4DG0E

Crystal structure of myristoylated wt catalytic subunit of camp-dependent protein kinase in complex with sp20 and amp-pnp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
338
Chain Sequence
SEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of N-terminal myristylation in the structure and regulation of cAMP-dependent protein kinase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 107
structure length 338
sequence length 341
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dg0E01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dg0E02
3UE4A 3KMUA 4YPDA 2QOBA 3Q5ZA 3VRYA 3BRBA 1R1WA 4LYNA 3NYVA 4GK3A 2PMLX 1I44A 3RZBA 5E1EA 3HV4A 2ITNA 2OF2A 5GZAA 4B4LA 2ZDUA 1WAKA 5EI2A 1FGKA 3HDNA 2QOCA 1ZLTA 2PVHA 2XJ2A 2H96A 2YM7A 1F3MC 2E9VA 3F7ZA 3DZQA 4DEIA 4TTHB 3WE4A 3E62A 3QQJA 2UW6A 5LMBA 1Q8WA 3L9MA 5K5NA 3CTQA 3KXMA 3CJFA 2ACXA 3LM5A 3QCXA 4FTIA 4Y5QA 1ZZLA 4O2PA 5IKWA 5C27A 4L43A 4BHNA 3GU6A 2WXVA 4O0RA 2NO3A 4YLKA 3MYGA 4U79A 5ANJA 3BEGA 5FRIA 3EL7A 4DTAA 3RALA 3DNDA 3QQLA 2EXEA 5J9YA 2OXYA 4C61A 4CEGA 2UZBA 3O7LD 4IAIA 3HV5A 4BI1A 3FMLA 4FA2A 5BVFA 3SG9A 5ANIA 4BR3A 2OZAB 1ZAOA 4KUJA 1WBTA 3DDPA 1CKPA 3QUPA 2PE1A 1PXJA 3MH2A 4FV3A 4YZ9A 3SLSA 4AGWA 4BCGA 4CFNA 5EYDA 2J50A 4UWCA 2C6KA 3NUPA 4AOJA 2W5HA 2I0VA 3DNEA 5LMKA 4FEXA 4DCAA 4DLJA 4NYEA 3OMVA 4U44A 5EKNA 3JY9A 4RC4A 3AMAA 1WBSA 4GFGA 3BU6A 4G2FA 2XJ1A 5CLPA 1FVVA 3W2CA 3G51A 3EZRA 4E6CA 3C0IA 4EH8A 1Q4LA 2I0HA 4GVJA 4BRXA 4FSQA 4L53A 4O7YA 4JS8A 5FEDA 2YJRA 4N4SA 4I22A 4FTTA 2XH5A 4E5BA 2WTKC 3FMNA 4L8MA 2X8IA 2YDIA 4KBCA 4IAKA 1VYWA 1CSNA 3DTWA 4H39A 4TYJA 3R7UA 3ZEPA 3R8ZA 3ATTA 2XM8A 3ZTXA 3Q4ZA 5AP2A 5JEBA 4CFWA 4FIHA 1SVHA 3QGWA 3FLSA 4FTRA 2VV9A 1Q41A 2X9FA 4EK8A 2HW7A 3AT4A 2J4ZA 3OOGA 3ZSHA 3VC4A 3DAEA 3Q5IA 5IUGA 5EQYA 3BU5A 3B2WA 3V6RA 2O65A 4RIYA 3DXNA 1JQHA 1Z9XA 3W2SA 2R4BA 2QG7A 5FDXA 3VQUA 4GV1A 2UW5A 3I79A 4RZWA 3ULZA 3CIKA 3QHRA 4MF0A 4HYUA 4CFVA 2BRHA 3EKNA 5FTOA 2BUJA 5D1JA 4ITJA 1O9UA 2VTQA 3ORTA 5JFVA 2IVVA 4MD8E 3UYTA 4A9YA 4F9WA 2IPXA 5EHLA 4C57A 4DT8A 2JLDA 1R0EA 4CRLA 5JFXA 4GU6A 1M14A 4IM2A 2WAJA 4G5JA 2QONA 3IOPA 3U9NA 2XNOA 3HRBA 2VTRA 5AUWA 2HZIA 4UY9A 2YISA 3RM6A 1MRUA 4EBWA 4EI4A 2HELA 4K2RA 3IW6A 3FC1X 1PXKA 3NUNA 1GZKA 3GCPA 4O0TA 3M11A 3FXXA 5DR9A 4CV9A 4E3CA 4IZ5A 3ETAA 2I40A 2WMTA 3PXZA 4C62A 5JZJA 2XMYA 5JT2A 4IWOA 5KBQA 4QMYA 2W1GA 3HA6A 4D2RA 2E9UA 3UTOA 2NP8A 2VO6A 4XS2A 4D4RA 4HNFA 4DEEA 4UALA 4NH1A 5EFQA 4R3RA 5HORA 4DH3A 2CNUA 2W5AA 3SOCA 4ZSJA 3C7QA 3ENHA 2BVAA 1R39A 4UYNA 3GI3A 5B0XA 3PPJA 4IAFA 2HIWA 4BDAA 5CAPA 1H26A 3ROYA 2WMQA 3G6HA 1LR4A 4D1XA 2QQ7A 3KCFA 2QHNA 3NCZA 3ACJA 4QQJA 5E9EA 2VTLA 4ZTSA 3FC2A 4UWYA 4WNKA 4NKAA 3R9OA 2XKFA 1Q62A 1WBNA 4YPSA 2GMXA 4JQEA 2A0CX 3DBEA 2W1HA 5A54A 5H9BA 3U9CA 1JKLA 4C37A 2QURA 2WQBA 4UB7A 3EHAA 5AR3A 4LL0A 4QMWA 2NRYA 4GG7A 4EOQA 4EORA 1YI6A 3JPVA 2VO3A 3A60A 3HV7A 5TR6A 2BR1A 4UXQA 5TF9A 5ITAA 4G3GA 4F64A 2VGPA 2VTSA 3QU0A 3EFJA 2PWLA 4HYSA 4EYJA 4EQCA 4YR8A 4QTCA 2JAVA 2WTCA 3EL8A 3R6XA 4GUBA 5IA2A 3RGFA 4EHEA 4PNIA 3ZRMA 4E7WA 2C5VA 5EOBA 3VUGA 4PMSA 4KBKA 3NW6A 3DY7A 3TWJA 2Y0AA 4GJ3A 2XNGA 3LCTA 2RFNA 1OKWA 3GUBA 3FKNA 4IWPA 2V7AA 4TNBA 3PFQA 5KO1A 3C51A 5A4QA 4R1VA 4M7IA 3WF6A 3QC4A 2YEXA 3PG1A 4IAZA 3W33A 2XZSA 2XIKA 2IZTA 5EG3A 3KCKA 4DGOA 5E8ZA 2XK7A 3P7AA 3U51A 4N6ZA 2UVYA 3FQSA 3C0GA 5K0XA 3R30A 4HW7A 4E6AA 3NNVA 1JKTA 3O17A 4EOKA 5M09A 3SRVA 5IQAA 4WRGA 3WIGA 3TUBA 2ZB1A 5BVKA 4FV2A 4X3FA 2CCIA 4GG5A 4FF8A 1XH7A 2F2UA 4O6EA 4FUXA 2PL0A 5I9YA 2NRUA 1FVRA 5JGAA 4JL9A 4BGGA 3E3PA 2C47A 5M4FA 4D4SA 3UOHA 1OZ1A 4KIKA 4F6WA 3DKGA 3FMJA 5A14A 4OW8A 2YIQA 2YLEA 3F2RA 5TT7A 2PVYA 4LUDA 1OPKA 3H4JA 3QRUA 4O7ZA 3PPZA 5KHWA 4GVAA 4LRMA 4B0GA 2H9VA 4QP6A 3HEGA 2GFCA 4QP4A 2C0TA 2BIYA 4EZ7A 5B2MA 4HYHA 3BYOA 3B8QA 3DXQA 2R7IA 3F82A 3C4EA 2YJSA 1Q5KA 2B9IA 2Y4IC 1W0XC 3V04A 4G9RA 4RFYA 4RIWB 2JD5A 1Q8UA 1YXXA 2UZWE 3M42A 5EM5A 2OH0E 3BKBA 2WD1A 1P5EA 4GEOA 1NVQA 4RIYB 2BROA 4TYHB 4W8EA 4A9RA 2PPQA 3ZUUA 5HNBA 2E9OA 4C4GA 3PVBA 4E6DA 1XH9A 3EN5A 5F95A 1ZYCA 2XKCA 3BE9A 4IAAA 2XKDA 4YJTA 3SQQA 1KSWA 1YXTA 3W2RA 3E93A 5EDPA 3W2PA 2C5XA 2DYLA 4ZTHA 2QO9A 1UNHA 5CASA 1NXKA 3A7IA 5CQUA 5KMIA 4DGLC 4BCQA 4DTBA 2W4OA 3ODZX 3HGKA 4RIXA 2W99B 4QYEA 4O0SA 4F65A 2BZIB 3CXWA 5HKMA 4XG4A 2QOQA 2WQOA 4MXAA 3IW4A 4F1MA 3TNPC 3D14A 5E8TA 5L2QA 3GGFA 4ONAA 5CVFA 4FSWA 4ZZOA 3GQLA 2W06A 3Q6WA 3O8TA 2B7AA 3RWQA 1MUOA 3RAIA 4RX5A 4FTJA 2LAVA 1G8AA 3GOKA 3R01A 4ANBA 5M4UA 4I6FA 4FKOA 2JDOA 4JBOA 1JLUE 3DKCA 3FLNC 4AQCA 4EBVA 5IEYA 5M4CA 1OIRA 3G90X 5DEYA 4ERKA 3FMHA 3DLSA 3FY2A 4XV2A 5HTBA 4QTDA 4MNEA 2YIWA 5CT0A 2WMVA 4E5AX 2PZ5A 5J79A 5IQIA 4KB8A 5EM7A 4BCMA 2JEDA 4LI5A 4YHJA 5HTIA 4YJOA 3GFEA 4DEDA 3DBCA 3QBNA 4M67A 5HVKA 3P7CA 5I9ZA 5GIPE 3GCVA 5A46A 4QQCA 3HDMA 5AFVA 4G1WA 2QKRA 1E1VA 1XQZA 2IZSA 2PY3A 3KRRA 2YAKA 4MXCA 5HU9A 4IMYA 4DCEA 2YAAA 5AUYA 2X8DA 4KS8A 4WG4A 3QA8A 4B7TA 4E5WA 3MESA 3CD3A 4EOJA 4M69B 3BE2A 2QC6A 3DQWA 2SRCA 2UW0A 3SD0A 1YOLA 2C6TA 4ZTLA 4FKIA 2OF4A 4IHPA 2FH9A 4BIDA 4QMZA 5FGKA 4Q5HA 4YNOA 2X4ZA 5CF4A 4S2ZA 4IZ7A 2OIQA 3OVVA 3TKHA 2XNEA 2YITA 3OG7A 2VX3A 4I5MA 2VO7A 4MD9E 1F0QA 4DBNA 4AGDA 4X2NA 3ZU7A 2ZMCA 1NT2A 2XA4A 3F3UA 4ZTNA 3KY2A 5T68A 3CR0A 3CEKA 3V5WA 1V0BA 1HOWA 4ZSLA 2B9JA 3WF7A 3CD8A 2HZNA 2VWZA 2QI8A 3NZ0A 4Y85A 3MIYA 4QMNA 5BUJA 3TV6A 2OXXA 4Z9LA 3RAHA 3VO3A 4OTIA 4PL5A 5CEOA 1O6YA 4RRVA 2I7QA 3BWJA 4PQNA 3W8LA 3SW4A 3UMXA 2F2CB 5H8BA 3DFCB 5AP4A 3SXFA 3VS1A 3NUSA 5FG8A 2XB7A 4CQEA 5JMSA 3PJ2A 4HPTE 4TWCA 4BCHA 3ENMA 2DS1A 2RFSA 3RPRA 2UZOA 2X81A 3HZTA 5CSWA 4CMTA 4C38A 4DA5A 3IW5A 4W9WA 3CKWA 4K0YA 2HW6A 3UJGA 4HYIA 1RQQA 5E8WA 3OCBA 4QMVA 4WO5A 4I4FA 2WEIA 3FYJX 4YLLA 4FG9A 4O0XA 4IZYA 3CS9A 4XYFA 3DQXA 2WOUA 4MQ1A 3WZUA 2YWVA 3TTIA 4NCTA 2QLQA 3NCGA 4QNAA 4FBXA 2REIA 1XJDA 4FNYA 4HVIA 3ANRA 2W1DA 4O83A 4XV9A 2IVSA 4IACA 2P55A 3QX4A 3KXZA 3V5QA 3NR9A 2BZJA 5JSMA 1KV1A 1UWHA 2ERKA 3OFMA 3QZFA 2ZV9A 2R3IA 4NSTA 4YJSA 5K0KA 1YOMA 2WFYA 5IPJA 3CPBA 1W82A 1S9JA 4IEBA 5M51A 4RLLA 3QC9A 3QD3A 3AC8A 3OY3A 3R2YA 2PVLA 4AZTA 4EHZA 3FEGA 5M08A 3EQHA 4ORKA 5LCKA 2C6EA 4G3FA 2OSCA 3PSDA 4D1ZA 4FKRA 4AAAA 3R7IA 3VBYA 5JH6A 5J1VA 4RFMA 5AA8A 2R3HA 4XP2A 1NVRA 3E88A 3OUKA 3R7EA 1K2PA 3L9LA 3LQ8A 4M84A 5IA3A 3NNXA 5FP6A 3WZEA 2ZM4A 4RJ4A 4N6YA 4O82A 4DBXA 4RFZA 4OTWA 3Q4UA 3G6GA 3R04A 4PPCA 4ITIA 2V55A 3DK7A 4A9TA 2X8EA 2O63A 2VRXA 2VZ6A 3HX4A 1OIUA 3NYNA 3WIKA 5IDPA 1YXUA 4G6LA 4KSPA 2P2HA 2ETMA 2OJJA 1BX6A 3VF9A 4ENYA 4FNZA 4JOAA 3EJ1A 3V51A 3NWWA 2BFYA 4F9CA 1LPUA 2W5BA 4L42A 4YGAA 1WZYA 4EH2A 2XNPA 3CTJA 4XP3A 2XK4A 2C5YA 2WNTA 3QTXA 3E63A 2AC3A 2JKOA 4L7FA 5BX0A 2QOFA 3PIZA 3UQGA 3MTFA 4HCVA 3WF5A 2RGPA 3E7VA 3BYVA 3KXGA 1XH5A 4AZFA 4HJOA 3LOKA 3BPRA 4PL4A 3TIZA 4B9DA 1LEZA 2EB2A 4NTTA 5AAEA 4I0TA 5IH6A 3OZ6A 1ERKA 3IOKA 1PXNA 1J1CA 3MH1A 4NCTC 5D10A 3REPA 4CLIA 3FMMA 4JRVA 4MCVA 2J2IB 3DLZA 3HUBA 3F5XA 2WELA 4DFZE 4BDJA 4NTSA 1IG1A 5JRQA 3RNIA 3POZA 3UG2A 4B99A 4WRSA 1OUYA 5JKGA 4RLKA 1KOBA 2W7XA 2P3GX 3QTZA 3R7VA 2B52A 3D9VA 2HAKA 5CSVA 4M66A 4FTCA 4U43A 3IW7A 4BDFA 4U3ZA 3Q9YA 4GCJA 5BVOA 5HD7A 3R73A 1M17A 3A7JA 5CAOA 4FIIA 3QZHA 5TKDA 4BBFA 5ANGA 2X6DA 5J95A 5FBOA 3K3JA 3OEFX 4IXPA 5HVYA 4C3FA 3MFSA 2QOIA 3HP2A 3O96A 4FL1A 2VU3A 4XP0A 4AX8A 5IF1A 4NT4A 1DAYA 5K4JA 5A3XA 3QZIA 3TV4A 4AT5A 4EK5A 3DS6A 2GQSA 2JAMA 4KS7A 4Z7GA 1OI9A 2PE0A 2YDJA 3NYOA 4E4LA 3PVWA 4RJ6A 5HE2A 2X2KA 4OTPA 3R8PA 3PZEA 3MVHA 4D0XA 4V04A 2IZRA 5IU2A 3W2OA 5E4HA 3I81A 4WBBB 4CYJA 3FSFA 2ZVAA 2WTKB 3E92A 3FZPA 2Y7JA 3EKKA 3PXKA 3OWPA 4TT7A 1YWRA 5CVHA 3SRVB 5CU2A 3DTCA 2YABA 3R2BA 1OVEA 4FSZA 5HZNA 1O6LA 4KIPA 3UZTA 1CDKA 1QCFA 4R5YA 3KXHA 4S31A 1E1XA 4JG6A 2W1ZA 4FSRA 4L46A 5AMNA 4XG3A 4BDGA 4CRSA 3BU3A 4RC3A 2JFLA 5LVLA 2JIVA 3QAME 1T45A 2GNJA 3UVQA 3ZM9A 4WIHA 1WVXA 1W83A 3QTUA 2VWWA 2IZUA 2YM8A 4MD7E 4O7NA 4RT7A 2PMOX 2YM5A 4QMOA 3Q60A 3JVSA 5EKOA 4MXYA 5GHVA 4BCKA 3FXWA 4HCTA 4GSBA 3ZBXA 1YDRE 4JDIA 3AC1A 4EOIA 2BRNA 4I93A 3GU4A 3DJ7A 3R9RA 3VUMA 4RQKA 3BYUA 1K9AA 4I6BA 2W4JA 4FZ6A 3ZH8A 4O91A 4BDBA 4D9TA 3Q53A 4IVAA 1PMUA 2ONLC 4XLIA 3BHTA 4D2PA 3ORMA 1GZ8A 2WTVA 3PWYA 1KE5A 4ZJJA 1L3RE 4Y46A 5DMZA 1Q99A 3MA3A 3FY0A 4K33A 4EOPA 2G2HA 3FE3A 2RIOA 2ETRA 1H1QA 3VQHA 3MWUA 4OTGA 4BI2A 5L8LA 3DJ5A 5DG5A 4BKYA 2W1EA 4ACGA 4E20A 4CD0A 2GS6A 5J7BA 3KB7A 4RGJA 3IGOA 4FIFA 3U54A 3U55A 4FV6A 1OIYA 4A9UA 3OW4A 4XX9A 2CJMA 4AN2A 2AUHA 1IA9A 3B8RA 2VTPA 3Q9XA 4FKTA 5HX8A 4FICA 4G31A 2J0KA 5DBXA 1P14A 2OFUA 4IDTA 1PJKA 4Z16A 3KVWA 3KN5A 2O8YA 3ZYAA 1UU3A 2Z60A 3FZRA 3TG1A 4UN0C 5CAUA 4HVHA 1IAJA 5AA9A 5C1QB 3WF9A 3ALNA 4DG0E 5HO7A 4KRCA 1U46A 3F3WA 2Z2WA 3FI8A 3PXFA 3HV3A 3QYWA 4AOIA 2ZJWA 3I7BA 4WOVA 3QL8A 5IQFA 2XEZA 4I0SA 4MF1A 3UQFA 2YZAA 4I6QA 3LFCA 1H24A 3V3VA 4EOLA 2VWXA 3AGLA 5AUTA 4GMYA 5DT0A 4GT4A 5E8SA 3MVMA 4BTKA 3FWQA 4DC2A 5A4TA 2PUPA 1VYZA 4FNWA 4GKIA 4M0YA 4GL9A 3TNWA 3OEZA 2V62A 3AOXA 1H1WA 3ERKA 2QVSE 3GNIB 3Q9WA 5ETAA 4ZSEA 1YKRA 4MNEB 4C4JA 3IONA 3LFQA 4FV4A 1TVOA 4II5A 4DINA 3UIBA 1DAWA 1MQ4A 4IB3A 4GS6A 5FP5A 3MFRA 4MVFA 2J51A 3T9IA 3ZZEA 4C34A 4NM7A 3VWAA 4X2GA 4NKSA 3SXRA 5D12A 3W2QA 3O8PA 5IUHA 2J5EA 4FTMA 4I92A 1J3HA 3Q4CA 4FMQA 4WT6A 4GUEA 1TQMA 3R8VA 4F1TA 5C8NA 4M97A 4RX8A 3RMFA 3TL8A 1FGIA 4PDSA 5B2KA 4BDCA 2GDOA 4CZUA 2XCHA 4EH5A 5CYIA 3GOPA 4RIXB 3OOMA 3POOA 1ZYDA 5E90A 4XH6A 3GC7A 4OTRA 4CFUA 2FSLX 2BZHB 4XG8A 2UZEA 4EH4A 5FXRA 3PDTA 2BDJA 3UOLA 2ITVA 4GK4A 4ZTQA 1FVTA 1F5QA 3JUHA 3LCSA 4L44A 3VS2A 4CCUA 3ZBFA 3ZFYA 5CU3A 2QNJA 2YLFA 4GRBA 1KE9A 3KK8A 4H3QA 4AU8A 4AZWA 1MRYA 3OCGA 5JFSA 3DAJA 3T3UA 2WMBA 4FG8A 3SXSA 4TYHA 4PY1A 5CF8A 3FQHA 3GU5A 3PG3A 4H1JA 4ENXA 3ALOA 4GU9A 3T3VA 5L4QA 2F7ZE 4NM3A 4LV5A 4CZTA 1W98A 3FLYA 2Q0BA 4JXFA 4BYIA 1FOTA 4XMOA 4R78A 2XIXA 1UA2A 4IVCA 3C1XA 2YFXA 1OKYA 3OTUA 4HOKA 4FT5A 3UNJA 3WZJA 1W84A 3AXWA 4MXZA 2WHBA 3QRTA 4RJ3A 1AQ1A 2OU7A 4EZ5A 3ZOSA 2PMNX 1GIJA 1KE7A 2W4KA 4HZSA 4BTJA 4FVQA 2Q83A 1GZNA 1NW1A 2OZAA 3MPAA 4R8QA 4F0FA 5LJJA 3EN7A 3UZRA 5M06A 4BCPA 4FEQA 2RSVA 3ZHPC 1CM8A 3DV3A 3V8WA 3TDWA 4AW5A 3FZSA 4RJ5A 5CT7A 5DOSA 4YTFA 3RK7A 3L9PA 4MX9A 1Q3WA 2WB8A 2W1FA 2XKEA 3HUCA 4L7SA 1OBGA 2X6EA 4ZAUA 2CGXA 3KKVA 4PUZA 2ITOA 3UP7A 5J9ZA 4HVDA 4ZP5A 3MH0A 4J95A 5GJFA 2GSFA 2VO0A 1XBAA 1V1KA 3KN6A 3TZ8A 5ETFA 4JRNA 2C6MA 5H8EA 1A9UA 4C35A 3F7WA 3BGZA 2LGCA 4C4EA 4USEA 3D0EA 3TKIA 4FTUA 4J96A 2BHHA 4L45A 5EHOA 2IW9A 2ZV2A 3VS6A 3CP9A 4E4XA 4X7QA 2PVJA 3NS9A 5F1ZA 5HE3A 4XBRA 4EJ7A 4NJ3A 4Y83A 3DBQA 1FQ1B 2CMWA 2WTJA 4U3YA 3LFNA 2PULA 3LXNA 3II5A 3MPTA 1L8TA 3VRZA 4C33A 3A61A 4LOOA 3CBLA 2R3OA 4FX3A 4OLIA 4AWIA 2O0UA 5C8KA 3FQEA 4ZSGA 3NIZA 3EZVA 1RW8A 4Q5EA 3OD6X 4MHAA 3CLYA 4ANSA 4E93A 5T6KA 3H9OA 2WMUA 3QKKA 5F9EA 4ZY4A 3N4TA 3SX9A 3ID6C 3FHIA 3HAVA 2P0CA 1H25A 4YHTA 4A7CA 2R3RA 2VGOA 4CG9A 4PPBA 4PMPA 3FZTA 5F20A 2J90A 2JFMA 1Y8YA 3HLLA 3I5ZA 4CSVA 3BV3A 4GFMA 2R64A 3GP0A 3NAYA 5HGIA 1ZYJA 3AC4A 4NUSA 3D5XA 5A6NA 2C6IA 5C4KA 3UBDA 5C01A 5CEMA 2HY81 5EW9A 2CKQA 2YHVA 3WZDA 3K5VA 1UU9A 4NZWB 5M57A 5L2IA 3F61A 1BLXA 3CQUA 4ZY5A 4FT7A 3NVKI 4EYMA 4ZZMA 2DUVA 2C3LA 3A62A 3FSKA 1LP4A 4K18A 1T46A 3QXOA 5HICA 1HCLA 3RTPA 3V5PA 3IDPA 4D2VA 4RX9A 3HMOA 3ZRKA 4ZJVA 4MXXA 2BAJA 5JQ5A 4IB5A 5I3OA 2C69A 3SOAA 1KE8A 4DFYA 1NY3A 3C4XA 4LFIA 3ZM4A 4BF2A 3FJQE 1OMWA 5AIKA 5AP7A 3S3IA 3RPYA 2I1MA 1IA8A 4EUTA 3UZPA 3W55A 3VS7A 3VBQA 5CZIA 3A7FA 2PMIA 4W8DA 5HCZA 4RSSA 1Q3DA 4Q2AA 5AAFA 3R8UA 3CTHA 4O1PA 3UDBA 4E26A 2VWVA 3QGYA 5KMKA 3KGAA 4O0VA 3VHKA 4JLCA 4YC8A 2GFSA 5LMKC 4FSMA 3TDVA 3PA3A 1QPDA 4FT9A 5M56A 4A4OA 3FKOA 3GQIA 4KAOA 3ZO1A 3E8DA 4BN1A 3PJ1A 1BKXA 4FV1A 2RKUA 1RE8A 3U6HA 4KSQA 3TJDA 3DGKA 4UYAA 1JOWB 2XYNA 5FEQA 2VTAA 2XUUA 3CKXA 2JDTA 3MV5A 5HIBA 4PTGA 2UW8A 2BTRA 4U80A 3MW1A 3O8UA 4ZZNA 2OW3A 1REKA 3EQIA 4MEDA 5AR8A 2HY0A 2XF0A 4R7HA 3S2PA 4AW2A 3NMUF 2Z7SA 3MN3A 1M7QA 3WILA 1MQBA 4ALWA 2YIXA 3RP9A 3DK3A 2XK6A 3WYYA 3BLHA 2KULA 5IA1A 2XBJA 1DI9A 4OR5A 5FUTA 4AA4A 4YBJA 2HENA 4IWQA 2RG6A 3IKAA 4PPAA 4BWPA 5A9UA 2G9XA 4Y5HA 3HA8A 5EQEA 4NK9A 4XCUA 3DFAA 2XRUA 4WD5A 2FGIA 4F7SA 3H9RA 3L8SA 4HZRA 4U42A 2BAKA 4EHVA 3MIAA 4AXAA 4DG2E 4E73A 1H8FA 2YERA 4YJRA 2HXQA 5KE0A 4FE2A 4QMSA 4F9BA 4YZBA 3PRFA 1DI8A 4D55A 3WF8A 3UO4A 4DEBA 3ZUTA 4D2TA 1P4FA 4TL0A 2R3MA 3V5JA 5E92A 1OBDA 2IG7A 2QU5A 1Z5MA 5CNOA 2XK9A 4NFMA 4RX7A 4EH9A 3EQBA 1VZOA 3EQRA 3LXKA 3FL4A 4RIOA 1PW2A 5FQDC 4FKSA 3DB6A 2FVDA 3G15A 2UVXA 5JZNA 4UV0A 5EYKA 5HNGA 4XNEA 3SGCA 4WUAA 4BDEA 5IEVA 4FIGA 1JAMA 1OITA 1ZOEA 1H00A 4J8NA 2R9SA 3ORLA 4K11A 3PY3A 1YQJA 3FI2A 2YA9A 4JAJA 3QXPA 3R0TA 1UVRA 3GBZA 3W32A 3ZSGA 1WBOA 1GOLA 4UMQA 2CKOA 4L3PA 5KNJA 3ORIA 1PXLA 1UKHA 1PXOA 2WTWA 3FBVA 4EC8A 4AF3A 3LJ0A 3D7TA 4LMUA 3R7GA 4QTEA 2GCDA 5HQ0A 4QP8A 2CSNA 4FODA 1Y6AA 3GCSA 3LVPA 4U6RA 5C03A 3LXPA 3TT0A 3ZO4A 3EOCA 3R71A 3EYHA 4C58A 3JYAA 4R3CA 5BMSA 4P2KA 3N4VA 3PVUA 4FZAB 2CGWA 1DS5A 1JSUA 4BCIA 4UZHA 4RC2A 5JGDA 4L68A 4FZFB 5AV0A 2XYUA 2G2FA 4ZEGA 4AA5A 3Q2JA 3GU8A 5E8UA 1YOJA 4DEAA 3C5IA 4YJUA 3C13A 3EN6A 4PP9A 4ASZA 4EH7A 4BZNA 4TY1A 3JY0A 2QO2A 4GFOA 3G33A 3I1AA 4O7RA 3D94A 1I09A 4U9AA 3BHHA 3SVVA 4IX4A 5M55A 3HMMA 2VWYA 2Y4IB 3ZUVA 1OECA 1B38A 5DWRA 3L8PA 5CEKA 2HOGA 2QOOA 3UO6A 3WBLA 2C3JA 4I21A 4B8MA 2B55A 2OK1A 3BEAA 4F4PA 5A4CA 4WNOA 5LMAA 1LEWA 1XH4A 3ZXTA 3ZLSA 3QCYA 2ITQA 3WZKA 5CSPA 2C30A 4YP8A 4K6ZA 2B4SB 4HNIA 2ZM1A 4O96A 4TYEA 4C3RA 3BGPA 1FPUA 3Q4TA 3P7BA 5AR5A 4EL9A 2HZ0A 5H2UA 3OHTA 3UVPA 4JR7A 4KIOA 1UKIA 2Q0NA 3CC6A 1URCA 3CSVA 4XBUA 3V8SA 4EONA 4IX5A 3A4OX 4B8LA 4FV7A 5IA5A 3R83A 3R9NA 3IDCA 4ANNA 5CALA 4D0WA 4CTBA 3EFLA 2EVAA 2XIZA 3W10A 1JSVA 2R7BA 2IW6A 5DA3A 5HD4A 5EW8A 3AT3A 1G5SA 3KRJA 5CX9A 1KV2A 3EMGA 2ZB0A 3DB8A 2JITA 2BRBA 2YCQA 4HGSA 3GC0A 4J53A 4L3LA 5KUPA 4AUAA 2HWOA 3LMIA 4W4VA 4CMOA 2G1TA 4XG7A 5ETCA 4DH1A 5EDQA 5AUUA 5K9IA 5KX8A 4FOBA 4C59A 3LJ2A 3R7YA 3ZONA 3LIJA 2XNNA 4FTQA 2QD9A 2X7FA 2UZUE 3P0MA 4FC0A 2J0IA 4JJRA 4B6LA 5I3RA 1AGWA 4Z7HA 4CNHA 3HKOA 3SW7A 2XCKA 2ITUA 2C6DA 2WU7A 3V01A 4MH7A 4IW0A 4QTBA 2E9PA 5JQ8A 4O0UA 2J5FA 2OJGA 3LFDA 3RINA 4QQTA 4WSQA 4J98A 1KWPA 4FTLA 3PJCA 3ORPA 4LRKA 4R7IA 2NNWB 5EH0A 2CDZA 4Q9SA 3OY1A 4AW0A 5G6VA 2AYPA 4OBOA 4E6QA 3COHA 1OM1A 3FPQA 4FSTA 2BRMA 3CGOA 1M2PA 2G15A 3CE3A 1XR1A 3R8MA 5AADA 1OL6A 4GK2A 3NUUA 1WVYA 4L01A 5FEEA 3JR1A 3UGCA 4PMTA 3K3IA 4YZNA 1PYEA 4YNEA 4BICA 3P1AA 2UVZA 3KQ7A 4CT1A 2OLCA 1QPCA 2GTMA 3LFEA 3RCJA 2WU6A 3FZOA 3C4ZA 3L9NA 4DITA 4CCBA 3NX8A 3K5UA 1FMOE 2X4FA 3LE6A 4FVPA 3QQGA 4NFNA 1CKIA 3OUNB 4RIWA 1GAGA 2EWAA 5J7HA 3QX2A 4LGDA 5AWMA 3R22A 5GNKA 3ZDUA 4TYIA 3CCNA 3P4KA 4KNBA 3NNUA 1J7LA 3VAPA 5KMNA 3PZHA 3TNQB 4Z55A 1YI4A 2XS0A 4XUFA 5HVJA 5J9LA 1VEBA 4E4NA 3VS3A 2Z7QA 4U81A 2CKPA 1ZRZA 5AX9A 1Y8GA 2BIKB 1Q61A 3BBTB 3BX5A 1EH4A 5LARA 5CY3A 3VBTA 4ASEA 4C36A 1WFCA 2B53A 2BTSA 3PRIA 2UW3A 5EM6A 3QALE 4QMUA 3COKA 4U40A 4C8BA 2DQ7X 1JBPE 4IH8A 3ZC5A 5FXSA 2A1AB 5KMLA 1YVJA 2OGVA 2B9FA 4I4EA 2QR8A 5IMXA 2JBOA 4G17A 4DE4A 4F9YA 3N51A 5L3AA 3BLRA 3HL7A 5AR7A 4NM0A 5LWMA 4BZDA 4I3ZA 3H3CA 5B7VA 5J1WA 4LRJA 2GS2A 2J6MA 2WKMA 2ONLA 3O2MA 4YZMA 5IA4A 3KMWA 4F0GA 1B6CB 5BYYA 2JKKA 2OI4X 2UUEA 3MBLA 3FYKX 5DT3A 3PE1A 3R1NA 2ZAZA 1JSTA 3NEWA 5HBHA 5D7AA 4XRJA 3FI3A 3TZ7A 1REJA 2OIBA 1YDSE 2W1CA 3EN9A 4WA9A 3W18A 3R9DA 3MJ1A 3ZSIA 1H27A 2YIYA 4ALUA 3F66A 4V05A 3T9TA 3FLZA 4ZIMA 3NUXA 5I0BA 4IFCA 1JKKA 3H0YA 4HPUE 3NW5A 4IDVA 4GIHA 5AUZA 3M2WA 1XWSA 4PF4A 1Q8TA 3I5NA 3BELA 4BIEA 4BGQA 3QHWA 3ZFXA 1H1SA 1KE6A 2C1AA 2WTDA 2UZLA 4FK3A 3RVGA 1UNLA 3G5DA 3EQGA 4QP3A 3S95A 4RWKA 2WOTA 3A4PA 1TKIA 3E8CA 4A4XA 3TM0A 1UU8A 3CQWA 3EQCA 4F6SA 4S30A 2ITTA 5EM8A 4FGRA 2UZNA 4IE9A 5T3QA 5CI6A 4O1OA 4JDKA 5I4NA 2XIYA 2FSOX 2YCFA 3PSCA 4EK6A 5CF6A 4XG6A 3PLAE 3G0FA 4CFMA 4J1RA 4W9XA 2AC5A 2QOHA 4RJ7A 3SV0A 5I5ZA 3MFTA 3PY1A 3TV7A 4A9SA 4APCA 4FKJA 4JBVA 2NPQA 3DOGA 4MWIA 4OT6A 3KXNA 2OJ9A 3WI6A 4HVSA 2GQRA 5CZHA 4G6OA 3R02A 4FL3A 5J87A 3O0GA 4CMUA 4R7BA 3E8NA 2OZOA 3PE2A 3RK5A 4U5JA 4X3JA 4M14A 4J71A 2QKWB 4JBPA 4JR3A 2F7XE 4QT1A 4U0IA 3PJ8A 1M52A 3RJCA 2WMWA 5C4LA 2X7OA 4G3CA 5LVNA 3MGYA 4QNYA 4BKJA 1YXVA 4Y72A 2GPHA 2ZDTA 4ZTRA 4I1ZA 3TXOA 4KA3A 3LKMA 3ZXZA 2VTMA 4ZLOA 2IWIA 2C1BA 4OBQA 4C7TA 5KKRC 4XEYA 1NA7A 1ZZ2A 2BRGA 5IA0A 3ZO3A 4K1BA 4PRJA 4IANA 3NIEA 3QTSA 3DKOA 4OGRA 3UIXA 4HGLA 3AC5A 2IVTA 3OBJA 3D5VA 5L2TA 2CGVA 4TN6A 4YLJA 5E1SA 5FWKK 4OAUC 2PVKA 3MY1A 4J99A 2C6OA 2IVUA 3EN4A 4D58A 5L6OA 4O86A 3GCUA 4P7EA 5HOAA 3A8WA 2B9HA 4P5QA 4YC3A 3F5UA 2HK5A 2V22A 2WGJA 4X6QC 4IWDA 2O5KA 3KXXA 1PKDA 2GTNA 3P78A 4KRDA 4KINA 4C02A 2E9NA 5IUIA 4BKZA 3Q9ZA 2BZKB 4IFGA 4NIFB 4F6UA 1G8SA 3BV2A 2R3GA 3Q04A 4FG7A 3GC9A 3W8QA 3VS0A 4AZVA 4IM3A 3PP1A 4WG3A 3LQ5A 3C4FA 2Z8CA 4TWOA 4WHZA 5ANKA 2EU9A 3C9WA 2VX0A 3PY0A 4GW8A 3BHVA 4KKHA 1QL6A 4QPSA 5IQHA 3ORKA 4FNXA 5EK7A 3HRCA 4YTIA 4FEVA 5EW3A 4BDDA 4RZVA 4BBEA 3QTIA 2VNWA 2ZMDA 2I6LA 5AM6A 1MP8A 4LGHA 4QP9A 5I9WA 1H08A 3EQDA 2C0IA 4MKCA 3AC2A 5CAVA 2ESMA 4BTMA 5DHJA 4I94A 1PYXA 4U97A 5DPVA 3F88A 4AOTA 3P23A 4RVMA 4ACMA 4DFNA 2IO6A 4JNWA 4RWIA 4RA5A 1J1BA 2WTIA 3VBXA 4FL2A 4DTKA 4AFJA 2XVDA 4GIIA 3ZEWA 4YBKA 5LCJA 3MTLA 4O7VA 1ZMWA 1PF8A 1P2AA 5HG8A 3ZZWA 5L2WA 4U45A 4PV0A 2RFDA 4EC9A 4IJ9A 2EXMA 1FBNA 3EFWA 2JIIA 3LM0A 3KMMA 1R3CA 4FTKA 3VW8A 4ZY6A 5J8IA 4AN3A 4EWQA 3GXLA 4EKLA 5HBJA 5J5TA 4YJQA 3S1HA 1SZMA 3TCPA 3P86A 4YHFA 3W16A 4JBQA 4F70A 1H28A 3VUDA 2Z7RA 2CLQA 3KEXA 5BVDA 4CFFA 5CVGA 5HX6A 3JXWA 3RAWA 5BNJA 3T8OA 4F63A 3QKLA 4EZ3A 3UO5A 3EFKA 4DGNA 4X2FA 4IM0A 5AAGA 5EQPA 1G3NA 4PX6A 4FI1A 4IB1A 4CT2A 4QMLA 4IQ6A 1QPJA 1JKSA 3C5UA 3CPCA 5HEZA 5DE2A 5BMMA 3QRIA 2XRWA 1DM2A 2VWIA 4DEHA 3UOJA 2C5OA 4BHZA 4IC8A 4YJPA 5CANA 4UXLA 5D9HA 4ARKA 4M8TA 4BGHA 3FPMA 1P4OA 4JG7A 5M4IA 3FL5A 5CXHA 4I0RA 2W1IA 4WBOA 2RF9A 5ANDA 4D4VA 4DAWA 3TTJA 2BCJA 1ZYSA 2GNFA 3HYHA 3ROCA 4DFXE 2VD5A 4O7SA 4FYNA 3Q6UA 4EUUA 2C0OA 4QYGA 4AG8A 2PSQA 4FEWA 3PWDA 1R78A 2OJIA 3I0OA 3L8XA 3WARA 3MH3A 4YO4A 5M07A 2X7GA 1BI8A 3P9JA 3UVRA 4EJNA 4O84A 1ZMUA 5KCVA 3S00A 1H1RA 1SNXA 1PMNA 5EOLA 3LAUA 1ZARA 3VS4A 4DGMA 4JT3A 4OTFA 1UWJA 4AZEA 3MY5A 4O22A 5HG7A 2HXLA 4ANLA 2F7EE 1VR2A 2QODA 4EOSA 1YHWA 5KMJA 4G9CA 3VNTA 2IW8A 3TUDA 4FKUA 2CN5A 4G16A 4BYJA 3UNZA 1Y6BA 3V5TA 3L1SA 3VN9A 3KU2A 3DBDA 4WSYA 1YDTE 5CWZA 3CY2A 4R77A 1R0PA 2OIDA 3D83A 5FTQA 3MJ2A 4JX3A 2CCHA 3KF7A 4AN9A 3IO7A 3QRJA 3LCDA 4D2SA 5L8JA 4GJ2A 1TQPA 2ZV8A 3AD5A 3UIMA 1HCKA 4CKJA 4ZOGA 2OG8A 4R6VA 2C68A 1RDQE 5CSXA 3PIYA 3QQFA 4DFBA 4YO6A 5DNRA 2OO8X 2HWPA 2Y9QA 4Y95A 3OROA 4EKKA 4C0TA 4JG8A 3W1FA 2F49A 2R3QA 4P90A 3QKMA 1PXIA 4CV8A 2VNYA 4CQGA 3SAYA 3EQPA 3KVXA 2OXDA 3ODYX 2ERZE 4G6NA 4J52A 2VUWA 5HLPA 2ITPA 4MBIA 2WO6A 3KA0A 5BUIA 1LUFA 3EIDA 3ORXA 3QCQA 5AP3A 5H8GA 3RCDA 3QD2B 3I6WA 3B2TA 1UV5A 1SM2A 2VWBA 4H36A 1YI3A 2V0DA 4XRLA 4YMJA 3R63A 3E5AA 2X1NA 4BCNA 5H3QA 2UW9A 3QZGA 2JKQA 2P4IA 2YIRA 5DRBA 1H01A 3A99A 2GNIA 2UZVA 1WMKA 4I41A 4ERWA 3ANQA 3LZBA 4DT9A 3DK6A 4I5CA 1GNGA 3ITZA 4GT3A 4ACDA 4H3PA 4NJDA 4X21A 4M15A 3RM7A 5TO8A 1NVSA 4AGCA 3V6SA 3R1YA 4BFMA 4M69A 4ASXA 5JN2A 5M53A 1U4DA 4YU2A 1PXPA 4RA4A 4PNKA 5LWNA 3NVMB 2OBJA 3RPSA 1SYKA 4R3PA 3F6XA 4EHGA 4XLVA 1OL5A 2XP2A 2YM6A 3ACKA 3SA0A 4K8AA 3VBWA 1ZXEA 4IZAA 5E8YA 4CGAA 4H1MA 4HCUA 4BCFA 4EH3A 3RI1A 4DYMA 4TWNA 3C50A 4LOQA 4ZTMA 3NUYA 1ZMVA 2C6LA 2YCSA 3COIA 4FYOA 5GINE 5CI7A 4NL0A 1YWNA 4M12A 3I7CA 2A4LA 2ITXA 1KOAA 5D11A 3IPHA 3SG8A 3VJNA 2OFVA 3Q3BA 5DLSA 5DRDA 3WOWA 2VN9A 4O7LA 1S9IA 5LVPA 2PZIA 1J91A 3Q52A 4L9IA 4MQ2A 2OICA 2WQMA 5HBEA 4FKLA 2O3PA 1VJYA 3ZMMA 1SVGA 4GYIA 3Q32A 4NWMA 4N0SA 4WUNA 3BQCA 4EWHA 3LPBA 3UNKA 3PXQA 4BDKA 5HU3A 3A7HA 1PY5A 2XM9A 3PA4A 4S34A 2JIUA 4J97A 4D5HA 3VVHA 5HLNA 3KULB 2RFEA 5FD2A 2PZRA 2XK3A 5IQDA 3RHXA 3NPCA 3D7TB 4IB0A 3EQFA 3BYMA 4MYGA 3AQVA 4FT3A 3AMBA 3FI4A 3R28A 3IW8A 3DJ6A 5AP6A 1PMVA 2VTNA 2Z7LA 3F5PA 4TPTA 2CN8A 3E8EA 3OT3A 5TE0A 2WMRA 4O27B 3ZCLA 3NRMA 5HHWA 2J0JA 1XO2B 4IAYA 4IVBA 3E3BX 1Q8YA 4H3BA 1JPAA 4RQVA 2ITWA 1WBWA 1CMKE 2VX1A 3OW3A 4XOYA 3P08A 5E91A 3EH9A 4FKGA 2H6DA 3QTQA 1WBPA 2ZYBA 5BPYA 1TQIA 1OKZA 3SDJA 2PZPA 2GS7A 4BWKA 3DPKA 5HO8A 3LMHA 4DLIA 5CAQA 5CU0A 2FYSA 4XJ0A 4BDHA 1FINA 2VTJA 1OIQA 2VTIA 1PMEA 2JDRA 4FV0A 3BIZA 1YRPA 1ZYLA 2X0GA 2BDFA 5LXMA 3HV6A 5BVWA 4RVTA 3DU8A 3VJOA 4DGGA 2J9MA 1ZWSA 3D5UA 4QYHA 5LOHA 2JC6A 1GIHA 4O0YA 4KKGA 5HCYA 3ZFMA 3LFBA 3PP0A 4FIEA 4UBAA 5AR2A 3DT1A 3G2FA 4O6LA 4U7ZA 4X3FB 1OUKA 3AG9A 4TWPA 2HCKA 5E8VA 5KKRB 5GJDA 3MVJA 3IG7A 4JVGA 4ZS0A 1FMKA 5EI8A 4XG2A 4AA0A 4F7NA 4ZLZA 2R5TA 5JGBA 2CPKE 5BVEA 3ATSA 2O64A 1ZY4A 4QTAA 2PE2A 2VAGA 2BFXA 5EI6A 2PVRA 3NAXA 4FKQA 2F4JA 2UZTA 2CHLA 5ETIA 2UW7A 4NEUA 3UC4A 4FKWA 2BAQA 3D2IA 3PVGA 4CKRA 5LVOA 4AGUA 2R0IA 1H4LA 1QPEA 1GZOA 2UV2A 3H0ZA 4OUCA 4C3PA 2WPAA 3VHEA 4EOMA 1XBBA 3BCEA 2PK9A 3O71A 2QG5A 4EQUA 5AR4A 4CG8A 2YM4A 2BPMA 1PXMA 3KFAA 3R00A 2ITZA 5HI2A 4QMMA 4QD6A 4ALVA 4YZDA 3UC3A 4OTDA 3DBFA 4JQ7A 1B39A 1IEPA 3G9NA 3GU7A 4FT0A 4FTAA 4RBLA 4C2WA 4E1ZA 3UG1A 1ND4A 2B54A 3OS3A 4XOZA 5AP5A 4QYFA 4CYIA 3QWJA 4LM5A 4UWBA 2ZOQA 4PDOA 2YM3A 3PJ3A 2RG5A 5HTCA 3KREA 3S0OA 1YW2A 4TYGA 5AUXA 3TN8A 3PPKA 4DFUA 3FXZA 3BYSA 3KC3A 3KK9A 4U41A 2GHLA 4PTEA 5DH3A 3FMKA 5KBRA 3UP2A 4F7JA 5BVNA 3HMPA 3PIXA 2XNMA 2A19B 3OBGA 4OTHA 2XEYA 2J7TA 4MNFA 5I9UA 3ORNA 4DN5A 4A06A 4PP7A 5ANEA 4I20A 4CLJA 1JVPP 3MFUA 5CEPA 1JWHA 3LMGA 4ITHA 5HESA 4QMQA 5HNIX 3DCVA 4RVLA 2A2AA 5CENA 4BCOA 3NGAA 4D4YA 4Y8DA 3LCKA 4G3DA 4GYGA 2R3NA 2WMSA 3C4WA 4M3QA 4H58A 3R1SA 3FMDA 3PYYA 5IEXA 4AS0A 4P5ZA 4E4MA 4W4WA 4F7LA 3DXPA 3ULIA 4YTCA 3QLGA 4IC7A 5KZ0A 3F3TA 3OF0A 4D1SA 4JQ8A 3ET7A 4V01A 1A06A 5DFPA 1BYGA 1OKVA 4E8AA 2WQNA 2BDWA 4NW6A 2PZYA 4F0IA 4OAVB 3KF4A 1JNKA 3O50A 3D5WA 3H9FA 3MB6A 4P4CA 1X8BA 4NW5A 4CFXA 3ZS5A 2YWPA 4IX6A 2W9FB 3N9XA 5FM2A 4M68A 4PTCA 4IX3A 5HG5A 5KHXA 4X2JA 4XV1A 5AIRA 3NYXA 1BI7A 2C5NA 4L00A 4EK3A 5JRSA 4YTHA 5TOZA 3C4CA 3PLSA 4D2WA 5GZ8A 4QYYA 1ZOHA 2R3LA 2W05A 3G0EA 3MA6A 3VUKA 5IDNA 4TZRA 3RK9A 5HE1A 4AT3A 1XH8A 4A4LA 4OT5A 3BLQA 4QMTA 1Y57A 3ZO2A 1O6KA 4GH2A 4DF3A 4J7BA 5L6WL 2Z02A 3I60A 4FVRA 2OKRA 5FBNC 3IK3A 3K54A 1YHSA 2GHGA 2XNBA 2O2UA 4I5PA 1U5QA 3RKBA 4ZLYA 3RAKA 4O7WA 5G1XA 2BILB 5AV2A 5DR6A 2FA2A 4YUQA 1OL1A 2R2PA 1M7NA 2WMXA 4G34A 4W4YA 4C4IA 2B1PA 2FSMX 4DHFA 4D28A 1XBCA 5F4NA 1U59A 4ZXTA 3BZ3A 5BYZA 3M1SA 4DFLA 2QOKA 5AP0A 4H05A 1BL6A 2JKMA 4W4XA 4RG0A 3VF8A 3D4QA 1K3AA 3Q96A 4C2VA 4FR4A 4JI9A 4FKPA 1U54A 2UW4A 3DDQA 1BUHA 3I4BA 2Y8OA 5DEWA 4BVUA 4QP2A 2GNHA 2W96B 1IR3A 3BGQA 1U54B 4G3EA 3KRLA 4FKVA 1OGUA 2PTKA 4DEGA 5JFWA 3N4UA 5ANOA 4CTCA 4N70A 4UEUA 4IVDA 5CU6A 4PWNA 3RWPA 3NW7A 2IN6A 4LV8A 4TW9A 4KBAA 4RVKA 4XV3A 5EYCA 1PRYA 2WEVA 3BI6A 4MXOA 2QCSA 1UNGA 5IH5A 2GQGA 5IQEA 3U6JA 3UQCA 1M2QA 3RBWA 4QMPA 1GIIA 3A7GA 5FDPA 2BKKA 3U8WA 2GHMA 4PDYA 2EB3A 2X39A 4N57A 3ZDIA 2GNLA 5BUEA 3U4WA 1H1PA 3OC1A 3UPXA 3F5GA 5HE0A 2PUIA 2FUMA 3ZLWA 4JAIA 3P5KA 2BMCA 1ZOGA 3AMYA 3VULA 1APME 4D9UA 2VTTA 2XK8A 2HZ4A 2ZM3A 3QCSA 2WMAA 5HO6A 3PA5A 4KIKB 3QTRA 1STCE 4KIQA 4F09A 5A6OA 4MBJA 4PDPA 3G9LX 4TKSA 2A27A 3QD0A 4APPA 5A4LA 4UMPA 4ZJIA 4DH7A 4UMRA 1H0WA 1ZY5A 3FKLA 4M0ZA 4WNMA 3OCTA 4O38A 2E2BA 1YHVA 1GJOA 3R21A 4IJPA 4BL1A 3BBWA 3GT8A 3TIYA 1Y91A 4GKHA 4I24A 4Y73A 5K3YA 5CEQA 1E9HA 3QTWA 2PU8A 2R3PA 2VTOA 4MTAA 5J5SA 1XHAA 2HYYA 3V5LA 5AJQA 3RHKA 4RWJA 3UMWA 2YN8A 3F3VA 4NIFA 3ORZA 4O81A 3EB0A 1SVEA 3I0QA 4IADA 1V0OA 2P2IA 4QQ5A 4RWLA 3BHUA 5AEPA 3D7ZA 5AV3A 3A8XA 3CJGA 3D2KA 2WIHA 4FUYA 4JDHA 2Y6OA 3VUTA 3DZOA 3R7OA 5DT4A 3HVCA 5LVMA 5CF5A 4I6HA 4LOPA 5D7VA 4FGBA 2FB8A 3ELJA 3DAKA 2W0JA 3JVRA 4I5HA 3RPVA 2GU8A 1BMKA 2V5QA 2R3JA 3IDBA 3QFVA 4L6QA 4R5SA 4TNDA 3MVLA 4YJNA 5AV1A 3LXLA 4FV5A 3BQRA 4QP1A 4ZK5A 3R9HA 3TI1A 3A2CA 2PUNA 4AACA 2GNGA 2Y6MA 4OTQA 3TUCA 3FUPA 2XBAA 5BYLA 3D15A 5IZFA 4AW1A 3HP5A 3BHYA 1Q8ZA 3MI9A 4USFA 4QP7A 3HECA 2PHKA 2W17A 3TJCA 4ZMEA 2BHEA 4MAOA 3AC3A 3LJ1A 3E64A 3Q2MA 4JIKA 3ZLXA 5M44A 2C3IB 3KRXA 2ITYA 2OJFE 3CQEA 1SNUA 2W9ZB 5JK3A 4LL5A 3AD6A 4UMTA 3QQUA 4MWHA 4FK6A 4KKEA 3IS5A 3VBVA 4AFEA 3H30A 4WG5A 4CXAA 4KABA 5E7RA 2OH4A 3R1QA 4S33A 5HG9A 5K5XA 2X2LA 4FV8A 3VS5A 3BWFA 4MK0A 3LCOA 4TXCA 4EK4A 4EQMA 3OCSA 3SKCA 4ASDA 3OWJA 3O23A 1OPJA 3GCQA 2Y4PA 1U5RA 3QLFA 5KMOA 3NUAA 2JBPA 5EDRA 5IMEA 4IIRA 2RL5A 4GT5A 3LFFA 2XIRA 2C3KA 2F9GA 3OT8A 4DH5A 4BTFA 1IAHA 5FM3A 4RPVA 5IQGA 4O2ZA 2J0MB 3UODA 5HLWA 1OB3A 5IG1A 4PL3A 1A48A 2QOLA 4YJVA 1RJBA 4PMMA 4JX7A 4YC6A 4BC6A 4DH8A 5F94A 1OL7A 4QOXA 1BL7A 4ZSAA 2G2IA 3P79A 4UZDA 4F9AA 3FMEA 3AD4A 1WVWA 4BIBA 5I9VA 1QMZA 3HMIA 5GJGA 4DG3E 4BI0A 4TRLA 3OWLA 4YZCA 5ACBC 4HGTA 3PSBA 2R0UA 3QYZA 5AUVA 5CS6A 3DKFA 3U4UA 5L2SA 1PKGA 3OP5A 5FTGA 3UPZA 3E7OA 5KMMA 3F69A 2X2MA 5C9CA 3O51A 4FZ7A 4L3JA 3PXYA 3VUIA 3GEQA 2X9EA 4CKIA 2JDSA 3QQKA 5CEIA 1OPLA 5GZ9A 4EEVA 4BBMA 3FLQA 5DGZA 4EOOA 4V0GA 4LGGA 5HIDA 4MBLA 3QA0A 4QRCA 4YSMA 3UYSA 1W8CA 4G5PA 3V8TA 5IISA 5DYJA 3GC8A 1IRKA 2XJ0A 4FSUA 4JDJA 2EUFB 4QO9A 5HIEA 1J7IA 1Q24A 2QO7A 4LMNA 4YURA 3U6IA 2B0QA 1MRVA 5ICPA 2J0LA 5EYMA 3C0HA 2FO0A 3RZFA 3AGMA 4AE6A 4Z3VA 1KUTA 2JDVA 3LW0A 4M13A 3ZLYA 3FZ1A 4O7TA 1CKJA 5L6PA 4A07A 1OL2A 5L8KA 5DN3A 3NDMA 2I0EA 2IJMA 2JGZA 4BCJA 5DIAA 5IQBA 1YWVA 1WCCA 4XG9A 2PVFA 3KULA 5C8MA 5B2LA 5CXZA 1IASA 2YACA 3IGGA 1PHKA 3KL8A 4HGEA 4CVAA 1V0PA 3HMNA 2PVNA 2YDKA 3OXTA 4J8MA 5AP1A 3LLAA 5GIOE 3RNYA 3VUHA 2ZV7A 4FIJA 3QD4A 5DR2A 2V7OA 3K2LA 3LFSA 3F9NA 3GVUA 2CGUA 4FTOA 2I0YA 2WIPA 4FZDB 4BY9E 2YZLA 5CNNA 3TZMA 3FLWA 1WBVA 3LFAA 3MY0A 3UIUA 1M2RA 1URWA 2QU6A 2CLXA 3PUPA 4CZYB 3TEIA 1AD5A 3IQ7A 4I23A 3GENA 4YSJA 3LHJA 3UOKA 4K9YA 4R1YA 2QR7A 2F57A 4D5KA 3SHEA 5CU4A 1XKKA 5FXQA 3CY3A 3FHRA 1J7UA 3F2AA 3ZC6A 3QRKA 4RMZA 2C4GA 4C4HA 4FSNA 1Z57A 2QHMA 2VTHA 4XHKB 5CQWA 5ACKA 5AV4A 4QMXA 5HCXA 4V0GB 4O0WA 4ACHA 4ZS4A 5DVRA 3GB2A 4FOCA 4USDA 1UU7A 5KZIA 3LLTA 3F2NA 2P33A 4KD1A 4HVGA 3MSSA 4ACCA 1YXSA 3WYXA 3PXRA 3CGFA 3OTVA 2BALA 4AE9A 3MS9A 4BWXA 4LUEA 3QUEA 4NU1A 5LQFA 4S32A 3VW6A 4JIAA 3SC1A 4AZSA 2R3KA 2KTYA 4L52A 4NM5A 4X2KA 3ZRLA 1H07A 2CNQA 3KRWA 1ATPE 5CSHA 2OWBA 3FV8A 4QPAA 3FDNA 3DA6A 4FTNA 2DWBA 3TKUA 3AT2A 3OWKA 2PYWA 2VWUA 1Q97A 5A4EA 5K4IA 1H0VA 3QWKA 5E8XA 4WKQA 3HRFA 4BDIA 2CNVA 2PUUA 4ID7A 3TACA 4WNPA 4X6RA 5D41A 3RPOA 2WQEA 3QUDA 4K77A 3EYGA 2G01A 4O21A 3FAAA 2UZDA 1GY3A 3PTGA 3TZ9A 3QF9A 3QQHA 4ANQA 4UX9A 4U8ZA 2CKEA 3O7LB 5EHYA 3MPMA 3E87A 4BB4A 4L67A 4FSYA 3L8VA 4C4FA 5I9XA 2QLUA 3HNGA 5AX3A 3GFWA 4F1OA 1XH6A 5AM7A 5BQ0A 3NSZA 3U87A 5FLFA 3MDYA 1SMHA 2R3FA 3JS2A 4UMUA 4OBPA 3IECA 3MB7A 4LG4A 5IQCA 3NNWA 3COMA 3F3ZA 4ZMFA 3I6UA 3TNHA 5C26A 2FSTX 3R8LA 3LQ3A 4ANOA 3TNIA 4AP7A 1CTPE 4QPMA 2BKZA 3NLBA 4KWPA 2ETKA 4AT4A 4RJ8A 1W7HA 2H8HA 3S4QA 4FEUA 3OXZA 4Q9ZA 4F08A 3H10A 4FV9A 3WE8A 2H34A 2EXCX 4X3FC 5CTPA 4BZOA 3HAMA 4X0MA 3THBA 4EH6A 3OXIA 2YCRA 3EWHA 5DI1A 3VIDA 4ANMA 5IH4A 4LQMA 2WZJA 4IBMA 4F99A 2PVMA
chains in the Genus database with same CATH superfamily
3UE4A 3KMUA 4YPDA 2QOBA 3Q5ZA 3VRYA 3BRBA 1R1WA 4LYNA 3NYVA 4GK3A 2PMLX 1I44A 3RZBA 5E1EA 3HV4A 2ITNA 2OF2A 5GZAA 4B4LA 2ZDUA 1WAKA 5EI2A 1FGKA 3HDNA 2QOCA 1ZLTA 2PVHA 2XJ2A 2H96A 2YM7A 1F3MC 2E9VA 3F7ZA 3DZQA 4DEIA 4TTHB 3WE4A 3E62A 3QQJA 2UW6A 5LMBA 1Q8WA 3L9MA 5K5NA 3CTQA 3KXMA 3CJFA 2ACXA 3LM5A 3QCXA 4FTIA 4Y5QA 1ZZLA 4O2PA 5IKWA 5C27A 4L43A 4BHNA 3GU6A 2WXVA 4O0RA 2NO3A 4YLKA 3MYGA 4U79A 5ANJA 3BEGA 5FRIA 3EL7A 4DTAA 3RALA 3DNDA 3QQLA 2EXEA 5J9YA 2OXYA 4C61A 4CEGA 2UZBA 3O7LD 4IAIA 3HV5A 4BI1A 3FMLA 4FA2A 5BVFA 3SG9A 5ANIA 4BR3A 2OZAB 1ZAOA 4KUJA 1WBTA 3DDPA 1CKPA 3QUPA 2PE1A 1PXJA 3MH2A 4FV3A 4YZ9A 3SLSA 4AGWA 4BCGA 4CFNA 5EYDA 2J50A 4UWCA 2C6KA 3NUPA 4AOJA 2W5HA 2I0VA 3DNEA 5LMKA 4FEXA 4DCAA 4DLJA 4NYEA 3OMVA 4U44A 5EKNA 3JY9A 4RC4A 3AMAA 1WBSA 4GFGA 3BU6A 2NYAA 4G2FA 2XJ1A 5CLPA 1FVVA 3W2CA 3G51A 3EZRA 4E6CA 3C0IA 4EH8A 1Q4LA 2I0HA 4GVJA 4BRXA 1G8JA 4FSQA 4L53A 4O7YA 4JS8A 5FEDA 2YJRA 4N4SA 4I22A 4O4CA 4FTTA 2XH5A 4E5BA 2WTKC 3FMNA 4L8MA 2X8IA 2YDIA 4KBCA 4IAKA 1VYWA 1CSNA 3DTWA 4H39A 4TYJA 3R7UA 3ZEPA 3R8ZA 3TYKA 3ATTA 2XM8A 3ZTXA 3Q4ZA 5AP2A 5JEBA 4CFWA 4FIHA 1SVHA 3QGWA 3FLSA 4FTRA 2VV9A 1Q41A 2X9FA 4EK8A 2HW7A 3AT4A 2J4ZA 3OOGA 3ZSHA 3VC4A 3DAEA 3Q5IA 5IUGA 5EQYA 3BU5A 3B2WA 3V6RA 2O65A 4DDIA 4RIYA 3DXNA 1JQHA 1Z9XA 3W2SA 2R4BA 2QG7A 5FDXA 3VQUA 4GV1A 2UW5A 3I79A 4RZWA 3ULZA 3CIKA 3QHRA 4MF0A 4HYUA 4CFVA 2BRHA 3EKNA 5FTOA 2BUJA 5D1JA 4ITJA 1O9UA 2VTQA 3ORTA 4O4BB 5JFVA 2IVVA 4MD8E 3UYTA 4A9YA 4F9WA 2IPXA 5EHLA 4C57A 4DT8A 2JLDA 1R0EA 4CRLA 5JFXA 4GU6A 1M14A 4IM2A 2WAJA 4G5JA 2QONA 3IOPA 3U9NA 2XNOA 3HRBA 2VTRA 5AUWA 2HZIA 4UY9A 2YISA 3RM6A 1MRUA 4EBWA 4EI4A 2HELA 4K2RA 3IW6A 3FC1X 1PXKA 3NUNA 1GZKA 3GCPA 4O0TA 3M11A 3FXXA 5DR9A 4CV9A 4E3CA 4IZ5A 4BJJB 3ETAA 2I40A 2WMTA 3PXZA 3W0SA 4C62A 5JZJA 2XMYA 5JT2A 4IWOA 5KBQA 4QMYA 2W1GA 3HA6A 4D2RA 2E9UA 3UTOA 2NP8A 2VO6A 4XS2A 4D4RA 4HNFA 4DEEA 4UALA 4NH1A 5EFQA 3TMOA 4R3RA 5HORA 4DH3A 2CNUA 2W5AA 3SOCA 4ZSJA 3C7QA 3ENHA 2BVAA 1R39A 4UYNA 3GI3A 5B0XA 3PPJA 4IAFA 2HIWA 4BDAA 5CAPA 1H26A 3ROYA 2WMQA 3G6HA 1LR4A 4D1XA 2QQ7A 3KCFA 2QHNA 4LDTA 3NCZA 3ACJA 4QQJA 5E9EA 2VTLA 4ZTSA 3FC2A 4UWYA 4WNKA 4NKAA 3R9OA 2XKFA 1Q62A 1WBNA 4YPSA 2GMXA 4JQEA 2A0CX 3DBEA 2W1HA 5A54A 5H9BA 3U9CA 1JKLA 4C37A 2QURA 2WQBA 4UB7A 3EHAA 5AR3A 4LL0A 4QMWA 2NRYA 4GG7A 4EOQA 4EORA 1YI6A 3JPVA 2VO3A 3A60A 3HV7A 5TR6A 2BR1A 4UXQA 5TF9A 5ITAA 4G3GA 4F64A 2VGPA 2VTSA 3QU0A 3EFJA 2PWLA 4HYSA 4EYJA 4EQCA 4YR8A 4QTCA 2JAVA 2WTCA 3EL8A 3R6XA 4GUBA 5IA2A 3RGFA 4EHEA 4PNIA 3ZRMA 4E7WA 2C5VA 5EOBA 3VUGA 4PMSA 4KBKA 3NW6A 3DY7A 3TWJA 2Y0AA 4GJ3A 2XNGA 3LCTA 2RFNA 3UDSA 1OKWA 3GUBA 3FKNA 4IWPA 2V7AA 4TNBA 3PFQA 5KO1A 3C51A 5A4QA 4R1VA 4M7IA 3WF6A 3QC4A 2YEXA 3PG1A 4IAZA 3W33A 2XZSA 2XIKA 2IZTA 5EG3A 3KCKA 4DGOA 5E8ZA 2XK7A 3P7AA 3U51A 4N6ZA 2UVYA 3FQSA 3C0GA 5K0XA 3R30A 4HW7A 4E6AA 3NNVA 1JKTA 3O17A 4EOKA 5M09A 3SRVA 5IQAA 4WRGA 3WIGA 3TUBA 2ZB1A 5BVKA 4FV2A 4X3FA 2CCIA 4GG5A 4FF8A 1XH7A 2F2UA 4O6EA 4FUXA 2PL0A 5I9YA 2NRUA 1FVRA 5JGAA 4JL9A 4BGGA 3E3PA 2C47A 5M4FA 4F78A 4D4SA 3UOHA 1OZ1A 4KIKA 4F6WA 3DKGA 3FMJA 4O4FA 5A14A 4OW8A 2YIQA 3AKLA 2YLEA 3F2RA 5TT7A 2PVYA 4LUDA 1OPKA 3H4JA 3QRUA 4O7ZA 3PPZA 5KHWA 4GVAA 4LRMA 4B0GA 2H9VA 4QP6A 3HEGA 2GFCA 4QP4A 2C0TA 2BIYA 4EZ7A 5B2MA 4HYHA 3BYOA 3B8QA 3DXQA 2R7IA 3F82A 3C4EA 2YJSA 1Q5KA 2B9IA 2Y4IC 1W0XC 3V04A 4G9RA 4RFYA 4RIWB 2JD5A 1Q8UA 1YXXA 2UZWE 3M42A 5EM5A 2OH0E 3BKBA 2WD1A 1P5EA 4GEOA 1NVQA 4RIYB 2BROA 4TYHB 4W8EA 4A9RA 3W0MA 2PPQA 3ZUUA 5HNBA 2E9OA 4C4GA 3PVBA 4E6DA 1XH9A 3EN5A 5F95A 1ZYCA 2XKCA 3BE9A 4IAAA 2XKDA 4YJTA 3SQQA 1KSWA 1YXTA 3W2RA 3E93A 5EDPA 3W2PA 2C5XA 2DYLA 4ZTHA 2QO9A 1UNHA 5CASA 1NXKA 3A7IA 5CQUA 5KMIA 4DGLC 4BCQA 4DTBA 2W4OA 3ODZX 3HGKA 4RIXA 2W99B 4QYEA 4O0SA 4F65A 2BZIB 3CXWA 5HKMA 4XG4A 2QOQA 2WQOA 4MXAA 3IW4A 4F1MA 3TNPC 3D14A 5E8TA 5L2QA 3GGFA 4ONAA 5CVFA 4FSWA 4ZZOA 3GQLA 2W06A 3Q6WA 3O8TA 2B7AA 3RWQA 1MUOA 3RAIA 4RX5A 4FTJA 2LAVA 1G8AA 3GOKA 3R01A 4ANBA 5M4UA 4I6FA 4FKOA 2JDOA 3BL9A 4JBOA 1JLUE 3DKCA 3FLNC 4AQCA 4EBVA 5IEYA 5M4CA 1OIRA 3G90X 5DEYA 4ERKA 3FMHA 3DLSA 3FY2A 4XV2A 5HTBA 4QTDA 4MNEA 2YIWA 5CT0A 2WMVA 4E5AX 2PZ5A 5J79A 5IQIA 4KB8A 5EM7A 4BCMA 2JEDA 4LI5A 4YHJA 5HTIA 4YJOA 3GFEA 4DEDA 3DBCA 3QBNA 4M67A 5HVKA 3P7CA 5I9ZA 5GIPE 3GCVA 5A46A 4QQCA 3HDMA 5AFVA 4G1WA 2QKRA 1E1VA 1XQZA 2IZSA 2PY3A 3KRRA 2YAKA 4MXCA 5HU9A 4IMYA 4DCEA 2YAAA 5AUYA 2X8DA 4KS8A 4WG4A 3QA8A 4B7TA 4E5WA 3MESA 3CD3A 4EOJA 4M69B 3BE2A 2QC6A 3DQWA 2XALA 2SRCA 2UW0A 3SD0A 1YOLA 2C6TA 4ZTLA 4FKIA 2OF4A 4IHPA 2FH9A 4BIDA 4QMZA 5FGKA 4Q5HA 4YNOA 2X4ZA 5CF4A 4S2ZA 4IZ7A 2OIQA 3OVVA 3TKHA 2XNEA 2YITA 3OG7A 2VX3A 4I5MA 2VO7A 4MD9E 4O4EA 1F0QA 4DBNA 4AGDA 4X2NA 3ZU7A 2ZMCA 1NT2A 2XA4A 3F3UA 4ZTNA 3KY2A 5T68A 3CR0A 3CEKA 3V5WA 1V0BA 1HOWA 4ZSLA 2B9JA 3WF7A 3CD8A 2HZNA 2VWZA 2QI8A 3NZ0A 4Y85A 3MIYA 4QMNA 5BUJA 3TV6A 2OXXA 4Z9LA 3RAHA 3VO3A 4OTIA 4PL5A 5CEOA 1O6YA 4RRVA 2I7QA 3BWJA 4PQNA 3W8LA 3SW4A 3UMXA 2F2CB 5H8BA 3DFCB 5AP4A 3SXFA 3VS1A 3NUSA 5FG8A 2XB7A 4CQEA 5JMSA 3PJ2A 4HPTE 4TWCA 4BCHA 3ENMA 2DS1A 2RFSA 3RPRA 2UZOA 2X81A 3HZTA 5CSWA 4CMTA 4C38A 4DA5A 3IW5A 4W9WA 3CKWA 4K0YA 2HW6A 3UJGA 4HYIA 1RQQA 5E8WA 3OCBA 4QMVA 4WO5A 4I4FA 2WEIA 3FYJX 4YLLA 4FG9A 3BL7A 3PFYA 4O0XA 4IZYA 3CS9A 4XYFA 3DQXA 2WOUA 4MQ1A 3WZUA 2YWVA 3TTIA 4NCTA 2QLQA 3NCGA 4QNAA 4FBXA 2REIA 1XJDA 4FNYA 4HVIA 3ANRA 2W1DA 4O83A 4XV9A 2IVSA 4IACA 2P55A 3QX4A 3KXZA 3V5QA 3NR9A 2BZJA 5JSMA 1KV1A 1UWHA 2ERKA 3OFMA 3QZFA 2ZV9A 2R3IA 4NSTA 4YJSA 5K0KA 1YOMA 2WFYA 5IPJA 3CPBA 1W82A 1S9JA 4IEBA 5M51A 4RLLA 3QC9A 3QD3A 3AC8A 3OY3A 3R2YA 2PVLA 4AZTA 4EHZA 3FEGA 5M08A 3EQHA 4ORKA 5LCKA 2C6EA 4G3FA 2OSCA 3PSDA 4D1ZA 4FKRA 4AAAA 3R7IA 3VBYA 5JH6A 5J1VA 4RFMA 5AA8A 2R3HA 4XP2A 1NVRA 3E88A 3OUKA 3R7EA 1K2PA 3L9LA 3LQ8A 4M84A 5IA3A 3NNXA 5FP6A 3WZEA 1ST4A 2ZM4A 4RJ4A 4N6YA 4O82A 4DBXA 4RFZA 4OTWA 3Q4UA 3G6GA 3R04A 4PPCA 4ITIA 2V55A 3DK7A 4A9TA 2X8EA 2O63A 2VRXA 2VZ6A 3HX4A 1OIUA 3NYNA 3WIKA 5IDPA 1YXUA 4G6LA 4KSPA 2P2HA 2ETMA 2OJJA 1BX6A 3VF9A 2IEWA 4FNZA 4JOAA 4ENYA 3EJ1A 3V51A 3NWWA 2BFYA 4F9CA 1LPUA 2W5BA 4L42A 3UDZA 1W2DA 4YGAA 1WZYA 4EH2A 4I6LA 2XNPA 3CTJA 4XP3A 2XK4A 2C5YA 2WNTA 3QTXA 3E63A 2AC3A 2JKOA 4L7FA 5BX0A 2QOFA 3PIZA 3UQGA 3MTFA 4HCVA 3WF5A 2RGPA 3E7VA 3BYVA 3KXGA 1XH5A 4AZFA 4HJOA 3LOKA 3BPRA 4PL4A 3TIZA 4B9DA 1LEZA 2EB2A 4NTTA 5AAEA 4I0TA 5IH6A 3OZ6A 1ERKA 2AEGA 3IOKA 1PXNA 1J1CA 3MH1A 4NCTC 5D10A 3REPA 4CLIA 3FMMA 4JRVA 4MCVA 2J2IB 3DLZA 3HUBA 3F5XA 2WELA 4DFZE 4BDJA 4NTSA 1IG1A 5JRQA 3RNIA 3POZA 3UG2A 4B99A 4WRSA 1OUYA 5JKGA 4RLKA 1KOBA 2W7XA 2P3GX 3QTZA 3R7VA 2B52A 3D9VA 2HAKA 5CSVA 4M66A 4FTCA 4U43A 3IW7A 4BDFA 4U3ZA 3Q9YA 4GCJA 5BVOA 5HD7A 3R73A 1M17A 3A7JA 3W0RA 5CAOA 4FIIA 3QZHA 5TKDA 4BBFA 5ANGA 2X6DA 5J95A 5FBOA 3K3JA 3OEFX 4IXPA 5HVYA 4C3FA 3MFSA 2QOIA 3HP2A 3O96A 4FL1A 2VU3A 4XP0A 4AX8A 5IF1A 4NT4A 1DAYA 5K4JA 5A3XA 3QZIA 3TV4A 4AT5A 4EK5A 3DS6A 2GQSA 2JAMA 4KS7A 4Z7GA 1OI9A 2PE0A 2YDJA 3NYOA 4E4LA 3PVWA 4RJ6A 5HE2A 2X2KA 4OTPA 3R8PA 3PZEA 3MVHA 4D0XA 4V04A 2IZRA 5IU2A 3W2OA 5E4HA 3I81A 4WBBB 4CYJA 3FSFA 2ZVAA 2WTKB 3E92A 3FZPA 2Y7JA 3EKKA 3PXKA 3OWPA 4TT7A 1YWRA 5CVHA 3SRVB 5CU2A 3DTCA 2YABA 3R2BA 1OVEA 4FSZA 5HZNA 1O6LA 4KIPA 3UZTA 1CDKA 1QCFA 4R5YA 3KXHA 4S31A 1E1XA 4JG6A 2W1ZA 4FSRA 4L46A 5AMNA 4XG3A 4BDGA 4CRSA 3BU3A 4RC3A 2JFLA 5LVLA 2JIVA 3QAME 1T45A 2GNJA 3UVQA 3ZM9A 4WIHA 1WVXA 1W83A 3QTUA 2VWWA 2IZUA 2YM8A 4MD7E 4O7NA 4RT7A 2PMOX 2YM5A 4QMOA 3Q60A 3JVSA 5EKOA 4MXYA 5GHVA 4BCKA 3FXWA 4HCTA 4GSBA 3ZBXA 1YDRE 4JDIA 3AC1A 4EOIA 2BRNA 4I93A 3GU4A 3DJ7A 3R9RA 3VUMA 4RQKA 3BYUA 1K9AA 4I6BA 2W4JA 4FZ6A 3ZH8A 4O91A 4BDBA 4D9TA 3Q53A 4IVAA 1PMUA 2ONLC 4XLIA 3BHTA 4D2PA 3ORMA 1GZ8A 2WTVA 3PWYA 1KE5A 4ZJJA 1L3RE 4Y46A 5DMZA 1Q99A 3MA3A 3FY0A 4K33A 4DHIB 4EOPA 2G2HA 3FE3A 2RIOA 2ETRA 1H1QA 3VQHA 3MWUA 4OTGA 4BI2A 5L8LA 3DJ5A 5DG5A 4BKYA 5BV3A 2W1EA 4ACGA 4E20A 4CD0A 2GS6A 5J7BA 3KB7A 4RGJA 3IGOA 4FIFA 3U54A 3U55A 4FV6A 1OIYA 4A9UA 3OW4A 4XX9A 2CJMA 4AN2A 2AUHA 1IA9A 3B8RA 2VTPA 3Q9XA 4FKTA 5HX8A 4FICA 4G31A 2J0KA 5DBXA 1P14A 2OFUA 4IDTA 1PJKA 4Z16A 3KVWA 3KN5A 2O8YA 3ZYAA 1UU3A 2Z60A 3FZRA 3TG1A 4UN0C 5CAUA 4HVHA 1IAJA 5AA9A 5C1QB 3WF9A 3ALNA 4DG0E 5HO7A 4KRCA 1U46A 3F3WA 2Z2WA 3FI8A 3PXFA 3HV3A 3QYWA 4AOIA 2ZJWA 3I7BA 4WOVA 3QL8A 2A98A 5IQFA 2XEZA 4I0SA 4MF1A 3UQFA 2YZAA 4I6QA 3LFCA 1H24A 3V3VA 4EOLA 2VWXA 3AGLA 5AUTA 4GMYA 5DT0A 4GT4A 5E8SA 3MVMA 4BTKA 3FWQA 4DC2A 5A4TA 2PUPA 1VYZA 4FNWA 4GKIA 4M0YA 4GL9A 3TNWA 3OEZA 2V62A 3AOXA 1H1WA 3ERKA 2QVSE 3GNIB 3Q9WA 3UDTA 5ETAA 4ZSEA 1YKRA 4MNEB 4C4JA 3IONA 3LFQA 4FV4A 1TVOA 4II5A 4DINA 3UIBA 1DAWA 1MQ4A 4IB3A 4GS6A 5FP5A 3MFRA 4MVFA 2J51A 3T9IA 3ZZEA 4C34A 4NM7A 3VWAA 4X2GA 4NKSA 3SXRA 5D12A 3W2QA 3O8PA 5IUHA 2J5EA 4AAYA 4FTMA 4I92A 1J3HA 3Q4CA 4FMQA 4WT6A 4GUEA 1TQMA 3R8VA 4F1TA 5C8NA 4M97A 4RX8A 3RMFA 3TL8A 1FGIA 4PDSA 5B2KA 4BDCA 2GDOA 4CZUA 2XCHA 4EH5A 5CYIA 3GOPA 4RIXB 3OOMA 3POOA 1ZYDA 5E90A 4XH6A 3GC7A 4OTRA 4CFUA 2FSLX 2BZHB 4XG8A 2UZEA 4EH4A 5FXRA 3PDTA 2BDJA 3UOLA 2ITVA 4GK4A 4ZTQA 1FVTA 1F5QA 3JUHA 3LCSA 4L44A 3VS2A 4CCUA 3ZBFA 3ZFYA 5CU3A 2QNJA 2YLFA 4GRBA 1KE9A 3KK8A 4H3QA 4AU8A 4AZWA 1TFFA 1MRYA 3OCGA 5JFSA 3DAJA 2IF8A 2WMBA 4FG8A 3T3UA 3SXSA 4TYHA 4PY1A 5CF8A 3FQHA 3GU5A 3PG3A 4H1JA 4ENXA 3ALOA 2AQXA 4GU9A 3T3VA 5L4QA 2F7ZE 4NM3A 4LV5A 4CZTA 1W98A 3FLYA 2Q0BA 4JXFA 4BYIA 1FOTA 4XMOA 4R78A 2XIXA 1UA2A 4IVCA 3C1XA 2YFXA 1OKYA 3OTUA 4HOKA 4FT5A 3UNJA 3WZJA 1W84A 3AXWA 4MXZA 2WHBA 3QRTA 4RJ3A 1AQ1A 2OU7A 4EZ5A 3ZOSA 2PMNX 1GIJA 1KE7A 2W4KA 4HZSA 4BTJA 4FVQA 2Q83A 1GZNA 1NW1A 2XANA 2OZAA 3MPAA 4R8QA 4F0FA 5LJJA 3EN7A 3UZRA 5M06A 4BCPA 4FEQA 2RSVA 3ZHPC 1CM8A 3DV3A 3V8WA 3TDWA 4AW5A 3FZSA 4RJ5A 5CT7A 5DOSA 4YTFA 3RK7A 3L9PA 4MX9A 1Q3WA 2WB8A 2W1FA 2XKEA 3HUCA 4L7SA 1OBGA 2X6EA 4ZAUA 2CGXA 3KKVA 4PUZA 2ITOA 3UP7A 5J9ZA 4HVDA 3AKKA 4ZP5A 3KIOC 3MH0A 4J95A 5GJFA 2GSFA 2VO0A 1XBAA 1V1KA 3KN6A 3TZ8A 5ETFA 4JRNA 2C6MA 5H8EA 1A9UA 4C35A 3F7WA 3BGZA 2LGCA 4C4EA 4USEA 3D0EA 3TKIA 4FTUA 4J96A 2BHHA 4L45A 5EHOA 2IW9A 2ZV2A 3VS6A 3CP9A 4E4XA 4X7QA 2PVJA 3NS9A 2X0PA 5F1ZA 5HE3A 4XBRA 4EJ7A 4NJ3A 4Y83A 3DBQA 1FQ1B 2CMWA 2WTJA 4U3YA 3LFNA 2PULA 3LXNA 3II5A 3MPTA 1L8TA 3VRZA 4C33A 3A61A 4LOOA 3CBLA 2R3OA 4FX3A 4OLIA 4AWIA 2O0UA 5C8KA 3FQEA 4AXFA 4ZSGA 3NIZA 3EZVA 1RW8A 4Q5EA 3OD6X 4MHAA 3CLYA 4ANSA 4E93A 5T6KA 3H9OA 2WMUA 3QKKA 5F9EA 4ZY4A 3N4TA 3SX9A 3ID6C 3FHIA 3HAVA 2P0CA 1H25A 4YHTA 4A7CA 2R3RA 2VGOA 4CG9A 1OGYA 4PPBA 4PMPA 3FZTA 5F20A 2J90A 2JFMA 1Y8YA 3HLLA 3I5ZA 4CSVA 3BV3A 4GFMA 2R64A 3GP0A 3NAYA 5HGIA 1ZYJA 3AC4A 4NUSA 3D5XA 5A6NA 2C6IA 5C4KA 3UBDA 5C01A 5CEMA 2HY81 5EW9A 2CKQA 2YHVA 3WZDA 3K5VA 1UU9A 4NZWB 5M57A 5L2IA 3F61A 1BLXA 3CQUA 4ZY5A 4FT7A 3NVKI 4EYMA 4ZZMA 2DUVA 2C3LA 3A62A 3FSKA 1LP4A 4K18A 1T46A 3QXOA 5HICA 1HCLA 3RTPA 3V5PA 3IDPA 4D2VA 4RX9A 3HMOA 3ZRKA 4ZJVA 4MXXA 2BAJA 5JQ5A 4IB5A 5I3OA 2C69A 3SOAA 1KE8A 4DFYA 1NY3A 3C4XA 4LFIA 3ZM4A 4BF2A 3FJQE 1OMWA 5AIKA 5AP7A 3S3IA 3RPYA 2I1MA 1IA8A 4EUTA 3UZPA 3W55A 3VS7A 3VBQA 5CZIA 3A7FA 2PMIA 4W8DA 5HCZA 4RSSA 1Q3DA 4Q2AA 5AAFA 3R8UA 3CTHA 4O1PA 3UDBA 4E26A 2VWVA 3QGYA 5KMKA 3KGAA 4O0VA 3VHKA 4JLCA 4YC8A 2GFSA 5LMKC 4FSMA 3TDVA 3PA3A 1QPDA 4FT9A 5M56A 4A4OA 3FKOA 3GQIA 4KAOA 3ZO1A 3E8DA 4BN1A 3PJ1A 1BKXA 4FV1A 2RKUA 1RE8A 3U6HA 4KSQA 3TJDA 3DGKA 4UYAA 1JOWB 2XYNA 5FEQA 3AKJA 2VTAA 2XUUA 3CKXA 2JDTA 3MV5A 5HIBA 4PTGA 2UW8A 2BTRA 4U80A 1XMMA 3MW1A 3O8UA 4ZZNA 2OW3A 1REKA 3EQIA 4MEDA 5AR8A 2HY0A 2XF0A 4R7HA 3S2PA 4AW2A 3NMUF 2Z7SA 3MN3A 1M7QA 3WILA 1MQBA 4ALWA 2YIXA 3RP9A 3DK3A 2XK6A 3WYYA 3BLHA 2KULA 5IA1A 2XBJA 1DI9A 4OR5A 5FUTA 4AA4A 4YBJA 2HENA 4IWQA 2RG6A 3IKAA 4PPAA 4BWPA 5A9UA 2G9XA 4Y5HA 3HA8A 5EQEA 4NK9A 4XCUA 3DFAA 2XRUA 4WD5A 2FGIA 4F7SA 3H9RA 3L8SA 4HZRA 4U42A 2BAKA 4EHVA 3MIAA 4AXAA 4DG2E 4E73A 1H8FA 2YERA 4YJRA 2HXQA 5KE0A 4FE2A 4QMSA 4F9BA 4YZBA 3PRFA 1DI8A 4D55A 3WF8A 3UO4A 4DEBA 3ZUTA 4D2TA 1P4FA 4TL0A 2R3MA 3V5JA 5E92A 1OBDA 2IG7A 2QU5A 1Z5MA 5CNOA 2XK9A 4NFMA 4RX7A 4EH9A 3EQBA 1VZOA 3EQRA 3LXKA 3FL4A 4RIOA 1PW2A 5FQDC 4FKSA 3DB6A 2FVDA 3G15A 2UVXA 5JZNA 4UV0A 5EYKA 5HNGA 4XNEA 3SGCA 4WUAA 4BDEA 5IEVA 4FIGA 1JAMA 1OITA 1ZOEA 1H00A 4J8NA 2R9SA 3ORLA 4K11A 3PY3A 1YQJA 3FI2A 2YA9A 4JAJA 3QXPA 3R0TA 1UVRA 3GBZA 3W32A 3ZSGA 1WBOA 1GOLA 4UMQA 2CKOA 4L3PA 5KNJA 3ORIA 1PXLA 1UKHA 1PXOA 2WTWA 3FBVA 4EC8A 4AF3A 3LJ0A 3D7TA 4LMUA 3R7GA 4QTEA 2GCDA 5HQ0A 4QP8A 2CSNA 4FODA 1Y6AA 3GCSA 3LVPA 4U6RA 5C03A 3LXPA 3TT0A 3ZO4A 3EOCA 3R71A 3EYHA 4C58A 3JYAA 4R3CA 5BMSA 4P2KA 3N4VA 3PVUA 4FZAB 2CGWA 1DS5A 1JSUA 4BCIA 4UZHA 4RC2A 5JGDA 4L68A 4FZFB 5AV0A 2XYUA 2G2FA 4ZEGA 4AA5A 3Q2JA 3GU8A 5E8UA 1YOJA 4DEAA 3C5IA 4YJUA 3C13A 3EN6A 4PP9A 4ASZA 4EH7A 4BZNA 4TY1A 3JY0A 2QO2A 4GFOA 3G33A 3I1AA 4O7RA 3D94A 1I09A 4U9AA 3BHHA 3SVVA 4IX4A 5M55A 3HMMA 2VWYA 2Y4IB 3ZUVA 1OECA 1B38A 5DWRA 3L8PA 5CEKA 2HOGA 2QOOA 3UO6A 3WBLA 2C3JA 4I21A 4B8MA 2B55A 2OK1A 3BEAA 4F4PA 5A4CA 4WNOA 5LMAA 1LEWA 1XH4A 3ZXTA 3ZLSA 3QCYA 2ITQA 3WZKA 5CSPA 2C30A 4YP8A 4K6ZA 2B4SB 4HNIA 2ZM1A 4O96A 4TYEA 4C3RA 3BGPA 1FPUA 3Q4TA 3P7BA 5AR5A 4EL9A 2HZ0A 5H2UA 3OHTA 3UVPA 4JR7A 4KIOA 1UKIA 2Q0NA 3CC6A 1URCA 3CSVA 4XBUA 3V8SA 4EONA 1ST0A 4IX5A 3A4OX 4B8LA 4FV7A 5IA5A 3R83A 3R9NA 3IDCA 4ANNA 5CALA 4D0WA 4CTBA 3EFLA 2EVAA 2XIZA 3W10A 1JSVA 2R7BA 2IW6A 5DA3A 5HD4A 5EW8A 3AT3A 1G5SA 3KRJA 5CX9A 1KV2A 3EMGA 2ZB0A 3DB8A 2JITA 2BRBA 2YCQA 4HGSA 3GC0A 4J53A 4L3LA 5KUPA 4AUAA 2HWOA 3LMIA 4W4VA 4CMOA 2G1TA 4XG7A 5ETCA 4DH1A 5EDQA 5AUUA 5K9IA 5KX8A 4FOBA 4C59A 3LJ2A 3R7YA 3ZONA 3LIJA 2XNNA 4FTQA 2QD9A 2X7FA 2UZUE 3P0MA 4FC0A 2J0IA