4DG0E

Crystal structure of myristoylated wt catalytic subunit of camp-dependent protein kinase in complex with sp20 and amp-pnp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
338
Chain Sequence
SEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of N-terminal myristylation in the structure and regulation of cAMP-dependent protein kinase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 107
structure length 338
sequence length 341
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dg0E01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dg0E02
1YOLA 3FY2A 2E9NA 2ETKA 4IWDA 5T3QA 4EQUA 3R1QA 4I41A 5L6PA 3BWJA 2ZMCA 4BTFA 5FTOA 3MJ2A 2GHMA 4FL2A 5IEVA 3Q32A 2B9FA 3TNWA 2PUUA 2R64A 1QCFA 4O21A 2ZB1A 4D4VA 4S2ZA 1PY5A 4EUUA 4P5ZA 4DGGA 5C03A 3R9HA 4HNFA 4JDIA 4YPDA 4M8TA 4ASXA 1OMWA 4N70A 5F9EA 1MP8A 3AMBA 1PKDA 3D5XA 4KIKA 4IVBA 2ZJWA 4V01A 4GG5A 2X9FA 5C8MA 3MPTA 4E6QA 3KQ7A 1M2RA 3RAIA 5BUIA 4LI5A 3UQCA 1WBOA 3W32A 4KNBA 4H1MA 2GNHA 3ZXTA 4XBUA 5AAEA 4UX9A 4MWHA 2Z02A 4QYFA 4FUXA 4TNDA 3RGFA 2F9GA 3H9FA 2BZKB 3DS6A 4PDYA 1G8AA 4MKCA 3NUSA 3ERKA 3GFWA 4BWKA 2Y6MA 3HA6A 4FSNA 3IW4A 3ZHPC 5M08A 4FTJA 4HYSA 5ETFA 4NCTC 4O81A 2V0DA 2UW9A 4AA5A 5HO8A 5I9ZA 5IEXA 4DEEA 2ITTA 3ZEWA 3OW4A 3AG9A 4RX9A 4AA0A 3PIZA 2IN6A 3QWKA 5HESA 3FC2A 1Q61A 5J5TA 4IXPA 4O7YA 2UZTA 3BLQA 4NT4A 4BI2A 3RBWA 3ZRKA 2PE1A 1PYEA 2PMLX 3Q4TA 4GT5A 3VUIA 3MGYA 1UKIA 5JK3A 3KXGA 2YITA 3NR9A 4GIIA 3TL8A 3ZO2A 5AP6A 4FVQA 3RPSA 4ZS0A 2SRCA 3F7ZA 2UZDA 3E8CA 5AUTA 4FKGA 5HNGA 5B2LA 3ULIA 2C0TA 1R78A 2VWUA 4LOOA 4S31A 2XNMA 4U3ZA 1JBPE 5CYIA 5FEDA 5AV1A 3SHEA 4YTCA 3HMPA 3FZ1A 4TRLA 2OH0E 3DZOA 5KZIA 1TQMA 4GK4A 1NVRA 1CSNA 1OL7A 4G16A 4YZDA 3TDVA 4FI1A 1U5QA 1JKSA 5EH0A 2W1GA 3WIGA 5CALA 4PY1A 5K9IA 3KULA 3BU6A 4CCUA 5A54A 3OWJA 2AC5A 2FSMX 4BDDA 3DXPA 3HV3A 4KAOA 3DOGA 5J7HA 3D2KA 1JWHA 3QLGA 2F49A 2X0GA 5IH5A 4O7SA 2J51A 3PZHA 1O6YA 4IB3A 2J0IA 3LJ1A 1H0VA 3ATTA 4C4HA 2PZPA 3A60A 4FGRA 4K0YA 4YURA 4UWCA 3ODZX 3H4JA 4YPSA 1XBAA 2UW4A 4TWPA 3GUBA 4DAWA 1KE7A 4YP8A 2IW8A 4MBJA 4FOBA 3PIXA 4QMSA 3ZUUA 2CCHA 2QNJA 5IU2A 3F5PA 3NYVA 2OXYA 2X7OA 3HA8A 4JVGA 5FP6A 4IZAA 4R78A 3CR0A 3OD6X 1ZY5A 3GU8A 5FBOA 3ZZEA 2Z60A 3DTCA 3KGAA 3LHJA 4YLJA 3UG2A 3FZTA 4M0ZA 4ITJA 4ACGA 5FUTA 2OJGA 3Q4UA 5AA8A 3HV4A 5KMJA 4RGJA 3QA8A 4QMVA 3AC2A 4X6QC 5AEPA 2WMWA 2IVSA 2H8HA 4I6QA 4EI4A 5BMMA 3QF9A 2OJIA 1BX6A 5A14A 3SW7A 3VUTA 1T45A 1ZWSA 2DYLA 3FHIA 3UMWA 4F9CA 4IAYA 5HKMA 1OIRA 4O0RA 5HIDA 2C4GA 2BRNA 3UVQA 2FSTX 3R7UA 3CTJA 2F7XE 3DPKA 4BCGA 2WB8A 2BZIB 4XLIA 4CYIA 4IX6A 3TUDA 2ZMDA 1B39A 1YI6A 4Z9LA 4AOTA 4JXFA 3C4ZA 3ANRA 1R0PA 4FYNA 5L8JA 2OIBA 1K3AA 2BDJA 4RZWA 3ZUTA 4EEVA 1CKIA 2Y7JA 3E8EA 3EH9A 3TT0A 3ATSA 2C0IA 5DEWA 3OZ6A 4TWNA 4FSMA 4U0IA 4Y46A 2WQMA 1UKHA 2CPKE 1J7IA 2X1NA 4MBIA 1Y6AA 2PVMA 3LFBA 5JZNA 5KE0A 4X21A 5KKRB 5EQYA 2PU8A 5I9WA 3QQJA 5L6OA 5CAUA 2R7IA 5CU3A 2PZ5A 4O83A 3PWYA 3P4KA 4C4EA 4PTGA 5IH6A 4IACA 3HDMA 3Q2MA 2X8IA 4PPAA 4F7NA 3LCDA 4XG3A 1K2PA 2VTLA 2DS1A 2W0JA 1QPEA 2QURA 3LXKA 4FNWA 5CSVA 3TNIA 4EBWA 4HYHA 4OR5A 4RJ4A 3UVPA 4CV9A 5JEBA 1MRUA 3PY3A 4E5AX 5AFVA 5DR2A 4YJNA 4ACCA 4FSTA 3BQRA 4FTKA 5LVLA 2XF0A 5AR8A 4R7HA 5I9VA 2JIUA 3EJ1A 4LGGA 2VTSA 2YIXA 3A99A 4AOJA 5LJJA 3EN9A 3OTUA 3AOXA 2WPAA 3VIDA 3FMJA 3LM5A 3M11A 3NEWA 3UTOA 4F1MA 4WBBB 5ANGA 5I0BA 1YWNA 5AV0A 4P4CA 4C35A 5HU3A 3G5DA 4ZJIA 3QC9A 1PRYA 4K77A 1QPJA 3P0MA 4BGGA 4D5KA 4TYHA 4C38A 2QD9A 3H0YA 2WO6A 3ORLA 4PMPA 1SNUA 3F2AA 4RJ3A 4WUNA 4IWPA 3QKKA 4BCQA 4FT3A 4DH7A 4CFVA 5AUZA 3TKIA 5TKDA 3ZSIA 2BAKA 1V0BA 3HX4A 4LGHA 4EOJA 5M07A 3QGWA 4RVMA 4UALA 3R8MA 4ZLZA 4EKKA 3MW1A 1PXKA 1VZOA 3TZMA 3MFTA 5F94A 4Y73A 5FM2A 5HI2A 5L2WA 2I0EA 4O7WA 3U9CA 2FB8A 3NAXA 4EH6A 4BYIA 5DT4A 5DYJA 5KX8A 4AT5A 3R04A 4H58A 3EQIA 3OWLA 4RIWA 3P86A 1H26A 1RW8A 4U79A 4DEHA 1CMKE 2ZVAA 2QU5A 4IM3A 1WFCA 4U97A 3QQLA 4Q9ZA 4XMOA 3UO4A 3FZPA 1E1VA 3LFNA 3K54A 4FEUA 4F4PA 1U54A 1W83A 2QODA 4D1XA 4W4WA 5DRBA 2R9SA 3OCBA 3ZC5A 5HX6A 5AR5A 4I6BA 5A3XA 5BVDA 3TKUA 2C30A 2FA2A 4KA3A 4ZP5A 5E90A 4IAIA 2W1HA 4ZIMA 3DFCB 3DNEA 1W0XC 3C7QA 3TV4A 3V51A 4EJNA 3VHKA 2EWAA 5DEYA 3ZS5A 3SD0A 3LXLA 2CLQA 1IASA 1F5QA 2WOTA 4GL9A 5HHWA 4MEDA 3R7VA 1IR3A 3PVUA 4NU1A 2BFYA 3V5LA 4A9SA 2RGPA 4IZ5A 4E4XA 2RL5A 4DF3A 2UZWE 2YLFA 5HGIA 5IA1A 5A4TA 3A7FA 3QYWA 3NMUF 3VULA 3NW5A 3WZKA 3LXNA 4FV8A 4TWOA 3UZTA 3C13A 4G5PA 4L8MA 4D4SA 4FV7A 5HCXA 2BTRA 4YZ9A 2X81A 4KWPA 2YDKA 4QP4A 4FA2A 2X8DA 3HEGA 4PMMA 4ZOGA 1UNHA 5EKNA 1TKIA 4FSWA 5AP2A 4CZTA 2ZV9A 3GCQA 4D2PA 1Y91A 4MD9E 2C5VA 5LARA 4OGRA 3SVVA 1MRVA 2UVYA 5KBRA 2PVHA 1HOWA 4W4VA 3CTQA 3PSDA 3CD3A 4OT5A 4YJOA 2YM3A 4JG6A 4GH2A 4ERWA 3FDNA 4I22A 3RP9A 1NVSA 3PUPA 3GGFA 4BDEA 4F1OA 2HENA 1FVVA 5L2TA 2IWIA 2YZAA 3TCPA 5LVOA 3O96A 2R0IA 3RK5A 4BI0A 4R1VA 4BZOA 5A46A 5IUGA 4I3ZA 3HP5A 3IW6A 4NM0A 2V55A 2VGOA 3EHAA 4XG7A 3ZSGA 4QNYA 5CAOA 4H36A 4W9XA 4EHVA 1EH4A 5DPVA 3OCGA 4BCHA 1OL2A 5J5SA 3CQWA 2OF2A 3ZO1A 4GFGA 3FSFA 5M4UA 3EFKA 4AT3A 5HVYA 3JS2A 4QPSA 3MFUA 4AW0A 4GU6A 2IZTA 3U54A 4FKJA 4WG3A 2OW3A 3KF7A 3QTUA 3DQXA 2E9OA 3DK7A 4DH5A 5CU4A 4APCA 1Q5KA 5FWKK 4ANSA 4CMTA 4JG8A 2BRGA 4G3CA 1E1XA 3U6JA 5JRQA 1P5EA 4ASEA 3ELJA 4QP2A 3VS7A 2BHEA 4F7LA 1OM1A 5LCKA 5DOSA 1XKKA 2CDZA 3O23A 4YC6A 4ZLYA 5J9YA 2ZAZA 4DBNA 2UVXA 3KC3A 3FPMA 3PLAE 3RAWA 4YO6A 2R3IA 1A9UA 4OLIA 5L6WL 3VBVA 4L3JA 5GZ9A 2VTTA 2VTNA 2VO0A 4BCKA 4O7VA 3FY0A 4FC0A 4N0SA 4RIOA 2GHGA 2XB7A 3CY2A 3E88A 4X3FA 4APPA 2GNLA 4IJPA 5FLFA 4Z7GA 5BVOA 4P2KA 2C0OA 2RG5A 4FYOA 2A2AA 3WYXA 1H25A 2PE2A 2WMAA 3TV6A 1KE9A 2BMCA 2CGVA 4R3PA 4OTPA 3UJGA 2NNWB 3NNWA 1OKWA 2XNOA 3LZBA 4Q2AA 4QQ5A 5FP5A 3HMMA 3CJFA 3GQLA 5BUEA 4ZY6A 4QTEA 4JQ8A 4ALWA 3FWQA 4UV0A 5CAPA 5D12A 3NUUA 4O1PA 1UU7A 4NEUA 2GCDA 4CT2A 3CY3A 3C4XA 3BYOA 4F0FA 1H27A 2P4IA 2VTJA 4FVPA 4HZRA 3VUHA 3TM0A 4QRCA 1VR2A 3D2IA 1ZZ2A 3MB7A 3VUGA 5IZFA 1URWA 4LV8A 3TTJA 4H05A 4JL9A 4USEA 4FSQA 4YUQA 4HVIA 3AT4A 4WKQA 2H9VA 4G31A 4C4FA 5JQ8A 3HLLA 4EH2A 2XIYA 4IH8A 4EUTA 4NL0A 3EYGA 5CF6A 5DT3A 1OVEA 2J90A 4P90A 3QGYA 3ZBXA 4G9CA 3QFVA 4ZK5A 2W9ZB 3R9NA 1R39A 1B38A 3BQCA 2CNVA 5EDPA 4WRSA 3UIMA 2GNGA 1H07A 4O86A 1XJDA 2WMQA 3ORTA 3BX5A 1KE8A 1GJOA 2AC3A 4BZNA 3OY3A 3CGOA 1Q8UA 2XK6A 3MY0A 4FTRA 4EOSA 4EK6A 4FMQA 5FEQA 2OK1A 3CKWA 3F6XA 3SA0A 1DI9A 1ZMVA 4O84A 3V8WA 4BGQA 4EWQA 2XNGA 4DFUA 1WVWA 3OROA 4OTRA 4L45A 2YIYA 2ZB0A 4RT7A 3SX9A 4DFZE 5J1VA 2CKQA 3PRFA 2X39A 5EYMA 2PUIA 4RLLA 1U4DA 5F95A 2BPMA 2VTQA 3LFDA 4FICA 3PYYA 5D7VA 1YXUA 5CF5A 2BVAA 4Y95A 3R8UA 4K33A 3ZUVA 3ROCA 5HIEA 1IG1A 2JKKA 2LGCA 3PA3A 1Q99A 5CT0A 3VUKA 2ESMA 3DAEA 4D4RA 4FL3A 4CFXA 4CXAA 5IF1A 4ITIA 5E8ZA 3I60A 2VTHA 3CGFA 1KE6A 3CTHA 4LFIA 5CVFA 4FKUA 2GFCA 4Y72A 1YHSA 4CD0A 3R71A 2NRYA 4PDPA 4RBLA 4PL3A 2ACXA 2UZOA 4ZAUA 2P2HA 4HPUE 5CSHA 4MXOA 3QZFA 4FEXA 4O7TA 2PSQA 2JKQA 4FV4A 4NIFA 4GVJA 1JSVA 1UVRA 5FTQA 3SLSA 4HVSA 3B8RA 3WE4A 3ZM9A 3H9OA 3IS5A 3QRJA 3NYNA 3FKNA 1U59A 3GC9A 3QTSA 5HG5A 4C3RA 2EXMA 2E9PA 3L8PA 5LVPA 4ZLOA 3QTIA 1GIHA 4WG4A 2PZRA 3PXYA 3SGCA 3ET7A 3RCDA 4CCBA 1ZYDA 4FIIA 3ZFYA 2XJ0A 4BZDA 3R73A 2BUJA 4AP7A 4CLIA 4ERKA 4PRJA 5A6NA 3A7HA 4TTHB 4XV1A 3POZA 4JDHA 1DI8A 2O64A 3H9RA 4XX9A 4AW2A 2H6DA 3BGZA 3FYKX 3MVMA 4KIOA 4PWNA 3VUMA 4B0GA 4DG2E 2KULA 5AIKA 1ZOHA 3GI3A 5H2UA 3T9IA 5GIOE 4FG8A 4I5MA 4K9YA 5HTBA 5HU9A 4I24A 3U9NA 5C1QB 4I94A 4CV8A 2YFXA 5KO1A 3I6UA 4BGHA 2OIDA 2R3LA 3HMIA 3MH1A 3Q9XA 2P55A 1NW1A 2R3GA 5H8BA 2G2IA 2QHNA 2YLEA 3PZEA 5HCZA 3SAYA 4GVAA 4YBJA 4U8ZA 3K5UA 2CLXA 4IWQA 3UG1A 3LFSA 1PHKA 2VTMA 4C7TA 2CNUA 3SDJA 3KK8A 5I4NA 2PUPA 1W82A 4TXCA 5CEIA 3WBLA 3W8QA 3H0ZA 3Q6UA 3TKHA 5HQ0A 3BELA 1NT2A 2CMWA 3RWPA 5CSWA 3G2FA 1O6KA 3I6WA 5IA0A 2UVZA 3E62A 4J98A 4LOPA 4EQMA 4AGCA 1STCE 2YDIA 2VO7A 3VUDA 4KD1A 3NNUA 2YWPA 5AV3A 1PJKA 3COKA 1SVGA 4D2SA 1FGKA 1Q3WA 2QKRA 3AC8A 1JOWB 3BE2A 4JDJA 3IKAA 3R7EA 5LVNA 4JQEA 3RHKA 1FMKA 3OS3A 1XH6A 4ZTHA 2WFYA 3BCEA 3PXRA 1OECA 2XIXA 3F2RA 4C57A 3C9WA 1UU9A 4B7TA 5HEZA 4V0GA 3Q96A 4TL0A 5EQPA 5FRIA 4OUCA 3EN6A 3OWPA 4DE4A 3Q53A 4C58A 4AE6A 2XIZA 4WIHA 3UC4A 4O7LA 5H8EA 5KBQA 1KOBA 4JBPA 5HCYA 3SXFA 3MTFA 2GQSA 3WF9A 4EOKA 4L7SA 3CP9A 3LPBA 4M84A 2WTDA 3GC7A 5JQ5A 4DT8A 4ZSAA 5BUJA 2ZV7A 3NCZA 4QQCA 3O8PA 3DBDA 1WVYA 4TT7A 2AUHA 4GS6A 2JKMA 4L44A 2Z2WA 3G6GA 4O0YA 3VBTA 5JFWA 4ANOA 5JFXA 2XYUA 5DRDA 2QOLA 4Y83A 1KE5A 1ZXEA 2G01A 3UPZA 3I1AA 3MH3A 1KV1A 3FE3A 3UIUA 4F9YA 1H4LA 3F5GA 5LMAA 5CS6A 1WCCA 4IIRA 5AV2A 4IE9A 5FD2A 3R8LA 3OUKA 4IHPA 3VW8A 2V7OA 5LMBA 3C5UA 3IGGA 4L43A 4A4LA 5CZHA 5DT0A 3E3PA 3QQGA 3CPBA 5LVMA 3DZQA 2VWXA 3IGOA 4QP1A 4Y5HA 5EYDA 4M15A 4IB0A 2EXEA 4JX7A 2OGVA 3U4WA 4YHTA 4BHZA 3R30A 4Z3VA 4UY9A 1UV5A 3QL8A 4I21A 4FV9A 2XKCA 3GCSA 3NNVA 2CGUA 3OT3A 4QP9A 3R8ZA 4HCUA 1LP4A 5HBHA 3FQSA 4AU8A 2XA4A 5B7VA 3WF5A 2EVAA 4M3QA 5CAQA 4YZNA 4FG9A 2VX1A 5HOAA 3HMNA 4B99A 4EYMA 2OI4X 1YWRA 3RK7A 2Y6OA 4CGAA 3OC1A 4UEUA 3QX4A 2YWVA 4YGAA 3R0TA 4KSQA 3HV7A 3PJ1A 3UDBA 3O50A 4BBMA 5EG3A 4AW5A 1XR1A 3OMVA 1O9UA 2XK9A 3OXTA 2JEDA 5IEYA 4JG7A 3BPRA 4QYEA 3UO6A 2V62A 2QOCA 3EQFA 3KCFA 2X2KA 4EH7A 3IQ7A 2VD5A 3UNZA 4D2RA 5HLNA 3SRVB 2OJJA 4DYMA 3JY9A 1BUHA 3QD4A 4RX7A 3Q04A 3T3VA 1W7HA 5J1WA 3MVHA 4O38A 4FKQA 2R3RA 5CNOA 5JGDA 1P2AA 4FT5A 3U51A 4MXAA 3UBDA 4FR4A 4E93A 3AGMA 4D9UA 3FMEA 4NJ3A 4MF1A 4TYEA 3MSSA 4TNBA 2J5EA 2BRBA 4U80A 4DT9A 2C1BA 4U7ZA 3AC3A 3GENA 1REKA 2BIKB 5F20A 4AXAA 2C5XA 4FKOA 5K5XA 4BCMA 2OIQA 3C4CA 2ZV2A 3OP5A 2LAVA 2VWVA 3BHUA 1CDKA 3F82A 3LJ2A 3NYOA 1UNGA 4D1SA 1SVEA 4IWOA 4QQTA 5EW8A 3SQQA 1GAGA 3NGAA 1YVJA 3R7GA 2ETRA 4D28A 3AT3A 2BRMA 4LMNA 4IB5A 4NK9A 4K6ZA 4O27B 4FE2A 3MVJA 3VRYA 2J0JA 4CFMA 5DH3A 2YM7A 4MXYA 3V5JA 3FLSA 4J8NA 2W7XA 3NSZA 3MB6A 3VF8A 3PE2A 1PXJA 2E9UA 3D83A 3T3UA 4B8MA 4CG8A 4RSSA 4ITHA 3RAHA 3QBNA 5KUPA 4HNIA 2WQBA 4ASDA 3DBCA 4XRJA 5HVKA 3W2OA 1G3NA 3D7TB 3ORZA 3UYTA 4RFZA 2PY3A 4YZMA 3NIEA 3KFAA 2YCRA 1JAMA 3GC8A 3MPAA 4BKZA 3ANQA 3L9LA 4IMYA 4TY1A 3MH0A 3O71A 3Q4CA 4D2VA 4E73A 1OBGA 3E8NA 4LRJA 4XJ0A 3RPOA 2OZOA 4YJPA 4DC2A 2BHHA 3HMOA 4F0GA 5BVWA 3WE8A 3CCNA 2JFLA 1V0PA 2CN5A 3KEXA 3ZTXA 1YW2A 4LOQA 3QCQA 4CVAA 3EZRA 5JFVA 4N6YA 4YR8A 4YU2A 3TI1A 1NXKA 3A8XA 3W16A 2GTNA 4E6AA 4TWCA 3O7LD 4EH3A 2W4KA 4I93A 5D10A 2ZV8A 3WYYA 2JDTA 4IDVA 2O65A 5DN3A 1NVQA 4ZTLA 4WSQA 4BR3A 2R3HA 2Z7RA 2QI8A 4PNIA 2IZSA 4J53A 3BYVA 3ZFXA 4QOXA 2X2LA 4AW1A 3PY1A 4FV5A 5ACKA 3QTWA 2W1DA 4PP7A 1WBWA 3PP0A 4XP2A 5M51A 4WA9A 2XM9A 1PMEA 2VRXA 5IMEA 1KUTA 1AGWA 3WI6A 4BDBA 4G6LA 4W4XA 5K0XA 4JI9A 3NW6A 3EFLA 4XYFA 3JVSA 4ZS4A 5EM8A 2RFDA 2R7BA 3AT2A 4NM7A 1ND4A 5FG8A 2EB3A 4DLJA 4MNFA 4GFMA 3FMKA 4PP9A 3RJCA 4QO9A 4EZ5A 2W17A 3QALE 3I4BA 4KIPA 4L46A 4MNEA 2Y4IB 4IM2A 4K18A 4QMMA 5IQBA 3V3VA 4EHZA 3F9NA 1WBSA 3HKOA 4AZVA 2WQNA 4ZSJA 2QR7A 3CLYA 3VS5A 4IVDA 3V04A 4FKIA 3P7BA 5JSMA 3QWJA 2IJMA 2OJFE 3O8TA 3BEAA 4L7FA 4I23A 5FTGA 2YISA 2C3LA 3A7GA 1PKGA 5D41A 5EK7A 4B4LA 3W2SA 4EOOA 4RPVA 1TQIA 3FKOA 5HBJA 3BGQA 1LUFA 5FXQA 5AX9A 3OWKA 4D0XA 1CKPA 4U40A 2Z8CA 4X3FC 4F9BA 5FM3A 4J7BA 4W9WA 3RWQA 3KXZA 3WARA 5IUIA 2NRUA 3E92A 3DJ7A 4KIQA 2BAQA 3WZEA 2ITPA 3ORKA 3VS0A 4AFJA 4E8AA 3PSBA 3U6IA 3HRFA 4QP3A 5DR9A 3POOA 4V04A 3EN7A 4H3BA 3KXHA 4BKJA 3V5TA 1ZZLA 1RE8A 3Q9WA 1J3HA 3MWUA 4M97A 2GS6A 2B9HA 3R9DA 4IBMA 5HO6A 5HX8A 3UIXA 5BVKA 3LE6A 4C4JA 4E1ZA 4JIKA 4XS2A 3SKCA 4RJ5A 3FXZA 3BI6A 5AV4A 2ZM3A 5M57A 3E64A 3S95A 1L3RE 5DBXA 5BMSA 4WHZA 2WTWA 3QCSA 5HE0A 4CFWA 5E91A 5HG7A 4AX8A 2R5TA 2WMTA 1XBCA 5EM7A 5H9BA 4A9UA 3DV3A 3MIYA 2YM5A 4K1BA 5GZAA 2ZDTA 3VNTA 5CF4A 3EQGA 4DBXA 3EB0A 3CKXA 5IQFA 2Z7SA 4BB4A 1SYKA 3UE4A 4EHGA 3LMHA 2HOGA 2WTKC 2R3QA 1JKKA 2FSOX 4GW8A 4BDIA 4YJSA 2ITZA 1HCKA 4EHEA 2RFSA 5HD4A 1I44A 4J99A 3V8SA 3TTIA 3ACJA 4CFNA 1YHVA 5EW3A 4GG7A 5EOLA 3HDNA 1Y8YA 2PMOX 3R28A 4AZEA 3VHEA 4BTJA 5CSXA 5BVNA 1ZYJA 3ZLYA 4X2FA 2UV2A 3ZDUA 2JDVA 5ACBC 3WZDA 5BVFA 4CKJA 3G90X 1F0QA 4FZDB 4O0XA 4L52A 4QT1A 4YNOA 4LRMA 4CZYB 4BCIA 2YJRA 5A4EA 4KKHA 3BV2A 4KB8A 4WG5A 4C36A 2QOHA 4DGLC 2YACA 2VTAA 2C6IA 2CKPA 4O7NA 5CVGA 4CEGA 3QUDA 5CQWA 1JLUE 4M14A 2OXXA 5AA9A 5ANOA 3QU0A 3IONA 3UOKA 4NCTA 5ETCA 2VAGA 4BICA 3E3BX 4YTFA 3GBZA 1M2PA 2E9VA 3OBJA 2OF4A 4USDA 4Y8DA 4GFOA 4IAFA 4ZY5A 3I0OA 3FXXA 2B54A 5GJFA 3RPVA 2I0YA 3KMMA 3D94A 1S9IA 2Y4IC 3R83A 3RPYA 1IA9A 1ATPE 4DFYA 3LMIA 3LFFA 4TYJA 2O0UA 3F69A 3LQ5A 5E8SA 2YM4A 3RAKA 4HVHA 3F3TA 3AMAA 3OY1A 4F9AA 5LCJA 2QOBA 1MQBA 5KKRC 3NS9A 5H3QA 4CFFA 4FTMA 1IAJA 4A4OA 3K3IA 4BDFA 1XO2B 2VN9A 3QRIA 2IW6A 5IQDA 4Q5EA 3UQGA 4L42A 1BKXA 2QCSA 4GKIA 2FVDA 3ODYX 2W99B 3ZO3A 4JOAA 3BHYA 3NW7A 2ONLC 1UU3A 3WF6A 2WKMA 5CU2A 3P5KA 1SM2A 5T68A 3UC3A 5BYZA 3MESA 1CM8A 3WILA 2VO6A 4M68A 2RKUA 5CANA 4FEVA 2B9IA 2YIRA 3A4OX 4I6HA 3VC4A 1OUKA 4EQCA 4FV2A 4MCVA 2WMSA 1ZYCA 5HTIA 4J8MA 4N6ZA 3RZFA 1URCA 4FKSA 4NW5A 2WMBA 4QD6A 4CKRA 4ZTQA 3ID6C 4F65A 2PHKA 2UW0A 4YZCA 2Y4PA 2WELA 3PIYA 1GZKA 4DFBA 3MA6A 3A4PA 4WUAA 3QAME 4MX9A 4BYJA 2NPQA 1SVHA 1YI4A 2ITNA 3NAYA 2PVKA 1G8SA 3MV5A 3FQEA 4DEAA 4L53A 4UMQA 5TR6A 3FUPA 4ZZMA 3Q52A 3TIYA 3PA4A 4NWMA 4O0WA 3FL4A 4L67A 2QONA 3ZLXA 4IQ6A 5CT7A 4NM3A 5JKGA 5E92A 3BIZA 4E4LA 4RIYB 1PXOA 3IOPA 4XV2A 1YXVA 4GT3A 5HTCA 4B8LA 2HXLA 4PTCA 4JT3A 4U9AA 4CMUA 1QL6A 2VTIA 4QMQA 3GOKA 3VJOA 5KMLA 2C68A 2UZVA 3L8SA 2NO3A 4MNEB 1YQJA 3BHTA 4M0YA 2B55A 2J0MB 3ORXA 1JVPP 3LJ0A 3E7VA 1VJYA 3P08A 3HAVA 3QCXA 3I7CA 5D1JA 5AP7A 5CEQA 2G1TA 2BZHB 3K3JA 4IAZA 4ALUA 3KL8A 5DG5A 3NVMB 3Q4ZA 4FT9A 3R02A 2BROA 3UPXA 2I0HA 3LFCA 3ZDIA 4I92A 2OO8X 4B9DA 1H1RA 1OGUA 3TUCA 5FXSA 2R4BA 5M09A 5EQEA 4EC8A 1H00A 5B0XA 2CGXA 5FDXA 2JDSA 2CNQA 4ID7A 3G15A 4JQ7A 4HCVA 5EYCA 4OTQA 4UYNA 2ERKA 3I81A 5BVEA 4JDKA 2ITWA 2GQGA 2FGIA 3QUEA 1FVRA 3GT8A 4NM5A 3OHTA 5CXHA 4EC9A 5JGAA 3QD3A 4PDSA 1A06A 5M06A 4IZ7A 4TYGA 3TZ8A 4DCAA 2C6OA 2XK3A 1VYWA 4U41A 3BYMA 2QG5A 5AMNA 2JBOA 4XG9A 5CX9A 3ZLWA 3V6RA 3P7CA 1J91A 4FIGA 4K8AA 1YDTE 1XH9A 2JIIA 4CRSA 3OF0A 4AZWA 2VTOA 3UP2A 2VTPA 3RCJA 3W33A 1M2QA 2JC6A 4RIYA 4HYUA 5K3YA 2ZDUA 3FLNC 3LQ3A 1OPJA 3D7TA 4YLKA 4JLCA 4F63A 4X2GA 4NTSA 5AIRA 5AP4A 4IX3A 4EORA 4YNEA 4EK4A 4BI1A 5LXMA 3VS3A 5CY3A 2YCSA 3EYHA 5TT7A 4I4EA 2WOUA 4X3JA 4IAAA 3LFQA 3CSVA 5DA3A 2JBPA 2BZJA 2YA9A 5JGBA 1DAYA 3DK3A 5I9UA 3HZTA 2O63A 3FV8A 4WSYA 2HK5A 4MHAA 4FKWA 5HLWA 2R3NA 3R63A 3AD6A 2DQ7X 4ENXA 4G3FA 5KHXA 5HD7A 5ANJA 2UZLA 4H1JA 4CZUA 2C5OA 2VZ6A 1XWSA 2C3IB 5EM5A 4AN3A 4TW9A 2BFXA 2XKDA 3H3CA 3PG1A 4L3PA 5AP0A 4UZHA 2BILB 1M7NA 3R1NA 4EZ7A 4F9WA 5GHVA 2C47A 3NRMA 3OBGA 4FEQA 3DBQA 4EWHA 1KWPA 2YABA 3HAMA 1GIIA 4KABA 4CQGA 3D5VA 4A9YA 2OJ9A 4PMTA 4UBAA 4FZFB 4FV6A 4IDTA 4OTWA 5FGKA 4F0IA 3QD2B 2WNTA 1WAKA 3OFMA 3G9NA 5IQIA 4HW7A 2C5NA 4Q9SA 4D9TA 4X2JA 5I3RA 3PWDA 1TVOA 3KXMA 2PPQA 3O0GA 4FF8A 2IVUA 3MS9A 4JR3A 2OXDA 3QYZA 4C59A 4NUSA 2B52A 3DAKA 4G9RA 4IVCA 4MQ1A 4YTHA 3NLBA 4BBFA 2XIKA 4C37A 1Q41A 1UU8A 5EHLA 5A4QA 4DEGA 4NFMA 1JSTA 1LPUA 2GNIA 3GXLA 5IDNA 4FK6A 4QTDA 3CQEA 4YBKA 3VF9A 3ENMA 1H28A 4FOCA 1J1CA 4AF3A 3LKMA 1X8BA 1ZOGA 2B9JA 3QZGA 5E1SA 5E9EA 3KF4A 4K2RA 3I79A 3KU2A 2F7ZE 4WNOA 1OB3A 5E8XA 3AQVA 4O0UA 3REPA 4E5WA 2ITOA 4ZTSA 4MWIA 4FEWA 2H34A 4F64A 4XG6A 1OZ1A 4FG7A 1FGIA 2FH9A 4GMYA 5AP3A 4HVGA 3NNXA 2OH4A 3E93A 4GYIA 3ZEPA 3DTWA 5TO8A 4JR7A 1P14A 4KS8A 5J8IA 4Z7HA 5CWZA 4BN1A 4C2WA 3UNKA 1JNKA 3DBEA 3NX8A 3TG1A 3T8OA 3TZ7A 5CENA 4ZJVA 4O7RA 4EOQA 3F2NA 4EH4A 1H24A 3LFAA 3PE1A 4I0RA 3IK3A 3QC4A 3FSKA 4YO4A 1IEPA 4QTAA 4DEIA 3S3IA 4D4YA 3LW0A 4H3QA 3KRWA 2WMVA 5C01A 2VWBA 5L2QA 5J7BA 4GUBA 3VS1A 5AADA 2X8EA 4GCJA 3MIAA 3FI2A 2XCKA 4FIJA 2OWBA 4MXZA 4YZBA 2FYSA 4NH1A 3TNPC 5EHYA 1WBPA 2R3PA 2BCJA 2JFMA 5F4NA 4EOPA 4DEDA 4I6FA 2VUWA 4FKTA 4M67A 5EOBA 3B2TA 4XBRA 4YJUA 4ORKA 3R22A 3IO7A 4U43A 1KSWA 1E9HA 1YRPA 4L68A 4IFGA 3R8PA 3GCPA 3VN9A 1OL5A 4FZ6A 4RVTA 3U87A 2OKRA 4GK2A 5LMKA 1BLXA 1RDQE 4DH1A 3VS4A 5L8LA 4LRKA 3COHA 4E6DA 4TKSA 2HZIA 4ZTRA 5ETIA 1KOAA 4PTEA 4C34A 2YEXA 3HP2A 1TQPA 3KA0A 5BPYA 3MBLA 2YZLA 1WZYA 3PSCA 3EQCA 3FZOA 2QVSE 4YHFA 3RINA 5CSPA 4II5A 4IVAA 3QTZA 3ORNA 4ENYA 4JX3A 3M1SA 4AT4A 5I9YA 2YIQA 5HLPA 2Q0BA 4OTIA 4AE9A 4ALVA 2XKFA 1OL6A 3I0QA 4A9RA 2Z7QA 3UIBA 1Z5MA 3C1XA 3S4QA 4EOLA 3UODA 4BL1A 3V6SA 1ZAOA 2ITXA 3PP1A 3JXWA 5JFSA 2R3MA 2B53A 3TWJA 5AAGA 4FZAB 1BL6A 3NWWA 3LLAA 2ITUA 2W5BA 4BDCA 4AQCA 3PJ8A 4PL5A 3GU4A 4C4GA 1XQZA 3JR1A 1PXLA 4IX4A 3TACA 3QA0A 3RM6A 5IA3A 3FJQE 3R21A 1QPDA 1U54B 2R3JA 4R5YA 4HVDA 2PE0A 4LG4A 2XH5A 3D5WA 3QRUA 3IDBA 3K5VA 1OI9A 3FI3A 3NDMA 4BTKA 3NPCA 4S33A 3Q5IA 5AP5A 2R2PA 4HGSA 3KRJA 3V5WA 3F3VA 4EK5A 3A62A 5I3OA 1W98A 2RSVA 3W2CA 4PUZA 3KRLA 5E8TA 3VJNA 4C3FA 2O2UA 2XMYA 4BCFA 2R0UA 5HORA 4ZMFA 1W8CA 4ANMA 4PDOA 3F5UA 4RWJA 4EYJA 2XEZA 5IPJA 5H8GA 4TPTA 3ACKA 4ZSEA 4GRBA 4HGLA 2QOOA 5HBEA 4I20A 4ANBA 2J50A 2A4LA 5GJDA 2W1EA 4KKEA 4M13A 5CNNA 4QNAA 2GU8A 4FTNA 2J9MA 4HPTE 3DKGA 3UOLA 3FBVA 3GOPA 3U55A 3AD4A 4LUDA 4QYYA 5ITAA 4B6LA 3COMA 5L4QA 4M12A 4Y5QA 4KINA 4AGWA 3DXQA 2XNBA 2J7TA 4FTCA 1VYZA 4QMWA 3BBTB 2GNJA 3OVVA 3A7IA 1QPCA 1Y6BA 3BGPA 2GDOA 2XKEA 5IA2A 4ZEGA 2VWYA 3ORMA 4U6RA 4YJRA 4CG9A 3D7ZA 4XNEA 2HAKA 3DU8A 5C27A 3BHHA 5EM6A 4IADA 4R8QA 4XUFA 4YTIA 3Q9ZA 4H39A 4AACA 2JAMA 2V22A 3O7LB 5AUYA 2YHVA 3B2WA 3G6HA 3G9LX 3QHRA 4L6QA 1BMKA 3E87A 3HRBA 3P23A 4FKVA 4XP3A 4BDAA 4R5SA 4A06A 3JVRA 4N4SA 5E4HA 1YOJA 3OEZA 4H3PA 2W1ZA 4XLVA 4G5JA 3MYGA 4LGDA 4UXQA 3KREA 4TZRA 4CRLA 3P9JA 3TV7A 3HL7A 3IPHA 1J7UA 2PZYA 4UMUA 4AA4A 2QOFA 5L2SA 2WTIA 4F7SA 5BX0A 5K5NA 2CGWA 1B6CB 2GSFA 2PTKA 4UB7A 4EH5A 4GSBA 4DTAA 3SXSA 4R3CA 2C6LA 3QHWA 1GIJA 5J87A 3QQHA 4QMLA 1JSUA 4QP6A 5HE1A 4BCPA 3FQHA 3OTVA 3EN5A 5FDPA 2C6DA 5M44A 3B8QA 5CTPA 4X2NA 5JMSA 3EKKA 2HCKA 5E1EA 4CFUA 4W8DA 4O2ZA 4DEBA 4V0GB 3ORPA 2J2IB 4KRDA 3MPMA 1P4FA 2I0VA 3ZLSA 3R01A 4C4IA 3BEGA 3BYSA 4QMTA 4J1RA 3O8UA 3VRZA 1Z9XA 3D5UA 1ZLTA 3WF7A 3QQUA 2JITA 4U5JA 5KMNA 4L9IA 5HZNA 3LXPA 3GFEA 3ORIA 3M42A 3BLRA 3VS2A 3NUYA 4G1WA 3OXIA 3IECA 3DJ5A 4QMXA 5CLPA 3ZU7A 3PVGA 4IANA 3GCUA 3WOWA 4X0MA 3ZBFA 3OUNB 3SV0A 2W1CA 4MTAA 5D11A 5HVJA 4RIXA 2OFVA 2X4ZA 1YXXA 4X6RA 3NUAA 3SXRA 2R3KA 2XYNA 4DINA 3PRIA 4LL0A 5L3AA 3P79A 4OW8A 4YJVA 1PMVA 3R1YA 3CC6A 5CEMA 4BVUA 3R8VA 4FV1A 5TF9A 4HGEA 4JBQA 5CU0A 2G2HA 2VNYA 3QKMA 1BI7A 4G6OA 2B0QA 4FSUA 5AUWA 5E7RA 4HGTA 3GU5A 4RVKA 4DG3E 4G6NA 2UW7A 2OBJA 4LQMA 2WU7A 4OBQA 3E7OA 3A7JA 4RC2A 2VX3A 3RTPA 3UMXA 3AXWA 3IW7A 4DTBA 2OU7A 4O1OA 1H1PA 1YKRA 1PXMA 4PF4A 4AZFA 2QKWB 1Q97A 5ANIA 4YLLA 4DGMA 1DAWA 2FO0A 3NZ0A 5BYLA 1Q62A 3C0GA 3FZRA 5IQEA 3WZJA 4FNXA 3L8XA 1APME 3QCYA 5CXZA 2CCIA 4U45A 4YSJA 3E5AA 2XUUA 2AYPA 3R00A 4BWXA 3Q2JA 3FYJX 3QX2A 2UW8A 3QTXA 2VX0A 3DDPA 4GUEA 2W5AA 2Y0AA 2WTJA 3R6XA 1J7LA 4ZTNA 2PMNX 1K9AA 2XS0A 4I5CA 3VS6A 3R1SA 1UA2A 2X7FA 4ZXTA 2BR1A 3BKBA 3RK9A 2JIVA 4FIHA 4NIFB 3KVXA 1BYGA 5D7AA 3N4VA 3KVWA 4S30A 3PJCA 4RFYA 2DWBA 3FLYA 4EL9A 1Q4LA 5TOZA 5ANEA 3FLZA 4O0TA 2C3JA 4LUEA 2PK9A 3G0EA 4NZWB 4HYIA 2QHMA 1PW2A 4I0TA 4M69B 4ZY4A 3PFQA 3EKNA 4CMOA 4RIWB 2XJ1A 4JS8A 4YC8A 2GTMA 3MTLA 2WZJA 3Q60A 4G34A 4O96A 5JZJA 4XH6A 3DAJA 3CS9A 4G3DA 4CT1A 4P7EA 4N57A 4FUYA 3FKLA 4ACDA 3LCSA 3L8VA 2UW6A 3NCGA 5J9LA 3ENHA 3QTRA 2F2UA 3HV5A 4TYIA 3DNDA 4OAVB 3G0FA 4UWBA 1IAHA 4E4NA 5DGZA 5EI2A 1YI3A 1OL1A 4F7JA 4GJ3A 4JRVA 3OXZA 3HV6A 2YM8A 3A2CA 3R7IA 4BKYA 4FX3A 5LMKC 1PF8A 1FOTA 4RFMA 4NKAA 1SZMA 4U42A 2OFUA 1NA7A 4R6VA 3ETAA 5AUXA 2X6DA 5AR3A 2FUMA 1GZ8A 2VGPA 1YHWA 3PJ2A 4QMYA 5AP1A 4XEYA 4ACMA 4BDJA 3A8WA 4DFNA 4R7BA 2V7AA 4FTAA 4QTCA 1OKYA 3I5NA 3KKVA 3OEFX 4BDKA 5IMXA 5E8WA 4GK3A 2W9FB 3U6HA 3RZBA 1Q8YA 4DN5A 4F09A 3KK9A 4RZVA 1PMNA 3KB7A 1IA8A 3HNGA 3RVGA 1V1KA 4NTTA 3N9XA 3AMYA 4KBAA 3IG7A 4D58A 5BQ0A 1FVTA 4IC8A 3ROYA 2GNFA 2YAKA 5CVHA 5DLSA 5LWMA 4EJ7A 5J79A 4AS0A 2CKOA 5GINE 4NW6A 1FBNA 4XOYA 3RNYA 3FI8A 4C3PA 4JBVA 1JPAA 2PVLA 4FNZA 4KSPA 2W1FA 5E8UA 3ZZWA 1MQ4A 2GS7A 3I5ZA 4FTQA 4O82A 2X4FA 3L9MA 3QZIA 5DI1A 3DFAA 3FZSA 2GQRA 4NKSA 1OBDA 5KMIA 4ZZNA 3LFEA 4QMPA 3DXNA 1XHAA 3R7OA 3LM0A 5B2MA 3LCTA 1H01A 2OICA 1WBTA 1OPKA 5DR6A 5CF8A 4WNMA 1R1WA 2WMUA 3CPCA 4DTKA 5TE0A 1PMUA 2YM6A 4IEBA 4AZTA 1Y8GA 5DFPA 3GVUA 5IG1A 2Q0NA 5ANDA 1ZMUA 5AX3A 4QMNA 2HZ0A 2GFSA 3ZC6A 2VO3A 1V0OA 4TYHB 4NJDA 2YCFA 2PMIA 2PVYA 3PG3A 4DH8A 4FT7A 4RWKA 4EKLA 1GZNA 4BIDA 2O5KA 3SC1A 4C33A 3EQHA 4L00A 2O3PA 3D14A 3PTGA 4FKLA 4XG2A 1WBVA 3TEIA 3NUNA 4Y85A 4I4FA 5IKWA 4D1ZA 3QD0A 2IVTA 5C8NA 3LOKA 4FK3A 2X2MA 4BCOA 2OLCA 4PMSA 3C0HA 2NP8A 4C2VA 2F7EE 4LM5A 3D15A 2W5HA 3N51A 4EK8A 3VWAA 3HYHA 4I0SA 5LQFA 2HW6A 2OZAB 3PXZA 4MQ2A 3ITZA 3CJGA 2UW5A 4UYAA 2XK7A 5FBNC 2C6KA 2F57A 2VTRA 3EQPA 3PA5A 4S34A 1SMHA 3H30A 1JKLA 4OTFA 4QTBA 4WRGA 4X7QA 5CZIA 3BRBA 5JRSA 2RF9A 3HECA 3A61A 4FL1A 2RG6A 1M14A 4G2FA 4EBVA 3PLSA 4AAAA 2WHBA 4Z55A 3FMHA 3RPRA 5AR7A 4NFNA 3F3WA 3FMLA 5C9CA 3V5QA 3G33A 4F6UA 2VWZA 2QU6A 4UN0C 3MA3A 3RKBA 3QXPA 5DE2A 2WIPA 3GU6A 1PXPA 4RJ6A 4WBOA 4C61A 1MRYA 3PXFA 2IVVA 4ZTMA 3FHRA 3GB2A 3DCVA 3OOGA 4RIXB 5AUVA 3F3UA 1H1SA 2JAVA 4AOIA 2BDFA 3PY0A 5AUUA 1YXTA 5KMKA 4UMTA 2I40A 4IB1A 4RWLA 4GKHA 4YMJA 4FSYA 1LR4A 2P3GX 4USFA 1H1WA 1YDRE 4CTBA 4RC4A 4Q5HA 3W2PA 2ITYA 2UZEA 3R9RA 1IRKA 2XNPA 2WEIA 3DJ6A 4R3RA 3E63A 4X2KA 4CTCA 2QOKA 4UZDA 1FINA 1ZOEA 2GHLA 4RQVA 1WBNA 5KCVA 3GU7A 5I9XA 5ETAA 2Q83A 2B7AA 3TIZA 5K4IA 3BZ3A 3F7WA 4RLKA 3NUPA 5JN2A 5BNJA 3IDCA 4FV0A 5IISA 4BF2A 3C4WA 3ZM4A 3BWFA 3RALA 2CJMA 3UQFA 2I6LA 3MDYA 4E26A 5GIPE 3PDTA 3DA6A 4UMPA 5EFQA 4MYGA 2EUFB 5JT2A 3FL5A 4FKPA 2HY0A 2VV9A 2CHLA 2X6EA 2XNNA 4JRNA 1MUOA 4QMOA 5AJQA 1Q8WA 2PVNA 4OTDA 2WGJA 4F08A 2PVJA 4O91A 3NVKI 3BLHA 2WTKB 3AD5A 3QXOA 4RX8A 5E8VA 1AQ1A 2X7GA 4X3FB 5FQDC 3N4UA 5AR4A 2BDWA 4AUAA 5CEPA 2WIHA 2G9XA 5DVRA 3C51A 3EQDA 4BIEA 3Q6WA 2XRWA 4I1ZA 4XOZA 1LEWA 3QTQA 4DHFA 4BHNA 2C6MA 2CSNA 5JH6A 2JD5A 1ZYLA 1AD5A 3DBFA 3VW6A 3VBQA 4V05A 1WMKA 3FLWA 3JPVA 4IC7A 1G5SA 3MH2A 4XV3A 4GU9A 3CXWA 3I7BA 3QUPA 3EWHA 4MF0A 3Q5ZA 3OT8A 2VNWA 4EK3A 3BE9A 4DITA 4R77A 2PVRA 3PPZA 1FMOE 2I1MA 1ZYSA 2ITVA 3DK6A 3DKOA 3MY1A 4FODA 3O51A 1PXIA 4M69A 2XBJA 4DA5A 3PPJA 3TXOA 4R1YA 2YERA 3CE3A 1H8FA 3ZFMA 4ZZOA 3JYAA 3EL7A 2P0CA 2XEYA 4WOVA 2QO2A 2KTYA 3COIA 3UYSA 4YJTA 2P2IA 3VBXA 5A6OA 3GQIA 4O6LA 3QRKA 4FV3A 3F5XA 1L8TA 4JNWA 3MFSA 4ARKA 4FTIA 2IG7A 4HCTA 4WT6A 1GZOA 4FNYA 3R7YA 3QLFA 4WNPA 2F4JA 4HOKA 5GNKA 4G3EA 3DQWA 2XJ2A 4GJ2A 1CTPE 3HRCA 2UW3A 5IQAA 2C3KA 3EN4A 4LYNA 2G2FA 2W96B 4BTMA 2ZYBA 3KULB 5DNRA 4MD7E 2A19B 2PYWA 3CBLA 3FI4A 4QP8A 1A48A 4G17A 3D0EA 2BALA 2HWPA 3DLSA 1PYXA 4GV1A 4PX6A 4PQNA 3UP7A 4ANLA 2EU9A 4JJRA 4C0TA 2XK8A 5DMZA 1OKZA 2GMXA 3JUHA 4RQKA 1KV2A 3NYXA 3S2PA 4QQJA 5CEOA 5K4JA 3QQKA 3EQRA 1YOMA 5HICA 1F3MC 5BYYA 4QMZA 4D5HA 2QLUA 4IFCA 3HUCA 4FSZA 3KXXA 3LMGA 4ZSLA 3TJDA 2QR8A 4CSVA 5IQGA 4FBXA 3T9TA 4E6CA 3LIJA 3SOCA 5L2IA 2C1AA 2HXQA 3TZ9A 2VU3A 3K2LA 4QP7A 4CYJA 2XVDA 4OBOA 2P33A 3UOHA 2VWWA 3GC0A 3R9OA 1Q24A 3ZYAA 4BCNA 3ULZA 1PXNA 5IA4A 4A4XA 3AGLA 4XHKB 1W84A 2XK4A 3BHVA 1UWHA 3QRTA 2BRHA 3DB8A 4JIAA 3OCSA 4I5PA 2CN8A 5EKOA 5FXRA 5KMOA 3VVHA 3N4TA 3DKFA 3RM7A 1QMZA 1DM2A 4AWIA 4IX5A 3IDPA 3WIKA 4KKGA 2XM8A 3W55A 4EZ3A 2WMXA 1UWJA 4GEOA 4J97A 4RA5A 4CKIA 4AN9A 2W06A 3G51A 1FPUA 2PL0A 3PJ3A 4RA4A 4BDHA 1GY3A 4I5HA 4DFXE 4GT4A 3GCVA 2RFNA 5CASA 5I5ZA 3AC1A 3MI9A 5EI6A 5EDQA 4DGNA 3TN8A 4AG8A 5M56A 4XG4A 4A07A 1M17A 2QO7A 1XBBA 1RJBA 2XBAA 2PZIA 3RI1A 3UNJA 3Q9YA 5T6KA 3IOKA 3FMNA 5M53A 2PULA 3II5A 2QOIA 4KBKA 3ZO4A 4E20A 4LV5A 4BCJA 3KRXA 3DDQA 1Q8TA 2QOQA 5B2KA 4GYGA 3EL8A 4JBOA 4YHJA 4YSMA 4R7IA 3FMMA 4ZJJA 2WU6A 2ETMA 4UMRA 4OAUC 1LEZA 4QMUA 4BDGA 3C4EA 1OUYA 3UVRA 4WNKA 4IM0A 5IDPA 2YCQA 1OKVA 4DCEA 5C26A 2YDJA 2ZOQA 2XRUA 4PL4A 1Q8ZA 3W1FA 3ZXZA 1OITA 1WVXA 1CKJA 2PWLA 3S1HA 5J95A 2X9EA 4BFMA 1Q3DA 5DIAA 3NIZA 3W2QA 3FLQA 1P4OA 3OW3A 4IZYA 4IJ9A 5M55A 4K11A 4FIEA 4FTUA 5LWNA 2REIA 2IZUA 3EQBA 4J95A 5CI7A 3QQFA 4CQEA 4LL5A 4D0WA 2W1IA 3R2BA 3AC4A 4TN6A 5J9ZA 5GZ8A 4QPMA 1ZY4A 4P5QA 2ZM1A 3EZVA 4MH7A 4G3GA 4BIBA 2XCHA 2FSLX 3FPQA 1I09A 3ZMMA 4C8BA 5IH4A 4J96A 2HELA 4RMZA 3M2WA 3TDWA 2WTCA 3BU5A 4XV9A 5KHWA 3PPKA 4FGBA 4RRVA 2QQ7A 3BYUA 3ZOSA 5ICPA 5G6VA 2G15A 2XZSA 4FTOA 4WO5A 5G1XA 2IPXA 3R2YA 5AM7A 2J0KA 3PXKA 1OPLA 1J1BA 3W10A 5C4LA 4O6EA 5ANKA 1BL7A 3CIKA 4FSRA 2YIWA 3KN6A 2OG8A 2Y8OA 4AGUA 1NY3A 3PVBA 3U8WA 3V5PA 3ZH8A 5IA5A 5EYKA 1ZRZA 3VQHA 2UZBA 3RNIA 5DHJA 1H1QA 1H0WA 4O0SA 5K0KA 3OG7A 2EXCX 2R3OA 2VWIA 3EFWA 5LOHA 2UUEA 5AAFA 3UGCA 5C4KA 3E8DA 3KRRA 1OIYA 2WD1A 3C5IA 5GJGA 2DUVA 3THBA 1OIUA 4GIHA 1Y57A 4KRCA 3ZSHA 4E5BA 3FEGA 2HY81 3ALNA 4QPAA 4MAOA 3SRVA 3UZPA 3AC5A 3FC1X 4OTGA 2YAAA 4D2TA 2PUNA 1YXSA 2J4ZA 3KN5A 4KIKB 5AR2A 3QZHA 4XP0A 2IO6A 4U3YA 2RIOA 3P78A 1O6LA 1GOLA 3EMGA 3O2MA 4KBCA 1S9JA 4YJQA 5EI8A 5A4LA 5IUHA 4O2PA 5EHOA 5KNJA 5A4CA 5M4IA 4L3LA 2A0CX 4CNHA 2HWOA 1XH8A 2RFEA 4D55A 3DLZA 3MN3A 4MBLA 1XH5A 4AN2A 4QYGA 3LCKA 1OIQA 2R3FA 3D4QA 3KY2A 3P1AA 5HG8A 4FKRA 2ITQA 3NUXA 4FZ7A 2ONLA 5HG9A 3MJ1A 4ANNA 2CKEA 4MXCA 2HZ4A 4JAJA 4F1TA 1RQQA 3UO5A 3DGKA 2JDRA 4UWYA 2BIYA 2C6TA 1U46A 5AM6A 1U5RA 3PXQA 2YJSA 1ERKA 4C02A 4EOMA 2C6EA 3MFRA 2BAJA 2WQOA 3GNIB 4A9TA 5D9HA 2E2BA 4CLJA 3DB6A 5HNIX 1R3CA 5HIBA 3LLTA 4FIFA 4M7IA 5AWMA 4E7WA 5FEEA 4NYEA 2JDOA 2XNEA 3V8TA 5IQHA 4XCUA 2IW9A 4HJOA 3SOAA 3LVPA 3LCOA 2HZNA 5HE2A 1ZMWA 1SNXA 1Z57A 3HGKA 4MVFA 3W8LA 4BWPA 4U44A 3U4UA 3VAPA 1R0EA 4W4YA 3CD8A 3BV3A 2I7QA 1YDSE 3CQUA 2W4JA 1T46A 4ZSGA 4S32A 2IZRA 4BRXA 4F99A 1YWVA 2BTSA 2WMRA 3TUBA 3L1SA 5E8YA 3F3ZA 2F2CB 1GNGA 4IAKA 4W8EA 2J0LA 3C50A 3Q3BA 2WQEA 4FTLA 4PPBA 3VBYA 2Z7LA 4AZSA 3HUBA 5CQUA 3F66A 4PNKA 2QC6A 4L01A 3ZRLA 1REJA 2GPHA 4YC3A 2A27A 2O8YA 3BU3A 4O7ZA 3SG9A 5EW9A 5M4CA 4U81A 4ONAA 3W2RA 4RC3A 4D2WA 5DWRA 3DY7A 4DH3A 5IQCA 2ERZE 5EDRA 4HZSA 3VQUA 3S0OA 3WF8A 4FVRA 4ASZA 3TNQB 4E4MA 4RWIA 2BKZA 3BBWA 3VBWA 4ZMEA 4O0VA 3HVCA 2HIWA 3EOCA 4FT0A 5L8KA 3KMUA 2UZUE 4F6WA 4XRLA 2WEVA 3P7AA 4RVLA 4DFLA 3DT1A 3TJCA 2JGZA 4AGDA 4OTHA 5CEKA 3H10A 2J6MA 2JLDA 4RG0A 2A1AB 1ZARA 4IW0A 3RHXA 2XIRA 3LQ8A 3TNHA 3FAAA 2GS2A 3O17A 3QKLA 3ZRMA 1XH4A 2UZNA 4J71A 4RJ8A 4BBEA 3UOJA 1BI8A 4MXXA 3F88A 2C5YA 4DG0E 2HYYA 2WXVA 3L9PA 3MY5A 1VEBA 4OBPA 5CI6A 3LAUA 4O22A 2B1PA 3GEQA 4EOIA 1M7QA 2QO9A 1JKTA 1JQHA 4F6SA 4RX5A 3JY0A 2V5QA 3S00A 2ZM4A 4E3CA 4F70A 3FMDA 5C8KA 2J5FA 4ACHA 3UZRA 3V01A 3SW4A 4DGOA 4EONA 4EH8A 3ALOA 3CEKA 2PVFA 3ZONA 5CAVA 2Y9QA 4RJ7A 2YN8A 3IW8A 2B4SB 2JKOA 3OCTA 2QG7A 4BY9E 5KMMA 4OT6A 5M4FA 4MD8E 3KCKA 4BC6A 5HE3A 4C62A 4XG8A 3DKCA 3PVWA 5HO7A 1HCLA 5HNBA 3SG8A 1DS5A 4Z16A 1M52A 2C69A 1UNLA 5F1ZA 2OZAA 1FQ1B 4KUJA 4KS7A 3D9VA 3KMWA 2XP2A 4PPCA 3RMFA 3C0IA 2W4OA 3C4FA 4QYHA 3L9NA 3FXWA 2OSCA 3MVLA 4UXLA 4AFEA 4A7CA 5A9UA 2H96A 3KXNA 3VO3A 3GP0A 3OOMA 2BKKA 3W18A 4M66A 2WAJA 2QLQA 3EIDA 3IW5A 1XH7A 5CU6A 3WZUA 4DLIA 2HW7A 4FTTA 4JAIA 4LMUA 4WD5A 5KZ0A 2EB2A 3EFJA 4NSTA 4ANQA 1H08A 4EH9A 3ZCLA 4PV0A 4MK0A 3F61A 2W05A 4J52A 2WTVA
chains in the Genus database with same CATH superfamily
1YOLA 3FY2A 2E9NA 2ETKA 4IWDA 5T3QA 4EQUA 3R1QA 4I41A 5L6PA 3BWJA 2ZMCA 4BTFA 5FTOA 3MJ2A 2GHMA 4FL2A 5IEVA 3Q32A 2B9FA 3TNWA 2PUUA 2R64A 1QCFA 4O21A 2ZB1A 4D4VA 4S2ZA 1PY5A 4EUUA 4P5ZA 4DGGA 5C03A 3R9HA 4HNFA 4JDIA 4YPDA 4M8TA 4ASXA 1OMWA 4N70A 5F9EA 1MP8A 3AMBA 1PKDA 3D5XA 4KIKA 4IVBA 2ZJWA 4V01A 4GG5A 2X9FA 5C8MA 3MPTA 4E6QA 3KQ7A 1M2RA 3RAIA 5BUIA 4LI5A 3UQCA 1WBOA 3W32A 4KNBA 4I6LA 4H1MA 2GNHA 3ZXTA 4XBUA 2XALA 5AAEA 4UX9A 4MWHA 2Z02A 4QYFA 4FUXA 4TNDA 3RGFA 2F9GA 3H9FA 2BZKB 3DS6A 4PDYA 1G8AA 4MKCA 3NUSA 3ERKA 3GFWA 4BWKA 2Y6MA 3HA6A 4FSNA 3IW4A 3ZHPC 5M08A 4FTJA 4HYSA 5ETFA 4NCTC 4O81A 2V0DA 2UW9A 4AA5A 5HO8A 5I9ZA 5IEXA 4DEEA 2ITTA 3ZEWA 3OW4A 3AG9A 4RX9A 4AA0A 3PIZA 2IN6A 3QWKA 5HESA 3FC2A 1Q61A 5J5TA 4IXPA 4O7YA 2UZTA 3BLQA 4NT4A 4BI2A 3RBWA 3ZRKA 2PE1A 1PYEA 2PMLX 3Q4TA 4GT5A 3VUIA 3MGYA 1UKIA 5JK3A 3KXGA 2YITA 3NR9A 4GIIA 3TL8A 3ZO2A 5AP6A 4FVQA 3RPSA 4ZS0A 2SRCA 3F7ZA 2UZDA 3E8CA 5AUTA 4FKGA 5HNGA 5B2LA 3ULIA 2C0TA 1R78A 3UDTA 2VWUA 4LOOA 4S31A 2XNMA 4U3ZA 1JBPE 5CYIA 5FEDA 5AV1A 3SHEA 4YTCA 3HMPA 3FZ1A 4TRLA 2OH0E 3DZOA 5KZIA 1TQMA 4GK4A 1NVRA 1CSNA 1OL7A 4G16A 4YZDA 3TDVA 4FI1A 1U5QA 1JKSA 5EH0A 2W1GA 3WIGA 5CALA 4PY1A 5K9IA 1G8JA 3KULA 3BU6A 4CCUA 5A54A 3OWJA 1ST0A 2AC5A 2FSMX 4BDDA 3DXPA 3HV3A 4KAOA 3DOGA 5J7HA 3D2KA 1JWHA 3QLGA 2F49A 2X0GA 5IH5A 4O7SA 2J51A 3PZHA 1O6YA 4IB3A 2J0IA 3LJ1A 1H0VA 3ATTA 4C4HA 2PZPA 3A60A 4FGRA 4K0YA 4YURA 4UWCA 3ODZX 3H4JA 4YPSA 1XBAA 2UW4A 4TWPA 3GUBA 4DAWA 1KE7A 4YP8A 2IW8A 4MBJA 4FOBA 3PIXA 4QMSA 3ZUUA 2CCHA 2QNJA 5IU2A 3F5PA 3NYVA 2OXYA 4BJJA 2X7OA 3HA8A 4JVGA 5FP6A 3TYKA 4IZAA 4R78A 3CR0A 3OD6X 1ZY5A 3GU8A 5FBOA 3ZZEA 2Z60A 3DTCA 3KGAA 3LHJA 4YLJA 3UG2A 3FZTA 4M0ZA 4ITJA 4ACGA 5FUTA 2OJGA 3Q4UA 5AA8A 3HV4A 5KMJA 4RGJA 3QA8A 4QMVA 3AC2A 4X6QC 5AEPA 2WMWA 2IVSA 1W2CA 2H8HA 4I6QA 4EI4A 5BMMA 3QF9A 2OJIA 1BX6A 5A14A 3SW7A 3VUTA 1T45A 1ZWSA 2DYLA 3FHIA 3UMWA 4F9CA 4IAYA 5HKMA 1OIRA 4O0RA 5HIDA 2C4GA 2BRNA 3UVQA 2FSTX 3R7UA 3CTJA 2F7XE 3DPKA 4BCGA 2WB8A 2BZIB 4XLIA 4CYIA 4IX6A 3TUDA 2ZMDA 1B39A 1YI6A 4Z9LA 4AOTA 4JXFA 3C4ZA 3ANRA 1R0PA 4FYNA 5L8JA 2OIBA 1K3AA 2BDJA 4RZWA 3ZUTA 4EEVA 1CKIA 2Y7JA 3E8EA 3EH9A 3TT0A 3ATSA 2C0IA 5DEWA 3OZ6A 4TWNA 4FSMA 4U0IA 4Y46A 2WQMA 1UKHA 2CPKE 1J7IA 2X1NA 4MBIA 1Y6AA 2PVMA 3LFBA 5JZNA 5KE0A 4X21A 5KKRB 5EQYA 2PU8A 5I9WA 3QQJA 5L6OA 5CAUA 2R7IA 5CU3A 2PZ5A 4O83A 3PWYA 3P4KA 4C4EA 4PTGA 5IH6A 4IACA 3HDMA 3Q2MA 2X8IA 4PPAA 4F7NA 3LCDA 4XG3A 1K2PA 2VTLA 2DS1A 2W0JA 1QPEA 2QURA 3LXKA 4FNWA 5CSVA 3TNIA 4EBWA 4HYHA 4OR5A 4RJ4A 3UVPA 4CV9A 5JEBA 1MRUA 3PY3A 4E5AX 5AFVA 5DR2A 4YJNA 4ACCA 4FSTA 3BQRA 4FTKA 5LVLA 2XF0A 5AR8A 4R7HA 5I9VA 2JIUA 3EJ1A 4LGGA 2VTSA 2YIXA 3A99A 4AOJA 5LJJA 3EN9A 3OTUA 3AOXA 2WPAA 3VIDA 3FMJA 3LM5A 3M11A 3NEWA 3UTOA 4F1MA 4WBBB 5ANGA 5I0BA 1YWNA 5AV0A 4P4CA 4C35A 5HU3A 3G5DA 4ZJIA 3QC9A 1PRYA 4K77A 1QPJA 3P0MA 4BGGA 4D5KA 4TYHA 4C38A 2QD9A 3H0YA 2WO6A 3ORLA 4PMPA 1SNUA 3F2AA 4RJ3A 4WUNA 4IWPA 3QKKA 4BCQA 4FT3A 4DH7A 4CFVA 5AUZA 3TKIA 5TKDA 3ZSIA 2BAKA 1V0BA 3HX4A 4LGHA 4EOJA 5M07A 3QGWA 4RVMA 4UALA 3R8MA 4ZLZA 4EKKA 3MW1A 1PXKA 1VZOA 3TZMA 3MFTA 5F94A 4Y73A 5FM2A 5HI2A 5L2WA 2I0EA 4O7WA 3U9CA 2FB8A 3NAXA 4EH6A 4BYIA 5DT4A 5DYJA 5KX8A 4AT5A 3R04A 4QDEA 4H58A 3EQIA 3OWLA 4RIWA 3P86A 1H26A 1RW8A 4U79A 4DEHA 1CMKE 2ZVAA 2QU5A 4IM3A 1WFCA 4U97A 3QQLA 4Q9ZA 4XMOA 3UO4A 3FZPA 1E1VA 3LFNA 3K54A 4FEUA 4F4PA 1U54A 1W83A 2QODA 4D1XA 4W4WA 5DRBA 2R9SA 3OCBA 3ZC5A 5HX6A 4QEBA 5AR5A 4I6BA 5A3XA 5BVDA 3TKUA 2C30A 2FA2A 4KA3A 4ZP5A 5E90A 4IAIA 2W1HA 4ZIMA 3DFCB 3DNEA 1W0XC 3C7QA 3TV4A 3V51A 4EJNA 3VHKA 2EWAA 5DEYA 3ZS5A 3SD0A 3LXLA 2CLQA 1IASA 1F5QA 2WOTA 4GL9A 5HHWA 4MEDA 3R7VA 1IR3A 3PVUA 4NU1A 2BFYA 3V5LA 4A9SA 2RGPA 4IZ5A 4E4XA 2RL5A 4DF3A 2UZWE 2YLFA 5HGIA 5IA1A 5A4TA 3A7FA 3QYWA 3NMUF 3VULA 3NW5A 3WZKA 3LXNA 4FV8A 4TWOA 3UZTA 3C13A 4G5PA 4L8MA 4D4SA 4FV7A 5HCXA 2BTRA 4YZ9A 2X81A 4KWPA 2YDKA 4QP4A 4FA2A 2X8DA 3HEGA 4PMMA 4ZOGA 1UNHA 5EKNA 1TKIA 4FSWA 5AP2A 4CZTA 2ZV9A 3GCQA 4D2PA 1Y91A 4MD9E 2C5VA 5LARA 4OGRA 3SVVA 2XAOA 1MRVA 2UVYA 5KBRA 2PVHA 1HOWA 4W4VA 3CTQA 3PSDA 3CD3A 4OT5A 4YJOA 2YM3A 4JG6A 4GH2A 4ERWA 3FDNA 4I22A 3RP9A 1NVSA 3PUPA 3GGFA 4BDEA 4F1OA 2HENA 1FVVA 5L2TA 2IWIA 2YZAA 3TCPA 5LVOA 3O96A 2R0IA 3RK5A 4BI0A 4R1VA 4BZOA 5A46A 5IUGA 4I3ZA 3HP5A 3IW6A 4NM0A 2V55A 2VGOA 3EHAA 4XG7A 3ZSGA 4QNYA 5CAOA 4H36A 4W9XA 3VONA 4EHVA 1EH4A 5DPVA 3OCGA 2XARA 4BCHA 1OL2A 5J5SA 3CQWA 2OF2A 3ZO1A 4GFGA 3FSFA 5M4UA 3EFKA 4AT3A 5HVYA 3JS2A 4QPSA 3MFUA 4AW0A 4GU6A 2IZTA 3U54A 4FKJA 4WG3A 2OW3A 3KF7A 3QTUA 3DQXA 2E9OA 3DK7A 4DH5A 5CU4A 4APCA 1Q5KA 5FWKK 4ANSA 4CMTA 4JG8A 2BRGA 4G3CA 1E1XA 3U6JA 5JRQA 1P5EA 4ASEA 3ELJA 4QP2A 3VS7A 2BHEA 4F7LA 1OM1A 5LCKA 5DOSA 1XKKA 2CDZA 3O23A 4YC6A 4ZLYA 5J9YA 2ZAZA 4DBNA 2UVXA 3KC3A 3FPMA 3PLAE 3RAWA 4YO6A 2R3IA 1A9UA 4OLIA 5L6WL 3VBVA 4L3JA 5GZ9A 2VTTA 2VTNA 2VO0A 4BCKA 4O7VA 3FY0A 4FC0A 4N0SA 4RIOA 2GHGA 2XB7A 3CY2A 3E88A 4X3FA 4APPA 2GNLA 4IJPA 5FLFA 4Z7GA 5BVOA 4P2KA 2C0OA 2RG5A 4FYOA 3W0OA 2A2AA 3WYXA 1H25A 2PE2A 2WMAA 3TV6A 1KE9A 2BMCA 2CGVA 4R3PA 4OTPA 3UJGA 2NNWB 3NNWA 1OKWA 2XNOA 3LZBA 4Q2AA 4QQ5A 5FP5A 3HMMA 3CJFA 3GQLA 5BUEA 4ZY6A 4QTEA 4JQ8A 4ALWA 3FWQA 4UV0A 5CAPA 5D12A 3NUUA 4O1PA 1UU7A 4NEUA 2GCDA 4CT2A 3CY3A 3C4XA 3BYOA 4F0FA 1H27A 2P4IA 2VTJA 4FVPA 4HZRA 3VUHA 3TM0A 4QRCA 1VR2A 3D2IA 1ZZ2A 3MB7A 3VUGA 5IZFA 1URWA 4LV8A 3TTJA 4H05A 4JL9A 4USEA 4FSQA 4YUQA 4HVIA 3AT4A 4WKQA 2H9VA 4G31A 4C4FA 5JQ8A 3HLLA 4EH2A 2XIYA 4IH8A 4EUTA 4NL0A 3EYGA 5CF6A 5DT3A 1OVEA 2J90A 4P90A 3QGYA 3ZBXA 4G9CA 3QFVA 4ZK5A 2W9ZB 3R9NA 1R39A 1B38A 3BQCA 2CNVA 5EDPA 4WRSA 3UIMA 2GNGA 1H07A 4O86A 1XJDA 2WMQA 3ORTA 3BX5A 1KE8A 1GJOA 2AC3A 4BZNA 3OY3A 3CGOA 1Q8UA 2XK6A 3MY0A 4FTRA 4EOSA 4EK6A 4FMQA 5FEQA 2OK1A 3CKWA 3F6XA 3SA0A 1DI9A 1ZMVA 4O84A 3V8WA 4BGQA 4EWQA 2XNGA 4DFUA 1WVWA 3OROA 4OTRA 4L45A 2YIYA 2ZB0A 4RT7A 3SX9A 4DFZE 5J1VA 2CKQA 3PRFA 2X39A 5EYMA 2PUIA 4RLLA 1U4DA 5F95A 2BPMA 2VTQA 3LFDA 4FICA 3PYYA 5D7VA 1YXUA 5CF5A 2BVAA 4Y95A 3R8UA 4K33A 3ZUVA 3ROCA 5HIEA 1IG1A 2JKKA 2LGCA 3PA3A 1Q99A 5CT0A 3VUKA 2ESMA 3DAEA 4D4RA 4FL3A 4CFXA 4CXAA 5IF1A 4ITIA 5E8ZA 3I60A 2VTHA 3CGFA 1KE6A 3CTHA 4LFIA 5CVFA 4FKUA 2GFCA 4Y72A 1YHSA 4CD0A 3R71A 2NRYA 4PDPA 4RBLA 4PL3A 2ACXA 2UZOA 4ZAUA 2P2HA 4HPUE 5CSHA 4MXOA 3QZFA 4FEXA 4O7TA 2PSQA 2JKQA 4FV4A 4NIFA 4GVJA 1JSVA 1UVRA 5FTQA 3SLSA 4HVSA 3B8RA 3WE4A 3ZM9A 3H9OA 3IS5A 3QRJA 3NYNA 3FKNA 1U59A 3GC9A 3QTSA 5HG5A 4C3RA 2EXMA 2E9PA 3L8PA 5LVPA 4ZLOA 3QTIA 1GIHA 4WG4A 2PZRA 3PXYA 3SGCA 3ET7A 3RCDA 4CCBA 1ZYDA 4FIIA 3ZFYA 2XJ0A 4BZDA 3R73A 2BUJA 4AP7A 4CLIA 4ERKA 4PRJA 5A6NA 3A7HA 4TTHB 4XV1A 3POZA 4JDHA 1DI8A 2O64A 3H9RA 4XX9A 4AW2A 2H6DA 3BGZA 3FYKX 3MVMA 4KIOA 4PWNA 3VUMA 4B0GA 4DG2E 2KULA 5AIKA 1ZOHA 3GI3A 5H2UA 3T9IA 5GIOE 4FG8A 4I5MA 4K9YA 5HTBA 5HU9A 2X0PA 4I24A 3U9NA 5C1QB 4I94A 4CV8A 2YFXA 5KO1A 3I6UA 4BGHA 2OIDA 2R3LA 3HMIA 3MH1A 3Q9XA 2P55A 1NW1A 2R3GA 5H8BA 2G2IA 2QHNA 2YLEA 3PZEA 5HCZA 3SAYA 4GVAA 4YBJA 4U8ZA 3K5UA 2CLXA 4IWQA 3UG1A 3LFSA 1PHKA 2VTMA 4C7TA 2CNUA 3SDJA 3KK8A 5I4NA 2PUPA 1W82A 4TXCA 5CEIA 3WBLA 3W8QA 3H0ZA 3Q6UA 3TKHA 5HQ0A 3P5JC 3BELA 1NT2A 2CMWA 3RWPA 5CSWA 3G2FA 1O6KA 3I6WA 5IA0A 2UVZA 3E62A 4J98A 4LOPA 4EQMA 4AGCA 1STCE 2YDIA 2VO7A 3VUDA 4KD1A 3NNUA 2YWPA 5AV3A 1PJKA 3COKA 1SVGA 4D2SA 1FGKA 1Q3WA 2QKRA 3AC8A 1JOWB 3BE2A 4JDJA 3IKAA 3R7EA 3W0MA 5LVNA 4JQEA 3RHKA 1FMKA 3OS3A 1XH6A 4ZTHA 2WFYA 3BCEA 3PXRA 1OECA 2XIXA 3F2RA 4C57A 3C9WA 1UU9A 4B7TA 5HEZA 4V0GA 3Q96A 4TL0A 5EQPA 1TZDA 5FRIA 4OUCA 3EN6A 3OWPA 4DE4A 3Q53A 4C58A 4AE6A 3AKKA 2XIZA 4WIHA 3UC4A 4O7LA 5H8EA 5KBQA 1KOBA 4JBPA 5HCYA 3SXFA 3MTFA 2GQSA 3WF9A 4EOKA 4L7SA 3CP9A 3LPBA 4M84A 2WTDA 3GC7A 3W0RA 5JQ5A 4DT8A 4DDIA 4ZSAA 5BUJA 2ZV7A 3NCZA 4QQCA 3O8PA 3DBDA 1WVYA 4TT7A 2AUHA 4GS6A 2JKMA 4L44A 2Z2WA 3G6GA 4O0YA 3VBTA 5JFWA 4ANOA 5JFXA 2XYUA 5DRDA 2QOLA 4Y83A 1KE5A 1ZXEA 2G01A 3UPZA 3I1AA 3MH3A 1KV1A 3FE3A 3UIUA 4F9YA 1H4LA 3F5GA 5BV3A 5LMAA 5CS6A 1WCCA 4IIRA 5AV2A 4IE9A 5FD2A 3R8LA 3OUKA 4IHPA 3VW8A 2V7OA 5LMBA 3C5UA 3IGGA 4L43A 4A4LA 5CZHA 5DT0A 3E3PA 3QQGA 3CPBA 5LVMA 3DZQA 2VWXA 3IGOA 4QP1A 4Y5HA 5EYDA 4M15A 4IB0A 2EXEA 4JX7A 2OGVA 3U4WA 4YHTA 4BHZA 3R30A 4Z3VA 4UY9A 1UV5A 3QL8A 4I21A 4FV9A 2XKCA 3GCSA 3NNVA 2CGUA 3OT3A 4QP9A 3R8ZA 4HCUA 1LP4A 5HBHA 4MUQA 3FQSA 4AU8A 2XA4A 5B7VA 3WF5A 2EVAA 4M3QA 5CAQA 4YZNA 4FG9A 2VX1A 5HOAA 3HMNA 4B99A 4EYMA 2OI4X 1YWRA 3RK7A 2Y6OA 4CGAA 3OC1A 4UEUA 3QX4A 3W0NA 2YWVA 4YGAA 3R0TA 4KSQA 3HV7A 3PJ1A 3UDBA 3O50A 4BBMA 5EG3A 4AW5A 1XR1A 3OMVA 1O9UA 2XK9A 3OXTA 2JEDA 5IEYA 4JG7A 3BPRA 4QYEA 3UO6A 2V62A 2QOCA 3EQFA 3KCFA 2X2KA 4EH7A 3W0QA 3IQ7A 2VD5A 3UNZA 4D2RA 5HLNA 3SRVB 2OJJA 4DYMA 3JY9A 1BUHA 3QD4A 4RX7A 3Q04A 3T3VA 1W7HA 5J1WA 3MVHA 4O38A 4FKQA 2R3RA 5CNOA 5JGDA 1P2AA 4FT5A 3U51A 4MXAA 3UBDA 4FR4A 4E93A 3AGMA 4D9UA 3FMEA 4NJ3A 4MF1A 4TYEA 3MSSA 4TNBA 2J5EA 2BRBA 4U80A 4DT9A 2C1BA 4U7ZA 3AC3A 3GENA 1REKA 2BIKB 5F20A 4AXAA 2C5XA 4FKOA 5K5XA 4BCMA 2OIQA 3C4CA 2ZV2A 3OP5A 2LAVA 2VWVA 3BHUA 1CDKA 3F82A 3LJ2A 3NYOA 1UNGA 4D1SA 1SVEA 4IWOA 4QQTA 5EW8A 3SQQA 1GAGA 3NGAA 1YVJA 3R7GA 2ETRA 4D28A 3AT3A 2BRMA 4LMNA 4IB5A 4NK9A 4K6ZA 4O27B 4FE2A 3MVJA 3VRYA 2J0JA 4CFMA 5DH3A 2YM7A 4MXYA 3V5JA 3FLSA 4J8NA 2W7XA 3NSZA 3MB6A 3VF8A 3PE2A 1PXJA 2E9UA 3D83A 3T3UA 4B8MA 4CG8A 4RSSA 4ITHA 3RAHA 3QBNA 5KUPA 4HNIA 2WQBA 4ASDA 3DBCA 4XRJA 5HVKA 3W2OA 1G3NA 3D7TB 3ORZA 3UYTA 4RFZA 2PY3A 4YZMA 3NIEA 3KFAA 2YCRA 1JAMA 3GC8A 3MPAA 4BKZA 3ANQA 3L9LA 4IMYA 4TY1A 3MH0A 3O71A 3Q4CA 4D2VA 4E73A 1OBGA 3KIOC 3E8NA 4LRJA 4XJ0A 3RPOA 2OZOA 4YJPA 4DC2A 2BHHA 3HMOA 4F0GA 5BVWA 3WE8A 3CCNA 2JFLA 1V0PA 2CN5A 3KEXA 3ZTXA 1YW2A 4LOQA 3QCQA 4CVAA 3EZRA 5JFVA 4N6YA 4YR8A 4YU2A 3TI1A 1NXKA 3A8XA 3W16A 3PUFC 2GTNA 4E6AA 4TWCA 3O7LD 4EH3A 2W4KA 4I93A 5D10A 2ZV8A 3WYYA 2JDTA 4IDVA 2O65A 5DN3A 1NVQA 4ZTLA 4WSQA 4BR3A 2R3HA 2Z7RA 2QI8A 4PNIA 2IZSA 4J53A 3BYVA 3ZFXA 4QOXA 2X2LA 4AW1A 3PY1A 4FV5A 5ACKA 3QTWA 2W1DA 4PP7A 1WBWA 3PP0A 4XP2A 5M51A 4WA9A 2XM9A 1PMEA 2VRXA 5IMEA 1KUTA 1AGWA 3WI6A 4BDBA 4G6LA 4W4XA 5K0XA 4JI9A 3NW6A 3EFLA 4XYFA 3JVSA 4ZS4A 5EM8A 2RFDA 2R7BA 3AT2A 4NM7A 1ND4A 5FG8A 2EB3A 4DLJA 4MNFA 4GFMA 3FMKA 4PP9A 3RJCA 4QO9A 4EZ5A 2W17A 3QALE 3I4BA 4KIPA 4L46A 4MNEA 2Y4IB 4IM2A 4K18A 4QMMA 5IQBA 3V3VA 4EHZA 3F9NA 1WBSA 3HKOA 4AZVA 2WQNA 4ZSJA 2QR7A 3CLYA 3VS5A 4IVDA 3V04A 4FKIA 3P7BA 5JSMA 3QWJA 2IJMA 2OJFE 3O8TA 4DDGA 3BEAA 4L7FA 4I23A 5FTGA 2YISA 2C3LA 3A7GA 1PKGA 5D41A 5EK7A 4B4LA 3W2SA 4EOOA 4RPVA 1TQIA 3FKOA 5HBJA 3BGQA 1LUFA 5FXQA 5AX9A 3OWKA 4D0XA 1CKPA 4U40A 2Z8CA 4X3FC 4F9BA 5FM3A 4J7BA 4W9WA 3RWQA 3KXZA 3WARA 5IUIA 2NRUA 3E92A 3DJ7A 4KIQA 2BAQA 3WZEA 2ITPA 3ORKA 3VS0A 4AFJA 4E8AA 3PSBA 3U6IA 1OGYA 3HRFA 4QP3A 5DR9A 3POOA 4V04A 3EN7A 4H3BA 3KXHA 4BKJA 3V5TA 1ZZLA 1RE8A 3Q9WA 1J3HA 3MWUA 4M97A 2GS6A 2B9HA 3R9DA 4IBMA 5HO6A 5HX8A 3UIXA 5BVKA 3LE6A 4C4JA 4E1ZA 4JIKA 4XS2A 3SKCA 4RJ5A 3FXZA 3BI6A 5AV4A 2ZM3A 5M57A 3E64A 3S95A 1L3RE 5DBXA 5BMSA 4WHZA 2WTWA 3QCSA 5HE0A 4CFWA 5E91A 5HG7A 4AX8A 2R5TA 3BL7A 2WMTA 1XBCA 5EM7A 5H9BA 4A9UA 3DV3A 3MIYA 2YM5A 4K1BA 5GZAA 2ZDTA 3VNTA 5CF4A 3EQGA 4DBXA 3EB0A 3CKXA 5IQFA 2Z7SA 4BB4A 1SYKA 3UE4A 4EHGA 1VLRA 3LMHA 2HOGA 2WTKC 2R3QA 1JKKA 2FSOX 4GW8A 4BDIA 4YJSA 2ITZA 2AEGA 1HCKA 4EHEA 2RFSA 5HD4A 1I44A 4J99A 3V8SA 3TTIA 3ACJA 4CFNA 1YHVA 4O4BB 5EW3A 4GG7A 5EOLA 3HDNA 1Y8YA 2PMOX 3R28A 4AZEA 3VHEA 4BTJA 5CSXA 5BVNA 1ZYJA 3ZLYA 4X2FA 2UV2A 3ZDUA 2JDVA 5ACBC 3WZDA 5BVFA 4CKJA 3G90X 1F0QA 4FZDB 4O0XA 4L52A 4QT1A 4YNOA 4LRMA 4CZYB 4BCIA 3UDSA 2YJRA 5A4EA 4KKHA 3BV2A 4KB8A 4WG5A 4C36A 2QOHA 4DGLC 2YACA 2VTAA 2C6IA 2CKPA 4O7NA 5CVGA 4CEGA 3QUDA 5CQWA 1JLUE 4M14A 2OXXA 5AA9A 5ANOA 3QU0A 3IONA 3UOKA 4NCTA 5ETCA 2VAGA 4BICA 3E3BX 4YTFA 3AKLA 3GBZA 1M2PA 2E9VA 2ZFYA 3OBJA 2OF4A 4USDA 4Y8DA 4GFOA 4IAFA 4ZY5A 3I0OA 3FXXA 2B54A 5GJFA 3RPVA 2I0YA 3KMMA 3D94A 1S9IA 2Y4IC 3R83A 3RPYA 1IA9A 1ATPE 4DFYA 3LMIA 3LFFA 4TYJA 2O0UA 3F69A 3LQ5A 4LV7A 5E8SA 2YM4A 3RAKA 4HVHA 3F3TA 3AMAA 3OY1A 4F9AA 5LCJA 2QOBA 1MQBA 5KKRC 3NS9A 5H3QA 4CFFA 4FTMA 1IAJA 4A4OA 3K3IA 4BDFA 1XO2B 2VN9A 3QRIA 2IW6A 5IQDA 4Q5EA 3UQGA 4L42A 1BKXA 2QCSA 4GKIA 2FVDA 3ODYX 2W99B 3ZO3A 4JOAA 3BHYA 3NW7A 2ONLC 1UU3A 3WF6A 2WKMA 5CU2A 3P5KA 1SM2A 5T68A 3UC3A 5BYZA 3MESA 1CM8A 3WILA 2VO6A 4M68A 2RKUA 5CANA 4FEVA 2B9IA 2YIRA 3A4OX 4I6HA 3VC4A 1OUKA 4EQCA 4FV2A 4MCVA 2WMSA 1ZYCA 5HTIA 4J8MA 4N6ZA 3RZFA 1URCA 4FKSA 4NW5A 2WMBA 4QD6A 4CKRA 4ZTQA 3ID6C 4F65A 2PHKA 2UW0A 4YZCA 2Y4PA 2WELA 3PIYA 1GZKA 4DFBA 3MA6A 3A4PA 4WUAA 3QAME 4MX9A 4BYJA 2NPQA 1SVHA 1YI4A 2ITNA 3NAYA 2PVKA 1G8SA 3MV5A 3FQEA 4DEAA 4L53A 4UMQA 5TR6A 3FUPA 4ZZMA 3Q52A 3TIYA 3PA4A 4NWMA 4O0WA 3FL4A 4L67A 2QONA 3ZLXA 4IQ6A 5CT7A 4NM3A 5JKGA 5E92A 4F78A 3BIZA 4E4LA 4RIYB 1PXOA 3IOPA 4XV2A 1YXVA 4GT3A 5HTCA 4B8LA 2HXLA 4PTCA 4JT3A 4U9AA 4CMUA 1QL6A 2VTIA 4QMQA 3GOKA 3VJOA 5KMLA 2C68A 2UZVA 3L8SA 2NO3A 4MNEB 1YQJA 3BHTA 4M0YA 2B55A 2J0MB 3ORXA 1JVPP 3LJ0A 3E7VA 1VJYA 3P08A 3HAVA 3QCXA 3I7CA 5D1JA 5AP7A 5CEQA 2G1TA 2BZHB 3K3JA 4IAZA 4ALUA 3KL8A 5DG5A 3NVMB 3Q4ZA 4FT9A 3R02A 2BROA 3UPXA 2I0HA 3LFCA 3ZDIA 4I92A 2OO8X 4B9DA 1H1RA 1OGUA 3TUCA 5FXSA 2R4BA 4DHZA 2IEWA 5M09A 5EQEA 4EC8A 1H00A 5B0XA 2CGXA 5FDXA 2JDSA 2CNQA 4ID7A 3G15A 4JQ7A 4HCVA 4O4DA 5EYCA 4OTQA 4UYNA 2ERKA 3I81A 5BVEA 4JDKA 2ITWA 2GQGA 2FGIA 3QUEA 1FVRA 3GT8A 4NM5A 3OHTA 5CXHA 4EC9A 5JGAA 3QD3A 4PDSA 1A06A 5M06A 4IZ7A 4TYGA 3TZ8A 4DCAA 2C6OA 2XK3A 1VYWA 4U41A 3BYMA 2QG5A 5AMNA 2JBOA 4XG9A 5CX9A 3ZLWA 3V6RA 3P7CA 1J91A 4FIGA 4K8AA 1YDTE 1XH9A 2JIIA 4CRSA 3OF0A 4AZWA 2VTOA 3UP2A 2VTPA 3RCJA