4DG0E

Crystal structure of myristoylated wt catalytic subunit of camp-dependent protein kinase in complex with sp20 and amp-pnp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
338
Chain Sequence
SEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Role of N-terminal myristylation in the structure and regulation of cAMP-dependent protein kinase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 107
structure length 338
sequence length 341
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dg0E01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dg0E02
5LXMA 2F7EE 2GHGA 4DG0E 2XF0A 5FP5A 5BUJA 2F4JA 4JG6A 2QOOA 4I93A 4W8DA 4ACCA 2QO7A 3KXXA 4L42A 4EUTA 2W5AA 3O8TA 4RWLA 2J4ZA 5AP0A 3EL8A 3P08A 4YBJA 5CF4A 5CU3A 5J7HA 5GNKA 4XG2A 3ZHPC 2VUWA 3ZO3A 3ZZWA 4B4LA 4EORA 2BZIB 3CEKA 2X7OA 3PXFA 3ZUUA 4C4GA 3MA3A 3FI8A 2WQNA 2R3MA 4MXCA 4HGLA 4MNEA 3ZDIA 4FODA 4NCTA 2YM3A 5CS6A 2QG5A 1ZRZA 5LMBA 1PMNA 5M06A 3D15A 4LI5A 5HCZA 4BBFA 4C33A 3ZBXA 4FT7A 2HZIA 4GT4A 4MTAA 4XOYA 2JEDA 3VS6A 5HIEA 3NUSA 3FUPA 4C3PA 2ZVAA 4RVMA 4JL9A 4D4VA 2P0CA 4FG9A 2IO6A 3P1AA 5B0XA 4JT3A 3FXXA 3G9LX 3SDJA 4BZNA 4BFMA 1OGUA 4F0GA 3BQCA 3Q53A 3GGFA 2GNLA 5DMZA 3R9NA 3VW8A 3PWYA 1XBCA 4WG3A 3FSFA 3PVWA 4GSBA 4RX7A 5IEVA 3U6JA 4FKPA 4JBPA 2W1CA 2B4SB 2BPMA 1UNGA 4M0ZA 3LFBA 4MNEB 2PMNX 4KIOA 3DFAA 5DIAA 1YVJA 4XV2A 5F4NA 4OAVB 4UXLA 5AP3A 2QR8A 2ZV7A 3MI9A 4G6NA 4K33A 1PMVA 5D7VA 2VU3A 2ZJWA 3EQGA 3K3JA 2QOBA 4J52A 4TT7A 3DDQA 4CRSA 2E9NA 4EOLA 3L8PA 2Y4PA 2YCRA 3QQHA 3UPZA 3PA5A 1Y57A 2UW4A 4L44A 3ID6C 5EQPA 3UP2A 3UOLA 3MESA 2JAMA 4WIHA 5H8BA 5EDRA 5JT2A 4OAUC 3PWDA 3GOPA 1MRUA 3FZOA 3PE2A 3SC1A 3LAUA 3VBVA 4UZDA 3NUNA 1ZY5A 4F9YA 4FV7A 4YSJA 3MVJA 4Y83A 2ITQA 5TOZA 3BRBA 3FKOA 3R04A 4KIQA 4BDIA 4HNIA 2O8YA 5HE0A 1Q97A 3LJ0A 5I3RA 4EOPA 1F3MC 2YIWA 2ITZA 3CKXA 4RFMA 4YURA 4L3LA 4J7BA 3DTCA 4MBLA 3EN6A 5DI1A 1S9IA 5GIOE 4OTIA 5BVEA 5HESA 4AW0A 3GT8A 4IX6A 3SXRA 2PL0A 4YJQA 4RA5A 3R8UA 2HIWA 3OT8A 3C1XA 1U5RA 3OG7A 2XK8A 2WMQA 3DTWA 5I9UA 3DBDA 1UU8A 1Y6AA 4HW7A 4E3CA 4TRLA 4BGQA 4EBWA 4F9BA 4HYUA 3SRVA 2X7FA 5FQDC 5IDPA 3SVVA 4J1RA 2HOGA 4Q9SA 3RMFA 3QTSA 2I0YA 3M42A 3ZC5A 4I21A 4EHVA 3FZSA 4TWCA 1Z9XA 3I4BA 4ZAUA 2BDWA 2XJ1A 3MPMA 4I22A 2O2UA 3ZUVA 5JZJA 4KIPA 2WU7A 4LFIA 5I9VA 2YERA 4CMOA 2R3IA 4APCA 5K3YA 4C36A 1GZNA 4ZJJA 2WZJA 3IECA 4GFOA 5L2QA 4BDKA 4YJTA 3BKBA 3NZ0A 4X2FA 1LUFA 2V7OA 4IWOA 4YHJA 2W1FA 1FVTA 3RAWA 1Q4LA 1XH6A 4PY1A 2EUFB 1GIJA 3QA0A 5M44A 1FBNA 5AM7A 2WHBA 5T3QA 3DAJA 2YM5A 5EW9A 4ZSEA 4FA2A 5DYJA 4TNBA 5AFVA 1ZYCA 4IB1A 3I5ZA 4LOPA 2WKMA 3QL8A 3LMIA 4P2KA 2ZM4A 2V62A 4OBPA 3MA6A 4AZEA 4IVBA 3E7VA 3W18A 1SNXA 2YIQA 4R7IA 2R0UA 4FKGA 4NFNA 2ZMDA 3QF9A 3LFFA 3R71A 4OBQA 4YJVA 3SRVB 4O7RA 4Q2AA 4DGOA 3MVLA 3PSDA 4YPDA 4CCUA 5BYLA 1XH8A 4J98A 3GFEA 1JAMA 1SNUA 4QO9A 4QMOA 4G3DA 4QMWA 3HMPA 5F94A 1FGKA 3WZKA 1FMOE 4RJ7A 3W10A 5E7RA 3WBLA 4EOQA 2JGZA 2VNYA 3NUUA 4NJDA 3HGKA 4M97A 3Q4UA 4D55A 5AV0A 2CKOA 2ERKA 5AM6A 5CEMA 1WBTA 4ERKA 4CTBA 1K2PA 3BEGA 4IIRA 2Z7LA 4B0GA 2HZ0A 5H9BA 3TNHA 5HE1A 3UNJA 3A7JA 4CYJA 1RQQA 3HMMA 4ANSA 1J7LA 4BF2A 4AAAA 3SXFA 1UWHA 4FUXA 4ALUA 4EQMA 2GQRA 4L01A 4NT4A 4CKJA 4Z16A 2VTQA 2Y9QA 3KMWA 4F4PA 3AG9A 1NVSA 2FGIA 4YHTA 3CQEA 3QZGA 1UNLA 4QMSA 3ZH8A 5GINE 4F1MA 4Z7HA 1JKKA 2PMLX 3LIJA 1PXOA 2E9PA 3F5GA 3GCVA 3R1YA 4G3EA 4K2RA 5HE3A 3DOGA 4AWIA 3D5UA 2VNWA 4TTHB 5CQWA 3HP2A 1P2AA 1YXSA 4RIYA 4DH5A 4C34A 5J7BA 5M4CA 5A54A 5FLFA 2WTWA 5AUXA 3S00A 4O82A 1BLXA 5IUHA 4DTBA 3A62A 3QQLA 5CXHA 4N6ZA 4O7VA 4MF0A 5LQFA 3E62A 5JMSA 2ESMA 4FGBA 4UMQA 4JG8A 1O6YA 3M11A 4EK6A 4U81A 3IGGA 4BGGA 4C0TA 4C2WA 3VS5A 3EQFA 5E1EA 2R4BA 5FBOA 3ULIA 2VX3A 5GHVA 2UW9A 1JKLA 1ZLTA 2QHMA 2YDIA 1U5QA 2C4GA 3ROYA 1LR4A 2ITXA 3E88A 4FV4A 5IH4A 2R3KA 5AV4A 2FSTX 4KB8A 1F0QA 5M56A 3DGKA 5TO8A 2O0UA 2VTTA 3F3TA 3AGLA 3E63A 1A48A 3BHUA 2OU7A 4U8ZA 2E2BA 5CU2A 4DYMA 5JK3A 4AE6A 4FTMA 1PXIA 4YU2A 3ZM9A 2PVYA 2PUNA 4FT9A 4RIYB 3FMKA 4CRLA 4ZTLA 3HV3A 4PPCA 5KBRA 3AD6A 2ITNA 3PIZA 5M55A 2JIUA 3VF9A 2J6MA 3KMMA 5J87A 3ZEWA 4DINA 4WNOA 3D83A 1PYXA 2XKEA 3CR0A 2R3QA 3PLSA 3GQIA 4TYGA 5GJGA 5HGIA 3CTJA 2XNNA 1YXVA 4I0SA 2ZV9A 5B2LA 2CGUA 4QOXA 3HEGA 2HZ4A 4HOKA 4LOQA 2XB7A 1OIQA 3R28A 4FTIA 4XG8A 5IQCA 1FPUA 5CVFA 2X2LA 5M4IA 4JAIA 4GEOA 5DT3A 3C5IA 3TM0A 4LOOA 3QZFA 5HO7A 3FMDA 3ZMMA 4G31A 4C57A 4MD8E 3P86A 4D2SA 4DEEA 2Y4IC 4MXOA 3OUKA 4PTCA 3UMWA 3TUDA 4XV9A 3WZUA 3DQXA 4G1WA 4MQ1A 4XUFA 3D5VA 3D5XA 5C27A 3NLBA 3PSBA 4E4NA 4BDAA 2QLQA 5KMKA 3UIUA 3F3WA 4P5QA 4BWPA 4EJ7A 3QX2A 3HV4A 2RF9A 4C35A 3FBVA 4RVKA 3PRIA 3PJ8A 4L45A 2WQBA 1V0PA 3AC5A 1Y8GA 3BI6A 3MH1A 1OZ1A 4O96A 4XRJA 4J71A 4FEWA 1JPAA 4PL4A 2JDRA 4IW0A 2XM8A 3DA6A 4H3BA 3ZXZA 5LMKC 4C4HA 3R9DA 2C69A 4KWPA 2XUUA 3H10A 2NRYA 3P7BA 4UN0C 3TNQB 2OZAA 2YCQA 4LG4A 2GQSA 4M67A 2PULA 3NW6A 3WF9A 4CD0A 3F61A 3GCSA 4EI4A 3KXHA 2WMXA 1L8TA 3FDNA 2UW6A 3OOMA 4QQCA 3II5A 3A60A 3MV5A 2C1BA 2HY0A 4HCUA 4JJRA 2WTIA 3C50A 3QCQA 4GIHA 4O0WA 4RX5A 2WAJA 4OTWA 1B38A 1WVYA 4ASXA 4DFBA 3OY1A 3UO6A 3CC6A 5LVLA 3F3ZA 1OBGA 4XRLA 3V04A 3OUNB 1PMEA 4ZZOA 3HV5A 3FZTA 4LGHA 4CG9A 2ZDTA 4F63A 3W2SA 4I1ZA 3KQ7A 3FLNC 3NIEA 3QQGA 4I3ZA 4Y72A 2OXYA 2XK9A 4D1SA 5BPYA 5IUIA 3RHXA 2VGPA 1E9HA 4JLCA 3BE2A 3Q04A 2CLXA 4N70A 4O2ZA 4CTCA 2C68A 3OFMA 4TXCA 2UZWE 2OZAB 3FXZA 1JLUE 2YJSA 3T8OA 5IDNA 3SHEA 1QPCA 4BRXA 2BRHA 3CCNA 3Q6UA 4EBVA 2UZUE 3G15A 3EQDA 2X4FA 4IDVA 4JNWA 5EYMA 3ZFMA 4F7SA 5A4TA 3SA0A 5HG9A 3TJDA 1M17A 3LLTA 3QAME 3QUDA 4X3JA 3LCOA 1OKWA 2F49A 3PRFA 3HDMA 3FE3A 4DC2A 3IW8A 3F9NA 4G3GA 4YLKA 4HVGA 1E1XA 3R1NA 4HPTE 4U0IA 3G6HA 3ZUTA 2JFMA 4OTDA 5C01A 3MIYA 1U59A 2WOUA 5TR6A 4BCFA 1ZYJA 4GS6A 4B7TA 3QX4A 3WYXA 2OJIA 3RBWA 4USEA 4FBXA 4R77A 4G9CA 3Q32A 2YAAA 2QOHA 4MF1A 4M13A 4OLIA 5L3AA 1STCE 1PJKA 2IZRA 3DKOA 2W7XA 3OBGA 4O0XA 4MAOA 3U87A 2W17A 5LOHA 5C03A 3W8QA 3QC4A 4WSQA 4JDHA 5A4QA 3PY0A 2FVDA 3EH9A 3ZYAA 4TYEA 3TEIA 3G51A 2BHEA 1WBPA 3V8SA 3OW4A 2A27A 2RIOA 3OXIA 3KK8A 4DEHA 2J90A 2CJMA 3HA8A 3GI3A 4QQ5A 2HAKA 2X2KA 4IM0A 4PTEA 3AC2A 5ETAA 3A7IA 4AF3A 4K11A 5TF9A 4L3JA 1YHVA 3TCPA 2AUHA 2XM9A 3AOXA 5FBNC 3SV0A 2I0EA 3JY9A 3LW0A 4AOTA 4BN1A 5DRDA 4EUUA 2IJMA 4KSPA 2Y0AA 2PUPA 4FZFB 2UZNA 2ITYA 3O71A 3LFSA 2CNVA 2XNBA 1ZARA 4WNKA 3RZBA 4DEAA 3SG8A 5LARA 1XH9A 5CT7A 3UPXA 4DCAA 3LFAA 3DB6A 3SXSA 3ZFYA 1H00A 1YQJA 4DBXA 2WGJA 3L8VA 3KXMA 1W84A 3QFVA 5EK7A 3DQWA 5CNNA 4MWHA 3V5PA 3RALA 4JQEA 5AX3A 3HECA 1IRKA 4QT1A 3ENMA 1WAKA 2RFDA 3PXRA 2FO0A 1CSNA 2OICA 2WQMA 3C4WA 2G1TA 3OROA 4AA0A 4E4MA 4E93A 2XEZA 4KABA 4IM3A 3WF7A 3WF6A 1M14A 2IN6A 4OTHA 4U7ZA 3WOWA 1YXUA 2YN8A 3R8ZA 3QUPA 2ZM1A 4FX3A 4AZTA 3FI2A 3H0YA 4IAFA 2WMSA 3C4EA 3F88A 4YZBA 1H01A 4FZAB 4Y85A 2UVYA 4I6BA 1DS5A 2KTYA 5ANJA 4TWOA 4EZ3A 2YLFA 3UE4A 3RK9A 4FYOA 3W2CA 4E26A 5AV3A 4FTRA 4QPAA 4EH8A 3V6SA 5LVNA 3QRKA 2H6DA 3COMA 3DKGA 4G2FA 2OIBA 4KD1A 4XCUA 4ZJIA 1CDKA 3BZ3A 2ETMA 3R9HA 3I1AA 5JH6A 4FKVA 2OG8A 2NO3A 4H05A 2FA2A 3R8PA 2O3PA 3I60A 4FV9A 5EKOA 5K9IA 5HOAA 4AZWA 1I44A 2F9GA 3R2BA 1ZMVA 4BI1A 3R8MA 2XJ0A 3R7UA 4RWIA 4QD6A 3DBFA 4GG5A 4ZSAA 2XMYA 4MBIA 2BAJA 5GZ8A 1XR1A 1PXJA 1Q24A 5CEPA 5FRIA 3F7WA 4OT5A 3AMBA 2WMWA 2XEYA 4EH7A 3QKMA 4RC4A 4WOVA 2YM7A 4I23A 4HVSA 4PNKA 1ZY4A 5CNOA 5IA4A 2XIZA 4PMPA 5HBJA 3TIZA 2VTIA 3L9LA 3P7CA 4CQEA 3NUXA 4D0WA 2YACA 3UDBA 3OF0A 5IPJA 4BYIA 2YHVA 5HO6A 4FTUA 1H26A 4NIFA 2C3IB 4NKAA 4S2ZA 5ETIA 3TKUA 5FXQA 4OT6A 2IPXA 3V5TA 5EOBA 2XCKA 5CU0A 3P78A 2XKFA 4AN9A 4XG3A 2W1ZA 2UZVA 5LWNA 2YIXA 4LUEA 2JKMA 2C6LA 4GK2A 5AR8A 3DK3A 5IA1A 4S34A 4UB7A 2YDKA 4DG3E 1KV1A 3K54A 4X6RA 1M7QA 1VJYA 2WTKC 3OCTA 1TVOA 5AA9A 5L2WA 3I6UA 3OBJA 5E90A 2YITA 3NIZA 5EHOA 3FKLA 1Q61A 3E8CA 4FK6A 5HO8A 4X3FA 2BROA 1H27A 3LE6A 4YJOA 3ATSA 1JQHA 4ZXTA 1ZMWA 3OCGA 2YDJA 3AC1A 4PL3A 5IQAA 2DWBA 5BNJA 5CEOA 2R3GA 3SKCA 4NW5A 1KE5A 5IU2A 3AT4A 4NIFB 1QPEA 1R1WA 3FV8A 4FSNA 3V6RA 2BDFA 4CNHA 4EONA 1KE9A 3QLFA 4AW1A 2PSQA 4EOIA 5CAVA 5C1QB 3VO3A 3U51A 5AUYA 4AW2A 1XJDA 3TZ7A 1T45A 2OF4A 2V55A 2FUMA 4IXPA 4TKSA 4BDFA 2VWIA 4EH2A 4ZY5A 5BVFA 3ATTA 4IQ6A 5C8MA 3NYOA 3VQUA 4ID7A 5CASA 3LMHA 2HXLA 4FNZA 3A7HA 3U6IA 3BV2A 5IQIA 4DGNA 3G2FA 4JBQA 2OXXA 4WNPA 4ITHA 4C62A 2GDOA 3U55A 2C0IA 3MS9A 4AGWA 2J2IB 3TDVA 3AMAA 2H34A 4UWYA 4X3FB 4GYGA 1JOWB 3BWJA 3DBQA 4U5JA 4YC8A 4E20A 4F7NA 3G9NA 4BL1A 3JS2A 3UMXA 3A8WA 2X6DA 3KXGA 4CLIA 3A7FA 4XBRA 4HVHA 5D11A 4DFXE 3C5UA 5FDXA 2C5VA 4AQCA 3VBQA 3GNIB 3MY0A 4A9YA 2W0JA 3NMUF 4JDJA 3O8PA 4IX4A 1R39A 2VV9A 3AT2A 3CBLA 3H9RA 4KSQA 4RVLA 4USDA 4ENYA 5CAOA 5HLNA 4R3PA 3VBYA 4QMNA 1I09A 4IB0A 4Q5EA 5DEWA 4FC0A 2ONLA 2XH5A 4RA4A 4JBOA 3ZBFA 2GNHA 2XRUA 3ANQA 4QMVA 5M51A 4F9AA 2WMRA 3UZTA 3NAYA 2XYNA 3FPMA 3FMLA 2B52A 4O7WA 4MH7A 5A4LA 5KMJA 4AFJA 2CHLA 4GV1A 5HEZA 5L6WL 5CQUA 3LHJA 3PIYA 5ACKA 3JR1A 4G16A 1AD5A 2NP8A 1OPJA 3LFNA 3R8VA 3UZRA 4LRKA 4W4YA 5A46A 3PVGA 3EQCA 5HX8A 4LMNA 4JDKA 5ANGA 4RJ5A 3GUBA 1BMKA 4H39A 3KEXA 5M08A 4FT5A 4NJ3A 3UJGA 2OH0E 4K1BA 4U79A 4ZTRA 4XG9A 4DTKA 1K9AA 4X2NA 5IKWA 5EDPA 5CEIA 4I4EA 2YA9A 2BRBA 1KWPA 4I5HA 4BZOA 4D58A 4ZLOA 4FKTA 3PJ1A 4DH1A 3FZPA 3PIXA 4GFMA 1Q99A 2Z8CA 3IG7A 3Q3BA 4NYEA 1WBWA 4KIKA 4XV1A 4PV0A 2PZIA 2YEXA 3JY0A 4QMTA 2C5NA 3TL8A 3NDMA 2EVAA 3VQHA 4ANNA 5A14A 2PZPA 2V0DA 3QD3A 3P4KA 3QZIA 5E9EA 4YO6A 4PWNA 5ETFA 3TZMA 5DOSA 5J9YA 4KUJA 3COHA 1NW1A 4YSMA 4MXXA 5DPVA 1OMWA 3CSVA 4N4SA 3TV4A 2F7ZE 4YJUA 3KRWA 3FYJX 2WMTA 3GBZA 2XRWA 4JQ8A 5DR9A 4D0XA 1CKJA 2JDVA 3C4CA 3NCGA 4N0SA 4UMUA 4DCEA 2OK1A 2XK4A 2R3HA 2XK7A 4FKWA 4JXFA 1M2RA 2WMAA 4QPSA 5I4NA 4GUBA 4L7FA 4YTHA 1FINA 4FYNA 3VC4A 4O81A 3OTUA 5HLPA 4FOCA 1VYWA 4KIKB 4RX8A 3EQRA 4U41A 5EG3A 1DAWA 1BX6A 2VTPA 3QKKA 5EM8A 5GZ9A 4XG7A 5BMMA 3S3IA 4JIAA 3JVSA 3L9PA 5HG8A 1GAGA 3A99A 2JDSA 4IWPA 3V3VA 1ATPE 4R8QA 4P90A 2UZEA 5EDQA 1QCFA 2C6IA 2QOLA 3M1SA 3OOGA 4TN6A 3TACA 3A4PA 2IWIA 4ZSJA 1P4FA 5EHYA 1LEWA 2BZKB 4FZ7A 3ZTXA 1CTPE 5FGKA 5IEYA 1OIRA 4NL0A 4BCMA 4JR7A 2QNJA 4WRSA 2QVSE 3CP9A 4XP2A 3AMYA 2QU6A 3ZSHA 4FZ6A 2NPQA 5BVDA 1OL6A 3QQFA 3LFEA 4CYIA 1SYKA 5DN3A 2RGPA 1ZMUA 2QU5A 5HTIA 2IVTA 2XA4A 1OKYA 4DH3A 3OTVA 1PF8A 4IAZA 4O83A 1MUOA 2BRGA 2HELA 4FSRA 1GZKA 5CEQA 4AXAA 2PUIA 2HENA 3RPYA 2CN8A 1LPUA 2X4ZA 4Z3VA 4J53A 2RKUA 3EQIA 4MNFA 2BTSA 4L52A 3ET7A 3AD4A 3DDPA 4JRNA 4W4XA 3TWJA 4WHZA 1SMHA 2HWOA 4DGGA 2WOTA 1BL6A 2UW8A 2YAKA 3GCQA 3ANRA 3I7BA 2DQ7X 3NNVA 3OCBA 4QMYA 5CT0A 4U43A 2XIKA 2PMIA 2BRNA 2OSCA 3HRBA 4QYHA 2ERZE 3ZSGA 1X8BA 2VGOA 3HA6A 4X7QA 4I6HA 4FEXA 5FTGA 4JS8A 3MPTA 3RCDA 1RW8A 3ZSIA 1SVGA 3SOCA 1B39A 3R1QA 2YJRA 3VS4A 2OH4A 1OPKA 3P23A 4AFEA 2OJGA 3PY1A 2VWVA 3GCPA 4NM3A 3TG1A 2C5XA 4LQMA 4ZLYA 1ZYDA 5BVWA 5TKDA 3ZO1A 3JYAA 3QTUA 4FL2A 4O0VA 3SQQA 1UVRA 2BAQA 2XNMA 4AP7A 4IM2A 3DPKA 4L43A 4EOMA 1Q8WA 1UU7A 3DY7A 2C6EA 4RBLA 3O51A 5CLPA 5HG7A 3RAKA 2WTJA 1V0BA 3VUDA 4UZHA 4HYSA 3VIDA 5AUUA 4ANMA 2W1GA 3VWAA 4K9YA 3MB6A 1PW2A 3NNUA 2FYSA 3TXOA 4IAYA 4BHZA 2WFYA 4BCIA 5AUWA 5CXZA 4AS0A 3C0IA 4RMZA 3MY5A 4YZ9A 3COKA 3K3IA 3CY3A 3RNIA 4C3RA 2ZM3A 4DEGA 4QP7A 4GK3A 4II5A 2GS2A 2R3OA 2XK6A 4BCGA 2VAGA 4XNEA 4O0YA 2B9HA 3QWKA 4BDCA 3OXTA 4FIFA 4FMQA 4HGTA 4LGDA 2PVFA 5IA3A 4O7NA 3MH0A 3BYSA 3V8WA 1AQ1A 1APME 4Y46A 2PE1A 3KGAA 3MW1A 4IACA 4CQGA 2ZOQA 1Q8UA 3KRRA 4YNOA 1XHAA 4MD7E 4GRBA 4C37A 3TN8A 5L8KA 4CGAA 2R7IA 4DTAA 2QR7A 4O7YA 3RPVA 3UOJA 3BE9A 4G9RA 4GG7A 4GIIA 5C4KA 1CKIA 4ZSGA 4PP7A 2B55A 3DU8A 3NSZA 4IEBA 4O38A 5K0XA 3UNKA 5FTOA 1G8SA 1PKGA 3W32A 4B99A 3HV7A 3ZRLA 1J1BA 2RG5A 2OXDA 2VTJA 5IQHA 2EWAA 4TWNA 5C8NA 3TJCA 2BKKA 4EQCA 4A4OA 4BHNA 4L7SA 5CI7A 4YJRA 3DT1A 1YI3A 1PMUA 4I20A 5J5TA 4BC6A 4DT8A 5EYDA 2JBPA 4BGHA 4D4YA 3AXWA 1FVVA 3AC4A 3F2RA 5IQGA 4JI9A 5CSXA 4AT4A 5L4QA 4F0FA 5D12A 1UU9A 4QP8A 3QXPA 2IZTA 5IQEA 4G6LA 4I94A 3ZRKA 3W33A 1OPLA 5K4JA 3ZXTA 3UQCA 2QHNA 2XNPA 4BDBA 3ERKA 4O22A 5D41A 2RFEA 2WPAA 3BYMA 2A0CX 1OUYA 4IFGA 2O64A 3ALOA 4K77A 3DJ6A 2PZ5A 2OJJA 4C4EA 1XWSA 1R78A 2IW9A 3LCTA 5FP6A 3EMGA 2OFUA 4MWIA 3BBTB 1ZOGA 1RDQE 4QTAA 3TNWA 2EU9A 3QGYA 5ANDA 5EM5A 3VBXA 3Q5IA 3RI1A 4R7BA 3CPBA 1YHSA 4IZ7A 3O50A 4PPAA 3ALNA 3KFAA 3Q6WA 4UMTA 3VBWA 3VS1A 4BVUA 4LUDA 1W7HA 5L2TA 4F1OA 4YGAA 2B1PA 3FAAA 5F1ZA 4EWQA 3U9NA 1ZXEA 4ACGA 4ZZMA 4MX9A 3TZ8A 4DA5A 1UV5A 4V0GA 3CQWA 2B53A 2BCJA 4A7CA 4D1ZA 4C58A 1GZOA 3HX4A 1MRVA 4FVRA 4QP4A 4F6WA 2PVHA 2BZHB 4ACMA 4FSQA 3ZCLA 4D2VA 3GQLA 1L3RE 5EM6A 4ZK5A 4EHGA 4Y8DA 2C6DA 3PFQA 5IMXA 2B9JA 1R3CA 2YZAA 3R9OA 3W1FA 4U97A 2PE2A 4XMOA 2WD1A 5HBHA 1Z57A 3TTJA 2QQ7A 3KRLA 5FD2A 4TY1A 3LQ8A 4C7TA 4GKHA 3Q2MA 2R3RA 1YHWA 3DXNA 2JC6A 2HW7A 3NX8A 4CFNA 2VTAA 4FZDB 3MJ1A 5FEDA 2R9SA 4E73A 1URWA 3A8XA 4K6ZA 3EHAA 5HNIX 4XBUA 4D9UA 4WBBB 4DEBA 3G90X 4GCJA 4AU8A 5ETCA 1XBBA 3QD0A 1WBOA 3ORZA 3QYWA 4NH1A 2H96A 1DI9A 4MVFA 5FM2A 5CVHA 2VRXA 1A06A 4TL0A 5M07A 3VN9A 3D5WA 5CVGA 4M66A 3PLAE 4QMZA 3RWPA 4AGDA 4FICA 5H2UA 4BCPA 1H1PA 4V0GB 3H9OA 3GCUA 2AC3A 4QQTA 1LEZA 2XNEA 2Y8OA 1H0VA 1R0PA 2FSMX 3IDCA 2XYUA 4AOJA 4DG2E 2YLEA 2YWVA 2QKWB 1O6KA 4O0TA 3HAVA 4O2PA 4QNYA 3LFDA 2BHHA 2CDZA 4J99A 3CJFA 5DR6A 5AV2A 3RTPA 4IZYA 3HNGA 2KULA 2Z60A 4DEDA 3RZFA 2RG6A 3R21A 4HYIA 2C6MA 2VO0A 3BU5A 5HVJA 1TQIA 4UWBA 5FWKK 3UBDA 5DVRA 4A07A 3ETAA 2I0VA 3R7GA 4PL5A 1ZZ2A 2X39A 3MN3A 3UQGA 4C02A 3QCXA 3QA8A 4K8AA 5I9YA 4H1JA 4YMJA 4EH9A 3TNPC 1CM8A 4TYHA 2JBOA 3L9NA 4R5YA 4GJ2A 3QRJA 5E91A 3RWQA 4ALWA 1Q5KA 3KCKA 3DXPA 2UUEA 5CI6A 3PA3A 2ETKA 3CD8A 5KCVA 5GZAA 3DJ5A 2CGWA 4ZIMA 1H8FA 3TZ9A 5IQFA 3F3VA 4Y73A 4BCKA 4PMMA 4MBJA 4ZP5A 4EK4A 3FHIA 1H1QA 5ANIA 2XJ2A 3O0GA 3ORLA 3AD5A 4S32A 1QPDA 3I81A 2PTKA 1YOMA 4W8EA 4YZNA 5CYIA 4BI2A 4FNXA 4CZTA 4CLJA 5HZNA 3WF5A 2HZNA 3BGPA 4KKHA 5J8IA 4B6LA 3KRXA 4CT2A 2XBAA 3KKVA 1HCKA 3BLQA 4TW9A 3T3UA 3E92A 2X2MA 2ETRA 3PG1A 4XLVA 1Q62A 5HICA 4F64A 4ARKA 1J1CA 2QCSA 4GU6A 5IQBA 2PHKA 2OLCA 4TYHB 4BIDA 3MTLA 3HKOA 3CXWA 2QD9A 1JVPP 4YJSA 4L68A 4CXAA 4BKZA 4FG7A 4FNYA 3RVGA 4E6DA 2GU8A 4FG8A 5CU4A 1J7UA 1GIHA 4BICA 3EZVA 4O0SA 1Q41A 4IAAA 5M53A 4FEQA 3R2YA 5TT7A 3MH2A 4D2RA 2JLDA 4R7HA 1VYZA 4P4CA 3SAYA 4ASDA 3UG2A 5ACBC 3R7EA 2VD5A 1MQ4A 4TYJA 4M69A 4EH3A 3KCFA 3G33A 4UV0A 2Z2WA 4UWCA 2ZB0A 3H3CA 3IW6A 4FKJA 3QTQA 4RQKA 3ZC6A 1TQMA 4G34A 2WEIA 3IS5A 3LKMA 4LV8A 2GSFA 4IH8A 4FKIA 2ZAZA 5BYZA 3UVRA 2F7XE 2ITPA 4FTTA 5JFVA 1JNKA 2V7AA 3PA4A 3GB2A 5E8UA 4QP2A 5HCYA 5L8JA 4XG6A 4XS2A 4RWJA 3AC8A 4HVIA 3S2PA 3C7QA 5EW8A 3TV6A 3I7CA 3DJ7A 2JKOA 1H4LA 3BLHA 4F6SA 4O6EA 4I5MA 4YJPA 4F08A 5CAUA 3A7GA 4NTSA 2PYWA 4C4IA 2E9UA 2BDJA 2J50A 5K5XA 3V8TA 4RQVA 3OEZA 4WO5A 3EOCA 4WUNA 5HIDA 5KMNA 4IZ5A 4M69B 4E6QA 5GJFA 2Y6MA 4L67A 5DG5A 3TUBA 3VULA 1MP8A 2BILB 5EKNA 4EH5A 2W9FB 1P14A 2Z7SA 3PP0A 4I6FA 5A4CA 3UYTA 4X2JA 5C9CA 3EQPA 1OI9A 2J5EA 3R83A 3R7YA 1M2QA 1YI4A 3QZHA 2J0MB 2BTRA 4IAKA 4Y5QA 4HVDA 1SVHA 2UZBA 2QOQA 3FQHA 3QQJA 4IC8A 4K0YA 3L1SA 4RJ8A 3WF8A 5DBXA 5AEPA 4FIHA 2G2IA 4L8MA 2VTRA 3C51A 4BZDA 3LCKA 4ONAA 3KF7A 3ORTA 1UNHA 2G2HA 4O86A 2VTLA 4WT6A 4C59A 4FNWA 4RJ6A 2PVJA 3O96A 4XYFA 1TQPA 4DGLC 1Y6BA 3M2WA 5D7AA 3R7OA 3K2LA 2F57A 2QOKA 3SG9A 1H28A 3MH3A 4QQJA 2BAKA 3ZRMA 3ELJA 2YIYA 2JDOA 2UZTA 1FVRA 2UVXA 2R3PA 5I0BA 3UP7A 5LMKA 5HBEA 4JIKA 4W4WA 5E8VA 4QYYA 3PY3A 5E8SA 2W5HA 4D2TA 1Y91A 4L53A 5D1JA 5J1WA 3VVHA 4MKCA 2XNGA 3R63A 3QBNA 3IGOA 4C2VA 4NUSA 3LLAA 4JRVA 4A9RA 1MQBA 3D2IA 4FTQA 3GP0A 4AW5A 3A61A 2JKQA 3EIDA 4R78A 2WELA 1QMZA 5M09A 3DAEA 5CAQA 2Y4IB 4D2WA 3E8NA 3OXZA 2QOFA 4U6RA 3FLWA 3IPHA 4WNMA 3NUYA 4EHZA 2X8IA 2XVDA 3UQFA 4UX9A 2C3KA 4FTLA 4KNBA 2R3FA 4UYAA 3UNZA 3ORMA 5JFWA 3D4QA 4O7LA 5KMLA 5HTBA 4L3PA 3VUMA 3BYUA 4YO4A 1REKA 3VUGA 5A6NA 1T46A 4CKRA 3WIGA 4KA3A 3IW5A 2CPKE 3ACKA 3P7AA 4AE9A 3OS3A 4FEUA 2DYLA 5AIKA 2LAVA 2PK9A 2GHLA 3VS7A 5AADA 3D7ZA 4FTCA 4QMPA 2Z7RA 4CT1A 5HU3A 1UWJA 2CNQA 4DFZE 4F9WA 5CF5A 4IANA 1OVEA 3EJ1A 5AP4A 3RK5A 3ZU7A 4DH7A 5K4IA 5JFXA 5KO1A 4XOZA 5KZIA 2QO9A 4BDEA 3KN5A 2UZDA 2A19B 4KS7A 4M7IA 3ZS5A 2OJ9A 3D94A 5HORA 4UY9A 1ZAOA 3FL5A 3SW7A 4IX3A 4O0UA 2B0QA 2W96B 2F2UA 1PXLA 5DEYA 1OB3A 3BHVA 3VF8A 4CFUA 4LM5A 4X2KA 3BGZA 2YM8A 2W1HA 1BI8A 5KKRC 2BKZA 2R3JA 3ZLXA 5JQ5A 1LP4A 4J97A 5DLSA 4O84A 2YABA 1WBVA 3EYHA 4QNAA 5DH3A 3JVRA 3NNXA 2OZOA 3ORXA 3ZFXA 4JVGA 4I5PA 3MVMA 4ALVA 3LOKA 3DZOA 5BVOA 4BDHA 1PXNA 3HRCA 5BYYA 3PJ2A 4ZSLA 4R5SA 3EN4A 3DK7A 5CX9A 1KE7A 3ZO4A 3L8SA 1H1WA 3MFRA 1BI7A 4IHPA 4ZEGA 4MHAA 1NVQA 3EFLA 5GIPE 3GC0A 2VWXA 1M7NA 4S33A 5JSMA 4FTJA 2FB8A 4GL9A 4Y5HA 4E4XA 1JSTA 1TKIA 4HCVA 2CNUA 4Z9LA 4NW6A 5IUGA 5JRQA 3HLLA 5B2MA 3TDWA 2EXEA 3ITZA 2ACXA 5LMAA 4BB4A 2CKEA 2NRUA 1DAYA 3N51A 2J5FA 4M15A 4M8TA 4RZVA 5CANA 3HMOA 4U3YA 4EEVA 3CIKA 1IAHA 3DCVA 4DF3A 3IDPA 2GNGA 5E8ZA 3VW6A 2XKDA 4HCTA 4GFGA 4EK3A 3ODYX 2YISA 5EQYA 1GOLA 4EOSA 1YWNA 1Q3WA 2GNIA 2GFCA 2F2CB 4ANQA 5AR3A 4YUQA 5AR7A 3T9IA 4DEIA 3EQBA 3HP5A 2O63A 2Q0NA 5J1VA 3UIXA 3RP9A 5HNGA 4XG4A 2R3NA 1V1KA 3E8DA 4FUYA 4S31A 3F5PA 2Y7JA 3OVVA 3TTIA 4DN5A 4ANOA 3UODA 3NVKI 3AGMA 2JFLA 2OI4X 4GVAA 2R64A 2UW0A 4QTEA 5IEXA 2VX0A 2BMCA 4NEUA 4FIEA 3LCDA 4OUCA 2C3JA 2C5OA 4DLIA 1SM2A 2QODA 4NCTC 1OUKA 1IR3A 2XZSA 2A1AB 1H1RA 1JWHA 3S0OA 2ITTA 4XX9A 4YZMA 1ZZLA 1WVXA 5HHWA 4EKLA 3HV6A 1W8CA 2FH9A 1OKZA 3QQUA 4RJ3A 3WE4A 3OT3A 3LQ3A 1P4OA 4QYGA 3IW4A 1BKXA 2OF2A 4I92A 3D2KA 2HW6A 4H58A 4L9IA 2CN5A 2YM4A 1R0EA 3LVPA 3OP5A 3IW7A 4FL3A 4PPBA 4BBMA 4N57A 4FV5A 1G5SA 3QCSA 4MXZA 1YXXA 4CKIA 4IAIA 4ZS4A 5IZFA 4YC3A 3RAIA 3DK6A 2FSOX 3D7TA 1OIUA 3BHYA 1CMKE 1PXMA 2VO6A 4CMTA 3E3BX 3VRYA 2Y6OA 3UOKA 2X8DA 2E9VA 2WQOA 2UZOA 4H3QA 2R0IA 5E8YA 3CLYA 4JQ7A 4CFWA 3MWUA 1FQ1B 1KE8A 4HJOA 4XEYA 3DZQA 4BCNA 3GVUA 4O7TA 5KHXA 4LMUA 4IDTA 3P5KA 5KMOA 4PQNA 1VR2A 3W2RA 3EN9A 2GQGA 2HK5A 2QC6A 3FLZA 4LL0A 4EC9A 4O7ZA 2J0IA 5CY3A 5E8XA 3I6WA 4ZOGA 1OL7A 1IA9A 3N4UA 3VS2A 4MXAA 4FK3A 4RIXA 2CLQA 3F69A 1UKHA 4PDPA 1EH4A 4F1TA 4AA4A 2ZDUA 2ZB1A 3GFWA 4YLJA 4DITA 4LRMA 4BIEA 4F7LA 3KK9A 2GTNA 4FOBA 4DBNA 5M57A 4OTGA 4H1MA 5HVKA 4FV8A 4GK4A 2W5BA 3QGWA 4DT9A 5EI6A 3WZDA 3D7TB 4ANBA 5K5NA 5CENA 2IVUA 1W0XC 3PUPA 2JIVA 3WYYA 3LPBA 4PDSA 4M3QA 3DXQA 2BALA 2GS7A 3FL4A 3DKCA 2YCSA 4GVJA 4PF4A 2QLUA 1H07A 3I0QA 4O7SA 4ZY4A 3FHRA 1Q8TA 2Q83A 1GZ8A 5IA0A 2EB2A 1CKPA 2WTCA 3MB7A 2J7TA 4RLLA 5EFQA 2B7AA 2CCIA 1OECA 2ITWA 4IJPA 1SVEA 2ZYBA 4W4VA 3ODZX 3Q4CA 4M14A 4O91A 1IAJA 3DKFA 1U54A 2DUVA 5IH5A 4NFMA 4RIXB 4KKGA 1F5QA 1KOAA 4NTTA 2I1MA 2UW7A 4FR4A 1ZOHA 3R1SA 4EWHA 2EXCX 5AP5A 4ORKA 4FV2A 5AMNA 5FM3A 1FOTA 2WQEA 2J0KA 4YPSA 4U3ZA 3FQEA 3CPCA 1BUHA 4I5CA 4DAWA 4F09A 4GJ3A 5CSPA 3BU3A 4O6LA 2QOIA 3TIYA 4FV0A 3REPA 3H30A 3D14A 3LM0A 5DNRA 3TNIA 5F9EA 3JXWA 2WTKB 4P7EA 4PMTA 4BTMA 5KHWA 3O23A 3BYVA 2OWBA 5ANKA 2CCHA 2O65A 1KV2A 4LRJA 2QKRA 4UALA 5J95A 5KZ0A 3W2PA 4AT5A 4WKQA 3C0HA 5HI2A 2BFYA 2JIIA 3R73A 4NZWB 2QO2A 3SLSA 4BCQA 3VJOA 5J5SA 4PNIA 2OJFE 3FY0A 3TT0A 5M4UA 5L6PA 1U54B 3POZA 3FY2A 3GC7A 4BCOA 3HUCA 3ZONA 5AP1A 5BUIA 3GU8A 4EOJA 5LVMA 5HNBA 2C0OA 3OZ6A 4O27B 2H8HA 5DT4A 3FC2A 3OHTA 1XO2B 2WIHA 3QTRA 3K5UA 4CG8A 2J0JA 5HLWA 3F5XA 4PRJA 3PZEA 3C4FA 4RG0A 3QRTA 3K5VA 4M68A 4BWKA 4BWXA 2J9MA 4Q5HA 4R1VA 1UKIA 1JBPE 3MSSA 5A4EA 4JAJA 3U4WA 5IF1A 1Y8YA 1OKVA 4EL9A 2JITA 4PP9A 5E8WA 4QTCA 5DHJA 5JGBA 5IQDA 3QHRA 4RFZA 4G6OA 4QP3A 5D10A 4YHFA 3F2AA 4MQ2A 2OBJA 3Q52A 5CWZA 1DI8A 2XBJA 3B2WA 3Q4TA 4FV1A 2B9FA 4X2GA 4YLLA 3QXOA 2CGXA 5ICPA 1PHKA 5HKMA 3QTXA 5DFPA 2OO8X 3Q4ZA 4FKRA 1OL1A 4QMQA 5BUEA 2VTMA 2WMUA 5FXSA 4ZLZA 4D4SA 5CZHA 1QPJA 4E4LA 4FTAA 1KSWA 5LWMA 1Z5MA 3BX5A 4FEVA 3NS9A 5CSWA 3BHTA 4Q9ZA 3P79A 4IB3A 2PVRA 3BBWA 2C5YA 4ZTSA 3BU6A 3WILA 3WZJA 5B7VA 2VTNA 5DA3A 4V04A 1H24A 2XNOA 4NWMA 1PRYA 5L8LA 2BUJA 3PDTA 2WNTA 3E3PA 3HDNA 4RFYA 3W2OA 3PJCA 1A9UA 2UW5A 4BR3A 3FPQA 4FVPA 4DHFA 5CZIA 3RJCA 5DE2A 3PXYA 3QUEA 4O0RA 2P55A 2OKRA 2RFSA 1Q8YA 2R3LA 5K0KA 4CFXA 3GU6A 2IZUA 1NA7A 1WBSA 4KS8A 4XP0A 1Q3DA 4AA5A 1E1VA 4AOIA 2GTMA 4QMMA 2WMVA 5KBQA 2IVSA 2R7BA 1GJOA 4PDOA 4C61A 3ENHA 5CAPA 5CALA 4DE4A 1AGWA 4EYJA 1DM2A 3RAHA 5ITAA 3HAMA 3F6XA 4HNFA 4QYEA 4ZJVA 5EYCA 4NM0A 2VTSA 3ZLYA 4X21A 3BWFA 3U9CA 3F2NA 2X9FA 4C3FA 2R5TA 3ACJA 4NM5A 1WVWA 3SX9A 2PZYA 2Q0BA 3OCSA 2VX1A 3CQUA 2BIKB 4GUEA 1WZYA 3IOKA 3IQ7A 3MFUA 5EM7A 1OM1A 4ACHA 3GU5A 3N4VA 4BKJA 4ZTMA 4EZ7A 3MPAA 2HYYA 3QLGA 3UVPA 2BR1A 3ZLSA 3AQVA 4E1ZA 2YWPA 4DGMA 3BYOA 4ITJA 3FQSA 4NSTA 4WBOA 3HMNA 3VUHA 3QD2B 4Z55A 4WG5A 4HPUE 4ACDA 4KBCA 5AP2A 5I5ZA 3MFTA 3CGFA 1B6CB 3MY1A 4E7WA 5LCJA 3KULA 3NPCA 1NVRA 3MFSA 1H25A 4YBKA 3ZEPA 3O7LD 3H0ZA 1OIYA 5EYKA 3I79A 3KB7A 5C4LA 4FVQA 3NR9A 4RZWA 4QMXA 1OL2A 3WARA 3RGFA 5HD7A 2AYPA 3ULZA 3EFJA 3OWJA 2QURA 3L9MA 4CFMA 3B8RA 3UOHA 3Q5ZA 3EL7A 4ZZNA 3PXQA 5A6OA 4FSZA 2IW8A 1J91A 2VWZA 4I0TA 2W9ZB 4FSYA 4F0IA 4FSUA 5KMMA 3S4QA 4S30A 2DS1A 3LXLA 3RPRA 3FLQA 3NNWA 1U4DA 3EB0A 3FKNA 4K18A 3EN7A 4GYIA 1H1SA 4AN2A 5IA2A 2OIDA 4H3PA 5DGZA 4UMPA 4HZRA 3G5DA 3IKAA 2BRMA 3GENA 4MYGA 5J9LA 4FV3A 1OBDA 3V51A 3KULB 5CF8A 1KUTA 4EK8A 3A4OX 4QP9A 1PXKA 3MBLA 3MJ2A 4EOOA 4BYJA 2Z02A 1NT2A 3TV7A 3UZPA 3NYVA 2OIQA 4AZVA 3DNDA 2ZV8A 4U44A 4OTFA 1RJBA 4TYIA 5CSVA 4FTKA 3GU7A 4FKLA 4GH2A 4AGUA 2Z7QA 1HCLA 2GHMA 4RIOA 3DBCA 3QU0A 4A9TA 2JKKA 1WBNA 4XHKB 3FJQE 2GCDA 4LL5A 3FI3A 3PPKA 1JKTA 3PXKA 4R1YA 3ORNA 3OWPA 3R8LA 3KY2A 2QOCA 3C4ZA 3RM7A 1REJA 4BCJA 3UGCA 4EYMA 2WIPA 4QP1A 4ZTQA 5FEQA 3VUTA 4E5WA 3D0EA 2XIXA 3DLSA 4I24A 2W1EA 3NYXA 3UC4A 2PE0A 2X9EA 3DBEA 3OY3A 3RKBA 3UIMA 5IMEA 4U80A 3HUBA 4CFFA 3R7VA 3F82A 5JKGA 3R9RA 1XH7A 3QD4A 4OTRA 3KN6A 1YWRA 2OFVA 3FWQA 1O6LA 2UW3A 3JPVA 4PX6A 1GIIA 2BIYA 3KXZA 3KVWA 3NCZA 5BMSA 2PUUA 5JRSA 3C4XA 3QALE 3RPOA 1NXKA 3CGOA 4EOKA 5HIBA 5J9ZA 3D9VA 5EHLA 5LJJA 2WB8A 4UBAA 3BELA 4ITIA 3FLYA 1PXPA 3EFWA 3BLRA 3FC1X 4RC2A 2ZV2A 3E93A 4A4XA 2VO3A 4G3FA 1OL5A 2X0GA 4FL1A 1XH5A 3OMVA 2X6EA 4TWPA 2PU8A 4H36A 2YFXA 3LFQA 5M4FA 5KX8A 5BQ0A 3E5AA 5AP6A 2IVVA 4FSTA 5DR2A 4J95A 5D9HA 5T68A 4JDIA 4RWKA 4FIGA 3ROCA 3VJNA 3ZOSA 4YTCA 4RSSA 1WCCA 2C6KA 2XCHA 3QC9A 3W2QA 3PP1A 5IISA 3NWWA 2ITVA 4C4JA 3NRMA 3OC1A 4GU9A 2XIRA 1YW2A 1UA2A 4DFUA 4MD9E 4U40A 4RIWA 4IFCA 3PVBA 4TPTA 5EOLA 4IVAA 4M84A 3VUKA 4FE2A 2G01A 3U6HA 3O17A 4QYFA 4ERWA 2VZ6A 3DFCB 4BI0A 1U46A 3Q9XA 1BYGA 1GY3A 3L8XA 4CMUA 3CD3A 3IDBA 3KXNA 3R00A 3HRFA 4XV3A 4RVTA 3ZM4A 4ZS0A 4OGRA 3OD6X 3GXLA 3LFCA 3GU4A 4YR8A 5DRBA 3KU2A 2C1AA 5EI2A 5JGAA 1JKSA 1HOWA 3IO7A 3C0GA 4UXQA 4X6QC 5AR5A 2GMXA 2GS6A 4R6VA 5IH6A 5HVYA 5AA8A 4XJ0A 3VHEA 3THBA 1UU3A 2W4OA 2C3LA 1PYEA 3DAKA 4FSMA 5CEKA 3VRZA 4AGCA 4J96A 3WI6A 3ZZEA 4D5KA 1JSUA 5EI8A 2CMWA 3NW7A 3FI4A 3UO4A 4CV9A 4IWDA 3HYHA 2EB3A 1BL7A 3JUHA 3CJGA 2PVMA 4RIWB 5I9ZA 4IWQA 5H8EA 4U42A 3EQHA 4WRGA 4BBEA 5I3OA 4GW8A 4ZTHA 4FTOA 5HU9A 4G17A 3EWHA 4MXYA 4ANLA 4NKSA 2I0HA 2A2AA 4BDJA 2C47A 4JR3A 1YKRA 2HWPA 5G1XA 3Q96A 3BPRA 2IG7A 3BHHA 5BX0A 3LMGA 4GT5A 4RLKA 2ITOA 3Q2JA 2UVZA 5E4HA 4F6UA 5TE0A 4J8MA 3QHWA 3KMUA 4E5AX 1G8AA 1W98A 2WTDA 3DV3A 4KKEA 4ZY6A 3R30A 2X81A 4Z7GA 3QQKA 3GC8A 4LGGA 5FUTA 3VUIA 3ORIA 3CE3A 4F65A 5I9WA 3PG3A 5FDPA 2WTVA 2VTOA 5HD4A 3CS9A 3BEAA 3C9WA 1XKKA 1YDSE 2GPHA 2UV2A 3HZTA 5JEBA 4EKKA 5F20A 3RINA 4D9TA 1PKDA 1K3AA 3DB8A 4YC6A 1YOJA 4TZRA 3T3VA 4A9UA 3NGAA 5HTCA 1FGIA 2J0LA 3RK7A 2PZRA 3U4UA 3G0FA 1IG1A 4FKOA 4QP6A 5AJQA 3WE8A 4C8BA 2LGCA 2G2FA 1ZYLA 1JSVA 5J79A 2XIYA 1URCA 3LXKA 4GT3A 4WD5A 3MVHA 5FG8A 4EJNA 2PVLA 3GC9A 4QTDA 4XH6A 3EYGA 4OR5A 2X8EA 3TKHA 3GEQA 4YTIA 2PVNA 2WO6A 5IG1A 5AAFA 4APPA 4BIBA 4MK0A 4DFNA 2P4IA 4AUAA 2CKPA 4FKUA 4AZFA 1J3HA 2RSVA 2P2IA 2EXMA 5GJDA 4ASEA 4O1PA 2I7QA 3KRJA 5FXRA 4EZ5A 1M52A 2X7GA 4YTFA 3AC3A 1XH4A 3O7LB 2G9XA 3H4JA 4KBKA 4TNDA 3PJ3A 3Q60A 4KBAA 4WG4A 3UC3A 4B9DA 4X3FC 4PTGA 2V22A 2GNFA 2VWUA 2NNWB 5G6VA 4E6CA 3EKNA 3CTQA 4J8NA 4YNEA 4V01A 3QKLA 1IEPA 4HGSA 2I40A 4MCVA 4EH4A 3NAXA 3FMJA 2WXVA 5FEEA 5KE0A 2H9VA 4BTKA 2SRCA 2PWLA 3PPZA 1YDRE 4IBMA 2BZJA 2CSNA 3QTWA 4YJNA 1WFCA 1VEBA 4OBOA 5HCXA 2W06A 5CU6A 1XQZA 3B2TA 3EZRA 3OWKA 4IE9A 3FSKA 3LQ5A 1YWVA 4R3CA 1V0OA 4RGJA 5JZNA 3KVXA 5E92A 3W8LA 3EKKA 3FMHA 3ZLWA 3HVCA 3ORPA 2AC5A 3CY2A 3RNYA 2G15A 3BQRA 3LJ1A 3RM6A 3V5WA 1MRYA 1FMKA 3LCSA 5JGDA 3SD0A 3SOAA 3EFKA 1KOBA 1IASA 2ITUA 4PUZA 3NVMB 1YOLA 3KF4A 4RC3A 3BIZA 3EN5A 3FYKX 3QWJA 4NM7A 4FKSA 4LYNA 2YCFA 4ENXA 2P33A 2XKCA 3RHKA 3NW5A 4CV8A 4XLIA 5AWMA 3DS6A 4G5PA 4DFLA 5AR4A 4CSVA 4YZDA 3UTOA 4KRCA 3DNEA 1YDTE 2ZMCA 4QTBA 3QCYA 4L6QA 3G6GA 4IC7A 2PY3A 5AR2A 2B54A 2PMOX 2XS0A 3LJ2A 3PYYA 5AX9A 3SGCA 4O1OA 1G3NA 3I0OA 2W1IA 3FZRA 3MIAA 5LCKA 4RJ4A 4FT3A 3A2CA 3POOA 5HX6A 1ERKA 3N9XA 3IONA 4IB5A 4L46A 4RPVA 5A3XA 4U9AA 3LZBA 5AIRA 3SW4A 3NUPA 2ONLC 4AACA 3FXWA 3IK3A 3VBTA 3Q9WA 3NYNA 5ANOA 4F70A 5LVOA 4UEUA 5JQ8A 3BV3A 4UMRA 3S95A 5F95A 3S1HA 1VZOA 3R22A 3FLSA 3V5JA 4FKQA 3FEGA 3VNTA 2W4KA 4G3CA 4L00A 4AG8A 4D2PA 2OGVA 4OTPA 5E1SA 2C30A 4ZTNA 4F9CA 5DT0A 4FIJA 4KINA 2FSLX 2HCKA 5AUZA 4D5HA 2BVAA 4B8LA 4RT7A 3FMNA 2P2HA 3TKIA 4E8AA 5FTQA 4CEGA 4F7JA 1YI6A 4QPMA 4BTFA 5KNJA 3OEFX 4G5JA 1SZMA 3W55A 4A06A 2VWBA 4I6QA 4DLJA 5JN2A 4U45A 2HXQA 2OW3A 1H08A 1M2PA 2B9IA 3DLZA 3UVQA 5C26A 5LVPA 3RCJA 4FGRA 3QRUA 2C0TA 3I5NA 4JX3A 1YXTA 4OW8A 3V5LA 2UZLA 3VS3A 1ZWSA 3PSCA 2REIA 4IVCA 4FI1A 4WSYA 5AP7A 4CFVA 3U8WA 3VHKA 3LXNA 5A9UA 5E8TA 4YP8A 4CZUA 2CKQA 4E6AA 4W9WA 3UYSA 2YZLA 1ND4A 3F3UA 3RPSA 4BDDA 4C4FA 1H0WA 4GMYA 4LV5A 4DFYA 3PVUA 4BTJA 5AUVA 3QRIA 2W05A 5EQEA 3UIBA 2I6LA 4EH6A 4WA9A 2QONA 3BGQA 4D28A 5BVKA 3KA0A 3NUAA 4JBVA 4ZMFA 2JD5A 1YRPA 4CVAA 1PY5A 3UG1A 1GNGA 4FIIA 1NY3A 2IZSA 5H8GA 1RE8A 3KL8A 1P5EA 4P5ZA 4BY9E 3BCEA 5JFSA 2VTHA 3E64A 4KRDA 4AT3A 1OITA 5AV1A 4BCHA 4BKYA 2PPQA 3KC3A 5HE2A 2GFSA 4I41A 3ZDUA 2HY81 3F5UA 4D4RA 4GKIA 3ORKA 4CZYB 4PDYA 3E87A 3CTHA 2VWYA 4QMUA 3QTZA 4JX7A 4X0MA 4WUAA 5L2IA 2C6OA 5T6KA 4CCBA 4IMYA 2V5QA 4EHEA 4FV6A 4YZCA 5AUTA 5CF6A 2A4LA 3COIA 5KMIA 2W99B 3R01A 4XP3A 1W83A 4C38A 5CSHA 1QL6A 4FTNA 4DH8A 2JDTA 3P9JA 4HYHA 2P3GX 5C8KA 4M0YA 3E7OA 1W82A 3MDYA 1ZYSA 5H3QA 4QRCA 3PXZA 3TUCA 4ZMEA 3PE1A 2O5KA 3OWLA 4FT0A 4M12A 4PMSA 4R3RA 3U54A 1O9UA 2WU6A 3HL7A 3Q9ZA 4MEDA 4NU1A 3VS0A 4OTQA 4O21A 5ANEA 3O2MA 2R2PA 3IOPA 4KAOA 4V05A 4AZSA 2QG7A 3PZHA 4EC8A 5AAGA 3H9FA 3R02A 4QMLA 3E8EA 2X1NA 4N6YA 3TI1A 5CTPA 4JOAA 3VAPA 2BFXA 4ASZA 3MTFA 3O8UA 4EQUA 4USFA 3C13A 3QYZA 4IVDA 3KREA 4FSWA 3WZEA 2XK3A 2XP2A 3LXPA 3MGYA 5BVNA 2YM6A 3QTIA 3B8QA 4IZAA 5L2SA 3F66A 3OW3A 4BDGA 1S9JA 2RL5A 3LM5A 4I0RA 3N4TA 2QI8A 2W1DA 3HMIA 3ZO2A 3GOKA 4IADA 3MYGA 3V01A 5KUPA 5HG5A 1IA8A 1WMKA 5EH0A 5I9XA 1Q8ZA 5L6OA 3R0TA 2E9OA 5HQ0A 3R7IA 2J51A 3P0MA 3G0EA 4B8MA 4F99A 3FMEA 3W16A 3UO5A 4RX9A 3PPJA 2RFNA 4D1XA 2C6TA 4E5BA 3FZ1A 5AAEA 4W9XA 3WIKA 2W4JA 2WEVA 4UYNA 2CGVA 3CKWA 4A9SA 4FF8A 1XBAA 4HGEA 4I4FA 2GNJA 2JAVA 3AT3A 4AX8A 1KE6A 5EW3A 4RRVA 2IW6A 4NK9A 5KKRB 4EK5A 4JG7A 2PVKA 3T9TA 3V5QA 3Q9YA 5B2KA 3F7ZA 5IA5A 2WMBA 5DWRA 1ZOEA 4IX5A 3R6XA 4AN3A 1J7IA 4IJ9A 4Y95A 3FMMA 3NEWA 3PTGA 4A4LA 2VO7A 2VWWA 2VN9A 4HZSA 2YIRA
chains in the Genus database with same CATH superfamily
5LXMA 2F7EE 2GHGA 4DG0E 2XF0A 5FP5A 5BUJA 2F4JA 4JG6A 2QOOA 4I93A 4W8DA 4ACCA 2QO7A 2A98A 3KXXA 4L42A 4EUTA 2W5AA 3O8TA 4RWLA 2J4ZA 5AP0A 3EL8A 3P08A 4YBJA 5CF4A 5CU3A 5J7HA 5GNKA 4XG2A 3ZHPC 2VUWA 3ZO3A 3ZZWA 4B4LA 4EORA 2BZIB 3CEKA 2X7OA 3PXFA 3ZUUA 4C4GA 3MA3A 3FI8A 2WQNA 2R3MA 4MXCA 4HGLA 4O4CA 4MNEA 3ZDIA 4FODA 4NCTA 2YM3A 5CS6A 2QG5A 1ZRZA 5LMBA 1PMNA 5M06A 3D15A 4LI5A 5HCZA 4BBFA 4C33A 3ZBXA 4FT7A 2HZIA 4GT4A 4MTAA 4XOYA 2JEDA 3VS6A 5HIEA 3NUSA 3FUPA 4C3PA 2ZVAA 4RVMA 4JL9A 4D4VA 2P0CA 4FG9A 2IO6A 3P1AA 5B0XA 3AKLA 4JT3A 3FXXA 3G9LX 3SDJA 4BZNA 4BFMA 1OGUA 4F0GA 3O5AA 3BQCA 3Q53A 3GGFA 2GNLA 5DMZA 3R9NA 3VW8A 3PWYA 1XBCA 4WG3A 3FSFA 3PVWA 4GSBA 4RX7A 5IEVA 3U6JA 4FKPA 4JBPA 2W1CA 2B4SB 2BPMA 1UNGA 4M0ZA 3LFBA 4MNEB 2PMNX 4KIOA 3DFAA 5DIAA 1YVJA 4XV2A 5F4NA 4OAVB 4UXLA 5AP3A 2QR8A 2ZV7A 3MI9A 4G6NA 4K33A 1PMVA 5D7VA 2VU3A 2ZJWA 3EQGA 3K3JA 2QOBA 4J52A 4TT7A 3DDQA 4CRSA 2E9NA 4EOLA 3L8PA 2Y4PA 2YCRA 3QQHA 3UPZA 3PA5A 1Y57A 2UW4A 4L44A 1W2FA 3ID6C 5EQPA 3UP2A 3UOLA 3MESA 2JAMA 4WIHA 5H8BA 5EDRA 5JT2A 4OAUC 3PWDA 3GOPA 1MRUA 3FZOA 3PE2A 3SC1A 3LAUA 3VBVA 4UZDA 3NUNA 3VONA 1ZY5A 4F9YA 4FV7A 4YSJA 3MVJA 4Y83A 2ITQA 5TOZA 3BRBA 3FKOA 3R04A 4KIQA 4BDIA 4HNIA 2O8YA 5HE0A 1Q97A 3LJ0A 5I3RA 4EOPA 1F3MC 2YIWA 2ITZA 3CKXA 4RFMA 4YURA 4L3LA 4J7BA 3DTCA 4MBLA 3EN6A 5DI1A 1S9IA 5GIOE 4OTIA 5BVEA 5HESA 4AW0A 3GT8A 4IX6A 3SXRA 2PL0A 4YJQA 4RA5A 3R8UA 2HIWA 3OT8A 3C1XA 1U5RA 3OG7A 2XK8A 2WMQA 3DTWA 5I9UA 3DBDA 1UU8A 1Y6AA 4HW7A 4E3CA 4TRLA 4BGQA 4EBWA 4F9BA 4HYUA 3SRVA 2X7FA 5FQDC 5IDPA 3SVVA 4J1RA 2HOGA 4Q9SA 3RMFA 3QTSA 2I0YA 3M42A 3ZC5A 4I21A 4EHVA 3FZSA 4TWCA 1Z9XA 3I4BA 4ZAUA 2BDWA 2XJ1A 3MPMA 4I22A 2O2UA 3ZUVA 5JZJA 4KIPA 2WU7A 4LFIA 5I9VA 2YERA 4CMOA 2R3IA 4APCA 5K3YA 4C36A 1GZNA 4ZJJA 2WZJA 3IECA 4GFOA 5L2QA 4BDKA 4YJTA 3BKBA 3NZ0A 4X2FA 1LUFA 2V7OA 4IWOA 4YHJA 2W1FA 1FVTA 4O4DA 3RAWA 1Q4LA 1XH6A 4PY1A 2EUFB 1GIJA 3QA0A 5M44A 1FBNA 5AM7A 2WHBA 5T3QA 3DAJA 2YM5A 5EW9A 4ZSEA 4FA2A 4DHIB 5DYJA 4TNBA 3W0RA 5AFVA 1ZYCA 4IB1A 3I5ZA 3TYKA 4LOPA 2WKMA 3QL8A 3LMIA 4P2KA 2ZM4A 2V62A 4OBPA 3MA6A 4AZEA 4IVBA 3E7VA 3W18A 1SNXA 2YIQA 4R7IA 2R0UA 4FKGA 4NFNA 2ZMDA 3QF9A 3LFFA 3R71A 4OBQA 4YJVA 3SRVB 4O7RA 4Q2AA 4DGOA 3MVLA 3PSDA 4YPDA 4CCUA 5BYLA 1XH8A 4J98A 3GFEA 4QEBA 1JAMA 1SNUA 4QO9A 4QMOA 4G3DA 4QMWA 3HMPA 5F94A 1FGKA 3WZKA 1FMOE 4RJ7A 3W10A 5E7RA 3WBLA 4EOQA 2JGZA 2VNYA 3NUUA 4NJDA 3HGKA 4M97A 3Q4UA 4D55A 5AV0A 2CKOA 2ERKA 5AM6A 5CEMA 1WBTA 4ERKA 4CTBA 1K2PA 3BEGA 4IIRA 2Z7LA 4B0GA 2HZ0A 5H9BA 3TNHA 5HE1A 3UNJA 3A7JA 4CYJA 1RQQA 3HMMA 4ANSA 1J7LA 4BF2A 4AAAA 3SXFA 1UWHA 4FUXA 4ALUA 4EQMA 2GQRA 4L01A 4NT4A 4CKJA 4Z16A 2VTQA 2Y9QA 4F78A 3KMWA 4F4PA 3AG9A 1NVSA 4AXFA 2FGIA 4YHTA 3CQEA 3QZGA 1UNLA 4QMSA 3ZH8A 5GINE 4F1MA 4Z7HA 1JKKA 2PMLX 3LIJA 1PXOA 2E9PA 3F5GA 3GCVA 3R1YA 4G3EA 4K2RA 5HE3A 3DOGA 4AWIA 3D5UA 2VNWA 4TTHB 5CQWA 3HP2A 1P2AA 1YXSA 4RIYA 4DH5A 4C34A 5J7BA 5M4CA 5A54A 5FLFA 2WTWA 5AUXA 3S00A 4O82A 1BLXA 5IUHA 4DTBA 3A62A 3QQLA 5CXHA 4N6ZA 4O7VA 4MF0A 5LQFA 3E62A 5JMSA 2ESMA 4FGBA 4UMQA 4JG8A 1O6YA 3M11A 4EK6A 4U81A 3IGGA 4BGGA 4C0TA 4C2WA 3VS5A 3EQFA 5E1EA 2R4BA 5FBOA 3ULIA 2VX3A 5GHVA 2UW9A 3AKJA 1JKLA 1ZLTA 2QHMA 2YDIA 1U5QA 2C4GA 3ROYA 1LR4A 2ITXA 3E88A 4FV4A 5IH4A 2R3KA 5AV4A 2FSTX 4KB8A 1F0QA 5M56A 3DGKA 5TO8A 2O0UA 2VTTA 3F3TA 3AGLA 3E63A 1A48A 3BHUA 2OU7A 4U8ZA 2E2BA 5CU2A 4DYMA 5JK3A 4AE6A 4FTMA 1PXIA 4YU2A 3ZM9A 2PVYA 2PUNA 4FT9A 4RIYB 3FMKA 4CRLA 4ZTLA 3HV3A 4PPCA 5KBRA 3AD6A 2ITNA 3PIZA 5M55A 2JIUA 3VF9A 2J6MA 3KMMA 5J87A 3ZEWA 4DINA 4WNOA 3D83A 1PYXA 2XKEA 3CR0A 2R3QA 3PLSA 3GQIA 4TYGA 5GJGA 5HGIA 3CTJA 2XNNA 1YXVA 4I0SA 2ZV9A 5B2LA 2CGUA 4QOXA 3HEGA 2HZ4A 4HOKA 4LOQA 2XB7A 1OIQA 3R28A 4FTIA 4XG8A 5IQCA 1FPUA 5CVFA 2X2LA 5M4IA 4O4EA 4JAIA 4GEOA 5DT3A 3C5IA 3TM0A 4LOOA 3QZFA 5HO7A 3FMDA 3ZMMA 4G31A 4C57A 4MD8E 3P86A 4D2SA 4DEEA 2Y4IC 4MXOA 3OUKA 4PTCA 3UMWA 3TUDA 4XV9A 3WZUA 3DQXA 4G1WA 4MQ1A 4XUFA 3D5VA 3D5XA 5C27A 3NLBA 3PSBA 4E4NA 4BDAA 2QLQA 5KMKA 3UIUA 3F3WA 4P5QA 4BWPA 4EJ7A 3QX2A 3HV4A 2RF9A 4C35A 3FBVA 4RVKA 3PRIA 3PJ8A 4L45A 2WQBA 1V0PA 3AC5A 1Y8GA 3BI6A 3MH1A 1OZ1A 4O96A 4XRJA 4J71A 4FEWA 1JPAA 4PL4A 2JDRA 4IW0A 2XM8A 3DA6A 4H3BA 3ZXZA 5LMKC 4C4HA 3R9DA 2C69A 4KWPA 2XUUA 3H10A 2NRYA 3P7BA 4UN0C 3TNQB 2OZAA 2YCQA 4LG4A 2GQSA 4M67A 2PULA 3NW6A 3WF9A 4CD0A 2ZFYA 3F61A 3GCSA 4EI4A 3KXHA 2WMXA 1L8TA 3FDNA 2UW6A 3OOMA 4QQCA 3II5A 3A60A 3MV5A 2C1BA 2HY0A 4HCUA 4JJRA 2WTIA 3C50A 3QCQA 4GIHA 4O0WA 4RX5A 2WAJA 4OTWA 1B38A 1WVYA 4ASXA 4DFBA 3OY1A 3UO6A 3CC6A 5LVLA 3F3ZA 1OBGA 4XRLA 3V04A 3OUNB 1PMEA 4ZZOA 3HV5A 3FZTA 4LGHA 4CG9A 2ZDTA 4F63A 3W2SA 4I1ZA 3KQ7A 3FLNC 3NIEA 3QQGA 4I3ZA 4Y72A 2OXYA 2XK9A 4D1SA 5BPYA 5IUIA 3RHXA 2VGPA 1E9HA 4JLCA 3BE2A 3Q04A 2CLXA 4N70A 4O2ZA 4CTCA 2C68A 3OFMA 4TXCA 2UZWE 1XMMA 2OZAB 3FXZA 1JLUE 2YJSA 3T8OA 5IDNA 3SHEA 1QPCA 4BRXA 2BRHA 3CCNA 3Q6UA 4EBVA 2UZUE 3G15A 3EQDA 2X4FA 4IDVA 4JNWA 5EYMA 3ZFMA 4F7SA 5A4TA 3SA0A 5HG9A 3TJDA 1M17A 3LLTA 3QAME 3QUDA 4X3JA 3LCOA 1OKWA 2F49A 3PRFA 3HDMA 3PUFC 3FE3A 4DC2A 3IW8A 3F9NA 4G3GA 4YLKA 4HVGA 1E1XA 3R1NA 4HPTE 4U0IA 3G6HA 3ZUTA 2JFMA 4OTDA 5C01A 3MIYA 1U59A 2WOUA 5TR6A 4BCFA 1ZYJA 4GS6A 1TFFA 4B7TA 3QX4A 3WYXA 2OJIA 3RBWA 4USEA 4FBXA 4R77A 4G9CA 3Q32A 2YAAA 2QOHA 4MF1A 4M13A 4OLIA 5L3AA 1STCE 1PJKA 2IZRA 3DKOA 2W7XA 3OBGA 4O0XA 4MAOA 3U87A 2W17A 5LOHA 5C03A 3W8QA 3QC4A 4WSQA 4JDHA 5A4QA 3PY0A 3W0OA 2FVDA 3EH9A 3ZYAA 4TYEA 3TEIA 3G51A 2BHEA 1WBPA 3V8SA 3OW4A 2A27A 2RIOA 3OXIA 3KK8A 4DEHA 2J90A 2CJMA 3HA8A 3GI3A 4QQ5A 2HAKA 2X2KA 4IM0A 4PTEA 3AC2A 5ETAA 3A7IA 4AF3A 4K11A 5TF9A 4L3JA 1YHVA 3TCPA 2AUHA 2XM9A 3AOXA 5FBNC 3SV0A 2I0EA 3JY9A 3LW0A 4AOTA 4BN1A 5DRDA 4EUUA 2IJMA 4KSPA 2Y0AA 2PUPA 4FZFB 2UZNA 2ITYA 3O71A 3LFSA 2CNVA 2XNBA 1ZARA 4WNKA 3RZBA 4DEAA 3SG8A 5LARA 1XH9A 5CT7A 3UPXA 4DCAA 3LFAA 3DB6A 3SXSA 3ZFYA 1H00A 1YQJA 4DBXA 2WGJA 3L8VA 3KXMA 1W84A 3QFVA 5EK7A 3DQWA 5CNNA 4MWHA 3V5PA 3RALA 4JQEA 5AX3A 3HECA 1IRKA 4QT1A 3ENMA 1WAKA 2RFDA 3PXRA 2FO0A 1CSNA 2OICA 2WQMA 3C4WA 2G1TA 3OROA 4AA0A 4E4MA 4E93A 2XEZA 4KABA 4IM3A 3WF7A 3WF6A 1M14A 2IN6A 4OTHA 4U7ZA 3WOWA 1YXUA 2YN8A 3R8ZA 3QUPA 2ZM1A 4FX3A 4AZTA 1G8JA 3FI2A 3H0YA 4IAFA 2WMSA 3C4EA 3F88A 4YZBA 1H01A 4FZAB 4Y85A 2UVYA 4I6BA 1DS5A 2KTYA 5ANJA 4TWOA 4EZ3A 2YLFA 3UE4A 3RK9A 4QDVA 4FYOA 3W2CA 4E26A 5AV3A 4FTRA 4QPAA 4EH8A 3V6SA 5LVNA 3QRKA 2H6DA 3COMA 3DKGA 4G2FA 2OIBA 4KD1A 4XCUA 4ZJIA 1CDKA 3BZ3A 2ETMA 3R9HA 3I1AA 5JH6A 4FKVA 2OG8A 3AKKA 2NO3A 4H05A 2FA2A 3R8PA 2O3PA 3I60A 4FV9A 5EKOA 5K9IA 5HOAA 4AZWA 1I44A 2F9GA 3R2BA 1ZMVA 4BI1A 3R8MA 2XJ0A 4AAYA 3R7UA 4RWIA 4QD6A 3DBFA 4GG5A 4ZSAA 2XMYA 4MBIA 2BAJA 5GZ8A 1XR1A 4AQKA 1PXJA 1Q24A 5CEPA 5FRIA 3F7WA 4OT5A 3AMBA 2WMWA 2XEYA 4EH7A 3QKMA 4RC4A 4WOVA 2YM7A 4I23A 4HVSA 4PNKA 1ZY4A 5CNOA 5IA4A 2XIZA 4PMPA 5HBJA 3TIZA 2VTIA 3L9LA 3P7CA 4CQEA 3NUXA 4D0WA 2YACA 3UDBA 3OF0A 5IPJA 4BYIA 2YHVA 5HO6A 4FTUA 1H26A 4NIFA 2C3IB 4NKAA 4S2ZA 5ETIA 3TKUA 5FXQA 4OT6A 2IPXA 3V5TA 5EOBA 2XCKA 5CU0A 3P78A 2XKFA 4AN9A 4XG3A 2W1ZA 2UZVA 5LWNA 2YIXA 4LUEA 2JKMA 2C6LA 4GK2A 5AR8A 4DDIA 3DK3A 5IA1A 4S34A 4UB7A 2YDKA 4DG3E 1KV1A 3K54A 4X6RA 1M7QA 1VJYA 2WTKC 3OCTA 1TVOA 5AA9A 5L2WA 3I6UA 3OBJA 5E90A 2YITA 3NIZA 5EHOA 3FKLA 1Q61A 3E8CA 4FK6A 5HO8A 4X3FA 2BROA 1H27A 3LE6A 4YJOA 3ATSA 1JQHA 4ZXTA 1ZMWA 3OCGA 4LDTA 2YDJA 3AC1A 4PL3A 5IQAA 2DWBA 5BNJA 5CEOA 3TMOA 2R3GA 3SKCA 4NW5A 1KE5A 5IU2A 3AT4A 4NIFB 1QPEA 1R1WA 3FV8A 4FSNA 3V6RA 2BDFA 4CNHA 4EONA 1KE9A 3QLFA 4AW1A 2PSQA 4EOIA 5CAVA 5C1QB 3VO3A 3U51A 5AUYA 4AW2A 1XJDA 3TZ7A 1T45A 2OF4A 2V55A 2FUMA 4IXPA 4TKSA 4BDFA 2VWIA 4EH2A 4ZY5A 5BVFA 3ATTA 4IQ6A 5C8MA 3NYOA 3VQUA 4ID7A 5CASA 3LMHA 2HXLA 4FNZA 3A7HA 3U6IA 3BV2A 4I6LA 5IQIA 4DGNA 2NYAA 3G2FA 4JBQA 2OXXA 4WNPA 4ITHA 4C62A 2GDOA 3U55A 2C0IA 3MS9A 4AGWA 2J2IB 3TDVA 3AMAA 2H34A 4UWYA 4X3FB 4GYGA 1JOWB 3BWJA 3DBQA 4U5JA 4YC8A 4E20A 4F7NA 3G9NA 4BL1A 3JS2A 3UMXA 3A8WA 2X6DA 3KXGA 4CLIA 3A7FA 4XBRA 4HVHA 5D11A 4DFXE 3C5UA 5FDXA 2C5VA 4AQCA 3VBQA 3GNIB 3MY0A 4A9YA 2W0JA 3NMUF 4JDJA 3O8PA 4IX4A 1R39A 2VV9A 3AT2A 3CBLA 3H9RA 4KSQA 4RVLA 4USDA 4ENYA 5CAOA 5HLNA 4R3PA 3VBYA 4QMNA 1I09A 4IB0A 4Q5EA 5DEWA 4FC0A 2ONLA 2XH5A 4RA4A 4JBOA 3ZBFA 2GNHA 2XRUA 3ANQA 4QMVA 5M51A 4F9AA 2WMRA 3UZTA 3NAYA 2XYNA 3FPMA 3FMLA 2B52A 4O7WA 4MH7A 2X0PA 5A4LA 5KMJA 4AFJA 2CHLA 4GV1A 5HEZA 5L6WL 5CQUA 3LHJA 3PIYA 5ACKA 3JR1A 4G16A 1AD5A 2NP8A 1OPJA 3LFNA 3R8VA 3UZRA 4LRKA 4W4YA 5A46A 3PVGA 3EQCA 5HX8A 4LMNA 4JDKA 5ANGA 4RJ5A 3UDTA 3GUBA 1BMKA 4H39A 3KEXA 5M08A 4FT5A 4NJ3A 3UJGA 2OH0E 4K1BA 4U79A 4ZTRA 4XG9A 4DTKA 1K9AA 4X2NA 5IKWA 5EDPA 5CEIA 4I4EA 2YA9A 2BRBA 1KWPA 4I5HA 4BZOA 4D58A 4ZLOA 4FKTA 3PJ1A 4DH1A 3FZPA 3PIXA 4GFMA 1Q99A 2Z8CA 3IG7A 3Q3BA 4NYEA 1WBWA 4KIKA 4XV1A 4PV0A 2PZIA 2YEXA 3JY0A 4QMTA 2C5NA 3TL8A 3NDMA 2EVAA 3VQHA 4ANNA 5A14A 1G8KA 2PZPA 2V0DA 3QD3A 3P4KA 3QZIA 5E9EA 4YO6A 4PWNA 5ETFA 3TZMA 5DOSA 5J9YA 4KUJA 3COHA 1NW1A 4YSMA 4MXXA 5DPVA 1OMWA 3CSVA 4N4SA 3TV4A 2F7ZE 4YJUA 3KRWA 3FYJX 2WMTA 3GBZA 3P5JC 2XRWA 4JQ8A 5DR9A 4D0XA 1CKJA 2JDVA 3C4CA 3NCGA 4N0SA 4UMUA 4DCEA 2OK1A 2XK4A 2R3HA 2XK7A 4FKWA 4JXFA 1M2RA 2WMAA 4QPSA 5I4NA 4GUBA 4L7FA 4YTHA 1FINA 4FYNA 3VC4A 4O81A 3OTUA 5HLPA 4FOCA 1VYWA 4KIKB 4RX8A 3EQRA 4U41A 5EG3A 1DAWA 1BX6A 2VTPA 3QKKA 5EM8A 5GZ9A 4XG7A 5BMMA 3S3IA 4JIAA 3JVSA 3L9PA 5HG8A 1GAGA 3A99A 2JDSA 4IWPA 3V3VA 1ATPE 2IEWA 4R8QA 4P90A 2UZEA 5EDQA 1QCFA 2C6IA 2QOLA 3M1SA 3OOGA 4TN6A 3TACA 1OGYA 3A4PA 2IWIA 4ZSJA 1P4FA 5EHYA 1LEWA 2BZKB 4FZ7A 3ZTXA 1CTPE 5FGKA 5IEYA 1OIRA 4NL0A 4BCMA 4JR7A 2QNJA 4WRSA 2QVSE 3CP9A 4XP2A 3AMYA 2QU6A 3ZSHA 4FZ6A 2NPQA 5BVDA 1OL6A 3QQFA 3LFEA 4CYIA 1SYKA 5DN3A 2RGPA 1ZMUA 2QU5A 4LV7A 5HTIA 2IVTA 2XA4A 1OKYA 3UDSA 4DH3A 3OTVA 1PF8A 4IAZA 4O83A 1MUOA 2BRGA 2HELA 4FSRA 1GZKA 5CEQA 4AXAA 2PUIA 2HENA 3RPYA 2CN8A 1LPUA 2X4ZA 4Z3VA 4J53A 2RKUA 3EQIA 4MNFA 2BTSA 4L52A 3ET7A 3AD4A 3DDPA 4JRNA 4W4XA 3TWJA 4WHZA 1SMHA 2HWOA 4DGGA 2WOTA 1BL6A 2UW8A 2YAKA 3GCQA 3ANRA 3I7BA 2DQ7X 3NNVA 3OCBA 4QMYA 5CT0A 4U43A 2XIKA 2PMIA 2BRNA 2OSCA 3HRBA 4QYHA 2ERZE 3ZSGA 1X8BA 2VGOA 3HA6A 4X7QA 4I6HA 4FEXA 5FTGA 4JS8A 3MPTA 3RCDA 1RW8A 3ZSIA 1SVGA 3SOCA 1B39A 3R1QA 2YJRA 3VS4A 2OH4A 1OPKA 3P23A 4AFEA 2OJGA 3PY1A 2VWVA 3GCPA 4NM3A 3TG1A 2C5XA 4LQMA 4ZLYA 1ZYDA 5BVWA 5TKDA 3ZO1A 3JYAA 3QTUA 4FL2A 4O0VA 3SQQA 1UVRA 2BAQA 2XNMA 4AP7A 4IM2A 3BLAA 3DPKA 4L43A 4EOMA 1Q8WA 1UU7A 3DY7A 2C6EA 4RBLA 3O51A 5CLPA 5HG7A 3RAKA 2WTJA 1V0BA 3VUDA 4UZHA 4HYSA 3VIDA 5AUUA 4ANMA 2W1GA 3VWAA 4K9YA 3MB6A 1PW2A 3NNUA 2FYSA 3TXOA 4IAYA 4BHZA 2WFYA 4BCIA 5AUWA 5CXZA 4AS0A 3C0IA 4RMZA 3BL7A 3MY5A 4YZ9A 3COKA 3K3IA 3CY3A 3RNIA 4C3RA 2ZM3A 4DEGA 4QP7A 4GK3A 4II5A 2GS2A 2R3OA 2XK6A 4BCGA 2VAGA 4XNEA 4O0YA 2B9HA 3QWKA 4BDCA 3OXTA 4FIFA 4FMQA 4HGTA 4LGDA 2PVFA 5IA3A 4O7NA 3MH0A 3BYSA 3V8WA 1AQ1A 1APME 4Y46A 2PE1A 3KGAA 3MW1A 4IACA 4CQGA 2ZOQA 1Q8UA 3KRRA 4YNOA 1XHAA 4MD7E 4GRBA 4C37A 3TN8A 5L8KA 4CGAA 2R7IA 4DTAA 2QR7A 4O7YA 3RPVA 3UOJA 3BE9A 4G9RA 4GG7A 4GIIA 5C4KA 1CKIA 4ZSGA 4PP7A 2B55A 3DU8A 3NSZA 4IEBA 4O38A 5K0XA 3UNKA 5FTOA 1G8SA 1PKGA 3W32A 4B99A 3HV7A 3ZRLA 1J1BA 2RG5A 2OXDA 2VTJA 5IQHA 2EWAA 4TWNA 5C8NA 3TJCA 2BKKA 4QDEA 4EQCA 4A4OA 4BHNA 4L7SA 5CI7A 4YJRA 3DT1A 1YI3A 1PMUA 4I20A 5J5TA 4BC6A 3BL9A 4DT8A 5EYDA 2JBPA 4BGHA 4D4YA 3AXWA 1FVVA 3AC4A 3F2RA 5IQGA 4JI9A 5CSXA 4AT4A 5L4QA 4F0FA 5D12A 1UU9A 4QP8A 3QXPA 2IZTA 5IQEA 4G6LA 4I94A 3ZRKA 3W33A 1OPLA 5K4JA 3ZXTA 3UQCA 2QHNA 2XNPA 4BDBA 3ERKA 4O22A 5D41A 2RFEA 2WPAA 3BYMA 2A0CX 1OUYA 4IFGA 2O64A 3ALOA 4K77A 3DJ6A 2PZ5A 2OJJA 4C4EA 1XWSA 1R78A 2IW9A 3LCTA 5FP6A 3EMGA 2OFUA 4MWIA 3BBTB 1ZOGA 1RDQE 4QTAA 3TNWA 2EU9A 3QGYA 5ANDA 5EM5A 3VBXA 3Q5IA 3RI1A 4R7BA 3CPBA 1YHSA 4IZ7A 3O50A 4PPAA 3ALNA 3KFAA 3Q6WA 4UMTA 3VBWA 3VS1A 4BVUA 4LUDA 1W7HA 5L2TA 4F1OA 4YGAA 2B1PA 3FAAA 5F1ZA 4EWQA 3U9NA 1ZXEA 4ACGA 4ZZMA 4MX9A 3TZ8A 3UDZA 1UV5A 4V0GA 4DA5A 3CQWA 2B53A 2BCJA 4A7CA 4D1ZA 4C58A 1GZOA 3HX4A 1MRVA 4FVRA 4QP4A 4F6WA 2PVHA 2BZHB 4ACMA 4FSQA 3ZCLA 4D2VA 3GQLA 1L3RE 5EM6A 4ZK5A 4EHGA 4Y8DA 2C6DA 3PFQA 5IMXA 2B9JA 1R3CA 2YZAA 3R9OA 3W1FA 4U97A 2PE2A 4XMOA 2WD1A 5HBHA 1Z57A 3TTJA 2QQ7A 3KRLA 5FD2A 4TY1A 3LQ8A 4C7TA 4GKHA 3Q2MA 2R3RA 1YHWA 3DXNA 2JC6A 2HW7A 3NX8A 4CFNA 2VTAA 4FZDB 3MJ1A 5FEDA 2R9SA 4E73A 1URWA 3A8XA 4K6ZA 3EHAA 5HNIX 4XBUA 4D9UA 4WBBB 4DEBA 3G90X 4GCJA 4AU8A 5ETCA 1XBBA 3QD0A 1WBOA 3ORZA 3QYWA 4NH1A 2H96A 1DI9A 4MVFA 5FM2A 5CVHA 2VRXA 1A06A 4TL0A 5M07A 3VN9A 3D5WA 5CVGA 4M66A 3PLAE 4QMZA 3RWPA 4AGDA 4FICA 5H2UA 4BCPA 1H1PA 4V0GB 3H9OA 3GCUA 2AC3A 4QQTA 1LEZA 2XNEA 2Y8OA 1H0VA 1R0PA 2FSMX 3IDCA 2XYUA 4AOJA 4DG2E 2YLEA 2YWVA 2QKWB 1O6KA 4O0TA 3HAVA 4O2PA 4QNYA 4AXDA 3LFDA 2BHHA 2CDZA 4J99A 3CJFA 5DR6A 5AV2A 3RTPA 4IZYA 3HNGA 2KULA 2Z60A 4DEDA 3RZFA 2RG6A 3R21A 4HYIA 2C6MA 2VO0A 3BU5A 5HVJA 1TQIA 4UWBA 5FWKK 3UBDA 5DVRA 4A07A 3ETAA 2I0VA 3R7GA 4PL5A 1ZZ2A 2X39A 3MN3A 3UQGA 4C02A 3QCXA 3QA8A 4K8AA 5I9YA 4H1JA 3W0NA 4YMJA 4EH9A 3TNPC 1CM8A 4TYHA 2JBOA 3L9NA 4R5YA 2XAOA 4GJ2A 3QRJA 5E91A 3RWQA 4ALWA 1Q5KA 3KCKA 3DXPA 2UUEA 3ML1A 5CI6A 3PA3A 2ETKA 3CD8A 5KCVA 5GZAA 3DJ5A 2CGWA 4ZIMA 1H8FA 3TZ9A 5IQFA 3F3VA 4Y73A 4BCKA 4PMMA 4MBJA 4ZP5A 4EK4A 3FHIA 1H1QA 5ANIA 2XJ2A 3O0GA 3ORLA 3AD5A 4S32A 1QPDA 3I81A 2PTKA 1YOMA 4W8EA 4YZNA 5CYIA 4BI2A 4FNXA 4CZTA 4CLJA 5HZNA 3WF5A 2HZNA 3BGPA 4KKHA 5J8IA 4B6LA 3KRXA 4CT2A 2XBAA 3KKVA 1HCKA 3BLQA 4TW9A 3T3UA 3E92A 2X2MA 2ETRA 3PG1A 4XLVA 1Q62A 5HICA 4F64A 4ARKA 1J1CA 2QCSA 4GU6A 5IQBA 2PHKA 2OLCA 4TYHB 4BIDA 3MTLA 3HKOA 3CXWA 2QD9A 1JVPP 4YJSA 4L68A 4CXAA 4BKZA 4FG7A 4FNYA 3RVGA 4E6DA 2GU8A 4FG8A