 4J99A 3ULZA 4M15A 5HO8A 4RX9A 3D5UA 4QMZA 4AT5A 5M4IA 1XWSA 2WKMA 3ROCA 4R3CA 3NMUF 3ZO4A 3LCSA 2KULA 2WFYA 2BFYA 3LMHA 1YXVA 3B8RA 3S00A 2WNTA 3PJ2A 3FKLA 3UNZA 3VJNA 2W1CA 3RHKA 4X3FA 3LXLA 4F0GA 1ZYLA 4DGGA 4L9IA 4JDJA 3VBXA 1A06A 2HWOA 5IU2A 2Y8OA 5HNIX 5IA4A 3FI4A 2X8EA 3FAAA 3UTOA 3LLAA 3EQGA 2WOUA 4H1MA 3NSZA 5IQIA 2X9EA 4M7IA 4RMZA 3N4UA 5CSWA 1ZLTA 4XG3A 3O17A 2I7QA 4Z9LA 4H3BA 1ZZLA 3NYOA 3GCPA 4YBJA 3D9VA 3CD8A 5GZAA 2XJ0A 5AAFA 2WD1A 3RWQA 4NIFA 2BDWA 4ITHA 3ORLA 4ARKA 3ZBXA 5ITAA 3IW6A 3LOKA 4JBOA 2IZSA 3FQHA 3FPQA 4F09A 1ZOEA 3GQIA 2FH9A 4AN9A 1URWA 4IAZA 2LAVA 4ACGA 4ZZNA 4IWPA 1V0BA 4LOOA 1H28A 3QYWA 5IQDA 3EQIA 3DKGA 4X21A 3PPZA 4NFNA 2B4SB 3V8TA 2OF2A 2UZEA 3DJ7A 3R04A 4R6VA 4DEIA 5HLPA 2PULA 4U3YA 1L3RE 4IAKA 2GTNA 5F9EA 3TJDA 3FLSA 4KWPA 3R9NA 3BWFA 2CN8A 2I0VA 3QGYA 4FK3A 2ETMA 3CGFA 3HECA 5L2SA 2Z7RA 2JITA 1YWNA 3HMPA 2YDIA 2NNWB 4JG6A 2W05A 4IM0A 1JBPE 5AV2A 3T9IA 4EK8A 5B7VA 3R22A 4BHZA 4FSNA 5JRSA 3ET7A 1PMUA 4W4WA 3V3VA 4C3RA 4WNOA 2XK4A 5J9LA 3TDVA 4IW0A 4XEYA 4FTJA 5IPJA 2YJSA 1BL7A 4ZSGA 1BI8A 3LQ8A 4OTDA 3W2PA 5HG8A 4DA5A 1KE7A 3P86A 4I5PA 4QP7A 3B2WA 1OPKA 1Q97A 3DKFA 3G0FA 3QQJA 1ATPE 2ERKA 3C1XA 5HTCA 3OXZA 3ALOA 3BIZA 4YHTA 2YIYA 3FC2A 5HCYA 5BVFA 5EQEA 1VYZA 3P08A 2WQBA 5CI6A 2VWBA 2I0EA 3QUPA 5HX6A 5IDNA 3TI1A 2GFSA 3PPKA 4A9SA 4DG3E 1YRPA 4WNKA 3ELJA 5AUXA 3EQFA 4C2VA 4LRMA 5E8YA 1VEBA 5FTOA 3LFCA 4O0XA 1KV2A 1O6KA 3OCTA 4BI1A 3IOKA 4QMWA 3E3BX 1ZWSA 3R73A 4FUYA 5AR4A 3CTQA 2B54A 4L53A 2WMQA 3MH2A 2FSLX 2JGZA 4NK9A 3BYSA 1YHSA 5DPVA 5IQHA 3KQ7A 5DG5A 4CV8A 1MP8A 4D0XA 4DF3A 2F2UA 3QZHA 1VR2A 4ZSJA 4DH3A 3MY5A 3Q04A 1G3NA 2JDTA 4D55A 3QLGA 3OUNB 3UODA 2ZVAA 2XNMA 2VTTA 3EHAA 3OC1A 2X7OA 5BVDA 5CF8A 1ZOGA 3ZHPC 4P7EA 3KXMA 3HAVA 4DN5A 4QMOA 3TL8A 3CJGA 3V5JA 2X2MA 5I5ZA 3DXQA 2J0LA 5CLPA 1CKIA 3W8QA 3PP0A 5L2WA 2RSVA 3UQGA 4USEA 3F66A 3EN6A 4JRVA 4XUFA 4XYFA 5M53A 3MY0A 3RINA 1MQBA 4G17A 1Z57A 3TN8A 5CEKA 4LI5A 4QO9A 2OXDA 4YTHA 4O84A 5KE0A 4CD0A 3AT3A 3FUPA 3CCNA 5AFVA 3V6RA 5FRIA 3AMBA 4O0UA 3QA0A 2EXEA 3ORNA 5E8ZA 3T9TA 2E9OA 3L1SA 4E4MA 5AUYA 4BIBA 3SQQA 5HZNA 4F9CA 4C61A 1IAJA 2YM3A 2PY3A 4FL2A 3QYZA 3R1QA 3GC8A 4JAJA 2BZKB 5LWNA 1OECA 3TV7A 2EUFB 2GQSA 2WOTA 3CY2A 3LZBA 2UV2A 4F7LA 1ZYDA 4GYGA 3SAYA 3O8UA 2VO6A 3UO6A 1GIIA 2WO6A 1G5SA 5C8MA 4ANSA 5A14A 4RFYA 3I60A 5H8BA 3PY1A 3QTQA 5J1VA 2PE0A 3KN5A 2YM6A 3KF4A 1NT2A 3F61A 3WF9A 2DWBA 4WRSA 3H9FA 4GCJA 4NTSA 1WBTA 3Q5IA 2VWZA 4W9WA 5CQUA 4O7WA 2VN9A 2QO7A 3ZUUA 4EZ7A 3NIEA 2Y7JA 1KUTA 4FTLA 3ZLYA 1PXJA 2WMAA 4GK2A 5IA2A 4O91A 2YIQA 5HCZA 1YWRA 5AP2A 4YJPA 2JLDA 3Q9YA 2H8HA 4H58A 3VF8A 2FB8A 3ZLSA 3TKUA 3FXXA 4IC8A 2YFXA 4EI4A 4QMNA 2PTKA 2HENA 4Y46A 3SLSA 5ANIA 1YHWA 2P4IA 4D4VA 2R64A 5BVNA 3TNIA 2Y6OA 4LG4A 3KVWA 5DT3A 4L7SA 1S9JA 4QTAA 3O23A 1OIUA 4DE4A 4FTAA 4LYNA 4RRVA 2GNFA 3FHIA 4ANOA 2GNGA 2IO6A 4JBVA 5DEYA 3RTPA 5IA0A 3EFJA 4YHJA 3DJ6A 3PXZA 2RG6A 1B39A 4MNFA 3R7IA 2IVUA 2YZAA 4IZ5A 4YBKA 4A4OA 4BF2A 4CGAA 5L8KA 2C1BA 5FP6A 3RGFA 3NUSA 4YNEA 3I6UA 5E8UA 4RJ6A 5LOHA 4RBLA 3NUNA 1KWPA 1XO2B 5EDRA 3Q9ZA 4B8LA 3PXFA 1R0PA 1LP4A 3L9MA 1PXOA 3R7GA 3DTCA 4AOTA 5AA8A 4A9UA 3P7BA 4EUUA 4BCMA 4HYUA 2CNUA 4FV1A 3CQUA 3UVRA 5EM8A 2YIWA 3W2CA 4E73A 4IVCA 3A4OX 3R8ZA 5GINE 4JVGA 3C4WA 4DC2A 3LE6A 3E93A 3EL8A 4S30A 2ZAZA 4LV8A 5BVKA 4ZJVA 4ZSAA 4LL0A 1OMWA 4J96A 4OTIA 2XM9A 5CSPA 2O65A 2VO0A 5CF4A 1YOJA 3HDNA 4F0IA 3DB6A 4R78A 5FUTA 3Q6WA 2HXLA 3W10A 4K2RA 5CXZA 4D2PA 2PMIA 4W4XA 1ND4A 2J0IA 4QTEA 2F7ZE 2OI4X 3KCKA 4O6EA 5GJDA 4OBOA 4BCNA 5CEOA 4FKQA 2YLEA 1V1KA 2CGUA 4PV0A 4TN6A 2EU9A 1XH5A 5CU6A 1OZ1A 2JKKA 1REJA 4I22A 4I92A 5HU9A 4L3PA 3HRFA 4CVAA 2XRWA 4Y8DA 1YOLA 1IRKA 5D12A 2ZMCA 5GZ8A 5CQWA 2I1MA 4YLKA 4O7YA 4W8EA 2R0UA 1TQMA 4ZSLA 3QHRA 4FOCA 4FV2A 4TYJA 5AUUA 1U5QA 1X8BA 5LVPA 5I9UA 1WBSA 4USFA 4ZZMA 3W1FA 2BKZA 2R3IA 2XIYA 2O63A 2B55A 3AC2A 5EI6A 4ANNA 3DQXA 4ID7A 1NVQA 3R6XA 4OTWA 3UDBA 4C4GA 3PE2A 5IQBA 5JSMA 3LFEA 3RI1A 2W0JA 2BHHA 4FTRA 1JVPP 3V5LA 4WG5A 3KA0A 2X4FA 4M12A 3FC1X 4IAYA 3VS3A 4B99A 5FP5A 3TUDA 3P9JA 3JUHA 5E92A 1OIQA 3M11A 5GJGA 4QPSA 3IQ7A 3COMA 4UMRA 2W5HA 4KINA 2RG5A 4R5YA 3FHRA 5L6OA 4EH5A 5A54A 4P90A 3QD3A 4CCBA 3GP0A 3PVUA 5HNBA 3WZEA 4E8AA 2QOFA 3EWHA 2JKOA 4NM0A 3QXOA 1RQQA 4NW6A 4DLJA 5CZIA 3QQGA 2JBPA 4LFIA 2OIDA 3KF7A 3PWDA 4NCTA 5J9ZA 4MD7E 4LV5A 4IVDA 4F99A 4DFYA 4HJOA 3Q4CA 3KGAA 4A9TA 3ZXTA 4HVSA 3P79A 3OCBA 4J53A 2QD9A 4EJ7A 4C2WA 1URCA 3H30A 2O0UA 4L6QA 2CDZA 3R2YA 2Z7SA 1FMOE 3NNUA 4XG4A 5IH6A 4O96A 3RK5A 3AG9A 4KAOA 3TKHA 4HNIA 2P33A 2UZVA 3UIMA 1A48A 3P7AA 4YO6A 1L8TA 3BYMA 2ZDUA 3I81A 2BAQA 4FZAB 4JX3A 4E1ZA 4NL0A 3QTRA 2X39A 4J8NA 5KZIA 1WVXA 1QMZA 3PZHA 3KB7A 5CSVA 4F7NA 1KE5A 3ZDUA 1FOTA 4GU9A 2I0HA 3V04A 4RIWA 3ZUVA 4TWNA 2GHLA 2XKDA 5KX8A 1YOMA 3FKOA 4ZXTA 4GK3A 3FYKX 4ITJA 4N57A 4QRCA 1Y8YA 2CKOA 4GG5A 2BAKA 2UZNA 2EXCX 2VTNA 3QKKA 4KBAA 3E88A 4ZLYA 4QPMA 3B2TA 2QKRA 5JGDA 1ZRZA 5I9WA 5AR8A 4UYNA 1H26A 2Y9QA 3TKIA 4IANA 3R7YA 4EKLA 4P5ZA 3BYVA 3VC4A 1ZY4A 5I3RA 3BHYA 1Z5MA 1YXTA 2WMRA 3R02A 4G31A 3MVHA 1OL7A 1WVWA 3GB2A 4TWPA 4BKZA 3S2PA 4MHAA 4F4PA 4EHGA 3DAJA 4YSMA 5HNGA 5ANEA 3WBLA 1NW1A 4CZUA 5AUTA 1M2PA 4MBIA 5LCKA 4O7TA 3GOKA 4KS8A 4C34A 2XKEA 3HDMA 4QD6A 2VTQA 3BEGA 2DUVA 4BTFA 2VZ6A 3CE3A 3K5UA 1W84A 5CNNA 4IWDA 4Q2AA 3BX5A 4CV9A 4EYJA 2C30A 1W98A 2J0JA 4RWIA 4BCIA 4YU2A 4QP9A 2YM5A 1JWHA 4PNKA 3RCDA 4R1VA 3D2IA 1CDKA 4MK0A 5EFQA 3S95A 3K3JA 2F4JA 2FUMA 3D5VA 4RX8A 4F0FA 1Y57A 2UVYA 4K9YA 2ITQA 1Q4LA 4UALA 3LXPA 2G01A 4BDAA 1YHVA 4PPAA 1LEZA 2WTWA 3U6HA 3KMMA 1UV5A 4RG0A 3NUAA 5CEQA 4C4EA 2W99B 4YHFA 4RJ3A 4LGHA 4YPSA 4JNWA 4KABA 4U5JA 5AX3A 5ICPA 3WF5A 4R5SA 4C62A 5GIOE 3LFAA 1W8CA 1XH7A 4H1JA 5L8JA 4M69A 4AS0A 5K0KA 3AOXA 3DTWA 3MFSA 4RA4A 3ZRMA 3A2CA 2PU8A 1IR3A 2XIRA 3OY3A 3R1SA 3FL4A 5C8KA 4U81A 2OJ9A 4AQCA 4BR3A 5CAVA 2EB3A 3AC3A 4E4LA 1M14A 2W9ZB 3NNVA 2PVMA 4S34A 3U4UA 4AOJA 3NUUA 4MXZA 4D4YA 4BBMA 4E6CA 3EFLA 3ATSA 3OUKA 2HXQA 5D1JA 3ZC5A 4O0YA 1JLUE 4IC7A 3Q2MA 3QTSA 5EQYA 3R8UA 4LMNA 3UG2A 4TY1A 4WIHA 3Q4UA 4ANMA 4FEUA 1GNGA 3HLLA 2ITTA 4EK3A 2PVFA 3REPA 4FYNA 3KXGA 4FSWA 4KIQA 4D4SA 4BGGA 4F64A 4G1WA 4GVJA 1G8AA 1I44A 4QT1A 3C4FA 1YXUA 3C13A 3LXNA 3JXWA 3WZJA 4BGHA 5IKWA 4DITA 3A61A 3FL5A 4BDHA 5CSXA 1YQJA 4FVRA 4BB4A 5K5XA 3F2NA 5DR2A 5HD7A 5CALA 5E8XA 4FIHA 1OM1A 2B0QA 4O0WA 3NEWA 3FLZA 4PQNA 4PMSA 5HO6A 3FLNC 4D2TA 5AR5A 4OAUC 3WOWA 3SXSA 4BDKA 1A9UA 3IW7A 4IFGA 4JIAA 4L00A 4BDBA 4CFVA 5IF1A 3F3UA 3QTUA 4JAIA 4QMLA 2XK9A 3MESA 2QU5A 4D1SA 3W55A 5AR2A 1H1QA 4BZDA 4EBVA 2Z02A 3MH0A 5IQFA 3LW0A 4UB7A 5ETIA 2ITYA 1PHKA 2UVXA 2Y4PA 2W17A 4L01A 4XX9A 3FDNA 4I5HA 1QCFA 4CRSA 4H39A 1TVOA 4XMOA 5EK7A 2R9SA 4M0ZA 4UMTA 2XYNA 3ZUTA 4BCHA 2FA2A 2YDJA 4FSTA 4NU1A 3S0OA 2CLQA 3QQUA 3MGYA 2QVSE 3K2LA 3QD2B 4R1YA 1SVHA 1Q41A 3RMFA 4YC6A 2V7OA 4M8TA 4XP2A 4DH7A 3A7HA 4DFUA 2OGVA 4R3RA 4EC9A 2QHNA 4EK6A 4CSVA 5HO7A 3SW7A 1PXLA 2B1PA 2QNJA 3ULIA 3DA6A 2ETRA 3GU6A 2J0MB 1QPCA 2VTLA 3MVJA 3O51A 1OIRA 4IACA 3M2WA 4GV1A 3VBQA 5JGBA 3JVSA 4QNAA 2BRBA 5E8TA 3MTFA 3CTJA 5TF9A 3QRIA 5DR9A 4G9RA 2WQOA 3BU6A 2Q83A 3ODZX 1UVRA 1GZOA 2RKUA 3KL8A 4EBWA 4EORA 4EH2A 4CRLA 4CQGA 4Q9SA 5KNJA 4YZDA 3BCEA 3MSSA 3QCSA 1XBCA 1YXSA 2R0IA 1XH4A 3MH1A 4FT5A 4IM2A 4UEUA 3RM7A 3UE4A 4BFMA 1U4DA 2ITZA 4QP1A 3BE2A 3O50A 3QZGA 3AC1A 4DTAA 4BYIA 4F1TA 4O1OA 4CMOA 2BIYA 5CVGA 4ZY4A 4O0TA 3UZTA 2R3NA 3BU3A 3W2QA 5JMSA 2R3PA 2WMUA 4FKTA 2F49A 2JIVA 2VTSA 3GENA 2YABA 4KKEA 4ASDA 4CTCA 4HCVA 4FZ7A 5HE1A 5EI2A 3NWWA 2C6OA 3F5PA 3E92A 5FM2A 3AQVA 3FXWA 1WBNA 2XNGA 4OTHA 2WIHA 1Q5KA 4X3FC 4L43A 4FKLA 4W4VA 5IQCA 2XNEA 4FK6A 2P2IA 3PSBA 3Q4TA 2AC5A 1V0OA 5H8EA 4YR8A 3JR1A 4EEVA 4J71A 4R7IA 3I7CA 2BZIB 4IDTA 4CEGA 5DMZA 5HKMA 3DLZA 2A2AA 5DGZA 4FA2A 3QHWA 3D5XA 5DT0A 1WBPA 4BDGA 2OWBA 3RNYA 5J5TA 3DKCA 4BCJA 5CX9A 2QOOA 1SNXA 5C1QB 3O2MA 1ZYJA 4QP8A 4EOOA 2OSCA 4ALVA 3EN9A 5AWMA 4F9YA 3CKWA 1TQPA 4ONAA 1H8FA 3DCVA 4OT6A 2XKFA 5GHVA 3WF6A 4A4LA 1B38A 3DBCA 5AM6A 3HV3A 5HVJA 3O0GA 2R3LA 1LR4A 4YO4A 2QOIA 4NM7A 3QL8A 3VBYA 3GOPA 4TNBA 2WEIA 3DS6A 4MXXA 2YEXA 4O27B 4LM5A 1YWVA 4USDA 3KRLA 3VS2A 2VTRA 3HVCA 1WBWA 3ERKA 2WU6A 2QC6A 2XNBA 5EW9A 1GZNA 3U54A 1XJDA 3EQRA 2X8IA 4FIIA 4XG9A 5JK3A 4CKRA 2WMBA 3NDMA 1OL5A 3UVQA 4UZHA 3UZPA 5E1EA 5EHLA 3V5WA 3UOKA 2ZV2A 3NYVA 3PRFA 2BCJA 5L3AA 3D4QA 2R3JA 3F2AA 1CKJA 3QU0A 4M0YA 5DR6A 4U45A 5EM5A 5FLFA 5M4CA 5HE2A 2YWPA 2EWAA 1KE6A 4L42A 1J7UA 3EYGA 5L6PA 3AD6A 2QO9A 3VF9A 4O7NA 4U43A 3TACA 3LFFA 3EYHA 4GT4A 4GUEA 3AC8A 3FMMA 3NPCA 4BCOA 3OFMA 3ZTXA 3TIYA 4ERKA 1F5QA 2XUUA 3IS5A 3MN3A 3PVGA 4BZNA 3UGCA 3EJ1A 1QL6A 5HIEA 4C4JA 5FEDA 1JNKA 3CS9A 2IN6A 4YZCA 3HNGA 2X8DA 3LFDA 4L3LA 2R5TA 4O82A 3DXNA 3GCQA 3LJ1A 4JJRA 2GFCA 2UZUE 4QMSA 4N70A 3AXWA 1ZMWA 4GKIA 3DAEA 2QHMA 3OZ6A 3QUDA 3K3IA 3FMEA 4FODA 2J4ZA 2ZOQA 1Q8UA 3DY7A 3G5DA 3GC0A 3ORTA 3PE1A 4FNYA 2RIOA 3R1YA 4JQ7A 2WMVA 5GZ9A 3MVLA 3KXXA 3UP2A 3BHTA 2PUNA 1RW8A 3LVPA 2I6LA 3OWLA 2BMCA 1OKZA 3I1AA 3FBVA 4D58A 3VVHA 3PLAE 4FYOA 3DK6A 3MS9A 2IW6A 1JQHA 3EZVA 3MTLA 4E4NA 5AAGA 4XG8A 2OH0E 2QG5A 4DH5A 3UBDA 2QR8A 3JY0A 4UWBA 4BDCA 3FMNA 3SG9A 4ZS0A 1U46A 3UYSA 4L3JA 2IJMA 3G2FA 3ORKA 4D5KA 3F82A 2PL0A 4RGJA 4OBPA 1GY3A 2WU7A 3QKLA 4YJVA 2R4BA 4ZTSA 2AC3A 4UN0C 4OAVB 3BLHA 4TKSA 4J1RA 4GL9A 3SC1A 4F1OA 4ZTQA 2IZTA 3OWJA 3JS2A 4IDVA 1J91A 5CS6A 4KBKA 4B6LA 1H24A 3QRTA 3HUBA 2H6DA 4OTPA 3FSFA 4IEBA 5TE0A 4Q5EA 2OJGA 5IQEA 5ANJA 4EOJA 3HV4A 3HEGA 1BKXA 4NJDA 4QMYA 4FNZA 2OW3A 4FTQA 3UYTA 1MRUA 3IW4A 4RJ7A 4IM3A 1DS5A 1PXNA 2JFLA 1DI9A 4YNOA 4B7TA 5DH3A 1OGUA 4NM3A 4CT1A 4IAAA 2XK3A 5HTBA 4XBUA 5JFXA 2A19B 4CZTA 3FZTA 1SVGA 4NUSA 4O0VA 4IVAA 1FVVA 5DIAA 3W2OA 3UZRA 3R8MA 3WF7A 4YTFA 3FLYA 4IH8A 2WTKB 4MWHA 5EQPA 3ZM9A 4FC0A 2VTAA 3ACJA 5D11A 3D0EA 3UIXA 4FSQA 5C27A 4EJNA 2CJMA 3BLQA 4FTOA 5JFSA 4I41A 4KNBA 3BQCA 4GJ2A 4BCPA 5IQAA 3PVBA 4M13A 4MQ1A 4BYJA 4AWIA 3HUCA 3ZCLA 3KULB 4WG4A 3ZC6A 4C4HA 1SNUA 5J9YA 5M06A 5JQ5A 1HCKA 5JRQA 4RLKA 4MD9E 4C37A 2X2LA 2HELA 5CT0A 1JKLA 4EH7A 4AU8A 2C6LA 5CY3A 2ZM3A 1H00A 3DFAA 1MQ4A 3TCPA 4I0TA 3WE4A 4DEAA 5L2IA 3MFUA 3RALA 4MWIA 3SXFA 1M2QA 5AV3A 3JPVA 2C6DA 2GQGA 2VO3A 3NAYA 3PA4A 2BRMA 3TTIA 3ZEWA 3MA6A 3EB0A 4HYHA 2F7XE 3WZDA 2BAJA 3E63A 1DM2A 2JDSA 3EN5A 3A7GA 3DAKA 3OF0A 4D1ZA 1FINA 4L45A 4PP7A 2R3GA 2XEZA 2WPAA 4O22A 5BVWA 2X1NA 4ZK5A 3R8VA 3ZS5A 2W1DA 3E8NA 5IUGA 3GC7A 3RKBA 4FE2A 3BKBA 4KUJA 5CVHA 4G6LA 4QQ5A 1CMKE 4RWLA 2QO2A 4RPVA 4D1XA 3C0GA 5HICA 2QQ7A 3C7QA 4YJNA 2C5OA 3JYAA 4ACMA 2VWVA 3Q96A 3MY1A 2YCRA 3G9NA 4PL5A 5DOSA 2AYPA 4QQJA 5KMOA 1SVEA 2PZ5A 3F7WA 3I4BA 3HP5A 3R7UA 3QRUA 3A8WA 4GH2A 3C51A 3QRKA 2QCSA 1JPAA 3DB8A 3NNXA 5AP6A 5ANGA 3WZKA 3BBWA 5BNJA 4DT8A 4GMYA 1QPEA 3VUKA 4L8MA 1QPDA 3VS4A 3ZOSA 3LPBA 2V0DA 1O6LA 2B9IA 3CY3A 3GI3A 3GNIB 4K11A 4GUBA 3BGPA 2NRUA 3SX9A 3MDYA 3R63A 4KRDA 4DG2E 1KSWA 3QWJA 4ACHA 2W9FB 5KKRB 3GVUA 5EHOA 2CSNA 4FV5A 2R3HA 2XK8A 2W1IA 3WYXA 5HE0A 4BY9E 3E62A 3ZMMA 3IDCA 4FV9A 4TTHB 3GU7A 4NT4A 2Z7QA 5FDXA 5LMBA 5C26A 3WILA 4WT6A 3TNQB 3ZZWA 3CQEA 5B2LA 3RWPA 2YCSA 2VGOA 2FYSA 5KMIA 4GK4A 4PDOA 3UJGA 2C6IA 3G51A 1Q8ZA 4IZ7A 3TNPC 3QUEA 3Q60A 3LCDA 4AGUA 2O8YA 3EQDA 4XOYA 4EOMA 4S33A 3TXOA 5AV0A 1SYKA 4RIYA 3FZPA 3VUHA 4FG8A 1J3HA 4AP7A 1RDQE 3QKMA 3SKCA 5AADA 5EKNA 3SVVA 4X6QC 3UQCA 2RL5A 3PDTA 2XNPA 2B52A 3Q4ZA 4V01A 4NTTA 4BWXA 4X7QA 5HX8A 4KIKB 4NM5A 2QOHA 2H96A 2Y4IB 4EOPA 4IAFA 5IUHA 5TOZA 3RNIA 4Y72A 1PRYA 3NZ0A 4MXAA 4O7VA 3A7IA 5CASA 3RJCA 1CSNA 5CF5A 2VTJA 3LQ5A 4IHPA 5ETFA 3F5XA 5EYMA 4AA5A 5FXSA 2QODA 4FEWA 2LGCA 4JXFA 2B9JA 2C6KA 5AJQA 5FWKK 1R39A 2ZYBA 4TYIA 1K9AA 3UOHA 5HBJA 5IA1A 3E3PA 2GDOA 3DU8A 3RAWA 5LJJA 5CT7A 1IG1A 2UZLA 2VTHA 3I5NA 3P4KA 3H9OA 3POOA 3ORPA 3QCYA 5HHWA 5C01A 3KXNA 4EH8A 1KV1A 2R3RA 1Q61A 4BGQA 2VTOA 3V5PA 3RAHA 5L4QA 2Y0AA 1FGIA 3QQKA 3HV5A 4WBBB 4F6WA 5ANDA 5HTIA 2UVZA 3MA3A 2YAAA 2Y6MA 2XCKA 3FE3A 3FI8A 4D9TA 4FIEA 4ZLOA 5ETAA 4LQMA 4NCTC 2DS1A 3HMOA 1FQ1B 1NVSA 4TYHB 1UU9A 2FVDA 2VX0A 4FIJA 5D41A 3QZIA 5E7RA 1XKKA 5ANKA 2BUJA 4OW8A 3VULA 1MUOA 4EHVA 1BMKA 3A99A 3BLRA 3LLTA 4FTTA 1OUKA 3UMXA 3OWKA 5HQ0A 3LFBA 4G5JA 2GS6A 3H0ZA 3BYOA 1K3AA 2C6MA 5I9ZA 3G9LX 4RC2A 4FZDB 3F3TA 3OCGA 5AIKA 3CIKA 4ZSEA 1DAWA 2PSQA 5C4KA 4U3ZA 3I6WA 3HRCA 3ORIA 4BKYA 4F63A 4GSBA 3I7BA 2I0YA 4D0WA 5DNRA 4IWQA 4E6AA 1UWJA 4GIHA 1NXKA 1R3CA 4X2KA 3RP9A 4RQKA 4HVDA 3OWPA 4CFMA 4PNIA 5CENA 3N9XA 4RQVA 4FSRA 4WA9A 2HZ0A 3VW8A 3KXZA 4TYGA 4G2FA 2NO3A 3QTIA 4G3GA 3GEQA 3UG1A 4CG9A 4WUAA 4FKGA 4FZ6A 1REKA 3DZOA 4C8BA 3EOCA 3QZFA 5CTPA 5IUIA 4CFXA 3K54A 4U7ZA 5CU4A 3EQHA 4CKJA 2J7TA 2C3KA 4MAOA 4GYIA 4JBQA 3C4CA 5HORA 3HGKA 4TPTA 4FTNA 2X7GA 4I6HA 5B2MA 1UNLA 4KIOA 2V5QA 5A6OA 3DOGA 3ZYAA 4Y73A 4P4CA 5AUWA 4FT3A 4QTBA 3TT0A 2HK5A 4BDFA 3SA0A 3DBFA 4RZWA 3R8LA 5KUPA 1RJBA 1T46A 3RPSA 5AEPA 4RVMA 4DTBA 5AUZA 4X0MA 2FGIA 1VYWA 3MWUA 3E64A 4K33A 1P14A 2YLFA 3UIUA 1APME 2WTJA 1CKPA 3HMIA 3OCSA 2PMOX 4FL3A 1E1XA 3QTWA 4H3PA 4MTAA 5DFPA 1R78A 4O7SA 2WHBA 1PW2A 3CD3A 3ZFYA 1SMHA 3EN4A 4PTCA 1GOLA 3QX2A 5M57A 3PIYA 4YTCA 5FTGA 2HW6A 5FXQA 2J5EA 3S4QA 3P1AA 4FG7A 4B4LA 3NUXA 5LMAA 3UO4A 4O83A 5BYLA 2G2IA 5H8GA 4U9AA 4BCQA 3Q2JA 3NW5A 2UZTA 3ACKA 4XG7A 3R0TA 2IW8A 1BI7A 3VO3A 3A8XA 3F3WA 3MBLA 5AP5A 2H34A 3DLSA 4HGSA 2YM7A 4JG7A 4LOPA 4BZOA 3UQFA 1YI3A 4WUNA 2JEDA 5LVOA 4YJOA 4CLJA 4HYSA 4XV3A 3FY2A 2X6EA 4RWKA 2W7XA 3R01A 5LQFA 5IA5A 3Q9WA 4FNXA 2R3MA 3DK3A 1J7LA 2C3IB 4PMTA 5BVOA 5K9IA 5DN3A 3IK3A 4A07A 4FKUA 2C1AA 2XA4A 4BTMA 2CNQA 3P5KA 3AGMA 3CR0A 4XV9A 1P4OA 3ZO3A 1WFCA 3MB6A 4I5CA 4CLIA 4EONA 4KS7A 4E20A 4F6SA 4KKGA 2XK7A 4BDDA 2QOCA 1YI6A 4XV2A 3OD6X 4BDEA 3UOJA 2X9FA 4DG0E 4BCGA 2BVAA 2C4GA 3BHUA 4RWJA 3MH3A 4KRCA 3PYYA 5CF6A 3V5TA 5KO1A 3B8QA 3NUPA 4I4FA 4QP6A 1BYGA 3KEXA 5B0XA 5M08A 4C7TA 4EQCA 2PE1A 4ZTMA 4DFZE 4FKRA 4IBMA 4O7RA 1TQIA 2UW3A 4AX8A 5BYYA 1GZ8A 3VNTA 4N4SA 3LQ3A 2ESMA 4IIRA 4BDJA 4EOSA 3ZFXA 5HESA 4EWHA 5J1WA 4BBEA 5T6KA 3OTUA 4RVLA 4QP2A 1PXPA 3D83A 4FKSA 1BL6A 1OPJA 4QMTA 4RJ8A 4ZTNA 3TV6A 3KFAA 2PK9A 4YGAA 2EXMA 4JBPA 4ZJIA 4DGNA 2VX1A 4XH6A 4NWMA 4CFWA 4D2RA 1OITA 1FBNA 4UZDA 2XBJA 2OH4A 4FSUA 3SD0A 5C4LA 1V0PA 3QCQA 2X2KA 4IX4A 4FZFB 3U6IA 1S9IA 4DGMA 4C02A 2VV9A 2QOBA 3ZSGA 3D14A 5JZNA 3UPZA 1ERKA 2G2HA 3VBWA 3KRWA 5M55A 4A4XA 2ZJWA 3F5GA 3MFRA 4PPCA 5IH4A 3F6XA 4J98A 5M56A 2GNIA 3UNJA 2VU3A 2XS0A 2ZV7A 3WF8A 3VHEA 2XNNA 5I4NA 4IX6A 2OG8A 3P78A 2J51A 4L52A 3DPKA 2OZAB 4IFCA 3PIXA 3BEAA 1O9UA 3PA3A 4K6ZA 4XG2A 4AACA 2DYLA 4G34A 4YJTA 3ENHA 3R9DA 4ACDA 4EKKA 3KC3A 4XOZA 3FEGA 3W2RA 2X6DA 5JQ8A 2QKWB 4TT7A 5CZHA 1PF8A 2PVJA 3PSCA 4JOAA 3SW4A 5J7HA 3BQRA 4AZFA 2R7BA 2QOKA 3RPVA 3EQCA 4C3FA 4JLCA 4FBXA 4CT2A 5H3QA 4FT7A 4QTCA 1GZKA 4QMXA 2XB7A 3SDJA 4ASZA 5HCXA 1H01A 2W4JA 4DGLC 2GTMA 4HPTE 5E8WA 3NAXA 3BELA 3AMYA 2W1GA 4MD8E 1NA7A 2C5VA 2PUPA 1XH6A 2G1TA 4RIXB 4FTMA 4MBLA 1J1BA 5LWMA 4C59A 1XHAA 2CCHA 4EK5A 3F69A 4BKJA 5CAOA 3KREA 4Q5HA 5KMNA 2PWLA 3PVWA 4V04A 3K5VA 3ZXZA 5DVRA 2VGPA 4GFOA 2CMWA 4V0GB 4F6UA 1FVRA 3GUBA 3F7ZA 1FMKA 3G33A 4G16A 5AP0A 1OL1A 2F2CB 2XYUA 4Z7HA 3E8EA 5K3YA 3THBA 2QLQA 4I1ZA 3R9HA 3TJCA 3T3VA 2WTKC 2WZJA 4HVHA 4U42A 4Z7GA 3L9NA 5IDPA 5AR3A 4AZVA 3VS0A 4E93A 2YIRA 3IGOA 4I23A 3UNKA 2X0GA 4CYJA 1U54B 4HGEA 1Y8GA 4EHZA 4GEOA 3GCVA 1YW2A 2E9VA 3LCOA 4U8ZA 4U44A 4N6YA 3VW6A 5CANA 2XMYA 3I79A 4X6RA 3VQUA 4I5MA 5I9VA 5G1XA 2J2IB 5HBHA 2WTVA 3I0OA 3LHJA 4AFEA 2JAVA 1M52A 3NX8A 4QP4A 4YZ9A 3RK9A 2G15A 3DNDA 2J5FA 4NW5A 4KIPA 2BRNA 3BE9A 4QQTA 3CXWA 3L8PA 4GT3A 3ZBFA 4IX5A 2C5XA 4MNEB 4FTKA 4GS6A 4NSTA 4LL5A 2W1EA 4KSQA 4PY1A 4CFFA 1P2AA 4MXOA 4AGDA 4I3ZA 2C0OA 4BC6A 3ORXA 3COIA 4FKVA 4KBCA 4O1PA 4W8DA 5DWRA 3ZO1A 3LJ0A 4TXCA 4AXAA 3VBTA 3UO5A 1FVTA 1BX6A 1GIHA 4D4RA 4FKIA 2O5KA 4QYHA 4WG3A 1KOAA 2QOLA 2E2BA 3CKXA 3HMNA 3OW4A 1GIJA 4O81A 2PHKA 5HIBA 2VX3A 3KVXA 4JQEA 1QPJA 4FKOA 1JSUA 3CEKA 3GC9A 4PTEA 4RC3A 5CYIA 5IEXA 3Q5ZA 2BALA 3SOAA 3PA5A 3F3VA 4APPA 4R3PA 3TZMA 3CQWA 3S1HA 3LCKA 3E5AA 4NFMA 4PDPA 2I40A 4DGOA 4M3QA 5BUIA 3NLBA 3HV6A 4JR7A 5AR7A 2JFMA 3MV5A 4UWYA 4ZAUA 4RJ4A 3N51A 2XRUA 4QP3A 3E8CA 3BHHA 5HLNA 1OVEA 3A60A 1YXXA 3SRVB 1HOWA 2QONA 4UMUA 1H07A 2PVYA 2YN8A 3Q9XA 4TZRA 5D7AA 3QALE 3TZ9A 3LJ2A 5DRDA 5M51A 3VRYA 1PMEA 2RFDA 3QD4A 3I5ZA 3RZFA 4FKWA 1XQZA 2PVKA 4CFNA 4F7JA 3PY3A 4YC3A 2P3GX 3CGOA 3FXZA 2J6MA 4G3CA 4ANQA 2FO0A 2P0CA 4B9DA 4GW8A 4IQ6A 3WYYA 4I94A 4BI0A 2UW9A 3MPAA 2BRGA 3C5UA 4QMUA 3O96A 3FPMA 4OTGA 2F9GA 2OICA 1PKGA 4MBJA 2CGWA 4NKSA 3KCFA 3KULA 3TV4A 3VS6A 5JZJA 5DBXA 2XH5A 3L8VA 4RX5A 3MVMA 4UMPA 2UW6A 2A4LA 3MJ2A 4FIGA 1XBAA 5DRBA 3Q6UA 2IWIA 3R7EA 2XIXA 4QTDA 2PMNX 4AOIA 3PXYA 4GU6A 4TYEA 2IPXA 5AIRA 2UZBA 4U80A 4BL1A 5KMLA 4L7FA 3BV2A 4AZTA 2W06A 3RVGA 4C35A 3L9PA 1AGWA 4WBOA 4PMPA 2WMWA 4YZMA 3QGWA 2Y4IC 3C4XA 2X7FA 4MF0A 1U5RA 4FSYA 3RAKA 4FT0A 5EYCA 4C57A 5K4IA 4ASEA 4B0GA 2OIQA 2UW8A 1AQ1A 3AD4A 4I24A 4FV8A 4U6RA 4Y85A 2ZB1A 5FTQA 3ZRLA 1WMKA 3BRBA 4GFMA 2VWXA 2ERZE 3MIAA 2E9UA 5BMSA 4MQ2A 2IW9A 4OT5A 5GNKA 3GU4A 2WMSA 4YJQA 5A4QA 3VHKA 4IB3A 2OIBA 1H0VA 4RX7A 1XR1A 2XEYA 3SXRA 4GKHA 3PZEA 4F7SA 2C0TA 1J7IA 3QAME 3PJ1A 4ZIMA 2B9FA 2JKQA 3R9RA 2PYWA 4BTJA 4S31A 4TWCA 4IWOA 2JDVA 3IG7A 4FMQA 4MXCA 5M09A 5F95A 4QYYA 2BZHB 3U87A 2CNVA 4YSJA 3G0EA 2HCKA 2WXVA 3LM5A 4E5WA 5CAPA 1JKTA 5CEPA 5ANOA 4C38A 1CM8A 2OF4A 4UBAA 5F94A 4HCTA 3TWJA 4O2ZA 5HI2A 3ZU7A 5E8SA 3KK9A 5EHYA 4FL1A 1H27A 3OMVA 1UU7A 2OJIA 2G2FA 3O71A 1OKVA 2O2UA 2XK6A 5LVNA 5HEZA 3D15A 2C5NA 5FXRA 4JDHA 4FTCA 4YUQA 3FY0A 2DQ7X 2QR7A 4DEHA 4IAIA 4DH1A 2VTMA 3KN6A 3LIJA 3OEFX 3TUBA 3FZSA 4NYEA 5J87A 4QMVA 3FZ1A 5LMKC 4RT7A 3QWKA 3ORZA 4AT4A 3ATTA 3H9RA 3NYNA 4FICA 3A62A 5CU2A 4LGGA 4AGCA 4AN3A 3R9OA 1KE8A 4OBQA 3QTXA 3QC9A 4QNYA 4NZWB 4M67A 1G8SA 2XCHA 5GIPE 1WCCA 5DEWA 4K18A 4E5AX 1ZY5A 3LFQA 5HOAA 3DT1A 4ZMFA 4KIKA 4EOQA 5JEBA 1OKYA 1WAKA 2OLCA 3OVVA 3ZLWA 3EZRA 2JBOA 4J8MA 3AC5A 4RC4A 3WI6A 2B7AA 2BDJA 5JGAA 2JC6A 2VTPA 4E5BA 5F20A 4F9WA 1PMVA 3UP7A 4GRBA 4HVGA 1CTPE 4L46A 3OHTA 3FYJX 4RFMA 4ANBA 2FSOX 4EUTA 3OS3A 2QG7A 3PFQA 1PXIA 3W16A 2XJ1A 2A1AB 4HGTA 4WO5A 3QA8A 4I4EA 4FR4A 4ZJJA 1OBDA 4X3JA 4E7WA 3RPOA 3C5IA 4IZYA 3RM6A 1Y91A 2GHGA 3IW8A 4V05A 3TNHA 4YPDA 4ZEGA 4M68A 2Z60A 3VUDA 4IXPA 2PZPA 4K8AA 2WQNA 4J97A 3DXPA 5EDPA 5J8IA 3PPJA 3ZDIA 3Q52A 3P23A 4NJ3A 4K77A 3SOCA 3LCTA 5E1SA 3HAMA 2BROA 2GNLA 4JIKA 1UU8A 4TYHA 4BI2A 4ZY5A 4AE6A 5I9YA 4JDIA 3OBGA 3MIYA 4XCUA 3FLQA 4O6LA 3GXLA 5JFVA 4D28A 5AA9A 3E7VA 5CEMA 3NW6A 2C0IA 3D7TB 4PP9A 5BUJA 2XIZA 5H9BA 1ZZ2A 3PWYA 4HGLA 4MH7A 5LVLA 1PY5A 2BPMA 5L2TA 2OJJA 2UW0A 2GS7A 4A06A 4OUCA 1WZYA 4L44A 2BILB 4FG9A 5LMKA 3DGKA 5K0XA 4A9RA 2BZJA 4FSMA 4AG8A 5BUEA 5IEVA 3GBZA 3JY9A 4UXLA 4AA0A 3ZSHA 4KA3A 3FMHA 3IW5A 3II5A 5JN2A 3DBEA 1H25A 3MPTA 4FKJA 5KHXA 1Y6AA 1YDTE 5KHWA 2RF9A 1W0XC 1O6YA 5B2KA 5CXHA 3CP9A 3P0MA 4M66A 4RFZA 3FZRA 3PIZA 3SGCA 3IDBA 5HG5A 5BYZA 4C58A 1WBVA 1H1PA 2XZSA 4NKAA 1PJKA 4FT9A 1SZMA 3GFEA 3LXKA 1F3MC 3UVPA 4C0TA 4QMMA 4HPUE 1KE9A 2QURA 3FI2A 1OI9A 3NYXA 3C9WA 4EL9A 4F08A 2OFUA 4ZOGA 4ALWA 4YC8A 4AE9A 4CMUA 3SHEA 4EK4A 1BUHA 2WTCA 3GT8A 5DI1A 1UU3A 3OXIA 5HVKA 3FWQA 4WD5A 4ALUA 4BWKA 2RFNA 4QMQA 3E8DA 3L8SA 1ZXEA 5CWZA 5L2QA 5M44A 1Q24A 4Y5HA 4HOKA 2YCFA 5CVFA 4ERWA 5A4CA 5IEYA 3ETAA 3ITZA 4DEDA 2BKKA 3OG7A 3PP1A 4CXAA 5ETCA 2JIUA 3HKOA 5KMKA 4EH4A 2ITOA 3IPHA 2VTIA 4HZSA 4TW9A 2WQMA 1W82A 2YJRA 2VAGA 1YDRE 2J90A 3QC4A 3Q32A 2XJ2A 1XH8A 4UY9A 4Z3VA 2OO8X 3F2RA 3QQFA 3MB7A 4QOXA 3RPRA 5BQ0A 5DA3A 5AP4A 4G3FA 5D9HA 4OTQA 4ANLA 3U55A 5A4EA 4EOLA 4YZNA 1IA9A 3G6HA 2NPQA 4I21A 4G6OA 4Y5QA 4QYFA 1AD5A 4DFXE 3KRXA 4ZTHA 3DDQA 3DK7A 3TEIA 3UMWA 3MI9A 3ZO2A 3W32A 3ORMA 1Q99A 1PYXA 2HAKA 4E3CA 4O0RA 5FBNC 5J79A 2R3KA 4DYMA 2OBJA 2UW5A 4O7ZA 4C3PA 3MYGA 3PY0A 3QFVA 2OXYA 4ZY6A 2REIA 5IMEA 3NIZA 5AAEA 4JG8A 2IZRA 4TWOA 4H3QA 2FSMX 2R2PA 5A3XA 4GFGA 1LEWA 2IZUA 4FEVA 4PTGA 1FPUA 3NRMA 4UMQA 2HOGA 2UW7A 3WIGA 3CPBA 3O7LD 3W18A 4EHEA 5HGIA 3U9NA 2XKCA 3LFNA 2OZOA 4MF1A 4X2GA 3V8SA 2O3PA 2QU6A 2W96B 4Q9ZA 4X3FB 2ZV8A 1JSVA 2PZIA 4IE9A 5E91A 1DI8A 4U79A 4G3DA 3BGQA 2AUHA 3D94A 3EIDA 2BTSA
chains in the Genus database with same CATH superfamily
4BRXA 3O8TA 5EYKA 5EOLA 3PLSA 2XNOA 2OFVA 3PUPA 3DBDA 2OU7A 3OY1A 2ZDTA 4GIIA 3R2BA 2GPHA 3QXPA 4NIFB 4XJ0A 5TKDA 4EOIA 5BPYA 3T3UA 5AV4A 4BIEA 3BWJA 2R3FA 1H1RA 2YAKA 4I6FA 3W33A 4EH9A 3O5AA 4H05A 4ZS4A 5K5NA 4EH6A 3Q53A 3R00A 2VNYA 3EKKA 3TIZA 4EZ5A 1MRYA 4PWNA 4AA4A 1W7HA 3ANRA 2OXXA 2EB2A 3OTVA 5FG8A 4AW1A 2IVTA 3R21A 3IDPA 4P5QA 4YZBA 4E6QA 4E26A 2YITA 4TL0A 4HYIA 1UNHA 5G6VA 5J7BA 4YTIA 4ENXA 4E4XA 4IJPA 4U40A 4BJJA 4BHNA 2HW7A 3EQPA 5I9XA 3TM0A 2C5YA 4FV3A 2IVVA 4JRNA 4PMMA 4RJ5A 5EH0A 3VWAA 4AZSA 5KMMA 4CYIA 4U97A 4KKHA 4FX3A 2X0PA 5GJFA 5KZ0A 5J5SA 5LXMA 2OZAA 2C3JA 4DDIA 3KRRA 4MCVA 4RSSA 2JIIA 2GNHA 2SRCA 3BI6A 3NCZA 4C4FA 2Q0BA 1BLXA 3D2KA 5KMJA 2C6TA 2VWYA 3C0HA 2HWPA 4APCA 1VLRA 3BZ3A 2YIXA 2XF0A 4D2VA 1F0QA 3L9LA 4CKIA 2YCQA 1H1WA 2GNJA 4R8QA 4G6NA 4XLIA 4RZVA 4UXQA 5M07A 4ASXA 3VS1A 3F3ZA 3R71A 1M2RA 2NP8A 4I6BA 3GCSA 4RIXA 2Z7LA 1I09A 3R7VA 5T68A 4X2NA 2HZ4A 5DE2A 5E9EA 3N4VA 3DQWA 4O7LA 4BCKA 3POZA 1YKRA 3BGZA 5E8VA 3D5WA 3ZEPA 1Z9XA 3NNWA 2GMXA 4V0GA 1EH4A 2V22A 3BPRA 2ITWA 2UZWE 2CN5A 1R1WA 3RPYA 5JH6A 2CKQA 2QLUA 2A0CX 2X81A 5LCJA 4KSPA 4EC8A 5A9UA 2F7EE 2CKEA 5K4JA 3UOLA 1STCE 3EN7A 1H4LA 1H08A 1B6CB 4D2WA 1IA8A 4XBRA 1U54A 4AW2A 3LAUA 1XH9A 2G9XA 5KCVA 2VWIA 1J1CA 4QMPA 4FRFA 3F5UA 3ZRKA 4C36A 1Q3DA 4ZMEA 4FTIA 3PRIA 3V8WA 5AP7A 4ACCA 2F57A 5HVYA 4IB1A 5EKOA 4A9YA 2JDOA 2YA9A 4MVFA 4MYGA 3Q3BA 4UYAA 4D5HA 3OW3A 4B8MA 3M42A 2H9VA 3ZSIA 2UZOA 3GCUA 3KU2A 3A7JA 4I93A 4F1MA 1JKKA 2PPQA 2J9MA 3BV3A 3OT3A 4FSZA 4MNEA 5DLSA 5L6WL 3KIOC 3KXHA 4X2JA 2C69A 1GJOA 3R7OA 4LRJA 2PVHA 2YDKA 2P2HA 3FMJA 1U59A 5KBQA 1DAYA 3GU8A 5A6NA 1FGKA 3NUYA 3OOGA 4FEQA 4YLJA 3I0QA 5TO8A 4DBNA 3QLFA 3V51A 4QQCA 3PXKA 3QQLA 2BFXA 1Q62A 2IVSA 2WGJA 4YJUA 5H2UA 5HBEA 1MRVA 3H4JA 1H0WA 4R7BA 2CPKE 3AT4A 3CPCA 4JI9A 5I0BA 3OBJA 3G6GA 3MJ1A 3NW7A 4JS8A 4BDIA 3O8PA 3QBNA 3VUIA 5CU3A 3ZLXA 2VUWA 3R28A 2PZRA 4X2FA 3EH9A 4BN1A 5EW3A 3LMIA 4F9AA 1E1VA 4ENYA 1PXMA 3SV0A 4HVIA 1TKIA 2W1FA 2R3OA 4OTFA 3UC3A 5DHJA 5LVMA 2GQRA 4Z55A 4AW0A 3HA8A 2B9HA 4CFUA 2UW4A 2CLXA 2GHMA 4RIYB 3CTHA 3FQSA 3QX4A 4L67A 4FV4A 2QI8A 2WTIA 4Y95A 3U4WA 1UNGA 4EQUA 3UIBA 3VS7A 3V6SA 4U41A 4ORKA 3SRVA 4L68A 4DH8A 3AKJA 3QQHA 2WIPA 4AAAA 1M7QA 3BBTB 3V01A 2YWVA 1YDSE 4HNFA 5A46A 4YURA 4HW7A 4DAWA 4HCUA 5E90A 1LUFA 2WMXA 5HG7A 5JKGA 4PPBA 4PF4A 3ANQA 4FKPA 4FIFA 4GVAA 5BMMA 2WELA 5A4LA 3R1NA 4QPAA 4WNMA 3OT8A 3AGLA 3NS9A 5TR6A 4JT3A 5HD4A 1VJYA 2J50A 4DBXA 2YHVA 4EH3A 3IKAA 3VQHA 2VRXA 3FI3A 3RHXA 3FJQE 5AV1A 4XS2A 3G15A 3UDZA 1YI4A 4YJSA 4DCEA 4I6QA 4A7CA 1UKHA 4BIDA 4WSQA 2PVNA 3DJ5A 3KRJA 1P4FA 1UA2A 3MPMA 4O2PA 4OGRA 4YLLA 3R83A 4C33A 2VO7A 2ZMDA 2ONLC 1IASA 4RVKA 3IOPA 4J52A 2ACXA 2R3QA 3AT2A 2XP2A 2JAMA 3UC4A 3LM0A 3DDPA 5HU3A 4IJ9A 1Q3WA 2WTDA 3GU5A 2ITPA 3H10A 4FV0A 3TZ8A 4D2SA 1OIYA 3RZBA 4YMJA 5D10A 4EOKA 5AUVA 2VWUA 3ZH8A 4UX9A 3EMGA 5HE3A 4G3EA 4J7BA 2XVDA 4XNEA 3PSDA 3C50A 2PE2A 4AW5A 4XP3A 1OL6A 4GJ3A 4RVTA 4O0SA 3SG8A 3BYUA 4MXYA 2YERA 5E4HA 5CU0A 3HL7A 2C47A 1VZOA 4J95A 3KMUA 1NVRA 3U6JA 4M14A 3BHVA 4DFNA 3VAPA 3W0RA 3IONA 3DNEA 4PX6A 5EW8A 2OK1A 3FLWA 4RA5A 5D7VA 2PUIA 4S2ZA 3RK7A 2OJFE 3CBLA 2C68A 2W1HA 4FNWA 1LPUA 2XIKA 3MFTA 3QRJA 3TZ7A 3OROA 4O86A 4AFJA 3CSVA 3PG1A 1H1SA 5EM7A 3IGGA 2V7AA 3AC4A 2RGPA 1Q8TA 2C6EA 4FV7A 1OUYA 4IMYA 3NVKI 3EFKA 4AUAA 1JKSA 2FSTX 4M84A 2P55A 3KKVA 4EZ3A 5JT2A 4LOQA 2WQEA 2HZIA 5C03A 5TT7A 2YACA 3DBQA 2CGXA 4IZAA 4XRLA 4CCUA 2VWWA 3TDWA 4II5A 2W4OA 5CEIA 5M4UA 3CLYA 3MW1A 2GSFA 2PUUA 3AMAA 3IECA 3KMWA 2X4ZA 4FI1A 5AP3A 5EI8A 2VNWA 4YJRA 3FMDA 4AN2A 4ZP5A 1ZMVA 3TUCA 2WEVA 2ZM4A 4O38A 3OXTA 5DT4A 4DEBA 4DFBA 4DHFA 3HYHA 4HZRA 2W4KA 4JX7A 4YP8A 3VJOA 2R7IA 2UUEA 3QCXA 4G9CA 2Q0NA 4RIOA 4GT5A 4CMTA 2ZV9A 3ALNA 2YZLA 4DEGA 3GFWA 3PUFC 3FMKA 3W0PA 3F9NA 4PL3A 2BRHA 3BU5A 5DYJA 3WARA 5FDPA 4IX3A 3W2SA 2XBAA 5FD2A 4DFLA 2GS2A 1Y6BA 4AZEA 3EKNA 2A27A 5F1ZA 3PXQA 4IADA 1E9HA 2ONLA 3AD5A 3GGFA 4FOBA 4FVPA 4JDKA 5IA3A 4CG8A 3WZUA 4LGDA 2E9PA 1ZAOA 5EM6A 4FF8A 3ZZEA 2EVAA 2YM8A 3WIKA 2BR1A 4G5PA 4OLIA 3ROYA 1HCLA 4WRGA 2PZYA 3NCGA 2ITUA 5FGKA 2V62A 4BVUA 3NR9A 4WOVA 4MUQA 4XHKB 2PVLA 2HIWA 4FGRA 4PDYA 4TNDA 4I0RA 3PXRA 4FJVA 5AMNA 3A7FA 3LKMA 4XLVA 2J0KA 3HP2A 4WHZA 5EDQA 5IISA 4AT3A 3NGAA 1K2PA 4FV6A 3EFWA 3COHA 3H3CA 4PL4A 2QOQA 4UV0A 4F70A 1R0EA 4EYMA 3OP5A 5HIDA 3LMGA 1JAMA 3ODYX 3O7LB 3PJ8A 2OKRA 4K1BA 4BWPA 4W4YA 3D7ZA 4FVQA 4D9UA 3PJCA 2CCIA 3ID6C 4M97A 1ZYCA 1OL2A 4Y83A 5BX0A 2RFSA 5CI7A 4DEEA 4DLIA 4TRLA 5CSHA 5FEQA 4FUXA 5ACBC 3WE8A 3VS5A 4EWQA 3E87A 5JFWA 2RFEA 1XBBA 4WNPA 4RIWB 3ZONA 5C8NA 3HMMA 5KKRC 3N4TA 3RCJA 2B53A 5KBRA 2X0OA 5IMXA 3VIDA 4DT9A 2W5AA 5ACKA 4C4IA 1OPLA 4IVBA 3W8LA 2PVRA 2HY81 4O4CA 3TG1A 4LUEA 3TNWA 2ETKA 2WAJA 3G90X 3JVRA 5EYDA 1RE8A 3C0IA 2JKMA 2O64A 1PYEA 3UPXA 3LFSA 4QYGA 2HY0A 4MEDA 4AGWA 2GU8A 5FM3A 3V5QA 4U0IA 3D7TA 5HLWA 3FZOA 3HRBA 1Q8YA 3PG3A 3EL7A 5LARA 4ZZOA 2V55A 2BIKB 5FBOA 4ITIA 3RBWA 1PXKA 2YISA 1WBOA 4PUZA 2UZDA 4FTUA 4W9XA 4BTKA 2ITNA 3RAIA 4R7HA 4NEUA 3E7OA 5M4FA 2PMLX 2Z8CA 1OBGA 1SM2A 2HZNA 4MX9A 3DV3A 4JL9A 3EQBA 2BTRA 3FSKA 4K0YA 1JOWB 4WSYA 2VD5A 3QTZA 4FEXA 1T45A 3DZQA 3PTGA 4LUDA 4OR5A 5HG9A 5FQDC 3VUGA 4AF3A 3R30A 3C4ZA 4PDSA 3S3IA 1UWHA 4E6DA 1NY3A 2HYYA 2Z2WA 5EG3A 3VBVA 2CHLA 2XM8A 1ZARA 3DKOA 4IB0A 4XRJA 4JQ8A 1KOBA 2C3LA 2ZM1A 3VUTA 3VUMA 3IO7A 4Z16A 3PJ3A 4JR3A 3P7CA 5A4TA 2YM4A 2ZB0A 5I3OA 5IH5A 4KD1A 4XP0A 4CZYB 3COKA 4KB8A 1ZOHA 3F88A 3FQEA 4PRJA 1Q8WA 1P5EA 4LMUA 2ITXA 2BHEA 4DCAA 1UKIA 4OTRA 3OEZA 4XV1A 1W83A 3CC6A 2ITVA 5F4NA 5CAQA 1ZYSA 3KY2A 3DFCB 4RLLA 5FEEA 5EOBA 4UWCA 5BVEA 4NH1A 4GG7A 3U8WA 5AP1A 1YVJA 2W5BA 4ZTLA 3TTJA 3NVMB 4O21A 4XG6A 3T8OA 4BBFA 3C4EA 4IB5A 4P2KA 3U51A 2JD5A 3VN9A 4M69B 3QF9A 3H0YA 5AX9A 4AZWA 4CTBA 3ZFMA 1PMNA 4BICA 4EQMA 2IG7A 2GCDA 3CJFA 3ZM4A 1ZMUA 4CNHA 3HZTA 3L8XA 4I20A 2JDRA 4ZLZA 3QD0A 4F65A 2NRYA 4F9BA 4CQEA 4N6ZA 4S32A 2CKPA 3KK8A 3HX4A 5CAUA 4FGBA 5IG1A 5L8LA 2BDFA 4ZTRA 3R8PA 2WB8A 4MKCA 1IEPA 5J95A 3U9CA 1PKDA 1OB3A 5C9CA 3OOMA 3HA6A 2E9NA 4QYEA 4BCFA 4N0SA 1IAHA 3FV8A 1OKWA 4H36A 4WKQA 1M17A 2WMTA 3ENMA 4I0SA 4DINA 3VRZA 5AM7A 3FKNA 5IQGA 4LRKA 1WVYA 5CNOA 1JSTA 3HV7A 4R77A 4QDEA 2CGVA 3A4PA 1M7NA 5T3QA 4DTKA 1GAGA 3FMLA 3M1SA 5IZFA 2W1ZA 2KTYA 3GQLA 4J99A 3ULZA 4M15A 5HO8A 4RX9A 3D5UA 4QMZA 4AT5A 5M4IA 1XWSA 2WKMA 3ROCA 4R3CA 3NMUF 1TFFA 3ZO4A 3LCSA 2KULA 2WFYA 2BFYA 3LMHA 1YXVA 3B8RA 3S00A 2WNTA 3PJ2A 3FKLA 3UNZA 3VJNA 2W1CA 3RHKA 4X3FA 3LXLA 4F0GA 1ZYLA 4DGGA 4L9IA 4JDJA 3VBXA 1A06A 2HWOA 5IU2A 2Y8OA 5HNIX 5IA4A 3FI4A 2X8EA 4AQKA 3FAAA 3UTOA 3LLAA 3EQGA 2WOUA 4H1MA 3NSZA 5IQIA 2X9EA 4M7IA 4RMZA 3N4UA 5CSWA 1ZLTA 4XG3A 3O17A 2I7QA 4Z9LA 4H3BA 1ZZLA 3NYOA 3GCPA 4YBJA 3D9VA 3CD8A 5GZAA 2XJ0A 5AAFA 2WD1A 3RWQA 4NIFA 2BDWA 4ITHA 3ORLA 4ARKA 3ZBXA 5ITAA 2XAMA 3IW6A 3LOKA 4JBOA 2IZSA 3FQHA 3FPQA 4F09A 1ZOEA 3GQIA 2FH9A 4AN9A 1URWA 4IAZA 2LAVA 4LDTA 4ACGA 4ZZNA 4IWPA 1V0BA 4LOOA 1H28A 3QYWA 5IQDA 3EQIA 3DKGA 4X21A 3PPZA 4NFNA 2B4SB 3V8TA 2OF2A 2UZEA 3DJ7A 3R04A 4R6VA 4DEIA 5HLPA 2PULA 4QDVA 4U3YA 1L3RE 4IAKA 2GTNA 5F9EA 3TJDA 3FLSA 4KWPA 3R9NA 3BWFA 2CN8A 2I0VA 3QGYA 4FK3A 2ETMA 3CGFA 3HECA 5L2SA 2Z7RA 2JITA 1YWNA 3HMPA 2YDIA 2NNWB 4JG6A 2W05A 4IM0A 1JBPE 5AV2A 3T9IA 4EK8A 5B7VA 3R22A 4BHZA 4FSNA 5JRSA 3ET7A 1PMUA 4W4WA 3V3VA 4C3RA 4WNOA 2XK4A 5J9LA 3TDVA 4IW0A 4XEYA 4DHZA 4FTJA 5IPJA 2YJSA 1BL7A 4ZSGA 1BI8A 3LQ8A 4OTDA 3W2PA 5HG8A 4DA5A 1KE7A 3P86A 4I5PA 4QP7A 3B2WA 1OPKA 1Q97A 3DKFA 3G0FA 3QQJA 1ATPE 2ERKA 3C1XA 5HTCA 3OXZA 3ALOA 3BIZA 4YHTA 2YIYA 3FC2A 5HCYA 5BVFA 5EQEA 1VYZA 3P08A 2WQBA 5CI6A 2VWBA 2I0EA 3QUPA 5HX6A 5IDNA 3TI1A 1G8KA 2GFSA 3PPKA 4A9SA 4DG3E 1YRPA 4WNKA 3ELJA 5AUXA 3EQFA 4C2VA 4LRMA 5E8YA 1VEBA 5FTOA 3LFCA 4O0XA 1KV2A 1O6KA 3OCTA 4BI1A 3IOKA 4QMWA 3E3BX 1ZWSA 3R73A 4FUYA 5AR4A 3CTQA 2B54A 4L53A 2WMQA 3MH2A 2FSLX 2JGZA 4NK9A 3BYSA 1YHSA 5DPVA 5IQHA 3KQ7A 5DG5A 4CV8A 1MP8A 4D0XA 4DF3A 2F2UA 3QZHA 1VR2A 4ZSJA 4DH3A 3MY5A 3BL7A 3Q04A 1G3NA 2JDTA 4D55A 3TMOA 3QLGA 3OUNB 3UODA 2ZVAA 2XNMA 2VTTA 3EHAA 1G8JA 3OC1A 2X7OA 5BVDA 5CF8A 3BLAA 1ZOGA 3ZHPC 4P7EA 3KXMA 3HAVA 4DN5A 4QMOA 3TL8A 3CJGA 3V5JA 2X2MA 5I5ZA 3DXQA 2J0LA 5CLPA 1CKIA 3W8QA 3PP0A 5L2WA 2RSVA 3UQGA 4USEA 3F66A 3EN6A 4JRVA 4XUFA 4XYFA 5M53A 3MY0A 3RINA 1MQBA 4G17A 1Z57A 3TN8A 5CEKA 4LI5A 4QO9A 2OXDA 4YTHA 4O84A 5KE0A 4CD0A 3AT3A 3FUPA 3CCNA 5AFVA 3V6RA 5FRIA 3AMBA 4O0UA 3QA0A 2EXEA 3ORNA 5E8ZA 3T9TA 2E9OA 3L1SA 4E4MA 5AUYA 4BIBA 3SQQA 5HZNA 4F9CA 4C61A 1IAJA 2YM3A 2PY3A 4FL2A 3QYZA 3R1QA 3UDSA 3GC8A 4JAJA 2BZKB 5LWNA 1OECA 3TV7A 2EUFB 2GQSA 2WOTA 3CY2A 4O4EA 3LZBA 2UV2A 4F7LA 1ZYDA 4GYGA 3SAYA 3O8UA 2VO6A 3UO6A 1GIIA 2WO6A 1G5SA 5C8MA 4ANSA 5A14A 4RFYA 3I60A 5H8BA 3PY1A 3QTQA 5J1VA 2PE0A 3KN5A 2YM6A 3KF4A 1NT2A 3F61A 3WF9A 2DWBA 4WRSA 3H9FA 4GCJA 4NTSA 1WBTA 3Q5IA 2VWZA 4W9WA 5CQUA 4O7WA 2VN9A 2QO7A 3ZUUA 4EZ7A 3NIEA 2Y7JA 1KUTA 4FTLA 3ZLYA 1PXJA 2WMAA 4GK2A 5IA2A 4O91A 2YIQA 5HCZA 1YWRA 5AP2A 4YJPA 2JLDA 3Q9YA 2H8HA 4H58A 3VF8A 2FB8A 3ZLSA 3TKUA 3FXXA 4IC8A 2YFXA 4EI4A 4QMNA 2PTKA 2HENA 4Y46A 3SLSA 5ANIA 1YHWA 2P4IA 4D4VA 2R64A 5BVNA 3TNIA 2Y6OA 4LG4A 3KVWA 5DT3A 4L7SA 1S9JA 4QTAA 3O23A 1OIUA 4DE4A 4FTAA 4LYNA 4RRVA 2GNFA 3FHIA 4ANOA 2GNGA 2IO6A 4JBVA 5DEYA 3RTPA 5IA0A 3EFJA 4YHJA 3DJ6A 3PXZA 2RG6A 1B39A 4MNFA 3R7IA 2IVUA 2YZAA 4IZ5A 4YBKA 4A4OA 4BF2A 4CGAA 5L8KA 2C1BA 5FP6A 3RGFA 3NUSA 4YNEA 3I6UA 5E8UA 4RJ6A 5LOHA 4RBLA 3NUNA 1KWPA 1XO2B 5EDRA 3Q9ZA 4B8LA 3PXFA 1R0PA 2ZFYA 1LP4A 3L9MA 1PXOA 3R7GA 3DTCA 4AOTA 5AA8A 4A9UA 3P7BA 4EUUA 4BCMA 4HYUA 2CNUA 4FV1A 3CQUA 3UVRA 5EM8A 2YIWA 2X0QA 3W2CA 4E73A 4IVCA 3A4OX 3R8ZA 5GINE 4JVGA 3C4WA 4DC2A 3LE6A 3E93A 3EL8A 4S30A 2ZAZA 4LV8A 5BVKA 4ZJVA 4ZSAA 4LL0A 1OMWA 4J96A 4OTIA 2XM9A 5CSPA 2O65A 2VO0A 5CF4A 1YOJA 3HDNA 4F0IA 3DB6A 4R78A 5FUTA 3Q6WA 2HXLA 3W10A 4K2RA 5CXZA 4D2PA 2PMIA 4W4XA 1ND4A 2J0IA 4QTEA 2F7ZE 2OI4X 3KCKA 4O6EA 5GJDA 4OBOA 4BCNA 5CEOA 4FKQA 2YLEA 1V1KA 2CGUA 4PV0A 4TN6A 2EU9A 1XH5A 5CU6A 1OZ1A 2JKKA 1REJA 4I22A 4I92A 5HU9A 4L3PA 3HRFA 4CVAA 2XRWA 4Y8DA 1YOLA 1IRKA 5D12A 2ZMCA 5GZ8A 5CQWA 2I1MA 4YLKA 4O7YA 4W8EA 2R0UA 1TQMA 4ZSLA 3QHRA 4FOCA 4FV2A 4TYJA 5AUUA 1U5QA 1X8BA 5LVPA 5I9UA 1WBSA 4USFA 4ZZMA 3W1FA 2BKZA 2R3IA 2XIYA 2O63A 2B55A 3AC2A 5EI6A 4ANNA 3DQXA 4ID7A 1NVQA 3R6XA 4OTWA 3UDBA 4C4GA 3PE2A 5IQBA 5JSMA 3LFEA 3RI1A 2W0JA 2BHHA 4FTRA 1JVPP 3V5LA 4WG5A 3KA0A 2X4FA 4M12A 3FC1X 4IAYA 3VS3A 4B99A 5FP5A 3TUDA 3P9JA 3JUHA 5E92A 1OIQA 3M11A 5GJGA 4QPSA 3IQ7A 3COMA 4UMRA 2W5HA 4KINA 2RG5A 4R5YA 3FHRA 5L6OA 4EH5A 5A54A 4P90A 3QD3A 4CCBA 3GP0A 3PVUA 5HNBA 3WZEA 4E8AA 2QOFA 3EWHA 2JKOA 4NM0A 3QXOA 1RQQA 4NW6A 4DLJA 5CZIA 3QQGA 2JBPA 4LFIA 2OIDA 3KF7A 3PWDA 4NCTA 5J9ZA 4MD7E 4LV5A 4IVDA 4F99A 4DFYA 4HJOA 3Q4CA 3KGAA 4A9TA 3ZXTA 4HVSA 3P79A 3OCBA 4J53A 2QD9A 4EJ7A 4C2WA 1URCA 3H30A 2O0UA 4L6QA 2CDZA 3R2YA 2Z7SA 1FMOE 3NNUA 4XG4A 5IH6A 4O96A 3RK5A 3AG9A 4KAOA 3TKHA 4HNIA 2P33A 2UZVA 3UIMA 1A48A 3P7AA 4YO6A 1L8TA 3BYMA 2ZDUA 3I81A 2BAQA 4FZAB 4JX3A 4E1ZA 4NL0A 3QTRA 2X39A 4J8NA 5KZIA 1WVXA 1QMZA 3PZHA 3KB7A 2XAOA 5CSVA 4AAYA 4F7NA 1KE5A 3ZDUA 1FOTA 4GU9A 2I0HA 3V04A 4RIWA 3ZUVA 4AXFA 4TWNA 2GHLA 2XKDA 3VONA 5KX8A 1YOMA 3FKOA 4ZXTA 4GK3A 3FYKX 4ITJA 4N57A 4QRCA 1Y8YA 2CKOA 4GG5A 2BAKA 2UZNA 2EXCX 2VTNA 3QKKA 4KBAA 3E88A 4ZLYA 4QPMA 3B2TA 2QKRA 5JGDA 1ZRZA 5I9WA 5AR8A 4UYNA 1H26A 2Y9QA 3TKIA 4IANA 3R7YA 4EKLA 4P5ZA 3BYVA 3VC4A 1ZY4A 5I3RA 3BHYA 1Z5MA 1YXTA 2WMRA 3R02A 4G31A 3MVHA 1OL7A 1WVWA 3GB2A 4TWPA 4BKZA 3ML1A 3S2PA 4MHAA 4F4PA 4EHGA 3DAJA 4YSMA 5HNGA 5ANEA 3WBLA 1NW1A 4CZUA 5AUTA 1M2PA 4MBIA 5LCKA 4O7TA 3GOKA 4KS8A 4C34A 3UDTA 2XKEA 3HDMA 4QD6A 2VTQA 3BEGA 2DUVA 4BTFA 2VZ6A 3CE3A 3K5UA 1W84A 5CNNA 4IWDA 4Q2AA 3BX5A 4CV9A 4EYJA 2C30A 1W98A 2J0JA 4RWIA 4BCIA 4YU2A 4QP9A 2YM5A 1JWHA 4PNKA 3RCDA 4R1VA 3D2IA 1CDKA 4MK0A 5EFQA 3S95A 3K3JA 2F4JA 2FUMA 3D5VA 4RX8A 4F0FA 1Y57A 2UVYA 4K9YA 2ITQA 1Q4LA 4UALA 3LXPA 2G01A 4BDAA 1YHVA 4PPAA 1LEZA 2WTWA 3U6HA 3KMMA 1UV5A 4RG0A 3NUAA 5CEQA 4C4EA 2W99B 4YHFA 4RJ3A 4LGHA 4YPSA 4JNWA 4KABA 4U5JA 5AX3A 5ICPA 3WF5A 4R5SA 4C62A 5GIOE 3LFAA 1W8CA 1TZDA 1XH7A 4H1JA 5L8JA 4M69A 4AS0A 5K0KA 3AOXA 3DTWA 3MFSA 4RA4A 3ZRMA 3A2CA 2PU8A 1IR3A 2XIRA 3OY3A 3R1SA 3FL4A 5C8KA 4U81A 2OJ9A 4AQCA 4BR3A 5CAVA 2EB3A 3AC3A 4E4LA 1M14A 2W9ZB 3NNVA 2PVMA 4S34A 3U4UA 4AOJA 3NUUA 4MXZA 4D4YA 4BBMA 4E6CA 3EFLA 3ATSA 3OUKA 2HXQA 5D1JA 3ZC5A 4O0YA 1JLUE 4IC7A 3Q2MA 3QTSA 5EQYA 3R8UA 4LMNA 3UG2A 4TY1A 4WIHA 3Q4UA 4ANMA 4FEUA 1GNGA 3HLLA 2ITTA 4EK3A 2PVFA 3REPA 4FYNA 3KXGA 4FSWA 4KIQA 4D4SA 4BGGA 4F64A 4G1WA 4GVJA 1G8AA 1I44A 4QT1A 3C4FA 1YXUA 3C13A 3LXNA 3JXWA 3WZJA 4BGHA 5IKWA 4DITA 3A61A 3FL5A 4BDHA 5CSXA 1YQJA 4FVRA 4BB4A 5K5XA 3F2NA 5DR2A 5HD7A 5CALA 5E8XA 4FIHA 1OM1A 2B0QA 4O0WA 3NEWA 3FLZA 4PQNA 4PMSA 5HO6A 3FLNC 4D2TA 5AR5A 4OAUC 3WOWA 3SXSA 4BDKA 1A9UA 3IW7A 4IFGA 4JIAA 4L00A 4BDBA 4CFVA 5IF1A 3F3UA 3QTUA 4JAIA 4QMLA 2XK9A 3MESA 2QU5A 4D1SA 3W55A 5AR2A 1H1QA 4BZDA 4AXDA 4EBVA 2Z02A 3MH0A 2XANA 5IQFA 3LW0A 4UB7A 5ETIA 2ITYA 1PHKA 2UVXA 2Y4PA 2W17A 4L01A 4XX9A 3FDNA 4I5HA 1QCFA 4CRSA 4H39A 1TVOA 4XMOA 5EK7A 2R9SA 4M0ZA 4UMTA 2XYNA 3ZUTA 4BCHA 2FA2A 2YDJA 4FSTA 4NU1A 3S0OA 2CLQA 3QQUA 3MGYA 2QVSE 3K2LA 3QD2B 4DHJA 4R1YA 1SVHA 1Q41A 3RMFA 4YC6A 2V7OA 4M8TA 4XP2A 4DH7A 3A7HA 4DFUA 1ST0A 2OGVA 4R3RA 4EC9A 2QHNA 4EK6A 4CSVA 5HO7A 3SW7A 1PXLA 2B1PA 2QNJA 3ULIA 3DA6A 2ETRA 3GU6A 2J0MB 1QPCA 2VTLA 3MVJA 3O51A 1OIRA 4IACA 3M2WA 4GV1A 3VBQA 5JGBA 3JVSA 4QNAA 2BRBA 5E8TA 3MTFA 3CTJA 5TF9A 3QRIA 5DR9A 4G9RA 2WQOA 3BU6A 2Q83A 3ODZX 1UVRA 1GZOA 2RKUA 3KL8A 4EBWA 4EORA 4EH2A 4CRLA 4CQGA 4Q9SA