3M1SA

Structure of ruthenium half-sandwich complex bound to glycogen synthase kinase 3
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
351
structure length
348
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTFFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glycogen synthase kinase-3 beta
publication title Structure of anticancer ruthenium half-sandwich complex bound to glycogen synthase kinase 3beta
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 348
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3m1sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3m1sA01
1GZKA 3POOA 4HZRA 4IC7A 5HG5A 2OIDA 2GU8A 4FYOA 1PXNA 4YJQA 1OB3A 4RFMA 4FIEA 4M14A 5KMIA 5LARA 1H27A 3A7JA 4BCHA 4FTIA 3NIEA 3LCOA 4D0XA 1XH5A 2PMLX 4L3LA 4AA4A 4E5BA 2EXEA 4OTPA 1JNKA 3AD6A 4NIFA 2UW5A 3RALA 5H8GA 5ICPA 5A4CA 3F2AA 2C6LA 5KHXA 3ORIA 4BKYA 3RMFA 3D2KA 3ZFXA 4CG8A 5CEPA 1Q41A 3DOGA 1ZZLA 2E9NA 5FTOA 4L3JA 3V5PA 4IQ6A 3L9MA 4F9WA 3ZLYA 4U79A 3ZTXA 3NLBA 5HLPA 3PZHA 2ETKA 3P79A 4DFBA 2I7QA 1BMKA 1Q3DA 3ZXZA 5ANJA 3V5QA 4RZWA 1Y6AA 4L00A 3GB2A 4R78A 1Q61A 3QF9A 3BPRA 4KIKA 2C4GA 4Y83A 5ANGA 2YZAA 5GHVA 5FDPA 3HYHA 1YKRA 2XKFA 2BRHA 1W7HA 2QQ7A 3R04A 1PMVA 3D94A 2W96B 4J97A 3QXPA 5HE3A 3F3UA 4L7SA 2GFCA 3PLSA 4XV3A 3QYZA 4FOCA 4FNYA 3ID6C 1PXOA 3LJ0A 4ANSA 3MPAA 5D41A 2YIXA 3A7HA 1X8BA 4E5AX 1XBCA 1Z5MA 4EZ5A 3HAVA 3E62A 2VU3A 4PL3A 1ZY5A 5FM3A 4KS8A 5EI2A 3SXSA 2C6OA 3QQUA 5HG7A 1ZOGA 3BU5A 2OSCA 4YGAA 4AE9A 4W4VA 4G17A 5CWZA 4XMOA 5BVKA 4IWOA 4ZTNA 4RFYA 3ALOA 4BIBA 3R28A 4E5WA 3BE9A 1E1XA 2HY81 2JBPA 3TT0A 3B2WA 1H01A 3SD0A 4CTCA 3I79A 4NYEA 4Q5EA 3GU6A 4RVLA 4W4YA 3VS7A 5C03A 4FBXA 4Q9ZA 1ZYLA 3Q32A 3HVCA 5CSXA 4BIDA 3IO7A 4S2ZA 2OZAB 4O0XA 4ZTSA 3PYYA 5FWKK 3NPCA 3C9WA 1M7NA 1G8AA 3UZTA 3P23A 3AT3A 4IZYA 2XNOA 4L68A 2W99B 2GSFA 4WHZA 2VGPA 1WVXA 2G2HA 3OEZA 4BBEA 2H34A 2QU6A 4BDFA 4LRJA 3O8PA 3NZ0A 3VW8A 2VTHA 4CCUA 3Q9WA 4AG8A 1PMNA 2VWWA 5LVOA 2ZV7A 3FKLA 4LGHA 5AR3A 3NUXA 4LL0A 2JLDA 3Q52A 5F9EA 4Q5HA 4OTRA 2VWUA 3O7LD 4P2KA 3R9HA 2QNJA 4O22A 2CLQA 2WTKB 4BTJA 1TQMA 4OBQA 1UU9A 4EOQA 2XVDA 4LOPA 4AOTA 5E8YA 4TL0A 2VD5A 2OFUA 3C4XA 4WNKA 1VYZA 2ITTA 2WMBA 5HD4A 1PRYA 3UYTA 2IG7A 1KSWA 3PY1A 3V5LA 4RJ7A 4TTHB 4J71A 4W9WA 5AR4A 4TYIA 3F82A 4KABA 4X6RA 2C5XA 4XUFA 3BEGA 2C5VA 2VUWA 1K9AA 3IOPA 4CQEA 4O7TA 1WBOA 2V0DA 4GT4A 3NUYA 4U80A 1O9UA 2R5TA 3TV4A 5ANIA 3BU6A 3E3BX 4BCKA 3AC8A 5K0XA 2IPXA 2YDKA 2EB3A 4YC3A 3Q2JA 3VS2A 4A4OA 1ZOEA 4F7JA 2P2IA 4C4HA 2WOTA 5C27A 5BVOA 1YI4A 1OL1A 3KN6A 3ZBFA 4AN2A 5L2WA 4ZLOA 3EB0A 4QYFA 5I9YA 2DYLA 4GYIA 3O51A 4UMUA 4JBQA 4O7NA 3EQFA 3PE2A 1WVYA 1IG1A 2C5NA 3HV3A 4TXCA 5GNKA 4C33A 2JGZA 3MPMA 3RWPA 3BBTB 3V01A 3ZSHA 2HCKA 4FV3A 4RIYA 4AN9A 3W2CA 3D4QA 3OWJA 3KQ7A 5DH3A 5CENA 4ORKA 4QTDA 4K9YA 4TWOA 4FEVA 5K5XA 3DKGA 2QOFA 3UO6A 2Y4IB 2WOUA 4K18A 3KULA 1RW8A 4ZJIA 4C58A 5KCVA 4R6VA 5L3AA 4HCTA 5M44A 3IPHA 4IWQA 2XM8A 4CFXA 4ZZOA 4JIAA 3QKKA 5EYMA 2OJ9A 3BCEA 4CZTA 4OTDA 3HV4A 3QGWA 1GNGA 3EH9A 4ANBA 3UZRA 4DE4A 2QR8A 4QP8A 5EKOA 1IAHA 3EYGA 5ETAA 5EI6A 4EUTA 4W4WA 4UB7A 4YNOA 3VUDA 5J7HA 2DWBA 4BC6A 4IEBA 2XNEA 4ANOA 4C2VA 2WMAA 2WTVA 3TACA 3W8QA 2ZV2A 4XRJA 4L7FA 3TXOA 4E8AA 2W5BA 3QX4A 3R01A 3A62A 4RGJA 3RAWA 4MD8E 1QL6A 5M4CA 4XX9A 4APPA 4G1WA 2A4LA 1PXKA 4HJOA 1NVRA 3A7GA 3IW7A 4MBJA 4X21A 1XR1A 3CGFA 3V8WA 3ZUTA 4BCGA 5LJJA 2UW9A 2GNFA 4TY1A 1WBTA 4YNEA 3UBDA 2QODA 4Y5HA 5C8MA 4FZDB 2PZ5A 4E6AA 1ZMVA 2UZEA 4JT3A 5M51A 4CD0A 4U40A 4ZMEA 5AUTA 5E7RA 3MFSA 2IVSA 1P14A 4NIFB 4JG6A 3LZBA 4QMLA 2Y9QA 3S4QA 4L52A 3PXRA 4CNHA 5HCYA 5C8KA 3OROA 2B0QA 2IVVA 2BAQA 3PPKA 3BE2A 3U9CA 4WO5A 3GOKA 5C01A 4AFJA 3UQFA 1FINA 3ZBXA 2QOOA 2IW9A 2BAKA 4EOKA 1TQPA 5CT7A 5ACBC 4F9BA 4H3PA 4YJRA 4ITHA 2BKKA 3T3VA 4E1ZA 2QLQA 4I6QA 4YJPA 2XEYA 4YLLA 4I0RA 4ZY4A 4UMPA 2GHGA 4KIKB 3OZ6A 1R0PA 4EJ7A 3EYHA 3VS3A 5JKGA 5E1EA 4QPSA 5E90A 1WCCA 4GFOA 2Y6OA 2VTTA 3ETAA 3QRJA 4OAUC 4CLJA 4AACA 2BMCA 3FLSA 3ZRLA 3R8MA 1KOAA 5IQHA 4KKGA 3I0QA 4EL9A 5BPYA 1B6CB 1OZ1A 3FLYA 5AV4A 1KE8A 2IWIA 3LFFA 3PTGA 4FTMA 2PE2A 4FGBA 4D9UA 5JGAA 2R3LA 2W0JA 3NSZA 2XH5A 4WG5A 2WTJA 3FC1X 5AM6A 4EZ7A 2B9FA 2GNHA 4L45A 3RHXA 5LWNA 2ESMA 3DFCB 3IQ7A 3W1FA 2YISA 5DR2A 4O84A 2WQNA 1OITA 1SVHA 2UW3A 1W8CA 4CGAA 2FGIA 5KZ0A 1PXJA 3EQBA 4LOOA 3T9IA 4BB4A 2NO3A 3DAJA 2HZ0A 3DJ6A 5AX3A 4GRBA 1PJKA 4M15A 3HDNA 5EYCA 1JSVA 3FMLA 4WUNA 4EOPA 2XB7A 5CAOA 4IIRA 2BKZA 2VGOA 2QHMA 5HLNA 3OT8A 5AV1A 3VBQA 1GIIA 3DK3A 5DGZA 4RZVA 5ETCA 3TCPA 4C3RA 5LQFA 4F09A 1OL5A 4PWNA 1PXLA 4S34A 4IX4A 1KE6A 3O17A 1PKGA 5JFXA 4BZNA 2W1IA 3ATTA 4RJ5A 4DEHA 4UWBA 3FUPA 4CZUA 4AP7A 3HUBA 5IA3A 2FSTX 5DWRA 4D0WA 4GJ2A 4BDAA 1MRVA 2PSQA 2HZIA 2YIQA 3HX4A 2HENA 4O91A 4ALWA 4ZSEA 2C1BA 4BDBA 4KIPA 3O7LB 5CAUA 1SNXA 4TYEA 3FPMA 4QQCA 5JFWA 3R73A 3GBZA 1H1SA 3MFUA 4QMXA 3VUHA 4C4IA 4XLVA 2FUMA 4CFMA 3U6IA 3OY1A 4ACCA 5HG8A 3VUTA 4AX8A 1SVEA 4X2NA 2RFNA 3DBDA 4LFIA 5EI8A 4DG2E 3TTIA 3PXQA 3WE8A 4F7LA 1Q8YA 4CG9A 1MP8A 1YHWA 3NDMA 4O2ZA 2AYPA 4FT9A 4IJ9A 4TPTA 4AN3A 4EQCA 4BICA 3GI3A 4PTCA 4B8MA 3C4EA 4MH7A 1WFCA 2R3KA 2GNIA 3CE3A 5AP3A 4ZJJA 4FKRA 2BTSA 3E8CA 4YJOA 2OBJA 5J5TA 3KMMA 4FSQA 3C4ZA 3QWKA 4GEOA 4BIEA 5EKNA 4CVAA 2YCQA 5FM2A 3WZEA 4F9YA 2J90A 4BDHA 1KWPA 5I3RA 3FC2A 2AUHA 3QGYA 4LGDA 3VQUA 5FD2A 4G3CA 2ERZE 1P5EA 3NAYA 1H00A 2F7XE 4U8ZA 3UIBA 4AU8A 1KV1A 2E9OA 5FGKA 4LGGA 3KRWA 4GG7A 4CFUA 3EN9A 3MWUA 4TNBA 4Y95A 3D5VA 3QZIA 4CXAA 4JBOA 2NPQA 5HESA 3EN6A 4C8BA 1AQ1A 2YWVA 3VW6A 3FBVA 1ZYCA 4PPBA 4RIYB 4RVMA 3RPYA 3KREA 5GZ9A 4FZFB 2C6MA 4KSQA 3E5AA 4JJRA 5DRDA 5CU0A 2VTOA 1H4LA 4WRSA 3KULB 4TYGA 1VEBA 3LXLA 4QT1A 4R1VA 2GNGA 2QLUA 5EK7A 4ZTQA 3RCJA 1SMHA 2YM6A 4JL9A 3CP9A 3R7UA 4A7CA 4DN5A 2WU6A 1F0QA 4ZOGA 4FA2A 4BWPA 4YTIA 4YUQA 4I92A 3QRTA 4TT7A 4JX7A 3AMBA 3NMUF 4D5KA 4HPUE 5IH4A 1Q8ZA 1OKYA 4D4YA 3KMUA 3I7BA 3FHRA 2CMWA 4IX6A 3BKBA 3OP5A 4PTGA 4WUAA 4YJTA 2J4ZA 3NYXA 4WIHA 4TNDA 2XJ1A 3QYWA 4E26A 3GU7A 1DI9A 3N4TA 3RK5A 3SDJA 2HXLA 3GENA 3PJ2A 1UNHA 3FDNA 1YXSA 3WBLA 2I0VA 4ZLZA 1W98A 4PRJA 2UV2A 3LIJA 4EYJA 1UU8A 3E88A 5EDRA 2Q83A 3Q2MA 2YITA 5T3QA 4K2RA 5FP5A 4CKIA 3DZQA 5IKWA 5CY3A 2C68A 4FG9A 3MY1A 2WTIA 4YHJA 5HHWA 3ACJA 1VYWA 5DI1A 4C4FA 2O64A 2Y6MA 3ZLXA 2GHMA 3K5VA 3KFAA 5KMMA 4DTKA 2OIQA 4V01A 5E8SA 2CCHA 3FMMA 3NNXA 3OTVA 4GUEA 5L2IA 3E8DA 4JR3A 5EQEA 3BLQA 3DPKA 2R3OA 4MEDA 4RJ3A 4PTEA 3C4CA 1VZOA 1ZYDA 3VF8A 5J9LA 4G3FA 1MUOA 3EQDA 3UC4A 4QD6A 1STCE 3LJ2A 1GOLA 1JOWB 4G6OA 3QFVA 5BUJA 2H8HA 4RFZA 1OPLA 4XG7A 4ZXTA 4QP3A 3KXHA 5I3OA 3TUDA 4I41A 4ANMA 3VUMA 1LUFA 1KOBA 1CSNA 3M2WA 1ZXEA 3QC9A 4DEAA 4GK2A 4J7BA 5BYZA 4LYNA 3CPBA 4UWCA 3OCGA 5E8XA 4E4LA 3QCYA 4IE9A 3DQXA 3F88A 4ZTLA 3VS5A 4PNKA 2B53A 4RQKA 3S0OA 4QP4A 3R7OA 5D10A 5TKDA 3GVUA 3C5IA 3ZOSA 3NGAA 3HMPA 2IO6A 4QYYA 5E4HA 3NX8A 2XBAA 1OIQA 4XV2A 2UW7A 2I0YA 2R3NA 4I21A 2W1FA 2Z02A 2QG5A 2WELA 4FT7A 3VS6A 1MQBA 4BTMA 4PDOA 3LCDA 4GS6A 1WBWA 2X81A 4DYMA 4FKGA 3D5UA 3OTUA 5TOZA 4FV8A 4EWHA 3G15A 4EH9A 3RAKA 3UVQA 4U41A 2QHNA 5CX9A 2XNPA 4RX8A 3RJCA 3MESA 3MTLA 4U43A 1ZYJA 1RQQA 3FMJA 3PSBA 5I9XA 4K33A 3KY2A 4JQ7A 1Q97A 1BL6A 4R7HA 4I20A 3SOCA 5B2KA 2BZHB 3PVUA 3DLZA 4BGGA 4OTHA 2XK4A 1VR2A 4PL5A 4HGSA 3DDPA 4L53A 5AIRA 5DA3A 3FI4A 3LFDA 1UU3A 2RG6A 4I23A 3GU8A 4FSUA 4AT3A 4MTAA 2HOGA 4ZS0A 4H39A 4S32A 3EL7A 3EN5A 2G1TA 3CJFA 4PDPA 5LMKA 5AR8A 4IWPA 4OGRA 4X2FA 4RIOA 3DKCA 3R83A 4U45A 3VHEA 3PY0A 4EOIA 3JS2A 5DVRA 5AP7A 2X2MA 4QQTA 2JIUA 4IM3A 4F1MA 4AS0A 3LVPA 5DLSA 1FMKA 5CEKA 4FNZA 4DCAA 4L8MA 3B8QA 4PQNA 2WEIA 4AQCA 1Y57A 2VWYA 2WMQA 3WOWA 4H58A 1JQHA 5DFPA 4B99A 3OWKA 3R8UA 2YM4A 4I94A 2XNNA 4M84A 1TKIA 5EDQA 2CNUA 1B38A 1IA8A 4QMZA 5CF4A 4WSQA 5IQAA 1I09A 4UZDA 3MI9A 3H3CA 3NCZA 3P7CA 2ITQA 4Z3VA 3FI2A 4OTGA 2OO8X 4X3FA 3C4WA 3QZGA 4GW8A 4KRCA 3F5XA 2J7TA 5FG8A 3MYGA 4FOBA 3P08A 2XEZA 2RFEA 3QXOA 5EHLA 4EORA 2QOKA 5AFVA 5M06A 2P3GX 4GL9A 4AGUA 5CF6A 2YDIA 4N57A 3LOKA 3UIXA 3ZM9A 4MBIA 1GIJA 1U59A 2EUFB 2BRMA 5ACKA 3TJCA 3I7CA 3E87A 2ZM4A 4M0YA 4U0IA 3VJOA 5M4UA 2ETMA 3E64A 4RWJA 2W4JA 3BYVA 3WYYA 1JVPP 1SM2A 2E9PA 3A61A 3L9LA 4JOAA 3PE1A 3GCUA 3ZO4A 4A06A 4IZAA 4OTQA 1REJA 3MN3A 2ITPA 4FSNA 3IECA 4Z7GA 1A06A 3NIZA 3CSVA 3JY0A 4QMOA 2C5YA 4UXQA 2CN5A 3KRRA 3W2SA 3C4FA 3FHIA 3TUBA 4M8TA 5BVDA 5IH5A 1PY5A 4JAIA 2XA4A 5L4QA 1ZOHA 3K2LA 4X2GA 2QURA 2XYNA 3CCNA 5JT2A 5KMJA 4ZSJA 1DI8A 3KN5A 4DHFA 5GZAA 4CRSA 5AUVA 4XEYA 1V0OA 4OTWA 3I6WA 4WKQA 4F0GA 3LFAA 4GH2A 4UXLA 3RZFA 4UV0A 3IGGA 5BUEA 1Y8YA 2W5HA 4FTOA 4FSYA 4MXOA 3F7ZA 3H0ZA 3P86A 4FSTA 4FX3A 4IHPA 2RKUA 4EK4A 4OR5A 4FKUA 4BCFA 4BCJA 5EQPA 3GT8A 5AP4A 4LL5A 4YHTA 5CXZA 2GHLA 5AMNA 1UKIA 4IMYA 4CMUA 2YIYA 1M17A 2I0HA 2YCRA 4O1PA 4OAVB 4P7EA 3TNQB 3ZMMA 4FG7A 4RG0A 2BTRA 4RA4A 1QPDA 2WPAA 2XNGA 2VTIA 2YAAA 3UMXA 2FSOX 3TTJA 1OKZA 4O7ZA 5ANDA 3W2RA 5K4IA 5L2TA 3COIA 3KU2A 2WO6A 4ZAUA 3NYVA 4GUBA 5JQ8A 2A0CX 4ACHA 3LCTA 4EK3A 3PVWA 4ERWA 2H9VA 4J8MA 4FTCA 2R9SA 4DBNA 4I6FA 4ZP5A 5L6OA 2CSNA 2VWXA 5IH6A 2XIRA 2C6TA 4QYGA 2OJFE 3MTFA 2VTPA 5KBRA 1GZOA 5ETIA 3ZDIA 5M09A 1YXVA 5HCZA 2JKMA 2B1PA 1IR3A 1YWRA 2XYUA 4FC0A 3BGPA 1GJOA 5CU3A 1CTPE 3ZO3A 4YZDA 4BDIA 4EHZA 5HU3A 1P4FA 5AP1A 2OJJA 5CALA 4FEWA 4NKAA 2BHEA 4RJ4A 2ONLA 3DDQA 4XLIA 3EN4A 4HGEA 4NK9A 2ZM1A 5K5NA 4ALUA 4FKTA 4A9TA 1PYEA 3KEXA 3OFMA 4EHEA 1LPUA 4TZRA 4FL3A 4GT3A 4C62A 3NYNA 1M52A 4DG0E 3ZEWA 1JLUE 3V51A 2RSVA 4R5YA 3PRIA 1W83A 5LWMA 3FY0A 4NW5A 4RX7A 2CNVA 2C3KA 4ZY6A 3UTOA 4FI1A 4BDGA 5K4JA 4QMVA 4L67A 5HTCA 4IFGA 1Y91A 4PV0A 2PHKA 4MHAA 4QTCA 4YSMA 4Q2AA 4UBAA 3S95A 5KUPA 4UN0C 5I0BA 5C1QB 4TKSA 3ET7A 4RLLA 3S00A 3AMAA 4QTEA 4FEUA 4XNEA 2KULA 3FXZA 4FZ7A 4M67A 5ETFA 4ASDA 5HEZA 4C2WA 3MIAA 3COKA 4GCJA 4B7TA 2X4ZA 3KXNA 4HVDA 1J7IA 2R7IA 2R0IA 3OXZA 2YZLA 4AGWA 4EOSA 5CEMA 5H8EA 2W9ZB 5DPVA 2IW6A 2VX3A 4EZ3A 4HNIA 5CEOA 3ITZA 5C9CA 1PF8A 4XP2A 4BTKA 5HGIA 4BDDA 3MH2A 5EW9A 3Q3BA 1JKSA 2ACXA 1SNUA 3KL8A 2PK9A 5E1SA 5FTQA 4E6CA 4DF3A 2GTNA 4CYJA 3BRBA 3C51A 1W0XC 5KKRC 5IG1A 2YWPA 5DEWA 3QTIA 5L6PA 4KBCA 3KRJA 4B6LA 3U55A 3FXWA 3F5GA 4GIIA 4NT4A 4PDSA 4WA9A 5CSHA 4D4RA 3VUGA 4M97A 4IXPA 3CBLA 5BUIA 3CQUA 4YZBA 4YZ9A 4EC8A 3E8EA 4LRKA 5HIDA 3TEIA 4DH7A 3JVRA 3BZ3A 2RL5A 2X0GA 4G34A 1FVTA 3QD4A 3SRVA 1OBGA 2OGVA 5HOAA 3W10A 5F1ZA 2OG8A 5G1XA 1BKXA 4FKOA 2WMUA 4NKSA 3PSDA 2X8EA 3K5UA 2IZSA 2HIWA 2WEVA 5EOLA 3T8OA 3UIMA 3UC3A 3HEGA 4X3FB 3EQPA 5FXSA 4A9UA 4MNFA 5J87A 3JVSA 4M66A 5L6WL 5DMZA 4WG3A 4FODA 5HO6A 5LXMA 4EKLA 5KZIA 4MAOA 3AC2A 3DKFA 3DBQA 3PVGA 3Q5IA 4JX3A 4M13A 3VBXA 3W2PA 3A4OX 4E6DA 4YMJA 4FEXA 2VAGA 3MFTA 3DS6A 4IAIA 3GC0A 5JN2A 1L3RE 3KCKA 4EK8A 2G2FA 3KRXA 3PXFA 3RAIA 3ZUVA 2C0OA 2VO0A 3JPVA 4RC3A 4DITA 4AW2A 3GFEA 4FEQA 4KSPA 1XH7A 4HYHA 2Z7QA 3F5UA 3GC8A 4USFA 4BDKA 4J8NA 1XH8A 1CKIA 4RWKA 4RJ6A 3BIZA 3ENHA 3OW3A 4GG5A 3C5UA 4FTNA 4ZK5A 3RKBA 4D55A 2YM5A 2PZRA 3HP2A 4QMUA 5AUZA 4AXAA 4LMUA 1QCFA 2GDOA 4QTBA 3DV3A 2XMYA 2QOCA 2C69A 5AM7A 3N4VA 1WBSA 3EZRA 3W55A 1LR4A 2WMXA 3QTUA 3ODYX 4I5MA 4HCUA 4BCNA 5AR2A 3RK9A 3SGCA 1FMOE 5IMEA 2ZYBA 4JAJA 3BV3A 2J50A 5KNJA 1M2QA 2BHHA 3ANRA 3AC4A 3CTQA 2UVXA 3RCDA 2QKWB 2JDOA 4I22A 3ZS5A 3PJ8A 4AZSA 2JKOA 4C3FA 5EOBA 4OTIA 1O6LA 4QMWA 4RX9A 3Q4TA 4ZZNA 3F66A 2GNJA 3E7OA 2PUPA 1XJDA 2YERA 2C6DA 3MVLA 4L46A 5JFSA 5IA5A 2C3JA 3FSKA 2XK8A 4BDEA 2V55A 4BY9E 4LQMA 1OPKA 3SC1A 3W2QA 4DEDA 2HW7A 2GS6A 4XYFA 3QRIA 5ANEA 2GQSA 1JKTA 3WF5A 1S9JA 3ZFYA 2OI4X 3PJ3A 5DN3A 3SA0A 4PL4A 1KV2A 3UPXA 3OOGA 5BVNA 5HU9A 3R30A 5KMLA 3OD6X 4O27B 1OUYA 3PJ1A 3SLSA 5AEPA 2XRUA 4BHZA 3P7BA 3F2RA 4YP8A 3UODA 3L9NA 3R0TA 3PA3A 2Y7JA 5DT0A 3SW7A 5EHOA 5HNBA 1GZNA 3A7IA 3VQHA 4XG6A 2CGVA 4R7IA 1QMZA 4IZ7A 5LVPA 4IBMA 3HNGA 4BI1A 1IEPA 3NVMB 3HDMA 2ERKA 3MBLA 3OVVA 4C7TA 3K54A 2PUNA 2W1HA 3K3JA 1WZYA 3Q6UA 5LCJA 4J99A 3HECA 3FI8A 3EMGA 3CPCA 3A8XA 2BDJA 1KE5A 3C50A 3R00A 4FNWA 4XS2A 4FIHA 3HKOA 4IANA 3G6HA 3WZJA 5HVKA 4BCQA 2J2IB 4MD9E 4DCEA 1UVRA 5AUUA 2GQRA 5E8UA 4USEA 4S30A 1FGKA 2CHLA 4FICA 1UNGA 1QPEA 2BCJA 3HMOA 4RWIA 2BFYA 2A2AA 4DBXA 3UQCA 4NL0A 3RI1A 4C36A 5AP6A 3E63A 2JFLA 3L8SA 5FDXA 3M11A 1YDTE 3II5A 4O6EA 2P0CA 5CNOA 2BVAA 3O2MA 3V5WA 3HRFA 1ERKA 2AC5A 2VTJA 1ZWSA 2C30A 5CVFA 3QU0A 2FSMX 4XG2A 5HVYA 1LEZA 5H2UA 2W9FB 1OIRA 5IQBA 3O50A 4KINA 3ODZX 4ANNA 3AG9A 5GZ8A 4UALA 3QKLA 2CGXA 2ITWA 3TZ7A 3EJ1A 1JWHA 4YPSA 4AWIA 5M57A 1HCKA 4BWXA 4RA5A 3ZU7A 4W8DA 5CSPA 3FV8A 2W4OA 5IUGA 1MQ4A 2ZMDA 4RC2A 4DTAA 2R3GA 3ZLWA 4NJDA 3F3VA 4NM0A 5HE1A 2WMVA 3UG1A 3QQLA 3HV7A 3V04A 2J6MA 1AGWA 3BYOA 3SW4A 4QTAA 2W17A 3G5DA 5CASA 4EH2A 3RPRA 3W2OA 3FL5A 2Z7LA 1YXTA 4QQ5A 2CGUA 4JRVA 4BWKA 2BDWA 4KWPA 2GS2A 3L1SA 1G8SA 4ZMFA 1PW2A 4YPDA 2VNWA 4IACA 4AGDA 4AT5A 1RJBA 2YEXA 3O23A 5BQ0A 4R3RA 3VO3A 3TM0A 3I0OA 4NWMA 1M7QA 5J7BA 3T9TA 3FQSA 2PVLA 4OBOA 3WILA 4DLIA 2OKRA 4KIOA 3IDCA 4ZEGA 5CI7A 3SRVB 3PUPA 2O5KA 4BTFA 4IX5A 5D7AA 3Q9YA 3QHWA 4I3ZA 4LOQA 3F2NA 4G31A 3F5PA 1O6YA 1XQZA 3KMWA 3QQFA 4QRCA 3UOKA 4A4XA 4C35A 4J95A 4BYJA 3V8TA 1K3AA 4NZWB 5T6KA 4DFXE 1ATPE 2PVJA 4E20A 3UZPA 2X1NA 1F3MC 2A1AB 1NT2A 3UO5A 4EBWA 5M07A 4FT0A 4JDKA 4O0VA 3LW0A 2VTSA 3IW6A 4QOXA 4WRGA 3VHKA 1ZMWA 4FZ6A 4AW5A 4KKEA 5EM8A 3QTZA 3R1SA 4LI5A 4NTSA 3SVVA 4GYGA 4J52A 4CYIA 1WAKA 1JBPE 1XKKA 1XH6A 4GV1A 2IN6A 3ZO2A 3LFBA 2C6EA 3EHAA 5CEIA 3ROYA 2R7BA 3PWDA 5LOHA 4LG4A 2Z60A 4AW0A 2RGPA 3OCBA 4GJ3A 4FIIA 4M3QA 4FV4A 4IM0A 4R77A 3GXLA 2BZJA 1PHKA 3MJ2A 3GU4A 2A27A 4E4MA 4OTFA 1NY3A 4G5JA 3AT4A 4AUAA 2PVRA 3G9NA 1U5RA 3QTXA 2UZDA 5J1WA 5EM7A 4ANLA 5DE2A 4F1OA 2XK6A 4JR7A 3ZSGA 4KD1A 3WF9A 5GJGA 2IW8A 3G33A 4EQMA 2YJRA 1Q5KA 2HWPA 3KKVA 4NUSA 5CAPA 4IAZA 2ITUA 1MRUA 1OKVA 2X7OA 4CT1A 4Z7HA 4IC8A 1ZYSA 1PXIA 2PVYA 5C4LA 2WNTA 3O0GA 3NCGA 1BUHA 3RM7A 4KUJA 2BDFA 3NR9A 4EI4A 5IA1A 3F61A 1PMUA 4EEVA 4IB1A 5CZHA 3R63A 5AX9A 5J5SA 3QTRA 3HV5A 3ATSA 2XRWA 1H8FA 5FXRA 4PMPA 2VZ6A 2X2KA 3DAKA 3ULZA 2QOHA 4BDCA 4AZVA 2YN8A 3E8NA 3G51A 5IDNA 3LLTA 4IAKA 5TT7A 4DT8A 3H4JA 2PMNX 3IW8A 4CMTA 3R02A 3DQWA 4M69A 5CSVA 4EJNA 3MVHA 2IVTA 4I5CA 2XBJA 4AZEA 3UGCA 4F99A 4DFUA 4DFZE 3OXTA 4GIHA 2C6KA 4GK4A 5GIPE 3IDBA 3LXKA 3LCSA 4RVKA 2VO6A 3DY7A 3I6UA 3GC7A 4IM2A 3HLLA 3IDPA 4FKQA 4HCVA 4MXCA 4NM5A 4O0YA 4FTKA 4RLKA 3QLGA 4WBOA 2CKPA 2ITNA 4NFNA 1FGIA 2NP8A 3AC5A 5A4TA 5EH0A 1IA9A 4E7WA 5J95A 4BBMA 3FI3A 4EH4A 5FUTA 3EQHA 4X6QC 3F3TA 4EC9A 3CIKA 5HNIX 1CDKA 4O2PA 2UZTA 3EQRA 3ORMA 3QQJA 4AA0A 4JS8A 1J3HA 4DGLC 4QMNA 1VJYA 4O1OA 3QWJA 4TRLA 2BRGA 3ZRMA 4AF3A 3JY9A 4YZNA 1BI7A 2IJMA 4PDYA 4XG8A 1E1VA 4AZFA 5L2QA 4F7NA 3DTWA 4MXAA 2LGCA 4WG4A 3QC4A 5E9EA 3DJ5A 2Y4PA 4QNAA 4QO9A 4BFMA 1UU7A 2QC6A 1ZMUA 2YHVA 5IEVA 2BRNA 2QG7A 3OHTA 3TN8A 3TZ8A 2HAKA 2W1EA 3ORKA 2FO0A 4ASZA 4O7RA 2CLXA 3OOMA 4BHNA 2GNLA 2BPMA 1Z9XA 4IADA 3FL4A 2DS1A 4JXFA 2F49A 3U4WA 4DFYA 3QZFA 3N9XA 3NEWA 3R21A 2XCHA 3TIYA 3D83A 5BYYA 1H0WA 3PWYA 4KNBA 3SXRA 2P33A 4C4EA 3BLRA 4UMQA 2XK3A 4F7SA 5CLPA 3EKNA 3P4KA 4YU2A 3KK9A 2C47A 2X8DA 3ORTA 3ZC5A 4JIKA 3U87A 2VX1A 2AC3A 3LFCA 1A48A 4C38A 4GU6A 4NEUA 2X6EA 5F4NA 1DAYA 5A46A 3FMDA 2OZOA 5CXHA 5H9BA 4AA5A 5M08A 2YJSA 3QQGA 5HORA 5EYDA 3GCQA 2B52A 3ZXTA 4FYNA 4B9DA 3KCFA 1ZARA 3LHJA 5AJQA 2Z7RA 2JIIA 3BHUA 3LQ5A 3R8VA 4U3ZA 3QKMA 2WXVA 4BI2A 3DT1A 5C4KA 2JITA 2GPHA 2HYYA 2UW8A 3CGOA 5DOSA 4R8QA 1WBNA 3EFWA 3M1SA 1O6KA 4G5PA 4I4EA 4DEBA 4PPAA 3T3UA 5A14A 5CF5A 3G2FA 4FV2A 3NUUA 4D1ZA 3P5KA 2GTMA 5M53A 4Y85A 4Y73A 1Q99A 3U6HA 5D7VA 4JRNA 4UWYA 3NW7A 3CY3A 4YO4A 4PX6A 1Y8GA 4DTBA 3SG9A 1ZRZA 1W82A 5CU6A 4PP9A 4PMMA 2G9XA 5KO1A 3MPTA 3MH3A 4W8EA 5EM5A 4BRXA 4ARKA 2F7ZE 2J51A 3QTQA 4U7ZA 5HZNA 5HIEA 4XV1A 5DEYA 3NAXA 4QNYA 1SYKA 5HI2A 4QP6A 4C02A 3PIZA 4YC8A 3FY2A 1PXMA 3LM5A 5FRIA 3SG8A 2BZKB 2HY0A 4D2SA 4FSZA 2H6DA 3MB7A 2W05A 4B8LA 5F20A 3D7ZA 4O7YA 2VWZA 3FWQA 3RTPA 3QUPA 4CT2A 1P4OA 1SVGA 2QVSE 4O0UA 4DGMA 5JFVA 3QCQA 2WTKC 4OBPA 4YHFA 3RBWA 3UP2A 2W1GA 4E6QA 2JAVA 5AUYA 4EH8A 1F5QA 4U5JA 2XNBA 1Q62A 4AOJA 1EH4A 1Y6BA 4FK6A 4Y5QA 1IASA 3I60A 2JDTA 4CEGA 3UO4A 4I24A 5HQ0A 5K0KA 4UEUA 4FTJA 2NNWB 1FVRA 4FTRA 4G6NA 4WBBB 5I9UA 4BCOA 4C4GA 5IQCA 3R9RA 3RZBA 3IW4A 4II5A 3CS9A 2PZPA 2RFDA 4WD5A 4LUDA 5AR7A 3WE4A 3WIKA 4RMZA 4F0FA 3V5TA 4M12A 2V7AA 2VX0A 1CKPA 3RP9A 2OF2A 4O0RA 3LM0A 4CFNA 2OJGA 3F7WA 3SKCA 1R3CA 2PVHA 3QRKA 5B0XA 4DT9A 1KE7A 2VO7A 1H1PA 4GFMA 1H25A 3AC3A 4JLCA 5E8ZA 5GJDA 3QD3A 4MXXA 1TQIA 2JDRA 2WMTA 4DFNA 2BUJA 1OM1A 3RNYA 3UE4A 4B4LA 3OWPA 3R7IA 3UQGA 4HVGA 2JKKA 2VTNA 1Q8UA 3EL8A 3EQCA 3PZEA 2ZMCA 3ACKA 3QZHA 3HMIA 2W06A 4KIQA 5CI6A 5A6NA 3ZUUA 4K6ZA 2Y4IC 3HA8A 2OW3A 3REPA 1WBVA 2IZUA 3QCXA 3BX5A 3HP5A 4M69B 4YJNA 2B9IA 3JUHA 5EDPA 1J1BA 5JMSA 2QU5A 4DFLA 4D9TA 2OJIA 3AOXA 3AD5A 2OF4A 3TG1A 3AMYA 5HE0A 3TJDA 1PXPA 4ZSAA 4ZS4A 4FKVA 4QYHA 1FBNA 4NCTC 3RK7A 1OBDA 2CJMA 2HZNA 3PPZA 3CD8A 3DBFA 4QP9A 1H1WA 3VJNA 4P90A 5ANOA 2BR1A 4EKKA 2UZWE 3A2CA 3V6SA 1W84A 4TN6A 3R8PA 3UJGA 4AAAA 2RIOA 3R22A 2EXCX 5CAVA 1JAMA 3NUPA 2I1MA 3PIYA 2WMSA 4YTFA 5DNRA 1YHVA 4FTLA 3MVMA 1CM8A 3ZRKA 5HBJA 5IA2A 3QD0A 5KMNA 3ZCLA 4AT4A 1I44A 1UV5A 2E9VA 3EOCA 4D1XA 3FAAA 4CSVA 2ITVA 3Q60A 3WARA 2XJ2A 3LFQA 4C3PA 1JPAA 4M0ZA 4RPVA 1OL7A 5HG9A 4ACMA 2Q0BA 4U6RA 5F94A 3HAMA 4MF1A 1G5SA 3LE6A 1OL2A 4TW9A 4XBUA 5BMSA 1K2PA 3P78A 3UNKA 2FA2A 4EUUA 4MK0A 4AE6A 4O81A 3TDVA 2WMWA 5GINE 4XCUA 2Y8OA 5CVGA 2X7GA 4BKZA 2ZB1A 2J5EA 3QX2A 4S31A 2QOIA 4FK3A 4YBKA 4C61A 5CF8A 1R78A 2DQ7X 4N0SA 4YTHA 3PXZA 4O0WA 5JRSA 3VWAA 3EWHA 4IFCA 1TVOA 5C26A 2WKMA 3WF7A 4HYIA 4A9RA 4CLIA 3MY5A 4U81A 4ASXA 5IA0A 4XH6A 3HL7A 4B0GA 1U5QA 3A8WA 4GKIA 5I5ZA 5E8TA 5AV3A 5FBNC 4D2PA 5B7VA 3FLWA 2OXXA 5A4QA 3HV6A 4XG4A 3ALNA 3ZZWA 1ND4A 1YWNA 3DA6A 2F9GA 4IDVA 4TYJA 1PKDA 4M68A 1B39A 3ERKA 3GOPA 5D9HA 5JGDA 4IJPA 4I5PA 4J1RA 2I0EA 4FKIA 1URCA 3VBTA 2OWBA 3DK6A 1YXXA 3CEKA 2ZDUA 4BN1A 1HCLA 1ZZ2A 4JG8A 5LCKA 3R9NA 3AGMA 5IA4A 3P7AA 3KXMA 4U9AA 4WNOA 5HBEA 3EZVA 3R7VA 4MD7E 4IWDA 4FG8A 1DM2A 2WFYA 3OCTA 5JEBA 3N4UA 3NNVA 2JIVA 5E8WA 4K11A 2JDVA 3PG1A 2HW6A 4BI0A 3LMGA 2GFSA 5BX0A 3GQLA 1BL7A 3DLSA 4X2JA 4XV9A 1QPCA 2WTDA 2QD9A 4Z9LA 3V3VA 1V0PA 5IEXA 3P0MA 5I9ZA 4E3CA 1PYXA 4C37A 3ORLA 1H28A 3A7FA 4UYAA 4CFFA 5IQIA 4J96A 3AD4A 3PA4A 2UUEA 1XWSA 2BILB 3FQEA 2UZNA 4ENXA 4RVTA 4V05A 4U44A 5HKMA 3NW5A 5HO7A 4W9XA 4O21A 4RT7A 1ZAOA 3CQWA 1OVEA 2W4KA 3FE3A 2R0UA 4MWHA 4WNMA 2XKDA 2RF9A 3OEFX 2WIPA 3FLQA 3TIZA 3CTJA 4P5ZA 4ALVA 3F3ZA 3NW6A 1GZ8A 3BWFA 3ZC6A 5K3YA 5HD7A 5HLWA 5L8JA 3D7TA 3PFQA 3IW5A 3RM6A 3UNZA 3NS9A 4PUZA 2C5OA 4MXZA 2SRCA 4K1BA 4UYNA 3K3IA 3BELA 4D2WA 4FNXA 1H1RA 2O3PA 3A60A 3PRFA 2PE0A 4XG3A 5IZFA 3V5JA 5AA8A 4H3BA 4IVBA 3R8LA 4FTTA 3CJGA 5H8BA 4D5HA 2JAMA 3BYMA 4HOKA 2ZB0A 4O38A 4F6SA 2CNQA 3Q6WA 4XG9A 2J0LA 3HMMA 3OT3A 4BDJA 2OFVA 3V6RA 2FSLX 5K9IA 4BL1A 4BYIA 2RFSA 1OUKA 3EIDA 3QL8A 2B9HA 5AUXA 3QAME 2B54A 4YJUA 5JZNA 1M2PA 1H07A 2R3PA 2WIHA 3TI1A 3TZMA 2VWVA 3LJ1A 3ULIA 4PP7A 5A4EA 4FIJA 5CTPA 5A9UA 5CANA 4KKHA 4EK5A 4K0YA 2YACA 3TUCA 2PWLA 5AIKA 4QMYA 4XBRA 5AADA 5BYLA 4KB8A 5LMAA 4DGOA 4EHVA 1YI3A 3KVXA 1JKKA 1FPUA 5EQYA 5EYKA 3NVKI 3R7GA 2X7FA 5KMOA 3IOKA 4FKSA 3L9PA 4F64A 3I4BA 4C34A 3QCSA 4FTUA 4JQEA 4DGGA 5AAEA 3BHHA 4RSSA 5CZIA 3QLFA 3FLZA 5IF1A 2YCSA 3EFKA 2C1AA 5F95A 3G90X 3ENMA 3OWLA 4AZTA 3MJ1A 5JGBA 2C0IA 2YM7A 3DAEA 1OPJA 2CPKE 2PVMA 3FYJX 3PP0A 4MQ2A 4O0SA 4I0SA 4P5QA 4XOYA 5FEDA 4Z16A 3D0EA 1NXKA 4I6HA 4RWLA 3VN9A 3D9VA 4F9CA 5FP6A 4EYMA 2VTQA 1Q8WA 4XP0A 3FKNA 4MXYA 3SV0A 4FSWA 1R0EA 4DH1A 3QUDA 5CT0A 4F65A 5AWMA 3UP7A 2XCKA 3LAUA 1M14A 3RINA 1QPJA 3BQCA 3KRLA 1U54A 4WOVA 5LMBA 5EG3A 4R3PA 3IKAA 3AQVA 3GGFA 2R3FA 3PXYA 1U46A 3QD2B 4ZLYA 1RE8A 2GMXA 4FSMA 2UW4A 4YLKA 2CKQA 4PNIA 1YDRE 3BLHA 3LLAA 3ZYAA 3NRMA 5IISA 2VTAA 4MWIA 4WNPA 2NRYA 3FMKA 2X8IA 1A9UA 4IVDA 4O96A 4BCMA 4E73A 2VV9A 5J1VA 1KE9A 4XJ0A 4HW7A 4L3PA 2X9FA 2YAKA 2XKCA 3FMHA 4HZSA 3FYKX 5AP2A 3AXWA 5BVEA 2OLCA 5IPJA 4HYSA 5CYIA 2EVAA 4TWPA 5KE0A 2KTYA 4YSJA 5LVMA 3GU5A 4X2KA 3S1HA 3TWJA 4BF2A 4AGCA 1IRKA 2Z7SA 4F6WA 3GUBA 3KGAA 1HOWA 3LXPA 3EFJA 1J1CA 3WZKA 3QRUA 2VTLA 1IAJA 4OUCA 3DBCA 3H0YA 3MFRA 3SAYA 4D1SA 4DEGA 1JSUA 4OT6A 4I0TA 1XBBA 2QR7A 5D1JA 3TZ9A 3U9NA 3WF8A 5CU4A 2JDSA 3U4UA 1XBAA 1RDQE 4GT5A 2QOQA 3M42A 2PPQA 4GKHA 4FIFA 5CQUA 1L8TA 4QP7A 2WHBA 3LQ8A 3FZSA 4FZAB 1OL6A 4RRVA 4DEEA 4A9SA 4FVRA 5IQEA 3R6XA 3KA0A 3POZA 4XP3A 2XIXA 3E7VA 4EH7A 3TNIA 3Q5ZA 3PG3A 4JG7A 4NM3A 4TWNA 3VUIA 3RPVA 5JH6A 1KUTA 4NU1A 3MSSA 3W33A 4YJVA 2EXMA 5E8VA 2ZOQA 4E4XA 5BVFA 2EU9A 3GEQA 3ZDUA 2J0KA 4L43A 4Z55A 2CDZA 2LAVA 3U8WA 1YOMA 2VO3A 4AW1A 2IVUA 2R3HA 4YLJA 5EW3A 3ZZEA 4FMQA 4Y8DA 2O8YA 1U4DA 5FQDC 4NSTA 1URWA 4FF8A 3LMIA 4O82A 2YM8A 1YWVA 3UIUA 3F6XA 3Q4UA 5JQ5A 5L8KA 3KVWA 4FT3A 4R1YA 2VTRA 3SX9A 4CRLA 4O86A 3VS1A 3FZ1A 3MA3A 4C59A 2WQOA 3R7EA 5A4LA 3R2YA 5HICA 2ITYA 3SXFA 4DLJA 2WQEA 2VWIA 4Q9SA 4YC6A 4LV5A 3BYSA 3VS0A 4FE2A 3DXPA 2W1CA 2WTWA 3AC1A 5JK3A 4NTTA 2PTKA 3BGZA 3DCVA 4IAFA 2OICA 4GK3A 2P2HA 2WD1A 3GP0A 5M55A 4JI9A 5HTIA 5HX8A 1YVJA 2OH4A 3DK7A 2WQBA 4EH3A 3CKWA 2V7OA 2XIKA 3CXWA 4H3QA 2PUUA 3VRYA 2IZTA 5IUIA 2R3RA 4QMQA 4BZOA 2UVYA 4HYUA 4FGRA 3FKOA 3SHEA 3L8PA 5HIBA 1E9HA 2FVDA 2PVFA 3H9RA 4UX9A 4IX3A 3Q96A 4RIXA 2CGWA 3MB6A 3WYXA 3LFNA 3E92A 3QTWA 3D7TB 4QMMA 2QKRA 1UKHA 2R3QA 4WSYA 3BV2A 4JNWA 3RPSA 2HELA 4X0MA 4QQJA 5AP0A 3FPQA 1SZMA 3BU3A 2YDJA 3DKOA 2QO2A 4X7QA 3NNWA 4F70A 3UDBA 4FV5A 4JVGA 1FOTA 3AT2A 3Q53A 3UOHA 5L8LA 4N70A 4E4NA 4AZWA 3DZOA 3DTCA 4ERKA 3ZEPA 1YOLA 3OBJA 2XF0A 1OI9A 3B8RA 2C3IB 3DFAA 4XOZA 4L44A 2FB8A 3ORPA 4RC4A 2EWAA 1REKA 4V0GA 3DU8A 4FSRA 5EFQA 1PMEA 4ONAA 3OS3A 3H9FA 1JKLA 4ZIMA 3Q4CA 5DYJA 4QP1A 4UMTA 5JRQA 5DT3A 4D28A 5KX8A 4LV8A 3UPZA 1H26A 3KK8A 1WBPA 3UOLA 2PY3A 1H1QA 3QA0A 3TNPC 3ZO1A 3R1NA 4F9AA 3RHKA 3MW1A 4BCIA 1OKWA 3LFSA 5DR6A 3FMEA 5C8NA 2BROA 4TWCA 4LUEA 2X39A 2UVZA 4BVUA 2P4IA 4F08A 4JQ8A 4I93A 2R3MA 3TNHA 3GQIA 3PPJA 2JC6A 5TR6A 4APCA 4X3JA 2PUIA 2ZV9A 3KC3A 2ZV8A 4ZSLA 3VNTA 4DH8A 4D2RA 4A07A 2F57A 3C0HA 3GCSA 2JD5A 5ANKA 4IVAA 4D4SA 5I9VA 3CY2A 3I1AA 4G9CA 3VAPA 4GVJA 3EQGA 4JBPA 4ZSGA 3E93A 3QUEA 4BGHA 2J0MB 5IQFA 2PVNA 4E93A 1XH9A 2XK9A 4IW0A 3COHA 1OIUA 3HRCA 5KBQA 2OU7A 5A6OA 3JXWA 4G2FA 5D11A 5DHJA 5BMMA 4DEIA 3C7QA 4CV9A 3OUNB 2CCIA 2OIBA 5M56A 5E92A 1J91A 4GMYA 3FZTA 5GIOE 4Y72A 4CFVA 3E3PA 2XNMA 1U54B 4RJ8A 2UZBA 2PU8A 2VNYA 5DBXA 4KBKA 5KMKA 3ZFMA 5TF9A 4EQUA 2YIWA 3FJQE 4O0TA 4AOIA 2PE1A 1YW2A 2QO9A 4MNEA 4DAWA 4JDHA 2YCFA 2XIYA 3I5NA 3WF6A 3VC4A 2WAJA 2J0JA 4NFMA 4OT5A 4U42A 2V62A 4O7VA 1P2AA 4C4JA 3BHYA 3WZDA 4N4SA 3VBWA 3O8TA 3B2TA 3RPOA 3BBWA 5J9ZA 1YOJA 2ITZA 2OXDA 2Z8CA 3F9NA 4P4CA 1Q3WA 5KKRB 2VWBA 3GNIB 3ZSIA 2VRXA 4TYHA 3DNDA 3MS9A 2JEDA 4L01A 4FTQA 3UYSA 3ORXA 1UNLA 1T45A 2XJ0A 4LMNA 2J5FA 1J7LA 2WU7A 3WI6A 4EHGA 4K77A 3DBEA 4FT5A 5J79A 2Y0AA 5HO8A 1H0VA 3QTSA 4ITJA 3RWQA 3DB6A 4MQ1A 3SOAA 4ACDA 3IK3A 2ITOA 4ZJVA 4PF4A 4IZ5A 5HX6A 2X4FA 2XIZA 2ZM3A 4EBVA 4F6UA 1UA2A 3MDYA 2PMIA 5EW8A 4ASEA 5I9WA 4NH1A 1YXUA 4I1ZA 4MYGA 2FH9A 1S9IA 1R1WA 4EOJA 4R5SA 3HZTA 4YJSA 3U51A 3UNJA 4YBJA 3CR0A 3OUKA 3FLNC 4H36A 2I6LA 4F0IA 4DH3A 1OGUA 2REIA 2W1DA 4ANQA 2G15A 3W8LA 1UWHA 3EQIA 4HNFA 4PPCA 4O7SA 4O7LA 4FL2A 4CTBA 4FKWA 5M4IA 4W4XA 5DT4A 5FEEA 3D5XA 5IDPA 4J98A 4DINA 3ANQA 4L42A 1JSTA 3CTHA 3DXNA 5HTBA 2CKOA 2UZUE 1V0BA 2A19B 2UZOA 4U3YA 4RQVA 3HRBA 2YLEA 4YO6A 3VBVA 2VN9A 3LFEA 3LXNA 5ITAA 3R9DA 3FXXA 3R9OA 4G3DA 3TL8A 4QMTA 3LCKA 4FR4A 4CKRA 2YLFA 4GU9A 2B9JA 4HGTA 2IZRA 4IDTA 4QPMA 3U54A 1FQ1B 4D4VA 3P9JA 2F7EE 1ZY4A 2VTMA 4EWQA 1YHSA 3QQHA 5AP5A 1YRPA 2XK7A 2YABA 1FVVA 2QOBA 3HGKA 3PXKA 4YTCA 3BGQA 2OK1A 3FMNA 3JR1A 2WQMA 3G0EA 3IONA 5CS6A 4FV1A 3W18A 1V1KA 5HCXA 1WMKA 4CZYB 2O2UA 3VRZA 4FVQA 1J7UA 2HWOA 1G3NA 2W7XA 4HVHA 1Q8TA 3OCSA 3KF4A 2B55A 5I4NA 3OF0A 4RIXB 5AA9A 4A9YA 4O83A 2R4BA 5L2SA 2BZIB 3EFLA 5EM6A 5LMKC 2PZIA 3IGOA 2O63A 3BHVA 3N51A 5A3XA 4C0TA 3HMNA 3DGKA 5EHYA 4BR3A 4EK6A 4N6ZA 3IS5A 4LM5A 1NVSA 4H1JA 2GCDA 4ZTHA 3BEAA 5AUWA 4EONA 3L8VA 5CSWA 3GFWA 3ORNA 4FIGA 2X6DA 4J53A 3R7YA 2BFXA 2R2PA 3Q4ZA 5CVHA 2WB8A 3NWWA 5FTGA 4FVPA 2B7AA 4DA5A 2BIYA 5CQWA 4MKCA 2C0TA 2G2IA 4S33A 1XO2B 3MH0A 2X2LA 4IB3A 3MIYA 3RGFA 2XS0A 5CAQA 3CC6A 2XZSA 3MVJA 1GIHA 2UZVA 4V0GB 4HGLA 3P1AA 3FSFA 4X3FC 4KA3A 5GJFA 3PSCA 4QP2A 3UMWA 4RIWA 1NW1A 3COMA 3QHRA 4ZTRA 3UVPA 1Q4LA 4UMRA 5T68A 3TKHA 3RNIA 4D2VA 3RAHA 3PJCA 4PMTA 3R2BA 4EH5A 4KBAA 2QOLA 3KB7A 4IB0A 3ZLSA 4KRDA 3C0GA 4PMSA 2F2UA 3S3IA 4FV9A 3TDWA 2XP2A 4IB5A 4BGQA 1DAWA 2XM9A 2PYWA 3MA6A 2QO7A 4NM7A 4A4LA 2B4SB 3Q9XA 4I6BA 5B2MA 5IQDA 3F3WA 5BNJA 3U6JA 2X9EA 4MBLA 4QYEA 3R1YA 1Z57A 5HNGA 4CCBA 4EOLA 4HVSA 3ORZA 5TO8A 5LVNA 3BHTA 2ZVAA 5M4FA 4BKJA 3PVBA 3ZM4A 4CV8A 4FUXA 3UOJA 5FXQA 2OXYA 5AR5A 4YR8A 4OLIA 3NYOA 4ENYA 1YI6A 2DUVA 2HZ4A 1APME 4DC2A 3R1QA 3D2IA 3QBNA 3W16A 3A99A 4MVFA 4O7WA 1YDSE 3NUSA 5IU2A 2V5QA 3VIDA 3KF7A 5CEQA 3FZPA 4NW6A 5AAFA 5FBOA 5IQGA 4MNEB 4F1TA 3IG7A 4IH8A 3TKUA 4IAAA 4QMPA 2QI8A 5JZJA 2PL0A 3WZUA 4AFEA 2CKEA 2F4JA 2PVKA 4DGNA 2UW6A 4JBVA 4EOOA 3FEGA 3OG7A 4JDJA 5AV2A 4EH6A 2E9UA 4GVAA 3H30A 2PMOX 4MF0A 4KS7A 4OW8A 3VUKA 3FQHA 4ZY5A 5AAGA 3Q04A 4EOMA 4XHKB 4ZZMA 2C3LA 3C13A 4CQGA 2BRBA 3D15A 3PDTA 2R3IA 2NRUA 4TYHB 4YZCA 2BALA 1YQJA 4G3EA 5B2LA 4I4FA 5H3QA 3O8UA 2GS7A 2J0IA 2ETRA 4JDIA 4USDA 4Y46A 5CU2A 4FKLA 4FKPA 2OH0E 5HE2A 3VVHA 4QPAA 3THBA 4CKJA 3LPBA 4ID7A 3NUAA 3PY3A 3UG2A 2R64A 5IEYA 2E2BA 2R3JA 2FYSA 3C0IA 3ZHPC 5CNNA 2I40A 3CD3A 3HUCA 1NA7A 3L8XA 4WT6A 4F4PA 1OIYA 3LKMA 3G0FA 5A54A 3VBYA 5DR9A 3VS4A 3OW4A 3LMHA 2EB2A 4M7IA 4LRMA 2PZYA 1BX6A 2OZAA 2QONA 2UZLA 1NVQA 4GFGA 2JKQA 4UY9A 3OC1A 4HPTE 2BAJA 5DIAA 4FL1A 3OXIA 1BYGA 4H1MA 3R8ZA 4C57A 2ONLC 5AV0A 3OMVA 5J9YA 4IAYA 3MV5A 3ROCA 3QALE 4L9IA 3VULA 3BWJA 2F2CB 2WZJA 4YZMA 3R71A 5TE0A 2G01A 4BBFA 3PLAE 1OMWA 2J9MA 4UZHA 4HVIA 2O0UA 3CKXA 5E91A 2ZDTA 1BLXA 2C6IA 3O96A 2H96A 4QMSA 4R7BA 2BIKB 4N6YA 1LP4A 1OECA 3KXGA 3EN7A 3GCVA 3OY3A 1XHAA 3H9OA 3H10A 4FV7A 4I5HA 3VF9A 5KHWA 4FKJA 4L6QA 4G9RA 3G6GA 3DXQA 2HK5A 2YIRA 4RBLA 4KAOA 4F63A 3PIXA 2HXQA 3FZRA 4IVCA 2WMRA 2ITXA 3MH1A 2W1ZA 4U97A 3BI6A 3QA8A 1H08A 3I5ZA 3PA5A 4ITIA 4CFWA 1WVWA 4FUYA 4G6LA 4V04A 4FV0A 5IUHA 4H05A 3GCPA 4BZDA 3S2PA 3CQEA 3SQQA 5HVJA 3D14A 2W5AA 4R3CA 3GC9A 1M2RA 3ELJA 4GSBA 5J8IA 2CN8A 2YA9A 4NJ3A 4PY1A 4O6LA 3BQRA 3WIGA 3QQKA 2Z2WA 4DH5A 1BI8A 2V22A 3NUNA 3EKKA 3V8SA 2JBOA 2O65A 2ZJWA 2WTCA 4FV6A 3G9LX 3PP1A 3TKIA 1AD5A 4G16A 2QCSA 3D5WA 2P55A 2GQGA 3MGYA 1CMKE 1XH4A 4G3GA 4BCPA 1GAGA 1T46A 4ACGA 3NNUA 3C1XA 1UWJA 3TNWA 3JYAA 3Q9ZA 3TV7A 5LVLA 2ZAZA 3ZH8A 1R39A 3ZONA 4CMOA 2YM3A 2RG5A 4ZTMA 3FZOA 5FEQA 2XKEA 3KXXA 2UW0A 3MY0A 4DG3E 4YURA 2JFMA 3DNEA 3HA6A 3LQ3A 3OBGA 5IMXA 2PULA 2Q0NA 3DJ7A 4XRLA 4MX9A 5BVWA 3O71A 5HBHA 4NCTA 3F69A 1ZLTA 1DS5A 3DB8A 4K8AA 1GY3A 1LEWA 5FLFA 4D58A 3CLYA 4RX5A 3BYUA 4RIWB 1H24A 1Q24A 4MCVA 3RVGA 5G6VA 4FTAA 2WGJA 4D2TA 5D12A 3A4PA 5DG5A 3W32A 1CKJA 3KXZA 3TV6A 3AGLA 5DRBA 5JSMA 1MRYA 2YFXA 3I81A 2XUUA 3UVRA
chains in the Genus database with same CATH superfamily
1GZKA 3POOA 4HZRA 4IC7A 5HG5A 2OIDA 2GU8A 4FYOA 1PXNA 4YJQA 1OB3A 4RFMA 4FIEA 4M14A 5KMIA 5LARA 1H27A 3A7JA 4BCHA 4FTIA 3NIEA 3LCOA 4D0XA 4BJJB 1XH5A 2PMLX 4L3LA 4AA4A 4E5BA 2EXEA 4OTPA 1JNKA 3AD6A 4NIFA 2UW5A 3RALA 5H8GA 5ICPA 5A4CA 3F2AA 2C6LA 5KHXA 3ORIA 4BKYA 3RMFA 3D2KA 3ZFXA 4CG8A 5CEPA 1Q41A 3DOGA 1ZZLA 2E9NA 5FTOA 4L3JA 3V5PA 4IQ6A 3L9MA 4F9WA 3ZLYA 4U79A 3ZTXA 3NLBA 5HLPA 3PZHA 2ETKA 3P79A 4DFBA 2I7QA 1BMKA 1Q3DA 3ZXZA 5ANJA 3V5QA 4RZWA 1Y6AA 4L00A 3GB2A 4R78A 1Q61A 3QF9A 3BPRA 4KIKA 2C4GA 4Y83A 5ANGA 2YZAA 5GHVA 5FDPA 3HYHA 1YKRA 2XKFA 2BRHA 1W7HA 2QQ7A 3R04A 1PMVA 3D94A 2W96B 4J97A 3QXPA 5HE3A 3F3UA 4L7SA 2GFCA 3O5AA 3PLSA 4XV3A 3QYZA 4FOCA 4FNYA 3ID6C 1PXOA 3LJ0A 4ANSA 2IF8A 3MPAA 5D41A 2YIXA 3A7HA 1X8BA 4E5AX 1XBCA 1Z5MA 4EZ5A 3HAVA 3E62A 2VU3A 4PL3A 1ZY5A 5FM3A 4KS8A 5EI2A 3SXSA 3W0QA 2C6OA 3QQUA 5HG7A 1ZOGA 3BU5A 2OSCA 4YGAA 4AE9A 4QEBA 4W4VA 4G17A 5CWZA 4XMOA 5BVKA 4IWOA 4ZTNA 4RFYA 3ALOA 4BIBA 3R28A 4E5WA 3BE9A 1E1XA 2HY81 2JBPA 3TT0A 3B2WA 1H01A 3SD0A 4CTCA 3I79A 4NYEA 4Q5EA 3GU6A 4RVLA 4W4YA 3VS7A 2XARA 5C03A 4FBXA 4Q9ZA 1ZYLA 3Q32A 3HVCA 5CSXA 4BIDA 3IO7A 4S2ZA 2OZAB 4O0XA 4ZTSA 3PYYA 5FWKK 3NPCA 3C9WA 1M7NA 1G8AA 3UZTA 3P23A 3AT3A 4IZYA 2XNOA 4L68A 2W99B 2GSFA 4WHZA 2VGPA 1WVXA 2G2HA 3OEZA 4BBEA 2H34A 2QU6A 4BDFA 4LRJA 3O8PA 3NZ0A 3VW8A 2VTHA 4CCUA 3Q9WA 4AG8A 1PMNA 2VWWA 5LVOA 2ZV7A 3FKLA 4LGHA 5AR3A 3NUXA 4LL0A 2JLDA 3Q52A 5F9EA 4Q5HA 4OTRA 2VWUA 3O7LD 4P2KA 3R9HA 2QNJA 4O22A 2CLQA 2WTKB 4BTJA 1TQMA 4OBQA 1UU9A 4EOQA 2XVDA 4LOPA 4AOTA 5E8YA 4TL0A 2VD5A 2OFUA 3C4XA 4WNKA 1VYZA 2ITTA 2WMBA 5HD4A 1PRYA 3UYTA 2IG7A 1KSWA 3PY1A 3V5LA 4RJ7A 4TTHB 4J71A 4W9WA 5AR4A 4TYIA 3F82A 4KABA 4X6RA 2C5XA 4XUFA 3BEGA 2C5VA 2VUWA 1K9AA 3IOPA 4CQEA 4O7TA 1WBOA 2V0DA 4GT4A 3NUYA 4U80A 1O9UA 2R5TA 3TV4A 5ANIA 3BU6A 3E3BX 4BCKA 3AC8A 5K0XA 2IPXA 2YDKA 2EB3A 4YC3A 3Q2JA 3VS2A 4A4OA 1ZOEA 4F7JA 2P2IA 4C4HA 2WOTA 5C27A 4O4BB 5BVOA 4DHZA 1YI4A 1OL1A 3KN6A 3ZBFA 4AN2A 5L2WA 4ZLOA 3EB0A 4QYFA 5I9YA 2DYLA 4GYIA 3O51A 4UMUA 4JBQA 4O7NA 3EQFA 3PE2A 1WVYA 1IG1A 2C5NA 3HV3A 4TXCA 5GNKA 4C33A 2JGZA 3MPMA 3RWPA 3BBTB 3V01A 3ZSHA 2HCKA 4FV3A 4RIYA 4AN9A 3W2CA 3D4QA 3OWJA 3KQ7A 5DH3A 5CENA 4ORKA 4QTDA 4K9YA 4TWOA 4FEVA 5K5XA 3DKGA 2QOFA 3UO6A 2Y4IB 2WOUA 4K18A 3KULA 1RW8A 4ZJIA 4C58A 5KCVA 4R6VA 5L3AA 4HCTA 5M44A 3IPHA 4IWQA 2XM8A 4CFXA 4ZZOA 4JIAA 3QKKA 5EYMA 2OJ9A 3BCEA 4CZTA 4OTDA 3HV4A 3QGWA 1GNGA 3EH9A 4ANBA 3UZRA 4DE4A 2QR8A 4QP8A 5EKOA 1IAHA 3EYGA 5ETAA 5EI6A 3PFYA 4EUTA 4W4WA 4UB7A 4YNOA 3VUDA 5J7HA 2DWBA 4BC6A 4IEBA 2XNEA 4ANOA 4C2VA 2WMAA 2WTVA 3TACA 3W8QA 2ZV2A 4XRJA 4L7FA 3TXOA 4E8AA 2W5BA 3QX4A 3R01A 3A62A 4RGJA 3RAWA 4MD8E 1QL6A 5M4CA 4XX9A 4APPA 4G1WA 2A4LA 1PXKA 4HJOA 1NVRA 3A7GA 3IW7A 4MBJA 4X21A 1XR1A 3CGFA 3V8WA 3ZUTA 4BCGA 3UDTA 5LJJA 2UW9A 2GNFA 4TY1A 1WBTA 4YNEA 3UBDA 2QODA 4Y5HA 5C8MA 4FZDB 2PZ5A 4E6AA 1ZMVA 2UZEA 4JT3A 5M51A 4CD0A 4U40A 4ZMEA 5AUTA 5E7RA 3MFSA 2IVSA 1P14A 4NIFB 4JG6A 3LZBA 4QMLA 2Y9QA 3S4QA 4L52A 3PXRA 4CNHA 5HCYA 5C8KA 3OROA 2B0QA 2IVVA 2BAQA 3PPKA 3BE2A 3U9CA 4WO5A 3GOKA 5C01A 4AFJA 3UQFA 1FINA 3ZBXA 2QOOA 2IW9A 2BAKA 4EOKA 1TQPA 5CT7A 5ACBC 4F9BA 4H3PA 4YJRA 4ITHA 2BKKA 3T3VA 4E1ZA 2QLQA 4I6QA 4YJPA 2XEYA 4YLLA 4I0RA 4ZY4A 4UMPA 2GHGA 4KIKB 3OZ6A 1R0PA 4EJ7A 3EYHA 3VS3A 5JKGA 5E1EA 4QPSA 5E90A 1WCCA 4GFOA 2Y6OA 2VTTA 3ETAA 3QRJA 4OAUC 4CLJA 4AACA 2BMCA 3FLSA 3ZRLA 3R8MA 1KOAA 5IQHA 4KKGA 3I0QA 4EL9A 5BPYA 1B6CB 1OZ1A 3FLYA 5AV4A 1KE8A 2IWIA 3LFFA 3PTGA 4FTMA 2PE2A 4FGBA 4D9UA 5JGAA 2R3LA 2W0JA 3NSZA 2XH5A 4WG5A 2WTJA 3FC1X 5AM6A 4EZ7A 2B9FA 2GNHA 4L45A 3RHXA 5LWNA 2ESMA 3DFCB 3IQ7A 3W1FA 2YISA 5DR2A 4O84A 2WQNA 1OITA 1SVHA 2UW3A 1W8CA 4CGAA 2FGIA 5KZ0A 1PXJA 3EQBA 4LOOA 3T9IA 4BB4A 2NO3A 3DAJA 2HZ0A 3DJ6A 5AX3A 4AQKA 4GRBA 1PJKA 4M15A 3HDNA 5EYCA 1JSVA 3FMLA 4WUNA 4EOPA 2XB7A 5CAOA 4IIRA 2BKZA 2VGOA 2QHMA 5HLNA 3OT8A 5AV1A 3VBQA 3AKLA 1GIIA 3DK3A 5DGZA 4RZVA 5ETCA 3TCPA 4C3RA 5LQFA 4F09A 1OL5A 4PWNA 1PXLA 4S34A 4IX4A 1KE6A 3O17A 1PKGA 5JFXA 4BZNA 2W1IA 3ATTA 4RJ5A 4DEHA 4UWBA 3FUPA 4CZUA 4AP7A 3HUBA 5IA3A 2FSTX 5DWRA 4D0WA 4GJ2A 4BDAA 1MRVA 2PSQA 2HZIA 2YIQA 3HX4A 2HENA 4O91A 4ALWA 4ZSEA 2C1BA 4BDBA 4KIPA 3O7LB 5CAUA 1SNXA 4TYEA 3FPMA 4QQCA 5JFWA 3R73A 3GBZA 1H1SA 3MFUA 4QMXA 3VUHA 4C4IA 4XLVA 2FUMA 4CFMA 3U6IA 3OY1A 4ACCA 5HG8A 3VUTA 4AX8A 1SVEA 4X2NA 2RFNA 3DBDA 4LFIA 5EI8A 4DG2E 3TTIA 3PXQA 3WE8A 4F7LA 1Q8YA 4CG9A 1MP8A 1YHWA 3NDMA 4O2ZA 2AYPA 4FT9A 4IJ9A 4TPTA 4AN3A 4EQCA 4BICA 3GI3A 4PTCA 4B8MA 3C4EA 4MH7A 1WFCA 2R3KA 2GNIA 3CE3A 5AP3A 4ZJJA 4FKRA 2BTSA 3E8CA 4YJOA 2OBJA 5J5TA 3KMMA 4FSQA 3C4ZA 3QWKA 4GEOA 4BIEA 5EKNA 4CVAA 2YCQA 5FM2A 3WZEA 4F9YA 2J90A 4BDHA 1KWPA 5I3RA 3FC2A 2AUHA 3QGYA 4LGDA 3VQUA 5FD2A 4G3CA 2ERZE 1P5EA 4O4CA 3NAYA 1H00A 2F7XE 4U8ZA 3UIBA 4AU8A 1KV1A 2E9OA 5FGKA 4LGGA 3KRWA 4GG7A 4CFUA 3EN9A 3MWUA 4TNBA 4Y95A 3D5VA 3QZIA 4CXAA 4JBOA 2NPQA 5HESA 3EN6A 4C8BA 1AQ1A 2YWVA 3VW6A 3FBVA 1ZYCA 4PPBA 4RIYB 4RVMA 3RPYA 3KREA 5GZ9A 4FZFB 2C6MA 4KSQA 3E5AA 4JJRA 5DRDA 5CU0A 2VTOA 1H4LA 4WRSA 3KULB 4TYGA 1VEBA 3LXLA 4QT1A 4R1VA 2GNGA 2QLUA 5EK7A 4ZTQA 3RCJA 1SMHA 2YM6A 4JL9A 3CP9A 3R7UA 4A7CA 4DN5A 2WU6A 1F0QA 4ZOGA 4FA2A 4BWPA 4YTIA 4YUQA 4I92A 3QRTA 4TT7A 4JX7A 3AMBA 3NMUF 4D5KA 4HPUE 5IH4A 2ZFYA 1Q8ZA 1OKYA 4D4YA 3KMUA 4O4FA 3I7BA 3FHRA 2CMWA 4IX6A 3BKBA 3OP5A 4PTGA 4WUAA 4YJTA 2J4ZA 3NYXA 4WIHA 4TNDA 2XJ1A 3QYWA 4E26A 3GU7A 1DI9A 3N4TA 3RK5A 3SDJA 2HXLA 3GENA 3PJ2A 1UNHA 3FDNA 1YXSA 3WBLA 2I0VA 4ZLZA 1W98A 4PRJA 2UV2A 3LIJA 4EYJA 1UU8A 3E88A 5EDRA 2Q83A 3Q2MA 2YITA 5T3QA 4K2RA 5FP5A 4CKIA 3DZQA 5IKWA 5CY3A 2C68A 4FG9A 3MY1A 2WTIA 4YHJA 5HHWA 3ACJA 1VYWA 5DI1A 4C4FA 4AXCA 2O64A 2Y6MA 3ZLXA 2GHMA 3K5VA 3KFAA 5KMMA 4DTKA 2OIQA 4V01A 5E8SA 2CCHA 3FMMA 3NNXA 3OTVA 4GUEA 5L2IA 3E8DA 4JR3A 5EQEA 3BLQA 3DPKA 2R3OA 4MEDA 4RJ3A 4PTEA 3C4CA 1VZOA 1ZYDA 3VF8A 5J9LA 4G3FA 1MUOA 3EQDA 3UC4A 4QD6A 1STCE 3LJ2A 1GOLA 1JOWB 4G6OA 3QFVA 5BUJA 2H8HA 4RFZA 1OPLA 4XG7A 4ZXTA 4QP3A 3KXHA 5I3OA 3TUDA 4I41A 4ANMA 3VUMA 1LUFA 1KOBA 1CSNA 3M2WA 1ZXEA 3QC9A 4DEAA 4GK2A 4J7BA 5BYZA 4LYNA 3CPBA 4UWCA 3OCGA 5E8XA 4E4LA 3QCYA 4IE9A 3DQXA 3F88A 4ZTLA 3VS5A 4PNKA 2B53A 4RQKA 3S0OA 4QP4A 3R7OA 5D10A 5TKDA 3GVUA 3C5IA 3ZOSA 3NGAA 3HMPA 2IO6A 4QYYA 5E4HA 3NX8A 2XBAA 1OIQA 4XV2A 2UW7A 2I0YA 2R3NA 4I21A 2W1FA 2Z02A 2QG5A 2WELA 4FT7A 3VS6A 1MQBA 4BTMA 4PDOA 3LCDA 4GS6A 1WBWA 2X81A 4DYMA 4FKGA 2NYAA 3D5UA 3OTUA 5TOZA 4FV8A 4EWHA 3G15A 4EH9A 3RAKA 3UVQA 4U41A 2QHNA 5CX9A 2XNPA 4RX8A 3RJCA 3MESA 3MTLA 4U43A 1ZYJA 1RQQA 3FMJA 3PSBA 5I9XA 4K33A 3KY2A 4JQ7A 1Q97A 1BL6A 4R7HA 4I20A 3SOCA 5B2KA 2BZHB 3PVUA 3DLZA 4BGGA 4OTHA 2XK4A 1VR2A 4PL5A 4HGSA 3DDPA 4L53A 5AIRA 5DA3A 3FI4A 3LFDA 1UU3A 2RG6A 4I23A 3GU8A 4FSUA 4AT3A 4MTAA 2HOGA 4ZS0A 4H39A 4S32A 3EL7A 3EN5A 2G1TA 3CJFA 4PDPA 5LMKA 5AR8A 4IWPA 4OGRA 4X2FA 4RIOA 3DKCA 3R83A 4U45A 3VHEA 3PY0A 4EOIA 3JS2A 5DVRA 5AP7A 2X2MA 4QQTA 2JIUA 4IM3A 4F1MA 4AS0A 3LVPA 5DLSA 1FMKA 5CEKA 4FNZA 4DCAA 4L8MA 3B8QA 4PQNA 2WEIA 4AQCA 1Y57A 2VWYA 2WMQA 3WOWA 4H58A 1JQHA 5DFPA 4B99A 3OWKA 3R8UA 2YM4A 4I94A 2XNNA 4M84A 1TKIA 5EDQA 2CNUA 1B38A 1IA8A 4QMZA 5CF4A 4WSQA 5IQAA 1I09A 4UZDA 3MI9A 3H3CA 3NCZA 3P7CA 2ITQA 4Z3VA 3FI2A 4OTGA 2OO8X 4X3FA 3C4WA 3QZGA 4GW8A 4KRCA 3F5XA 2J7TA 5FG8A 3MYGA 4FOBA 3P08A 2XEZA 2RFEA 3QXOA 5EHLA 4EORA 2QOKA 5AFVA 5M06A 2P3GX 4GL9A 4AGUA 4FJVA 5CF6A 2YDIA 4N57A 3LOKA 3UIXA 3ZM9A 4MBIA 1GIJA 1U59A 2EUFB 2BRMA 5ACKA 3TJCA 3I7CA 3E87A 2ZM4A 4M0YA 4U0IA 3VJOA 5M4UA 2ETMA 3E64A 4RWJA 2W4JA 3BYVA 3WYYA 1JVPP 1SM2A 2E9PA 3A61A 3L9LA 4JOAA 3PE1A 3GCUA 3ZO4A 4A06A 4IZAA 4OTQA 1REJA 3MN3A 2ITPA 4FSNA 3IECA 4Z7GA 1A06A 3NIZA 3CSVA 3JY0A 4QMOA 2C5YA 4UXQA 2CN5A 3KRRA 3W2SA 3C4FA 3FHIA 3TUBA 4M8TA 5BVDA 5IH5A 1PY5A 4JAIA 2XA4A 5L4QA 1ZOHA 3K2LA 4X2GA 2QURA 2XYNA 3CCNA 5JT2A 5KMJA 4ZSJA 1DI8A 3KN5A 4DHFA 5GZAA 4CRSA 5AUVA 4XEYA 1V0OA 4OTWA 3I6WA 4WKQA 4F0GA 3LFAA 4GH2A 4UXLA 3RZFA 4UV0A 3IGGA 5BUEA 1Y8YA 2W5HA 4FTOA 4FSYA 4MXOA 3F7ZA 3H0ZA 3P86A 4FSTA 4FX3A 4IHPA 2RKUA 2XAMA 4EK4A 4OR5A 4FKUA 4BCFA 4BCJA 5EQPA 3GT8A 5AP4A 4LL5A 4YHTA 5CXZA 2GHLA 5AMNA 1UKIA 4IMYA 4CMUA 2YIYA 1M17A 2AQXA 2I0HA 2YCRA 4O1PA 4OAVB 4P7EA 3TNQB 3ZMMA 4FG7A 4RG0A 2BTRA 4RA4A 1QPDA 2WPAA 2XNGA 2VTIA 2YAAA 3UMXA 2FSOX 3TTJA 1OKZA 4O7ZA 5ANDA 3W2RA 5K4IA 5L2TA 3COIA 3KU2A 2WO6A 4ZAUA 4I6LA 3NYVA 4GUBA 5JQ8A 2A0CX 4ACHA 3LCTA 4EK3A 3PVWA 4ERWA 2H9VA 4J8MA 4FTCA 2R9SA 4DBNA 4I6FA 4ZP5A 5L6OA 2CSNA 2VWXA 5IH6A 4AXEA 2XIRA 2C6TA 4QYGA 2OJFE 3MTFA 2VTPA 5KBRA 1GZOA 5ETIA 3ZDIA 5M09A 1YXVA 5HCZA 2JKMA 2B1PA 1IR3A 1YWRA 2XYUA 4FC0A 3BGPA 1GJOA 5CU3A 1CTPE 3ZO3A 4YZDA 4BDIA 4EHZA 5HU3A 1P4FA 5AP1A 2OJJA 5CALA 4FEWA 4NKAA 2BHEA 4RJ4A 2ONLA 3DDQA 4XLIA 3EN4A 4HGEA 4NK9A 2ZM1A 5K5NA 4ALUA 4FKTA 4A9TA 1PYEA 3KEXA 3OFMA 4EHEA 1LPUA 4TZRA 4FL3A 4GT3A 4C62A 3NYNA 1M52A 4DG0E 3ZEWA 1JLUE 3V51A 2RSVA 4R5YA 3PRIA 1W83A 5LWMA 3FY0A 4NW5A 4RX7A 2CNVA 2C3KA 4ZY6A 3UTOA 4FI1A 4BDGA 5K4JA 4QMVA 4L67A 5HTCA 4IFGA 1Y91A 4PV0A 2PHKA 4MHAA 4QTCA 4YSMA 4Q2AA 4UBAA 3S95A 5KUPA 4UN0C 5I0BA 5C1QB 4TKSA 3ET7A 4RLLA 3S00A 3AMAA 4QTEA 4FEUA 4XNEA 2KULA 3FXZA 4FZ7A 4M67A 5ETFA 4ASDA 5HEZA 4C2WA 3MIAA 3COKA 3UDZA 4GCJA 4B7TA 3KIOC 2X4ZA 3KXNA 4HVDA 1J7IA 2R7IA 2R0IA 3OXZA 2YZLA 4AGWA 4EOSA 5CEMA 1W2FA 5H8EA 2W9ZB 5DPVA 2IW6A 2VX3A 4EZ3A 4HNIA 4DHJA 5CEOA 3ITZA 5C9CA 1PF8A 4XP2A 4BTKA 5HGIA 4BDDA 3MH2A 5EW9A 3Q3BA 1JKSA 2ACXA 1SNUA 3KL8A 2PK9A 5E1SA 5FTQA 4E6CA 4DF3A 2GTNA 4CYJA 3BRBA 3C51A 1W0XC 5KKRC 5IG1A 2YWPA 5DEWA 3QTIA 5L6PA 4KBCA 3KRJA 4B6LA 3U55A 3FXWA 3F5GA 4GIIA 4NT4A 4PDSA 4WA9A 5CSHA 4D4RA 3VUGA 4M97A 4IXPA 3CBLA 5BUIA 3CQUA 4YZBA 4YZ9A 4EC8A 3E8EA 4LRKA 5HIDA 3TEIA 4DH7A 3JVRA 3BZ3A 2RL5A 2X0GA 4G34A 1FVTA 3QD4A 3SRVA 1OBGA 2OGVA 5HOAA 3W10A 5F1ZA 2OG8A 5G1XA 1BKXA 4FKOA 2WMUA 4NKSA 3PSDA 2X8EA 3K5UA 2IZSA 2HIWA 2WEVA 5EOLA 3T8OA 3UIMA 3UC3A 3HEGA 4X3FB 3EQPA 5FXSA 4A9UA 4MNFA 1G8JA 5J87A 3JVSA 4M66A 5L6WL 3BL9A 5DMZA 4WG3A 4FODA 5HO6A 5LXMA 4EKLA 5KZIA 4MAOA 3AC2A 3DKFA 3DBQA 3PVGA 3Q5IA 4JX3A 4M13A 3VBXA 3W2PA 3A4OX 4E6DA 4YMJA 4FEXA 2VAGA 3MFTA 3DS6A 4IAIA 4JMQA 3GC0A 5JN2A 1L3RE 3KCKA 4EK8A 2G2FA 3KRXA 3PXFA 3RAIA 3ZUVA 2C0OA 2VO0A 3JPVA 4RC3A 4DITA 4AW2A 3GFEA 4FEQA 4KSPA 1XH7A 4HYHA 2Z7QA 3F5UA 3GC8A 4USFA 4BDKA 4J8NA 1XH8A 1CKIA 4RWKA 4RJ6A 3BIZA 3ENHA 3OW3A 4GG5A 3C5UA 4FTNA 4ZK5A 3RKBA 4D55A 2YM5A 2PZRA 3HP2A 4QMUA 5AUZA 4AXAA 4LMUA 1QCFA 2GDOA 4QTBA 3DV3A 2XMYA 2QOCA 2C69A 5AM7A 3N4VA 1WBSA 3EZRA 3W55A 1LR4A 2WMXA 3QTUA 3ODYX 4I5MA 4HCUA 4BCNA 5AR2A 3RK9A 3SGCA 1FMOE 5IMEA 2ZYBA 4JAJA 3BV3A 2J50A 5KNJA 1M2QA 2BHHA 3ANRA 3AC4A 3CTQA 2UVXA 3RCDA 2QKWB 2JDOA 4I22A 3ZS5A 3PJ8A 4AZSA 2JKOA 4C3FA 5EOBA 4OTIA 1ST0A 1O6LA 4QMWA 4RX9A 3Q4TA 4ZZNA 3F66A 2GNJA 3E7OA 2PUPA 1XJDA 2YERA 2C6DA 3MVLA 4L46A 5JFSA 5IA5A 2C3JA 3FSKA 2XK8A 4BDEA 2V55A 4BY9E 4LQMA 1OPKA 3SC1A 3W2QA 4DEDA 2HW7A 2GS6A 4XYFA 3QRIA 5ANEA 2GQSA 1JKTA 3WF5A 1S9JA 3ZFYA 2OI4X 3PJ3A 5DN3A 3SA0A 4PL4A 1KV2A 3UPXA 3OOGA 5BVNA 5HU9A 3R30A 5KMLA 3OD6X 4O27B 1OUYA 3PJ1A 3SLSA 5AEPA 2XRUA 4BHZA 3P7BA 3F2RA 4YP8A 3UODA 3L9NA 3R0TA 3PA3A 2Y7JA 5DT0A 3SW7A 5EHOA 5HNBA 1GZNA 3A7IA 3VQHA 4XG6A 2CGVA 4R7IA 1QMZA 4IZ7A 5LVPA 4IBMA 3HNGA 4BI1A 1IEPA 3NVMB 3HDMA 1TZDA 2ERKA 3MBLA 3OVVA 4C7TA 3K54A 2PUNA 2W1HA 3K3JA 1WZYA 3Q6UA 5LCJA 4J99A 3HECA 3FI8A 3EMGA 3CPCA 3A8XA 2BDJA 1KE5A 3C50A 3R00A 4FNWA 4XS2A 4FIHA 3HKOA 4IANA 1TFFA 3G6HA 3WZJA 5HVKA 4BCQA 2J2IB 4MD9E 4DCEA 1UVRA 5AUUA 2GQRA 5E8UA 4USEA 4S30A 1FGKA 2CHLA 4FICA 1UNGA 1QPEA 2BCJA 3HMOA 4RWIA 2BFYA 2A2AA 4DBXA 3UQCA 4NL0A 3RI1A 4C36A 5AP6A 3E63A 2JFLA 3L8SA 5FDXA 3M11A 1YDTE 3II5A 4O6EA 2P0CA 5CNOA 2BVAA 3O2MA 3V5WA 3HRFA 1ERKA 2AC5A 2VTJA 1ZWSA 2C30A 5CVFA 3QU0A 2FSMX 4XG2A 5HVYA 1LEZA 5H2UA 2W9FB 1OIRA 5IQBA 3O50A 4KINA 3ODZX 4ANNA 3AG9A 5GZ8A 4UALA 3QKLA 2CGXA 2ITWA 3TZ7A 3EJ1A 1JWHA 4YPSA 4AWIA 5M57A 1HCKA 4BWXA 4RA5A 3ZU7A 4W8DA 5CSPA 3FV8A 2W4OA 5IUGA 1MQ4A 2ZMDA 4RC2A 4DTAA 2R3GA 3ZLWA 4NJDA 3F3VA 4NM0A 5HE1A 2WMVA 3UG1A 3QQLA 3HV7A 3V04A 2J6MA 3W0NA 1AGWA 3BYOA 3SW4A 4QTAA 2W17A 3G5DA 5CASA 4EH2A 3RPRA 3W2OA 3FL5A 2Z7LA 1YXTA 4QQ5A 2CGUA 4JRVA 4BWKA 2BDWA 4KWPA 2GS2A 3L1SA 1G8SA 4ZMFA 1PW2A 4YPDA 2VNWA 4IACA 4AGDA 1ST4A 4AT5A 1RJBA 2YEXA 3O23A 5BQ0A 4R3RA 2XANA 3VO3A 3TM0A 3I0OA 4NWMA 1M7QA 5J7BA 3T9TA 3FQSA 2PVLA 4OBOA 3WILA 4DLIA 2OKRA 4KIOA 3IDCA 4ZEGA 5CI7A 3SRVB 3PUPA 2O5KA 4BTFA 4IX5A 5D7AA 3Q9YA 3QHWA 4I3ZA 4LOQA 3F2NA 4G31A 3F5PA 1O6YA 1XQZA 3KMWA 3QQFA 4QRCA 3UOKA 4A4XA 4AAYA 4C35A 4J95A 4BYJA 3V8TA 1K3AA 4NZWB 5T6KA 4DFXE 1ATPE 2PVJA 4E20A 3UZPA 2X1NA 1F3MC 2A1AB 1NT2A 3UO5A 4O4EA 4EBWA 5M07A 4FT0A 4JDKA 4O0VA 3LW0A 2VTSA 3IW6A 4QOXA 4WRGA 3VHKA 1ZMWA 4FZ6A 4AW5A 4KKEA 5EM8A 3QTZA 3R1SA 4LI5A 4NTSA 3SVVA 4GYGA 4J52A 4CYIA 1WAKA 1JBPE 1XKKA 1XH6A 4GV1A 2IN6A 3ZO2A 3LFBA 2C6EA 3EHAA 5CEIA 3ROYA 2R7BA 3PWDA 5LOHA 4LG4A 2Z60A 4AW0A 2RGPA 3OCBA 4GJ3A 4FIIA 4M3QA 4FV4A 4IM0A 4R77A 3GXLA 2BZJA 1PHKA 3MJ2A 3GU4A 2A27A 4E4MA 4OTFA 1NY3A 4G5JA 3AT4A 4AUAA 2PVRA 3G9NA 1U5RA 3QTXA 2UZDA 5J1WA 5EM7A 4ANLA 5DE2A 4BJJA 4F1OA 2XK6A 4JR7A 3ZSGA 4KD1A 3WF9A 5GJGA 2IW8A 3G33A 4EQMA 2YJRA 1Q5KA 2HWPA 3KKVA 4NUSA 5CAPA 4IAZA 2ITUA 1MRUA 1OKVA 2X7OA 4CT1A 4Z7HA 4IC8A 1ZYSA 1PXIA 2PVYA 5C4LA 2WNTA 3O0GA 3NCGA 1BUHA 3RM7A 4KUJA 2BDFA 3NR9A 4EI4A 5IA1A 3F61A 1PMUA 4EEVA 4IB1A 5CZHA 3R63A 5AX9A 5J5SA 3QTRA 3HV5A 3ATSA 2XRWA 1H8FA 5FXRA 4PMPA 2VZ6A 2X2KA 3DAKA 3ULZA 2QOHA 4BDCA 4AZVA 2YN8A 3E8NA 3G51A 5IDNA 3LLTA 4IAKA 5TT7A 3W0OA 4DT8A 3H4JA 2PMNX 3IW8A 4CMTA 3R02A 3DQWA 4M69A 5CSVA 4EJNA 3MVHA