4DG0E

Crystal structure of myristoylated wt catalytic subunit of camp-dependent protein kinase in complex with sp20 and amp-pnp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
338
Chain Sequence
SEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Role of N-terminal myristylation in the structure and regulation of cAMP-dependent protein kinase.
pubmed doi rcsb
source organism Mus musculus
total genus 107
structure length 338
sequence length 341
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dg0E01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dg0E02
3KRWA 3C4WA 3LM0A 4FTQA 4GU9A 3PJCA 3D0EA 2ITOA 2ZDUA 2QD9A 4IDTA 5TR6A 4BDIA 4EZ5A 1KV2A 2FSMX 4IE9A 2UZDA 3W2SA 3HLLA 1Y8YA 4L43A 2BRHA 4U3ZA 3D94A 2BILB 3MY5A 4EOOA 5K4IA 4YHJA 4R1VA 3VS6A 4FKVA 2C30A 3DTCA 5CAPA 2XIZA 4C61A 4Y46A 2RFEA 2XBAA 5BMMA 3OUNB 1P4FA 4PPBA 1M7QA 4FV5A 1OUKA 4C35A 2FUMA 5CEOA 2R3HA 2XIXA 4ALUA 2JKMA 3DK6A 2HZ4A 4CFNA 1ZARA 1ND4A 5EDPA 5J9YA 1H1RA 2O0UA 2B9FA 1GZ8A 2G15A 4JX7A 2V62A 4HZRA 4FIJA 3VS7A 4C2VA 3QTIA 5BYYA 2OW3A 4G6LA 4JL9A 4RZWA 4DE4A 3HA8A 3F88A 5C03A 2YLFA 4ZXTA 4FTKA 4AE6A 4GH2A 2UW7A 2FB8A 4JLCA 5CENA 3UNZA 4DCEA 3O17A 4LGHA 1WBVA 3CC6A 4FNYA 4X3JA 4YR8A 4FL2A 5BVNA 5IDPA 5IEXA 3KY2A 2PZPA 5TT7A 1Q8TA 5BYLA 2VNYA 4ACMA 1BL7A 3DY7A 4H58A 2R3OA 4JIAA 5HX8A 5M4CA 2YIXA 2IWIA 2W4KA 2G2FA 2W1IA 3FLNC 3S2PA 3QZHA 2WTVA 4CRSA 3SKCA 3LFDA 2YIRA 4C3FA 1FMKA 2A4LA 3POZA 3ZO4A 1W8CA 3GVUA 3K3JA 3R1SA 4FG9A 3FKOA 1DAYA 2V7OA 4A06A 1LUFA 3JR1A 5AP3A 2AUHA 5AUXA 2W1ZA 4J97A 4FEQA 1JBPE 3OCGA 3UZTA 4X21A 5G6VA 4YHTA 3E3PA 3O0GA 4C4JA 3LFSA 2EWAA 4IWDA 1TQIA 3MDYA 4P5ZA 4E6CA 4D28A 2JIUA 2OJFE 5JRQA 4D1ZA 2AC3A 3QLFA 1JWHA 5EYCA 1U46A 1LP4A 3MA6A 1DM2A 4FTCA 3PZEA 1FVVA 4IZ5A 4QMTA 5A4EA 4JIKA 3RPSA 3AG9A 1M17A 4QOXA 5AM7A 3R8LA 1BKXA 4A9UA 3RAIA 4RG0A 4D4SA 1WVXA 2CGVA 2WOTA 4QYGA 5AADA 5DYJA 3V3VA 5LMKA 3LPBA 3S0OA 1PMEA 1OB3A 3TV6A 4GKHA 3N51A 1QPJA 3IECA 1GIHA 2BAKA 3IOPA 4LGGA 4QTDA 4G6NA 2ETKA 3TKUA 5EM6A 3EFLA 3DQWA 3FJQE 5LMAA 5BNJA 2QO2A 1U5QA 3FMDA 4U5JA 2F2UA 2XCHA 3PSDA 3ZLSA 4QPSA 1PXNA 4ANOA 4QMQA 1PXLA 3D7ZA 3OXZA 4LMNA 5DR6A 3RZFA 1OKYA 3KREA 4DAWA 4HCUA 4S34A 3QZGA 4FTOA 4FTJA 4I92A 5E91A 4AZSA 4U44A 4USEA 5HESA 4QMNA 2BKKA 1DS5A 4KS8A 4GRBA 5BUIA 2PVKA 5CVGA 5HBEA 1ZZ2A 2C6IA 5KKRB 3PVUA 3FYKX 5A9UA 4EK5A 3RKBA 4ZLOA 3ORIA 4XS2A 3KMMA 1M2QA 2I40A 2BFYA 4YMJA 3NR9A 4TYEA 5HKMA 2WTKB 4O0UA 2X39A 4I5MA 4J52A 5IMXA 3EQBA 3RM7A 3FMEA 2I0HA 4EHVA 2WMTA 4A4LA 2NPQA 3BPRA 3QC4A 4IH8A 3OBGA 3PXKA 3F5UA 4KUJA 4XV3A 3I81A 4GMYA 3OEFX 3SXSA 2B54A 3CSVA 5KNJA 2JKQA 2HY0A 2UVXA 3C0IA 5AUVA 3RAWA 1CKPA 4R7BA 4YO4A 5E92A 5BUEA 5B7VA 5LARA 4KIPA 4PL3A 3BZ3A 4FX3A 5HLNA 4EHGA 4WBOA 3GEQA 2H34A 1NT2A 4PMSA 4MX9A 4U3YA 5E7RA 5AJQA 2HZIA 3HAVA 3ZDUA 5KMLA 1BUHA 4H3PA 4MXXA 2PVHA 5IF1A 4GT4A 5GIOE 4TTHB 4DN5A 2F7EE 3OT8A 1YVJA 2YM7A 4FSMA 5AP0A 4O27B 3F61A 2O64A 2WMWA 3G9LX 5GZ9A 4CCUA 4EK3A 5CVFA 3AOXA 3V8TA 4WSYA 5EKNA 4NIFB 1JAMA 5EOBA 5IA1A 4QO9A 2CMWA 3GUBA 4RQVA 3DXPA 5J5TA 1KOBA 4YJUA 1MRUA 1SNUA 5JRSA 3O51A 4YURA 2RL5A 2WXVA 2OLCA 4DGMA 4DEDA 2FYSA 5AR7A 5HBHA 1OVEA 1W83A 3QTRA 4KAOA 1CMKE 2BUJA 2G2HA 2JFMA 4HVSA 4BDHA 2GFCA 2HXQA 3OCBA 3SHEA 4P2KA 3TUCA 3NWWA 4BYIA 3BE9A 3QCSA 4U80A 2H9VA 5E1SA 2R3MA 3FHRA 1JPAA 4C4EA 4GV1A 5DT0A 4DC2A 4YTCA 5JGBA 1SVHA 2ITXA 3HUCA 4LOOA 3BYMA 3RCJA 2C0TA 4XBUA 4BBMA 2WOUA 5ETFA 5F20A 5HO8A 4ZZMA 1WBWA 4MNEB 3F2RA 5DVRA 3F3ZA 3VHKA 3MB6A 4I4FA 3EIDA 5C9CA 4ZY5A 4QTAA 1XJDA 2IW6A 2JGZA 3CCNA 3GU4A 4IB5A 4S2ZA 3T3UA 2ZJWA 3IDBA 4CV9A 3ZFYA 5L6PA 5IDNA 3LFAA 3NNUA 4KD1A 5GINE 4I22A 3BLHA 5I9YA 3GQLA 3D2KA 4AGDA 4GSBA 3MIAA 4OTQA 3O8UA 1V0BA 1YXTA 4PPAA 3GOPA 4IC7A 3NUAA 2OKRA 1KE6A 3DGKA 5EHLA 4BGGA 1F0QA 3MTFA 2W06A 4AW5A 2O65A 4I5PA 2B9HA 4AT4A 1PXIA 4L46A 3E3BX 1H8FA 1L3RE 1Q3DA 4CCBA 4DGOA 4UXQA 4BBEA 5CSWA 2V7AA 2ETRA 4D2WA 1H27A 3QRKA 5IZFA 3NZ0A 3QD3A 5FXSA 3MH2A 3U87A 5HE0A 2F7ZE 3GB2A 3HNGA 4NUSA 3R7IA 3HRFA 3DJ6A 3JPVA 4KINA 3WIGA 3UPZA 4ONAA 4WNMA 4IX3A 4XP2A 3ORMA 3UP2A 2PYWA 2W0JA 4AFEA 3QQGA 2UZNA 3Q4UA 1EH4A 4QTEA 2EXCX 3L8PA 3PPKA 3SX9A 3T8OA 3PY3A 2VWBA 4ACHA 4DCAA 3QQHA 5AAFA 4KWPA 4AFJA 4D58A 1OITA 3ORXA 3BLRA 2X8IA 2Z7RA 3OF0A 4BCOA 4D1XA 4NCTC 5M56A 2UZUE 4WNKA 4UZDA 4FE2A 3RVGA 3ALNA 4Q9ZA 2P2IA 1ATPE 4FKPA 3SG8A 4O22A 4LMUA 2UZEA 4I0RA 5F94A 3R7VA 2BRBA 1J91A 3UQFA 4FKTA 4WRSA 3DT1A 2IPXA 3ZLWA 2IN6A 4FOBA 4FEUA 4DEEA 3VN9A 4EOMA 3HDMA 5IQIA 3PJ8A 5DA3A 3HRBA 3R63A 4FYNA 4BI2A 2CNQA 4AOTA 3ID6C 2HZ0A 3HV4A 3K2LA 4LYNA 3JUHA 4HGTA 4JBVA 3FPQA 3SLSA 1XWSA 4U8ZA 3ZS5A 4BWKA 4PDOA 1ZOGA 2BRNA 3LMGA 4FSZA 4OTIA 4QP3A 5EM5A 3MY1A 2R9SA 4QYFA 2BHEA 4FSWA 4RC3A 4XX9A 3U9CA 4CQEA 4G3CA 3HMOA 4D2PA 3H9FA 4YGAA 3G0EA 4GG5A 4W4YA 1AGWA 2DQ7X 4NYEA 1M7NA 3ULIA 2Y6OA 4IW0A 1ZWSA 1NVQA 5AX3A 4FA2A 2OIBA 2HWOA 3TIZA 4HVDA 4L7SA 3A7GA 5EW9A 3CQUA 5LCKA 3UYSA 2R7BA 3DBQA 2YISA 4JQ8A 5IA5A 3VIDA 3NIEA 3WBLA 1UA2A 2PMLX 2R0UA 4C4GA 2OH0E 3QCXA 3UC3A 5BUJA 2W5AA 4BB4A 4OW8A 4N6YA 4RWIA 3SQQA 4EORA 2XNGA 4BZOA 2WMXA 2IVTA 1PHKA 2OJJA 2R3RA 3GU7A 4IWOA 3R7YA 5IQCA 3C5UA 3DV3A 4O0YA 3OP5A 3O2MA 4FKSA 3RNIA 1GNGA 3R9RA 2ZVAA 2B52A 5A4LA 4O7VA 3W33A 4LRJA 4UY9A 2FSLX 2FO0A 3C0HA 4ERKA 2R3IA 4EKLA 3FQHA 4WKQA 4J71A 2OZAB 4QMPA 4RJ8A 3UOHA 4EC8A 3C4EA 5CSXA 2XJ0A 3VJOA 3CTJA 2O8YA 2W1GA 3FL4A 4LUEA 4LGDA 3UVRA 4YJNA 5K9IA 3G6GA 3BQCA 5CEPA 3SXFA 3MTLA 3HEGA 3COKA 3MSSA 3P7CA 2QCSA 4NK9A 2XK4A 3FI3A 5DHJA 3ZH8A 3Q4ZA 4NH1A 3FMLA 4PP9A 3W1FA 4DYMA 4GU6A 4HYSA 2BALA 2PVLA 3UYTA 3R7GA 3O50A 3NRMA 2IW8A 3FMMA 2VWXA 4AN3A 4CRLA 3KVWA 4Q9SA 4IANA 5LVPA 4FZ7A 4EH5A 5CLPA 2CKOA 3U6HA 3EN7A 4E6QA 4TPTA 5AUWA 4D2RA 4TRLA 1SM2A 4FV7A 4NIFA 3HV7A 4RWKA 1Q62A 3GNIB 2WAJA 1JKLA 4C4FA 2OK1A 4YZNA 3MH3A 4AZFA 1RJBA 4IMYA 5DI1A 4MD8E 5E8ZA 5HD4A 4MF1A 5CSHA 1IA9A 4DT8A 3NCGA 4ZTQA 2QG5A 3IONA 5AP1A 4FGRA 3BYOA 4BDAA 4AAAA 1NVSA 3PVWA 4YTFA 4EK6A 3H0ZA 4KSQA 4QD6A 4EH8A 3F3VA 3BU6A 3PJ3A 3FAAA 4HNFA 4TNBA 1YWVA 3E87A 3GBZA 4CLJA 3MS9A 4FG7A 5E8VA 2YITA 5AR4A 1O9UA 3ZSGA 3EMGA 5EYKA 5CXZA 1FGKA 4JG6A 4U7ZA 3GC8A 5EDRA 5IKWA 4FIEA 3CP9A 2VX3A 2VO3A 3UPXA 2BRMA 1NW1A 3L9PA 3DTWA 3QRUA 3TXOA 5T6KA 2Y6MA 1GJOA 3FKLA 3LLTA 3LW0A 3E8DA 4FTRA 1BI8A 2J5EA 3TZ7A 4RLLA 2BTRA 3O7LD 1YHSA 1XKKA 3TEIA 5HQ0A 2QOIA 5KZ0A 3UIBA 3E63A 3PE1A 2UZTA 3OFMA 3TG1A 4HGLA 4O0WA 3CJGA 2WMBA 4FKIA 4NWMA 2OJGA 3VHEA 3MN3A 4V05A 4QMZA 5CANA 3E8EA 3ZUUA 4JR7A 4F08A 4USDA 4UV0A 1Q41A 1E9HA 3DNEA 4WO5A 1IG1A 3SG9A 3DS6A 2C3IB 3FV8A 5BVDA 5CT7A 3V8SA 4FT5A 3V51A 4EZ3A 4O7YA 4W8DA 1UVRA 4PDPA 3UQCA 4O0XA 4FG8A 3UODA 3NEWA 4R5SA 3BHHA 3UO6A 1XBAA 3Q60A 4GW8A 5AV0A 1JSVA 3ZUVA 1XR1A 2ZM3A 3EB0A 5CU0A 5JFSA 1YXSA 1VYZA 2PZIA 3CGFA 2PVYA 3AMAA 3SOCA 4L67A 4EJ7A 1WCCA 4FV4A 1RW8A 3AT2A 5LCJA 4IZ7A 3GU6A 4OTPA 3VW8A 3BI6A 3LFNA 1YOMA 2XIYA 4U6RA 4AZTA 2A2AA 3QGYA 4XOYA 2ESMA 3BGPA 4FKJA 4WHZA 5BVWA 4KIOA 2VN9A 3FMNA 4ACDA 4M69B 5HG5A 2X0GA 4BHZA 3D15A 3HAMA 5DEWA 4S30A 3OG7A 1JKSA 3A61A 3WZDA 1Q24A 3FI4A 3HYHA 1Q99A 3ATSA 2PZ5A 4O7SA 3PE2A 4FKQA 4IM0A 3QFVA 5I3RA 4FK6A 2JAVA 4RMZA 4PPCA 3TNHA 2YN8A 3U8WA 3KA0A 5D1JA 5EHOA 3F5PA 1UV5A 1WBNA 5AA9A 5AV4A 3ZC6A 1V0OA 4DH8A 3HP5A 2VWYA 2GCDA 4EH2A 1URCA 4DLIA 5J7BA 3PSCA 5ANEA 4B8LA 1MP8A 3C4XA 4BGQA 4GL9A 4ZY4A 5KO1A 4O82A 3FLSA 3HL7A 2LGCA 3OTVA 4E4XA 3TIYA 3TUDA 3SRVB 2NNWB 3EQDA 4YTIA 4IX4A 5KE0A 4RX5A 4G3DA 4NM0A 4MXOA 3ZXTA 3TNIA 3ROCA 3QQLA 3QBNA 2XB7A 3EN9A 4LV8A 4H1JA 5IH5A 3I79A 4GIIA 3MI9A 4NL0A 4I94A 2YJRA 2UV2A 4GK3A 5DRDA 3VUMA 1YQJA 3QHWA 3DLZA 1KE5A 3GC9A 1V0PA 4UYNA 2P3GX 3LLAA 5IQHA 1NY3A 3ZZWA 2F7XE 4I1ZA 2RFSA 3F7ZA 4IFGA 4L3PA 4EOJA 3EQPA 2QHMA 3Q3BA 2XZSA 4FVQA 3EH9A 4JX3A 4CFFA 2XVDA 1OIUA 1A48A 2YLEA 1KWPA 2WB8A 3RK9A 4XG6A 4KIQA 5KKRC 2ZMDA 4V0GB 2OZAA 4ZSEA 4BDJA 4BDEA 4IWPA 4ZSJA 4AOIA 4O7NA 1W82A 4AE9A 5IA3A 3QZIA 4HJOA 2BCJA 3LM5A 4GFOA 5HTIA 4PL4A 1OBDA 3L8SA 3VO3A 2C5XA 3R30A 3TZMA 3BV2A 2HK5A 3Q04A 4FSTA 3TKIA 2IJMA 4NM3A 3LCKA 5KBRA 3TUBA 4R77A 4KBKA 4U81A 5H3QA 3D83A 4I5CA 2XM9A 3QQKA 4FZAB 2XIRA 4X2NA 3DKGA 2OFVA 3WE8A 1FGIA 2XA4A 3I0QA 4XP0A 1S9JA 3BU3A 3AD5A 2X9FA 3RGFA 2NO3A 4PDYA 3QD0A 1VR2A 2VWUA 4M67A 4QYYA 5D12A 3R83A 3TZ9A 2C0OA 4ANBA 4CMUA 5BMSA 4MXZA 4B9DA 2VWIA 2W96B 2VTTA 4RJ5A 2WMRA 4HZSA 3HVCA 4YSJA 3POOA 2CGXA 1WBTA 2H6DA 1G8SA 3FC2A 4RWLA 4B4LA 5HO7A 1OPLA 2JKKA 1UKHA 3G2FA 3UIUA 4G3GA 4L45A 3ZC5A 5LWMA 2AYPA 4AXAA 4ZK5A 3RWQA 1AQ1A 4FODA 1SVGA 5HNBA 4A9YA 3VBYA 2QOOA 5IEYA 4ASZA 4W4XA 3Q9YA 3QXOA 5M08A 3P7AA 3L1SA 5CAOA 4G9CA 2EU9A 4NKSA 5TOZA 3V5TA 3EZRA 3ORZA 4EH9A 2W1HA 1ZYCA 4BICA 2IO6A 4M12A 4UALA 4ASDA 3LQ8A 2VUWA 3PSBA 4NJDA 4YJOA 2BZJA 2OSCA 4P5QA 4RJ4A 1LEWA 4ZOGA 4RVLA 4U79A 4I4EA 4DEHA 2C68A 2BKZA 3AGLA 5DBXA 3SXRA 4EYMA 5ACKA 2FA2A 2Y4IC 5DRBA 2OJIA 4JR3A 4BCMA 4USFA 4FR4A 3TV4A 2VU3A 2H96A 3P7BA 4WIHA 5ANKA 3R21A 4IAZA 4UEUA 4GKIA 5CI7A 3N9XA 4DGNA 1H1SA 4C34A 4HVGA 1VJYA 5BVOA 4FT3A 4A07A 5C8NA 4FKLA 5CX9A 5ACBC 2J0JA 4R7IA 5FTOA 3MH1A 3CPCA 2JFLA 4E26A 1PXOA 3BHTA 3PIYA 4HCVA 3K5UA 4YO6A 5E8WA 1Y57A 3VUKA 1AD5A 2B53A 5J7HA 4F70A 2J0IA 4FSYA 3QRIA 2W9ZB 1UWHA 3IOKA 4YJVA 5M06A 4GT5A 2J51A 3AT4A 1XH9A 2WEIA 4K18A 2OZOA 3ZTXA 4JQEA 4AGUA 4TYJA 3MA3A 4YZDA 4L00A 3NVMB 5EQYA 4QMXA 5C4LA 4DTBA 1H4LA 3KC3A 4QQCA 3MY0A 5HLWA 2HY81 3R8PA 2HW6A 5IQAA 5KX8A 4BC6A 1OKWA 4BYJA 3I6WA 1DI8A 5EQPA 5I9WA 3O96A 2F49A 5EM7A 3I6UA 1T45A 5GZ8A 4FSNA 2VTRA 2BZIB 4S32A 4M69A 5J8IA 1K3AA 1ZMVA 5HG9A 4LUDA 3QYWA 5CSVA 4JDHA 2X8EA 1PKDA 2HCKA 3DB6A 4J53A 5LVLA 4IXPA 5A3XA 1NVRA 3AC8A 4U41A 3WOWA 5M44A 4ZSGA 1H25A 2I6LA 3PY0A 3EQIA 2IZUA 4J96A 4WNOA 3AXWA 3QYZA 5HVYA 3VS0A 3EFJA 1W98A 4RA5A 1H08A 1UNGA 1PXKA 4QQ5A 3HMPA 3P78A 2VWVA 5CNNA 3UOJA 3I4BA 4KABA 3CIKA 2Z02A 1UWJA 5E8TA 4CSVA 5I4NA 4PUZA 3HP2A 2AC5A 3VAPA 5E8YA 5CF5A 5H2UA 5L6OA 2C69A 3FI8A 4AQCA 4EONA 4WG3A 4Z7GA 4ZTNA 1OIQA 4RJ3A 5DMZA 4D2SA 2X7GA 5JQ8A 1YXXA 5K3YA 1G3NA 1FMOE 3BYSA 3KU2A 1GOLA 2ITUA 3ZXZA 4E7WA 4B8MA 4RQKA 5LVOA 3DAKA 4EI4A 2LAVA 3ZLXA 3F6XA 3KXMA 2YZAA 3DK3A 3BX5A 1NA7A 3PXRA 1Y6AA 1TQMA 4C7TA 4DG3E 2BAQA 1APME 4C38A 4AW2A 4G34A 4FT0A 4NEUA 3PIZA 4BTFA 3C4CA 3L9LA 2PUIA 3MGYA 3LVPA 4HCTA 3THBA 1IR3A 2W4OA 2XJ1A 3P08A 1ZYSA 3ZOSA 2CNVA 3KXGA 4NCTA 4AG8A 2XBJA 4M97A 4FC0A 2V22A 2HW7A 2J0KA 5D7VA 3QWJA 3RWPA 3LZBA 3A8WA 2Y7JA 3HZTA 4MNFA 5AEPA 3KKVA 3KEXA 3KXNA 4I21A 1Z9XA 2R3GA 1OL6A 3DKFA 3IGOA 3DBCA 1OL7A 4J8NA 5TF9A 4YPDA 1YKRA 4O21A 4YNEA 1BYGA 4XG4A 4DITA 3MESA 5CEIA 5AR2A 4C2WA 2OO8X 3FMKA 4BWXA 3JVSA 4DBXA 3UBDA 3VBWA 4FF8A 3LXNA 1SMHA 2R3JA 4ZIMA 2VTNA 3WIKA 5EQEA 2XEZA 3Q53A 4CZYB 4Y72A 4G3EA 2W1FA 3CKXA 3LFQA 3R73A 3L9MA 3P0MA 4JI9A 1KSWA 3E7OA 2WMVA 2W5BA 5A6OA 2XNNA 3ENHA 2PVJA 4DEIA 2BIYA 3NPCA 5M4IA 3FEGA 4ZLYA 2XK7A 2QURA 3FQEA 4JRVA 4EOSA 3VS1A 1M14A 1LEZA 3LXKA 4DGLC 3W2QA 4OR5A 2X8DA 1HCKA 4JS8A 5GJDA 4FNXA 4AZEA 4BIDA 4Z7HA 4Z16A 2GQRA 4PWNA 3W8LA 4L01A 5CT0A 1YDSE 2XNPA 1PYXA 2XMYA 5JK3A 1XH7A 3DBDA 2PL0A 4FMQA 1TVOA 5E8SA 1U59A 2Y9QA 2JD5A 3B2TA 5I0BA 3DJ7A 3JYAA 4DG0E 4OAUC 5HEZA 4G17A 3MH0A 4UBAA 2J9MA 3FSKA 3QWKA 2QOKA 2J0LA 3Q4CA 2CCHA 3OY3A 5F1ZA 3TN8A 3ZBXA 4YU2A 2BTSA 2YEXA 2C4GA 3QX4A 4S33A 3FZ1A 4WBBB 4R5YA 3I5ZA 5J5SA 2PE1A 5FBOA 1Q4LA 2BVAA 4I6BA 1O6YA 1KV1A 3A8XA 4GFGA 4KRDA 4JVGA 1BX6A 2WMQA 2O5KA 3H9OA 3CY2A 4DFXE 3EFWA 2XIKA 4E93A 1DI9A 3D4QA 5EI6A 3BYUA 1OECA 4RIXA 4APCA 3EYHA 4YZ9A 5J1VA 5HX6A 1GZNA 2PTKA 2PK9A 4CT1A 3JY0A 4BDFA 2WU7A 5JH6A 4DFBA 5DIAA 2XKFA 3OEZA 3OZ6A 4UMUA 5HE2A 2JDRA 4ANNA 2XKDA 5HO6A 3VUDA 2NP8A 4BKYA 4O0VA 4F9AA 5DH3A 4PY1A 2VX1A 1PMVA 3QRJA 4FV6A 5AWMA 3R9OA 3ZSIA 5JKGA 5FEQA 4H1MA 4FKUA 3PWDA 2FSOX 4C4IA 1H1WA 3KVXA 4KNBA 4OTFA 3NAYA 3PDTA 4CLIA 3PYYA 1WBPA 1J7IA 3OC1A 4PF4A 2EB2A 4GG7A 3ATTA 4ANSA 4XYFA 5KMIA 1J7LA 3EL7A 3ANRA 2PUPA 1RDQE 3NVKI 4TL0A 3CR0A 3M1SA 1OBGA 1R0PA 3DPKA 5AUYA 5CU2A 5AP2A 5HG8A 2UW5A 2YERA 3TI1A 3BE2A 5KMOA 4MD9E 3GGFA 4QP7A 4TYIA 4YC3A 2J7TA 3BGZA 5ETAA 1KE9A 3WF6A 4A4OA 3Q52A 2CGUA 4FVRA 2IZTA 2PY3A 2YWPA 2QOHA 2ZMCA 2VZ6A 4UN0C 4M68A 4CV8A 5J79A 4UYAA 5B2MA 4K11A 4JBOA 3AC4A 2BPMA 4I93A 3U51A 3FLZA 4AT5A 5JMSA 3EKNA 2BRGA 4BI0A 3LJ2A 2VO7A 4K2RA 2PWLA 3R8ZA 2Y4IB 3OROA 4A4XA 2R3QA 2XK6A 5J1WA 1M2PA 4WUAA 2GNGA 2RIOA 4R6VA 4X2FA 2R64A 4MXAA 4FK3A 4RIWB 1HCLA 5DLSA 4CYJA 4R3RA 3EFKA 2BDWA 5I9UA 3NDMA 3MJ1A 3RM6A 2Z8CA 4KIKB 5FXRA 3KN5A 4ZMEA 2WGJA 2V55A 3DJ5A 3IDPA 4FTAA 3KQ7A 3WYYA 2GS6A 3FWQA 4N6ZA 3ZFXA 3R28A 4DFUA 4FKWA 2W1EA 4RC2A 5IA2A 3BV3A 2GS7A 3BGQA 2ITQA 5FUTA 5IH4A 2A19B 4BKJA 3SGCA 4OTDA 4YLKA 2UVZA 4FSQA 2WFYA 4C4HA 5L3AA 2G2IA 2VO0A 3DAJA 3NYNA 2UW9A 2OXDA 3A7FA 1JSTA 4TWNA 5CU3A 3KF7A 2QG7A 3D14A 3CXWA 4BDCA 1ZOEA 2YM4A 4O7ZA 2OJ9A 4CFXA 3KCFA 4QT1A 3BBTB 4FTUA 4XUFA 3GFEA 4BTKA 5HU9A 3DA6A 5JQ5A 5E90A 5DT3A 3VQUA 3COMA 3OCSA 4IAFA 4NFNA 4CKRA 4WD5A 4F9CA 2XJ2A 4F65A 4IM3A 3OT3A 4FTTA 2ZAZA 2PE2A 4LG4A 4QMYA 4EKKA 2HAKA 4MQ1A 2ETMA 4UWYA 3R8VA 3SA0A 4FTMA 3DFCB 3SW7A 3ZFMA 4EJNA 2UZVA 2ITPA 4ASEA 5KBQA 3Q2JA 1P5EA 4FV1A 4LI5A 4RPVA 5L8JA 3SAYA 4YJRA 1QPEA 1OPKA 4ZZNA 4P90A 3CD8A 3DKCA 1TKIA 4AF3A 1QCFA 1MRVA 5IUGA 2GNLA 4I3ZA 1I09A 3NYVA 4ANMA 4JAIA 3C9WA 1U5RA 3FMJA 3O23A 4YTHA 3LMIA 4OBPA 4MTAA 5CNOA 2QI8A 4IZAA 3O7LB 4S31A 3RPRA 3G6HA 2ONLC 4E1ZA 4Z3VA 3TNPC 4OUCA 5IQDA 4F1TA 3RK5A 1SZMA 2VTIA 3U4UA 1ZAOA 3ZO1A 3O8TA 1GIIA 3QL8A 3TCPA 4F0IA 3PXYA 1R78A 2ITVA 3PUPA 4AZVA 5M57A 2C5VA 1OL5A 4QRCA 4HPTE 1YWNA 3MPAA 1OGUA 1J3HA 3QZFA 3R0TA 2OU7A 4MAOA 4Y5HA 2XK9A 2Z7LA 4XLIA 1QL6A 4XG9A 5HOAA 4AOJA 3LFFA 4GK2A 4L3JA 4X3FC 5F4NA 2VTJA 3E8NA 3OWPA 4QMSA 1TQPA 3PA4A 5KMKA 4JNWA 2QOFA 4FV0A 2ZDTA 3KXZA 4PQNA 3V5QA 3NUSA 3PXQA 4Z55A 4IJ9A 5JFWA 2CKPA 3R8UA 3FE3A 3FLQA 3QTUA 1U54B 1MUOA 4RFZA 4RIOA 3OS3A 4AP7A 3UO5A 3R04A 5A46A 2WU6A 2O3PA 3B2WA 3E7VA 5CAVA 4R1YA 3R9HA 2DS1A 5EW3A 4TW9A 3PG3A 2R2PA 5FDXA 3UMXA 3HV6A 4OBQA 3LHJA 4LM5A 3AQVA 1PXJA 4Y8DA 5ANJA 3W2PA 4DH1A 2CN8A 2E9VA 4KRCA 1R1WA 2OGVA 3TWJA 4BWPA 3LE6A 3PA5A 3PVBA 2PVMA 5JGDA 5JGAA 3VRZA 1XBBA 3ITZA 2I0VA 3ORPA 2WQEA 4O0TA 4FZDB 2YM5A 4J1RA 3ORLA 2YAAA 4HGEA 4F1OA 4RIYB 3F82A 3RJCA 3UP7A 4G31A 1CKIA 1Y8GA 2YCSA 1JSUA 4CGAA 2X7OA 3BLQA 2QC6A 2VTSA 4TWCA 2GNIA 3ZMMA 4C62A 3G9NA 2DYLA 2P33A 3MFSA 5A6NA 5C4KA 3QD2B 5IG1A 3ALOA 4PTEA 4LOQA 4XCUA 4EEVA 4AX8A 4NT4A 3TACA 3QA0A 3EWHA 2W7XA 1OL1A 4O2PA 3ZEPA 2GPHA 2ZM1A 4PMTA 4RVMA 4BY9E 4MCVA 2ITNA 3DK7A 3IKAA 4QP2A 3JVRA 4MBIA 5DEYA 3SC1A 3VULA 4F63A 5AFVA 4X2JA 4GFMA 3MFRA 2YM6A 2PE0A 4ZMFA 3R7EA 2P0CA 2Q83A 4LFIA 2GQSA 4EZ7A 4DG2E 3NW6A 3Q5IA 4XG7A 1KUTA 4CXAA 4DHFA 4O1PA 4IDVA 4L9IA 2WMUA 2JDTA 4TT7A 4UWBA 5A4CA 5EYDA 4IB1A 4MNEA 4WOVA 5FP6A 5FTQA 3GT8A 4DTKA 4KIKA 2YFXA 2BR1A 5IA4A 3C1XA 4EL9A 4JT3A 4ZY6A 1W7HA 1KE8A 2GQGA 3IK3A 4TWPA 3WZEA 4F9BA 1UU3A 1QPCA 4X0MA 1E1VA 4NJ3A 4XV1A 5C27A 4IX6A 2Y8OA 3ZSHA 5KUPA 4YUQA 3QTSA 4ZJJA 2BDJA 2B4SB 1GZOA 2YJSA 4G3FA 4TWOA 3AD6A 3AGMA 2XK3A 5KHXA 4E5WA 3HDNA 2DWBA 1H0VA 5TKDA 4L52A 4KKGA 1R39A 2C3LA 3WF8A 3VBQA 4I6FA 3PTGA 4GVJA 4TYHB 2WEVA 4XG3A 3E64A 4B0GA 1XH4A 3PRFA 5CSPA 5AX9A 2GHMA 4B7TA 1UNHA 5E8XA 3LJ0A 5HICA 2YCQA 4U45A 1JQHA 2P2HA 4YZMA 4CMTA 4JDJA 2YDJA 3W2CA 4IM2A 3KB7A 4JRNA 4AGWA 4EHZA 3TV7A 1XH8A 4ITHA 1ZYJA 2GS2A 2Z60A 4QP8A 4HVHA 4Y73A 3UIMA 2R4BA 3NUNA 3FC1X 5E9EA 3FBVA 4O91A 1WBSA 2G1TA 4H39A 5JZNA 5L2WA 2IVVA 4QMWA 4F1MA 3RZBA 2PU8A 3ROYA 3VQHA 1CTPE 5KHWA 4MXCA 1ZY4A 2O63A 1B38A 5L2QA 5FG8A 3QGWA 4RJ7A 4B6LA 2C6OA 4L3LA 3MVMA 3GCQA 2XCKA 3KK9A 4EUUA 1J7UA 4GUEA 3BU5A 4FYOA 3MVLA 4NW6A 3T9IA 4DT9A 1URWA 1R0EA 4V04A 1O6KA 4XV2A 4L44A 3DZQA 3UE4A 3ZZEA 2YIQA 2XRWA 5CQWA 3FHIA 3VBXA 3HA6A 5EHYA 2J5FA 3GXLA 3CY3A 1BI7A 4YLLA 1DAWA 2I0EA 1ZLTA 2YIWA 3BQRA 3EL8A 3AMYA 4FTNA 3ZBFA 4FBXA 2IZRA 5I9XA 5AP4A 4J7BA 4TN6A 1K2PA 5CVHA 4AN9A 4CFMA 2QR7A 4F9YA 3KRRA 3OY1A 1U54A 3F69A 3HMMA 2RG5A 5IU2A 1J1BA 2B55A 5CAQA 2EVAA 2OIQA 3E93A 4FKOA 3OCTA 4YBKA 4DEGA 3ZYAA 3MFTA 3FZPA 5M07A 4IIRA 3SW4A 4GYGA 3D2IA 4FOCA 4K8AA 4ERWA 5CI6A 4RX7A 1VZOA 2UW3A 3GCVA 2OFUA 4WUNA 2CGWA 3P1AA 4GT3A 4QNYA 3A62A 5EH0A 4BKZA 4ALVA 4M0ZA 5DOSA 3R71A 3HV3A 5EOLA 4L68A 4U97A 2IW9A 4Y85A 2C0IA 5AR5A 4I20A 3CGOA 4F7LA 3NUXA 4F7SA 3NAXA 3TTIA 4GK4A 5CTPA 4RIYA 3UG1A 3LOKA 4FI1A 1F3MC 5FEDA 4DH7A 2YM3A 4EK8A 1YI4A 3F3UA 3VRYA 3EKKA 4KA3A 4LL0A 4BDDA 3PRIA 5AP6A 4BVUA 2VWWA 5IEVA 5FDPA 3A7JA 1J1CA 4HYUA 4MEDA 2CJMA 1H07A 4QNAA 2WTJA 3EN5A 3QXPA 3UMWA 4BN1A 3R22A 2VWZA 3OMVA 3P9JA 3RCDA 4BCGA 3LCDA 4BZDA 5K0XA 3O71A 3OUKA 3OXIA 4O2ZA 1Q8UA 4V01A 2OXYA 3K3IA 4X2GA 4BCKA 4F6WA 3U6IA 4FZ6A 5CEQA 4WSQA 3DXNA 5M4FA 3TT0A 5BPYA 3QTQA 3D5VA 4KSPA 2C6LA 4CMOA 4X3FB 3GP0A 2E9PA 5JZJA 2I7QA 4JAJA 4IB0A 4TZRA 4E3CA 3Q6UA 2CPKE 5JFVA 2JDOA 4DFLA 3U55A 2W17A 5CXHA 4AACA 3K5VA 2VD5A 4ZTHA 4IADA 3LCOA 5LVMA 5JEBA 4II5A 4ID7A 4RJ6A 4OTRA 1OIRA 3RPYA 4BL1A 4OT6A 3TM0A 4FKRA 4R78A 3K54A 5JFXA 2XYUA 4LRKA 1QPDA 5BVFA 2XS0A 3PLAE 2UW6A 2R3PA 4M3QA 2CLQA 4BCPA 2PZYA 1JKTA 1ZZLA 2F57A 4IZYA 4G1WA 4ZTLA 2J90A 2C5OA 4W9XA 2CDZA 5L8LA 3EQRA 2WTCA 3C7QA 3MIYA 2YDKA 2XP2A 4IHPA 3HV5A 4M14A 3IO7A 4QYHA 4CKJA 4FEXA 2JDVA 5ANOA 3O8PA 3E8CA 3I7CA 4K6ZA 3ET7A 1M2RA 4QMUA 4F7NA 3DCVA 3PXFA 2DUVA 1ZYLA 3P79A 3EOCA 2G01A 5IA0A 3DU8A 4LOPA 4OTWA 5HTCA 3FYJX 3P4KA 4YJPA 4IFCA 4CQGA 5J9LA 2JC6A 4RWJA 3BHVA 3C51A 3MPTA 3OTUA 4TYHA 3LXLA 5ANGA 5HG7A 3UZPA 2UZWE 3EN6A 4XLVA 3ZM9A 2UZBA 3TTJA 3AT3A 5HCXA 5HE3A 1WVYA 2QOLA 3NNVA 4L53A 4HVIA 3CE3A 4YC8A 3T3VA 4D2VA 2HZNA 3OOMA 5HCYA 3KXHA 2C1BA 5CF8A 3H30A 1XO2B 1BMKA 4M7IA 2UUEA 1G5SA 2WMSA 4AA0A 4J8MA 3NSZA 4Y83A 4DFYA 4EYJA 4FV2A 3MB7A 3KMUA 5ETIA 1FPUA 4RFYA 1IASA 5FRIA 3W32A 3ERKA 4KKEA 1PF8A 4WRGA 5M4UA 4XMOA 3DQXA 3F5GA 3Q5ZA 3E62A 3PLSA 4CNHA 3N4UA 4AS0A 4DBNA 4PNKA 3W2OA 4O84A 4EQUA 3BIZA 4XOZA 4R7HA 3FZRA 3ZHPC 4IX5A 1B6CB 2W05A 5HBJA 3FI2A 2J4ZA 4RVTA 3V5JA 1WVWA 3BCEA 3NX8A 3R00A 4L42A 5LVNA 1OI9A 4F64A 2E2BA 3QKMA 4RBLA 3NUYA 4H3QA 3RK7A 2R3NA 3QC9A 4OGRA 4GVAA 4HNIA 2A27A 5J9ZA 4K33A 2HENA 2RSVA 3WZKA 4L6QA 4MWHA 5HD7A 4LRMA 2F2CB 5DPVA 5A4TA 3SRVA 3UIXA 2UW4A 1GIJA 2GU8A 4FSUA 5IUHA 2X2LA 2VO6A 4LV5A 4D2TA 4F7JA 5CZHA 4RGJA 3FZSA 3RP9A 4NM7A 3FQSA 4UX9A 5M55A 4JDIA 3IGGA 2A0CX 5CQUA 3KULB 2JAMA 3WYXA 5AMNA 5AAGA 4RFMA 1ERKA 5IQEA 2BAJA 1S9IA 3COIA 4O0RA 3RAHA 4EWQA 5DNRA 3PIXA 1ZOHA 1UNLA 4ACCA 3SVVA 3U9NA 2PSQA 2ZV8A 1PJKA 4AZWA 3F66A 1SYKA 1Z5MA 2ERKA 1YXVA 2GTNA 2XKCA 4H3BA 4C36A 5HIEA 1SNXA 3Q4TA 2YACA 4RLKA 4YZBA 3MBLA 2GNFA 3IG7A 4V0GA 4KBCA 3GOKA 1Q8YA 1JVPP 2B7AA 2JLDA 3ENMA 4DH5A 4CYIA 3NUUA 4F0FA 2VAGA 2UW0A 4I23A 3R9DA 4D0WA 1MRYA 2JIVA 2HOGA 3RPOA 3A60A 3CKWA 4XG8A 4YSMA 5AM6A 4EQCA 3NMUF 1V1KA 5FGKA 3E5AA 5K0KA 5BYZA 1QMZA 3NYOA 2X4ZA 4J95A 5EM8A 4D9UA 4D9TA 2O2UA 5FLFA 3OWJA 2Z7QA 4L7FA 5ETCA 4PMMA 1WAKA 5KMMA 2BZHB 4W4VA 2QOCA 4GUBA 3RAKA 3A4OX 3G51A 4YPSA 2XYNA 2ONLA 2V5QA 3F9NA 4ZLZA 2VNWA 4R3CA 3HKOA 4BIBA 4QP1A 3Q9XA 1H26A 2I1MA 3DBFA 3B8RA 4BRXA 4AU8A 1PMNA 4EBWA 4QP9A 2KTYA 1H28A 4UMTA 3ZRLA 3A7HA 4E6AA 3G0FA 4XRJA 4I24A 5HLPA 3A99A 4A7CA 3S3IA 4O7TA 3DZOA 3T9TA 1H0WA 3GC7A 4X3FA 4O96A 4ZZOA 5C26A 3HECA 1B39A 3QKKA 5D41A 5BVEA 3LIJA 2YWVA 1F5QA 2OIDA 2JBPA 3AD4A 4EBVA 3G5DA 4PDSA 3W2RA 3G15A 3BHUA 3NGAA 3BELA 4IAAA 3VW6A 3PVGA 4BTJA 4QMOA 5HZNA 3N4VA 4IAIA 2JIIA 2RKUA 3PJ1A 5K5NA 4OLIA 3KRLA 3ZU7A 1OM1A 1KOAA 3WF9A 4ZTMA 4QTBA 2X6EA 3GCPA 2WIPA 4BF2A 3NYXA 4GEOA 4MWIA 5EK7A 4FV9A 5EG3A 3QALE 3MWUA 2IVUA 3CTHA 4M0YA 3U6JA 4QPMA 1A06A 4MBLA 4G5PA 3IDCA 4EC9A 5L8KA 2PHKA 3EQFA 5EW8A 2ITTA 3QKLA 4YZCA 2C6TA 5FEEA 3NUPA 1PXMA 3I1AA 3TNQB 4HOKA 4QMVA 3IS5A 4C33A 3I60A 2WNTA 4YBJA 3ANQA 2ZYBA 5FM3A 5LMBA 1WBOA 1Y91A 5C8MA 4D5HA 4W8EA 4U43A 4F99A 4FUYA 1UKIA 5ANIA 4CKIA 4NW5A 5AA8A 3H3CA 1Q8WA 2J50A 3P5KA 4FUXA 4M66A 3WF5A 3LFEA 4E4MA 3LQ3A 4O1OA 3W16A 4CZUA 3CQWA 3C13A 2CNUA 1FQ1B 3CBLA 3R02A 4AT3A 4UMPA 3AMBA 3NCZA 2PMIA 4FZFB 3W18A 5H8EA 2KULA 2XNOA 5HNGA 5BQ0A 4TNDA 1Q5KA 4GJ3A 1LR4A 3SD0A 2CKQA 5IQBA 3HX4A 5E4HA 4DTAA 4FEVA 2BIKB 2J0MB 4TKSA 3LQ5A 2YCRA 4BZNA 4PTCA 3LCSA 3GI3A 4EH7A 5F9EA 3QF9A 4NSTA 3UNKA 1X8BA 3L8VA 4Y5QA 2C47A 4WG4A 2WQBA 5D11A 3VS4A 3I7BA 4YHFA 3V5PA 1Q3WA 2X4FA 5E8UA 3D5WA 2R5TA 3COHA 3LCTA 3QUDA 3QQJA 1A9UA 4CVAA 2CN5A 1H1QA 5IMEA 5D10A 4TYGA 1PRYA 4CG8A 2OICA 2W4JA 3LFCA 4J98A 4QYEA 4I41A 2A1AB 4UB7A 5HIBA 1Y6BA 2X1NA 4AW1A 4ZP5A 4OTHA 2P55A 3R9NA 5JSMA 1R3CA 1ZY5A 4EH4A 3EZVA 3CTQA 4CFUA 4XHKB 5B2KA 5LOHA 4IVAA 1IEPA 4N57A 5HIDA 4R8QA 2Q0BA 4PNIA 4AA5A 4G2FA 4OAVB 3MV5A 3FZOA 3SV0A 5LXMA 4BDGA 2VTHA 3TNWA 2H8HA 4XRLA 4CT2A 2UZOA 4UMQA 1PW2A 5GNKA 5CEKA 3UJGA 4EOQA 5CYIA 3MFUA 3FZTA 2ZOQA 3DXQA 1JNKA 4O7RA 2J6MA 3KULA 4KKHA 3FXZA 3E88A 3VWAA 3ZUTA 1PYEA 5AUTA 3IQ7A 5LJJA 4U42A 2HIWA 3IW5A 5BX0A 4ARKA 4FTLA 3NS9A 2B1PA 4I0SA 3FL5A 2FH9A 4IVBA 4JXFA 4EUTA 3VF8A 1OKVA 4Q5HA 4DEAA 5TO8A 5HVJA 3V6SA 3S1HA 2Y4PA 2QNJA 3HGKA 3VUIA 3CPBA 2YHVA 4G5JA 4NM5A 4I6HA 5ICPA 5HI2A 3S95A 3S4QA 2ZB0A 4MHAA 3R2BA 4D1SA 2VTQA 3OW4A 4FL1A 4BCJA 3Q6WA 3RINA 4H36A 3ZRMA 2ZV7A 2QOBA 3ELJA 1FOTA 4P4CA 4DF3A 2ACXA 4Z9LA 2PVRA 2UZLA 2OG8A 1OPJA 2V0DA 3BWJA 2GTMA 3HMNA 5HU3A 4R3PA 1JLUE 3C4FA 4ITJA 3VS3A 2VRXA 1YOJA 4N0SA 3SOAA 4C37A 2QQ7A 3IPHA 4CEGA 5DT4A 5CASA 3ACJA 5J87A 4UWCA 3CLYA 4DINA 3AC1A 4JG8A 2OF4A 5M51A 1XBCA 5GJFA 3VUGA 4QMMA 5A14A 5D7AA 1REKA 2C5NA 4IEBA 2W99B 4C3RA 4F09A 4PP7A 5KMJA 4MKCA 3NNWA 3OVVA 4K77A 3RPVA 5KCVA 4A9SA 1YDTE 2YM8A 2YCFA 2X2MA 4C57A 3LKMA 3PY1A 4P7EA 2EXEA 3H0YA 4DEBA 4FT7A 5CU4A 2JBOA 2C6KA 4F9WA 3DDPA 3OXTA 3F3TA 4GIHA 4YLJA 4TXCA 1YI3A 4KB8A 3JS2A 3GC0A 2JDSA 5AV1A 3V5LA 4BCIA 3GFWA 2FGIA 2GNHA 5EI8A 1VEBA 3FKNA 4CTBA 3JXWA 4UXLA 4PRJA 3C5IA 3NW5A 5AP5A 5I5ZA 3II5A 2WD1A 3UVPA 5FD2A 4O7LA 2HELA 3TJDA 3UC4A 3EYGA 5EI2A 4D5KA 4D4VA 4YJTA 3Q96A 3ORNA 3LMHA 2R0IA 2ZM4A 3AC5A 1FVRA 4JG7A 2RFNA 2QKWB 2WPAA 3RMFA 3F7WA 1NXKA 4ZJIA 3D7TB 3GQIA 4OTGA 3F5XA 3FXXA 4EOLA 3C0GA 3REPA 3ZLYA 3QAME 1W0XC 4PX6A 4I0TA 1CSNA 1UU8A 4CG9A 1W84A 2VGOA 3LJ1A 3OOGA 3MVHA 3UDBA 1ZRZA 2QLUA 3DLSA 4XH6A 1STCE 3ZM4A 3FLWA 3ZRKA 4APPA 5LMKC 4E8AA 2RFDA 5I9ZA 4W9WA 3KL8A 4MBJA 5FM2A 5IPJA 4B99A 2JITA 3LFBA 4FV3A 4QP6A 2XKEA 4YP8A 3TZ8A 5H9BA 3VBTA 1YHVA 4RRVA 3ZEWA 3VVHA 1ZMUA 2BMCA 2Q0NA 3DOGA 2WQOA 2R7IA 1I44A 4QP4A 3QU0A 2CKEA 4FGBA 3PXZA 4O6EA 4WT6A 5KMNA 4ZSAA 2E9UA 4N70A 5T68A 4DFNA 2FSTX 3R1QA 1XH6A 2WELA 4GYIA 1WMKA 5FXQA 2SRCA 4C3PA 1YWRA 3W10A 2GNJA 3UGCA 2WTIA 3RI1A 4C59A 3QUEA 2PMOX 1CDKA 3TJCA 3QCQA 4D55A 3UNJA 1CM8A 2WTWA 5T3QA 3R01A 4KS7A 3JY9A 4JDKA 2HWPA 4WA9A 5E1EA 4D4RA 2ITZA 3V8WA 3VS2A 2XM8A 1BLXA 4IWQA 3UOLA 2GSFA 4ZS4A 4G16A 4GCJA 1FVTA 4FNWA 3DAEA 2IVSA 2WQNA 3ZCLA 3V6RA 5TE0A 2WHBA 4CZTA 3U4WA 4ACGA 5AR3A 4ORKA 1H24A 4ZEGA 2ZV2A 5EYMA 2VTPA 1CKJA 2I0YA 2G9XA 4XNEA 4EWHA 3R1YA 3TL8A 4QTCA 2W1CA 2C1AA 5IH6A 4TY1A 4C02A 4CFVA 4PMPA 5C8KA 3KK8A 4NZWB 2X2KA 2W1DA 4ALWA 1L8TA 4MD7E 2VTAA 2XNMA 3D5UA 4RVKA 4F0GA 4FNZA 2BROA 5AUUA 1FBNA 4BCNA 1HOWA 3A7IA 4U40A 1IAHA 3KF4A 4RIWA 4RZVA 2PMNX 5FWKK 5JN2A 1H1PA 2C6EA 4F4PA 3RNYA 5B2LA 3RHKA 5L2SA 5L4QA 2VTMA 4IBMA 5GZAA 1KE7A 2YA9A 5ITAA 2QODA 3D5XA 4IQ6A 4O86A 3A2CA 4FVPA 1PY5A 5HNIX 4DH3A 4C8BA 5HVKA 4RC4A 3KRXA 4UZHA 2CLXA 4XP3A 3RTPA 4RSSA 5AAEA 5C1QB 3MYGA 3QRTA 4K1BA 2WZJA 2X6DA 1RQQA 4BFMA 1XHAA 2B0QA 3EQCA 4BCFA 3SDJA 3GU8A 2QO7A 2VTOA 2B9IA 3BWFA 2OH4A 3ORTA 4Q5EA 1XH5A 3CJFA 3QX2A 4L8MA 5LWNA 3QCYA 2PUUA 2QU6A 3VBVA 4H05A 4O81A 5FTGA 3PPJA 4G6OA 4ASXA 4D4YA 3MJ2A 4MK0A 3GU5A 4WNPA 2R3LA 5EDQA 1Q8ZA 2XUUA 3Q9WA 5J95A 4I6QA 2P4IA 4E4NA 2B9JA 3UZRA 2WQMA 3KN6A 3B8QA 3FLYA 4U9AA 4LQMA 4ENXA 3HMIA 3C4ZA 4ZTSA 4X2KA 3RALA 4EH6A 2PVFA 2C3JA 4EH3A 4YJQA 4AUAA 1JOWB 1GZKA 4BI1A 1O6LA 3FY2A 3VUHA 3WZUA 1OMWA 2GDOA 2R3KA 2CHLA 5BVKA 1K9AA 1REJA 4FT9A 5M53A 3LXPA 5H8GA 5AP7A 3WE4A 4DLJA 2PVNA 4XBRA 3KCKA 5CEMA 4JQ7A 5CY3A 5K5XA 2C6DA 1G8AA 4E20A 5DN3A 4EOKA 2OI4X 3UO4A 5DG5A 2CCIA 1Q97A 4M84A 5DFPA 3EQGA 2XEYA 5K4JA 2GHLA 5M09A 5FQDC 5CU6A 2VV9A 3LAUA 3R8MA 3IW7A 3MW1A 4BCQA 2HYYA 3QTWA 2VTLA 5AUZA 3R7OA 5HHWA 2E9NA 2PZRA 1H00A 2ERZE 4NKAA 5CZIA 5L2TA 3P23A 3DKOA 3NLBA 5I9VA 2WMAA 2C6MA 5H8BA 4DA5A 3FPMA 4M13A 3RBWA 4C58A 4CTCA 1H01A 4RX9A 1ZMWA 3DBEA 3M42A 4E5BA 5IQFA 3V04A 3FUPA 4IJPA 4M15A 3IW4A 4FIFA 4ANLA 4EK4A 4AA4A 3H10A 4EOIA 4F6UA 4I5HA 4X7QA 4AW0A 4IACA 3HUBA 3DFAA 4DGGA 2YABA 3QA8A 4DFZE 5JT2A 5GHVA 3EHAA 3MPMA 5IQGA 3UOKA 2JEDA 4LL5A 4XV9A 2X81A 4FV8A 1JKKA 3QQUA 4ZAUA 4QPAA 3R2YA 4BTMA 4O7WA 5GIPE 1MQ4A 4RT7A 3TDVA 4Y95A 4PTGA 4O6LA 4E73A 3KXXA 4O38A 3PWYA 3D7TA 2EB3A 3QTZA 3F3WA 4IAYA 4JBQA 1IAJA 2X9EA 2F4JA 4FIGA 2VGPA 3IW8A 2RGPA 1YOLA 3WZJA 2QU5A 1VYWA 5DR9A 1YXUA 1ZXEA 3ULZA 2RF9A 2YAKA 4A9RA 2OWBA 3QUPA 2QR8A 2XNBA 2QKRA 3EN4A 3P86A 4NFMA 3R6XA 4JOAA 4JBPA 4FEWA 1BL6A 1UU9A 4XG2A 3MVJA 3OHTA 3VF9A 4BCHA 3BYVA 3OWKA 5C01A 4HW7A 4YNOA 1LPUA 3I0OA 3Q2MA 4IAKA 4FTIA 2BDFA 4FIIA 3UQGA 2W9FB 4IVDA 3BEGA 1OZ1A 3G33A 3WF7A 4D0XA 1T46A 4E4LA 3OW3A 3PA3A 1P2AA 4ZS0A 4C0TA 2IG7A 5I3OA 2ZV9A 3M11A 4JJRA 4ZTRA 5GJGA 4OT5A 4MVFA 3VNTA 4BHNA 4ZJVA 3EQHA 3Q32A 3W8QA 3NIZA 4QMLA 5HE1A 3ODYX 4PL5A 5LQFA 3CQEA 5L2IA 3F2AA 3EJ1A 5EKOA 3KGAA 5CF4A 3FSFA 2QONA 2QVSE 5IUIA 3W55A 5D9HA 3NW7A 5A4QA 4NU1A 3H4JA 2W5HA 2PULA 4RX8A 3PPZA 2WIHA 4RA4A 2QHNA 3UVQA 4BGHA 2WTKC 5DWRA 3VUTA 3R1NA 4NTSA 2IZSA 1Q61A 3OD6X 5HGIA 1OIYA 3WILA 1P14A 4ENYA 1GY3A 3ZO3A 2OBJA 2CSNA 2NRUA 3BHYA 2Z7SA 4K0YA 1YDRE 4HYIA 5DE2A 3G90X 4MQ2A 4MXYA 5AV2A 3M2WA 3TKHA 3FDNA 3TDWA 1M52A 3E92A 4ITIA 1OKZA 4UMRA 3U54A 4EQMA 4QQTA 3CEKA 2XNEA 3OWLA 1OUYA 3BBWA 3PJ2A 4FL3A 4GJ2A 5F95A 2XK8A 3AC2A 3ACKA 3V5WA 4X6RA 3Q9ZA 1SVEA 3NNXA 4CD0A 5G1XA 4IC8A 4ZSLA 2QOQA 5AV3A 3ODZX 3AC3A 3WI6A 1YI6A 4IB3A 5DR2A 2EUFB 4X6QC 3FY0A 3DB8A 4HGSA 5HORA 4ANQA 3ORKA 1MQBA 5FP5A 4FSRA 2BZKB 2E9OA 3HRCA 3BEAA 3IW6A 5B0XA 5CALA 1PKGA 2C5YA 3DDQA 4MH7A 4F6SA 5HCZA 2YDIA 4BDKA 4OBOA 5CAUA 3KFAA 4E6DA 4BBFA 5KZIA 3QQFA 5DGZA 3QTXA 2BHHA 2QLQA 5AR8A 4J99A 2XRUA 3GCSA 4HYHA 3ETAA 3FMHA 5CF6A 4W4WA 4IVCA 1OL2A 4U0IA 1YW2A 1Z57A 3QLGA 4AN2A 3H9RA 2VX0A 5FBNC 3N4TA 2Y0AA 2OXXA 4XEYA 2Z2WA 3VJNA 1IA8A 4FIHA 3CD3A 3PZHA 3WARA 4KBAA 2REIA 3L8XA 2EXMA 1U4DA 3V01A 3ZO2A 3KMWA 3DNDA 2GHGA 1ZYDA 3ZDIA 3ZONA 4O83A 5ANDA 5AIKA 4MF0A 4A9TA 5AIRA 2UVYA 1E1XA 2ZB1A 4M8TA 1PXPA 2WKMA 3PP1A 3PG1A 4RIXB 2HXLA 2YZLA 4G9RA 1FINA 3BRBA 2OF2A 1WZYA 3F2NA 2NRYA 2XF0A 4BIEA 3GENA 3A4PA 2WO6A 3R7UA 1GAGA 4MYGA 4AWIA 4Q2AA 2ITWA 4WG5A 2GMXA 4XJ0A 3UTOA 2BFXA 2J2IB 5A54A 1YHWA 2QO9A 4HPUE 1IRKA 3QHRA 3I5NA 4E5AX 2RG6A 4BDBA 2YIYA 3C50A 1XQZA 3BKBA 3S00A 2JKOA 2ITYA 1RE8A 4FKGA 4N4SA 3KRJA 2XH5A 3CS9A 3L9NA 2C3KA 4YC6A 2PPQA 3FXWA 4O0SA 4GS6A 5L6WL 2R3FA 4BR3A 3GCUA 4EHEA 2F9GA 2GFSA 4AGCA 4EOPA 3D9VA 3VC4A 1P4OA 4PV0A 3PFQA 5CS6A 1YRPA 4FICA 3RHXA 2FVDA 3PP0A 2UW8A 4CFWA 1UU7A 4NTTA 1PMUA 2X7FA 1WFCA 3QD4A 5CWZA 5EFQA 4K9YA 5HTBA 4YJSA 3UG2A 4QQJA 2PUNA 2WTDA 3VS5A 3OBJA 5IISA
chains in the Genus database with same CATH superfamily
3KRWA 3C4WA 3LM0A 4FTQA 4GU9A 3PJCA 3D0EA 2ITOA 2ZDUA 2QD9A 4IDTA 5TR6A 4BDIA 4EZ5A 1KV2A 2FSMX 4IE9A 2UZDA 3W2SA 3HLLA 1Y8YA 4L43A 2BRHA 4U3ZA 3D94A 2BILB 3MY5A 4EOOA 5K4IA 4YHJA 4R1VA 3VS6A 4FKVA 2C30A 3DTCA 5CAPA 2XIZA 4C61A 4Y46A 2RFEA 2XBAA 5BMMA 3OUNB 1P4FA 4PPBA 1M7QA 4FV5A 1OUKA 4C35A 2FUMA 5CEOA 2R3HA 2XIXA 4ALUA 2JKMA 3DK6A 2HZ4A 4CFNA 1ZARA 1ND4A 5EDPA 5J9YA 1H1RA 2O0UA 2B9FA 1GZ8A 2G15A 4JX7A 2V62A 4HZRA 4FIJA 3VS7A 4C2VA 2XANA 3QTIA 5BYYA 2OW3A 4G6LA 4JL9A 4RZWA 4DE4A 3HA8A 3F88A 5C03A 2YLFA 4ZXTA 4FTKA 4AE6A 4GH2A 2UW7A 2FB8A 4JLCA 5CENA 3UNZA 4DCEA 3O17A 4LGHA 1WBVA 3CC6A 4FNYA 4X3JA 4YR8A 4FL2A 5BVNA 5IDPA 5IEXA 3KY2A 2PZPA 5TT7A 1Q8TA 5BYLA 2VNYA 4ACMA 1BL7A 3DY7A 4H58A 2R3OA 4JIAA 5HX8A 5M4CA 2YIXA 2IWIA 2W4KA 2G2FA 2W1IA 3FLNC 3S2PA 3QZHA 2WTVA 4CRSA 3SKCA 3LFDA 2YIRA 4C3FA 1FMKA 2A4LA 3POZA 3ZO4A 4LDTA 1W8CA 3GVUA 3K3JA 3R1SA 4FG9A 3FKOA 1DAYA 2V7OA 4A06A 1LUFA 3JR1A 5AP3A 2AUHA 5AUXA 2W1ZA 4J97A 4FEQA 1JBPE 3OCGA 3UZTA 4X21A 5G6VA 4YHTA 3E3PA 3O0GA 4C4JA 3LFSA 2EWAA 4IWDA 1TQIA 3MDYA 4DHJA 4P5ZA 4E6CA 3AKJA 4D28A 2JIUA 2OJFE 5JRQA 4D1ZA 2AC3A 3QLFA 1JWHA 5EYCA 1U46A 1LP4A 3MA6A 1DM2A 4FTCA 3PZEA 1FVVA 4IZ5A 4QMTA 5A4EA 4JIKA 3RPSA 3AG9A 1M17A 4QOXA 5AM7A 3R8LA 1BKXA 4A9UA 3RAIA 4RG0A 4D4SA 1WVXA 2CGVA 2WOTA 4QYGA 5AADA 5DYJA 3V3VA 5LMKA 3LPBA 3S0OA 1PMEA 1OB3A 3TV6A 4GKHA 3N51A 1QPJA 3IECA 1GIHA 2BAKA 3IOPA 4FRFA 4LGGA 4G6NA 2ETKA 3TKUA 5EM6A 3EFLA 3DQWA 3FJQE 5LMAA 5BNJA 2QO2A 1U5QA 3FMDA 4U5JA 2F2UA 2XCHA 3PSDA 3ZLSA 4QPSA 1PXNA 4ANOA 4QMQA 1PXLA 3D7ZA 3OXZA 4LMNA 5DR6A 3RZFA 1OKYA 3KREA 4DAWA 4HCUA 4S34A 3QZGA 4FTOA 4FTJA 4I92A 5E91A 4AZSA 4U44A 4USEA 5HESA 4QMNA 2BKKA 1DS5A 4KS8A 4GRBA 5BUIA 2PVKA 5CVGA 5HBEA 1ZZ2A 2C6IA 5KKRB 3PVUA 3FYKX 5A9UA 4EK5A 3RKBA 4ZLOA 3ORIA 4XS2A 3KMMA 1M2QA 2I40A 2BFYA 4YMJA 3W0MA 3NR9A 4TYEA 5HKMA 2WTKB 4O0UA 2X39A 4I5MA 4J52A 5IMXA 3EQBA 3RM7A 3FMEA 2I0HA 4EHVA 2WMTA 4A4LA 3O5AA 2NPQA 3BPRA 3QC4A 4IH8A 3OBGA 3PXKA 3F5UA 4KUJA 4XV3A 3I81A 4GMYA 3OEFX 3SXSA 3W0RA 2B54A 3CSVA 5KNJA 2JKQA 2HY0A 2UVXA 3C0IA 5AUVA 3RAWA 4AXDA 1CKPA 4R7BA 4YO4A 5E92A 5BUEA 5B7VA 5LARA 4KIPA 4PL3A 3BZ3A 4FX3A 5HLNA 4EHGA 4WBOA 3GEQA 2H34A 1NT2A 4PMSA 4MX9A 4U3YA 5E7RA 5AJQA 2HZIA 3HAVA 3ZDUA 5KMLA 1BUHA 4H3PA 3NFFB 4MXXA 2PVHA 5IF1A 4GT4A 5GIOE 4TTHB 4DN5A 2F7EE 3OT8A 1YVJA 2YM7A 4FSMA 5AP0A 4O27B 3F61A 2O64A 2WMWA 3G9LX 5GZ9A 4CCUA 4EK3A 5CVFA 3AOXA 3V8TA 4WSYA 5EKNA 4NIFB 1JAMA 5EOBA 5IA1A 4QO9A 2CMWA 3GUBA 4RQVA 3DXPA 3W0QA 5J5TA 1KOBA 4YJUA 1MRUA 1SNUA 5JRSA 3O51A 4YURA 2RL5A 2WXVA 2OLCA 4DGMA 4DEDA 2FYSA 5AR7A 5HBHA 1OVEA 1W83A 3QTRA 4KAOA 1CMKE 2BUJA 2G2HA 2JFMA 4HVSA 4BDHA 2GFCA 2HXQA 3OCBA 3SHEA 4P2KA 3TUCA 3NWWA 4BYIA 3BE9A 3QCSA 4U80A 2H9VA 5E1SA 2R3MA 3FHRA 1JPAA 4C4EA 4GV1A 5DT0A 4DC2A 4YTCA 5JGBA 1SVHA 2ITXA 3HUCA 4LOOA 3BYMA 3RCJA 2C0TA 4XBUA 4BBMA 2WOUA 5ETFA 5F20A 5HO8A 4ZZMA 1WBWA 4MNEB 3F2RA 5DVRA 3F3ZA 3VHKA 3MB6A 4I4FA 3EIDA 5C9CA 4ZY5A 4QTAA 4AAYA 1XJDA 2IW6A 2JGZA 3CCNA 3GU4A 4IB5A 4S2ZA 3T3UA 2ZJWA 3IDBA 4CV9A 3ZFYA 5L6PA 5IDNA 3LFAA 3NNUA 4KD1A 5GINE 4I22A 3BLHA 5I9YA 3GQLA 3D2KA 4AGDA 4GSBA 3MIAA 4OTQA 3O8UA 1V0BA 1YXTA 4PPAA 3GOPA 4IC7A 3NUAA 2OKRA 1KE6A 3DGKA 5EHLA 4BGGA 1F0QA 3MTFA 2W06A 4AW5A 2O65A 4I5PA 2B9HA 4AT4A 1PXIA 4L46A 3E3BX 1H8FA 1L3RE 1Q3DA 4CCBA 4DGOA 4UXQA 4BBEA 5CSWA 2V7AA 2ETRA 4D2WA 1H27A 3QRKA 5IZFA 3NZ0A 3QD3A 5FXSA 3MH2A 3U87A 5HE0A 2F7ZE 3GB2A 3HNGA 4NUSA 3R7IA 3HRFA 3DJ6A 3JPVA 4KINA 3WIGA 3UPZA 4ONAA 4WNMA 4IX3A 4XP2A 3ORMA 3UP2A 2PYWA 2W0JA 4AFEA 3QQGA 2UZNA 3Q4UA 1EH4A 4QTEA 2EXCX 3L8PA 3PPKA 3SX9A 3T8OA 3PY3A 2VWBA 4ACHA 4DCAA 3QQHA 5AAFA 4KWPA 4AFJA 4D58A 1OITA 3ORXA 3BLRA 2X8IA 2Z7RA 3OF0A 4BCOA 4D1XA 4NCTC 5M56A 2UZUE 4WNKA 4UZDA 4FE2A 3RVGA 3ALNA 4Q9ZA 2P2IA 1ATPE 4FKPA 3SG8A 4O22A 4LMUA 2UZEA 4I0RA 5F94A 3R7VA 2BRBA 1J91A 3UQFA 4FKTA 4WRSA 3DT1A 2IPXA 3ZLWA 2IN6A 4FOBA 4FEUA 4DEEA 3VN9A 4EOMA 3HDMA 5IQIA 3PJ8A 5DA3A 3HRBA 3R63A 4FYNA 4BI2A 2CNQA 4AOTA 3ID6C 2HZ0A 3HV4A 3K2LA 1W2DA 3JUHA 4HGTA 4JBVA 4LYNA 3FPQA 1XWSA 4U8ZA 3SLSA 3ZS5A 4PDOA 4BWKA 1ZOGA 2BRNA 3LMGA 4FSZA 4OTIA 4QP3A 5EM5A 3MY1A 2R9SA 4QYFA 2BHEA 4FSWA 4RC3A 4XX9A 3U9CA 4CQEA 4G3CA 3HMOA 4D2PA 3H9FA 4YGAA 3G0EA 4GG5A 4W4YA 1AGWA 2DQ7X 4NYEA 1M7NA 3ULIA 2Y6OA 4IW0A 1ZWSA 1NVQA 5AX3A 4FA2A 2OIBA 2HWOA 3TIZA 4HVDA 4L7SA 3A7GA 5EW9A 3CQUA 5LCKA 3UYSA 2R7BA 3DBQA 2YISA 4JQ8A 5IA5A 3VIDA 3NIEA 3WBLA 1UA2A 2PMLX 2R0UA 4C4GA 2OH0E 3QCXA 3UC3A 5BUJA 2W5AA 4BB4A 4OW8A 4N6YA 4RWIA 3SQQA 4EORA 2XNGA 4BZOA 3UDZA 2WMXA 2IVTA 1PHKA 2OJJA 2R3RA 3GU7A 4IWOA 3R7YA 5IQCA 3C5UA 3DV3A 4O0YA 3OP5A 3O2MA 4FKSA 3RNIA 1GNGA 3R9RA 2ZVAA 2B52A 5A4LA 4O7VA 3W33A 4LRJA 4UY9A 4O4FA 2FSLX 2FO0A 3C0HA 4ERKA 2R3IA 4EKLA 3FQHA 4WKQA 4J71A 2OZAB 4QMPA 4RJ8A 3UOHA 4EC8A 3C4EA 5CSXA 2XJ0A 3VJOA 3CTJA 2O8YA 2W1GA 3FL4A 4LUEA 4LGDA 3UVRA 4YJNA 5K9IA 3G6GA 3BQCA 5CEPA 3SXFA 3MTLA 3HEGA 3COKA 3MSSA 3P7CA 2QCSA 4NK9A 2XK4A 3FI3A 5DHJA 3ZH8A 3Q4ZA 4NH1A 3FMLA 4PP9A 3W1FA 4DYMA 4GU6A 4HYSA 2BALA 2PVLA 3UYTA 3R7GA 3O50A 3NRMA 2IW8A 3FMMA 2VWXA 4AN3A 4CRLA 3KVWA 4Q9SA 4IANA 5LVPA 4FZ7A 4EH5A 5CLPA 2CKOA 3U6HA 3EN7A 4E6QA 4TPTA 5AUWA 4D2RA 4TRLA 1SM2A 4FV7A 4NIFA 3HV7A 4RWKA 3AKKA 1Q62A 3GNIB 2WAJA 1JKLA 4C4FA 2OK1A 4O4BB 4YZNA 3MH3A 4AZFA 1RJBA 4IMYA 5DI1A 4MD8E 5E8ZA 5HD4A 4MF1A 5CSHA 1IA9A 4DT8A 3NCGA 4ZTQA 2QG5A 3IONA 5AP1A 4FGRA 3BYOA 4BDAA 4AAAA 1NVSA 3PVWA 4YTFA 4EK6A 3H0ZA 4KSQA 4QD6A 4EH8A 3TYKA 4AXFA 3F3VA 3BU6A 3PJ3A 3FAAA 4HNFA 4TNBA 1YWVA 3E87A 3GBZA 4CLJA 3MS9A 4FG7A 5E8VA 2YITA 5AR4A 1O9UA 3ZSGA 3EMGA 5EYKA 5CXZA 1FGKA 4JG6A 1VLRA 4U7ZA 3GC8A 5EDRA 5IKWA 4FIEA 3CP9A 2VX3A 2VO3A 3UPXA 1W2FA 2BRMA 1NW1A 3L9PA 3DTWA 3QRUA 3TXOA 5T6KA 2Y6MA 1GJOA 3FKLA 3LLTA 3LW0A 3E8DA 4FTRA 1BI8A 2J5EA 3TZ7A 4RLLA 2BTRA 3O7LD 1YHSA 1XKKA 3TEIA 5HQ0A 2QOIA 5KZ0A 3UIBA 3E63A 3PE1A 2UZTA 2XAMA 3OFMA 3TG1A 4HGLA 4O0WA 3CJGA 2WMBA 4FKIA 4NWMA 2OJGA 3VHEA 3MN3A 4V05A 4QMZA 5CANA 3E8EA 3ZUUA 4JR7A 4F08A 4USDA 4UV0A 1Q41A 1E9HA 3DNEA 4WO5A 1IG1A 3SG9A 3DS6A 2C3IB 3FV8A 5BVDA 5CT7A 3V8SA 4FT5A 3V51A 4EZ3A 4O7YA 4W8DA 1UVRA 4PDPA 3UQCA 4O0XA 4FG8A 3UODA 3NEWA 4R5SA 3BHHA 3UO6A 1XBAA 3Q60A 4GW8A 5AV0A 1JSVA 3ZUVA 1XR1A 2ZM3A 3EB0A 5CU0A 5JFSA 1YXSA 1VYZA 2PZIA 4MUQA 3CGFA 2PVYA 3AMAA 3SOCA 4L67A 4EJ7A 1WCCA 4FV4A 1RW8A 3AT2A 5LCJA 4IZ7A 3GU6A 4OTPA 3VW8A 3BI6A 3LFNA 1YOMA 2XIYA 4U6RA 4AZTA 2A2AA 3QGYA 4XOYA 2ESMA 3BGPA 4FKJA 4WHZA 5BVWA 4KIOA 2VN9A 3FMNA 4ACDA 4M69B 5HG5A 2X0GA 4BHZA 3D15A 3HAMA 5DEWA 4S30A 3OG7A 1JKSA 3A61A 3WZDA 1Q24A 3FI4A 3HYHA 1Q99A 3ATSA 2PZ5A 4O7SA 3PE2A 4FKQA 4IM0A 3QFVA 2XALA 5I3RA 4FK6A 2JAVA 4RMZA 4PPCA 3TNHA 2YN8A 3U8WA 3KA0A 5D1JA 5EHOA 3F5PA 1UV5A 1WBNA 5AA9A 5AV4A 3ZC6A 1V0OA 4DH8A 3HP5A 2VWYA 2GCDA 4EH2A 1URCA 4DLIA 5J7BA 3PSCA 5ANEA 4B8LA 1MP8A 3C4XA 4BGQA 4GL9A 4ZY4A 5KO1A 1ST0A 3FLSA 3HL7A 2LGCA 3OTVA 4E4XA 3TIYA 3TUDA 3SRVB 2NNWB 3EQDA 4YTIA 4IX4A 5KE0A 4RX5A 4G3DA 4NM0A 4MXOA 3ZXTA 3TNIA 3ROCA 3QQLA 3QBNA 2XB7A 3EN9A 4LV8A 4H1JA 5IH5A 3I79A 4GIIA 3MI9A 4NL0A 4I94A 2YJRA 2UV2A 4GK3A 5DRDA 3VUMA 1YQJA 3QHWA 3DLZA 1KE5A 3GC9A 1V0PA 4UYNA 4AXEA 2P3GX 3LLAA 5IQHA 1NY3A 3ZZWA 2F7XE 4I1ZA 2RFSA 3F7ZA 4IFGA 4L3PA 4EOJA 3EQPA 2QHMA 3Q3BA 2XZSA 4FVQA 3EH9A 4JX3A 4CFFA 2XVDA 1OIUA 1A48A 2YLEA 4DHIB 1KWPA 2WB8A 3RK9A 4XG6A 4KIQA 5KKRC 2ZMDA 4V0GB 2OZAA 4ZSEA 4BDJA 4BDEA 4IWPA 4ZSJA 4AOIA 4O7NA 1W82A 4AE9A 5IA3A 3QZIA 4HJOA 4I6LA 2BCJA 3LM5A 4GFOA 5HTIA 4PL4A 1OBDA 3L8SA 3VO3A 2C5XA 3R30A 3TZMA 3BV2A 2HK5A 3Q04A 4FSTA 3TKIA 2IJMA 4NM3A 3LCKA 5KBRA 3TUBA 4R77A 4KBKA 4U81A 5H3QA 3D83A 4I5CA 2XM9A 3QQKA 4FZAB 2XIRA 4X2NA 3DKGA 2OFVA 3WE8A 1FGIA 2XA4A 3I0QA 4XP0A 1S9JA 3BU3A 3AD5A 2X9FA 3RGFA 2NO3A 4PDYA 3QD0A 1VR2A 2VWUA 4M67A 4QYYA 5D12A 3R83A 3TZ9A 2C0OA 4ANBA 4CMUA 5BMSA 4MXZA 4B9DA 2VWIA 2W96B 2VTTA 4RJ5A 2WMRA 4HZSA 3HVCA 4YSJA 3POOA 2CGXA 1WBTA 2H6DA 1G8SA 3FC2A 4RWLA 4B4LA 5HO7A 4AXCA 1OPLA 2JKKA 1UKHA 3G2FA 3UIUA 4G3GA 4L45A 3ZC5A 5LWMA 2AYPA 4AXAA 4BJJB 4ZK5A 3RWQA 1AQ1A 4FODA 2X0OA 1SVGA 5HNBA 4A9YA 3VBYA 2QOOA 5IEYA 4ASZA 4W4XA 3Q9YA 3QXOA 5M08A 3P7AA 3L1SA 5CAOA 4G9CA 2EU9A 4NKSA 5TOZA 3V5TA 3EZRA 3ORZA 4EH9A 2W1HA 1ZYCA 4BICA 2IO6A 4M12A 4UALA 4ASDA 3LQ8A 2VUWA 3PSBA 4NJDA 4YJOA 2BZJA 2OSCA 4P5QA 4RJ4A 1LEWA 4ZOGA 4RVLA 4U79A 4I4EA 4DEHA 2C68A 2BKZA 3AGLA 5DBXA 3SXRA 4EYMA 5ACKA 2FA2A 2Y4IC 5DRBA 2OJIA 4JR3A 4BCMA 4USFA 4FR4A 3TV4A 2VU3A 2H96A 3P7BA 4WIHA 5ANKA 3R21A 2A98A 4IAZA 4UEUA 4GKIA 5CI7A 3N9XA 4DGNA 1H1SA 4C34A 4HVGA 1VJYA 5BVOA 4FT3A 4A07A 5C8NA 4FKLA 5CX9A 5ACBC 2J0JA 4R7IA 5FTOA 3MH1A 3CPCA 2JFLA 4E26A 1PXOA 3BHTA 3PIYA 4HCVA 3K5UA 4YO6A 5E8WA 1Y57A 3VUKA 1AD5A 2B53A 5J7HA 4F70A 2J0IA 4FSYA 3QRIA 2W9ZB 1UWHA 3IOKA 4YJVA 1XMLA 5M06A 4GT5A 2J51A 3AT4A 1XH9A 2WEIA 4K18A 2OZOA 3ZTXA 4JQEA 4AGUA 4TYJA 3MA3A 4YZDA 4L00A 3NVMB 5EQYA 4QMXA 5C4LA 4DTBA 1H4LA 3KC3A 4QQCA 3MY0A 5HLWA 2HY81 3R8PA 2HW6A 5IQAA 4DDGA 5KX8A 4BC6A 1OKWA 4BYJA 3I6WA 1DI8A 5EQPA 5I9WA 3O96A 2F49A 5EM7A 3I6UA 1T45A 5GZ8A 4FSNA 2VTRA 2BZIB 4S32A 4M69A 5J8IA 1K3AA 1ZMVA 5HG9A 4LUDA 3QYWA 5CSVA 4JDHA 2X8EA 1PKDA 2HCKA 3DB6A 4J53A 1TZDA 5LVLA 4IXPA 5A3XA 1NVRA 3AC8A 4U41A 3WOWA 5M44A 4ZSGA 1H25A 2I6LA 3PY0A 3EQIA 2IZUA 4J96A 4WNOA 3AXWA 3QYZA 5HVYA 3VS0A 3EFJA 1W98A 4RA5A 1H08A 1UNGA 1PXKA 4QQ5A 3HMPA 3P78A 2VWVA 5CNNA 3UOJA 3I4BA 4KABA 3CIKA 2Z02A 1UWJA 5E8TA 4CSVA 5I4NA 4PUZA 3HP2A 2AC5A 3VAPA 5E8YA 5CF5A 5H2UA 5L6OA 2C69A 3AKLA 3FI8A 4AQCA 4EONA 4WG3A 4Z7GA 4ZTNA 1OIQA 4RJ3A 5DMZA 4D2SA 2X7GA 5JQ8A 1YXXA 5K3YA 1G3NA 1FMOE 3BYSA 3KU2A 1GOLA 2ITUA 3ZXZA 4E7WA 4B8MA 4RQKA 5LVOA 3DAKA 4EI4A 2LAVA 3ZLXA 3F6XA 3KXMA 2YZAA 3DK3A 3BX5A 1NA7A 3PXRA 1Y6AA 1TQMA 4C7TA 4DG3E 2BAQA 1APME 4C38A 4AW2A 4G34A 4FT0A 4NEUA 3PIZA 4BTFA 3C4CA 3L9LA 2PUIA 3MGYA 3LVPA 4HCTA 3THBA 1IR3A 2W4OA 2XJ1A 3P08A 1ZYSA 3ZOSA 2CNVA 3KXGA 4NCTA 4AG8A 2XBJA 4M97A 4FC0A 2V22A 2HW7A 2J0KA 5D7VA 3QWJA 3RWPA 3LZBA 3A8WA 2Y7JA 3HZTA 4MNFA 5AEPA 3KKVA 3KEXA 3KXNA 4I21A 1Z9XA 2R3GA 1OL6A 3DKFA 3IGOA 3DBCA 1OL7A 4J8NA 5TF9A 4YPDA 1YKRA 4O21A 4YNEA 1BYGA 2X0PA 4XG4A 4DITA 3MESA 5CEIA 5AR2A 4C2WA 2OO8X 3FMKA 4BWXA 3JVSA 4DBXA 3UBDA 3VBWA 4FF8A 3LXNA 1SMHA 4DHZA 2R3JA 4ZIMA 2VTNA 3WIKA 5EQEA 2XEZA 3Q53A 4CZYB 4Y72A 4G3EA 2W1FA 3CKXA 3LFQA 3R73A 3L9MA 3P0MA 4JI9A 1KSWA 3E7OA 2WMVA 2W5BA 5A6OA 2XNNA 3ENHA 2PVJA 4DEIA 2BIYA 3NPCA 5M4IA 3FEGA 5BV3A 4ZLYA 2XK7A 2QURA 3FQEA 4JRVA 4EOSA 3VS1A 1M14A 1LEZA 3LXKA 4DGLC 3W2QA 4OR5A 2X8DA 1HCKA 4JS8A 5GJDA 4FNXA 4AZEA 4BIDA 4Z7HA 4Z16A 2GQRA 4PWNA 3W8LA 4L01A 5CT0A 1YDSE 2XNPA 1PYXA 2XMYA 5JK3A 1XH7A 3DBDA 2PL0A 4FMQA 1TVOA 5E8SA 1U59A 2Y9QA 2JD5A 3B2TA 5I0BA 3DJ7A 3JYAA 4DG0E 4OAUC 5HEZA 4G17A 3MH0A 4UBAA 2J9MA 3FSKA 3QWKA 2QOKA 2J0LA 3Q4CA 2CCHA 3OY3A 5F1ZA 3TN8A 3ZBXA 4YU2A 2BTSA 2YEXA 2C4GA 3QX4A 4S33A 3FZ1A 4WBBB 4R5YA 3I5ZA 5J5SA 2PE1A 5FBOA 1Q4LA 2BVAA 4I6BA 1O6YA 1KV1A 3A8XA 4GFGA 4KRDA 4JVGA 1BX6A 2WMQA 2O5KA 3H9OA 3CY2A 4DFXE 3EFWA 2XIKA 4E93A 1DI9A 3D4QA 5EI6A 3BYUA 1OECA 4RIXA 4APCA 3EYHA 4YZ9A 5J1VA 5HX6A 1GZNA 2PTKA 2PK9A 4CT1A 3JY0A 4BDFA 2WU7A 5JH6A 4DFBA 5DIAA 2XKFA 3OEZA 3OZ6A 4UMUA 5HE2A 2JDRA 4ANNA 2XKDA 5HO6A 3VUDA 2NP8A 4BKYA 4O0VA 4F9AA 5DH3A 4PY1A 2VX1A 1PMVA 3QRJA 4FV6A 5AWMA 3R9OA 3ZSIA 5JKGA 5FEQA 4H1MA 4FKUA 3PWDA 2FSOX 4C4IA 1H1WA 3KVXA 4KNBA 4OTFA 3NAYA 3PDTA 4CLIA 3PYYA 1WBPA 1J7IA 3OC1A 4PF4A 2EB2A 4GG7A 3ATTA 4ANSA 4XYFA 5KMIA 1J7LA 3EL7A 3ANRA 1G8KA 1RDQE 2PUPA 3NVKI 4TL0A 3CR0A 3M1SA 1OBGA 1R0PA 3DPKA 5AUYA 2AEGA 5CU2A 5AP2A 5HG8A 2UW5A 2YERA 3TI1A 3BE2A 5KMOA 4MD9E 3GGFA 4QP7A 4TYIA 4YC3A 2J7TA 3BGZA 5ETAA 1KE9A 3WF6A 4A4OA 3Q52A 2CGUA 4FVRA 2IZTA 2PY3A 2YWPA 2QOHA 2ZMCA 2VZ6A 4UN0C 4M68A 4CV8A 5J79A 4UYAA 5B2MA 4K11A 4JBOA 3AC4A 2BPMA 4I93A 3U51A 3FLZA 4AT5A 3UDTA 5JMSA 3EKNA 2BRGA 4BI0A 3LJ2A 2VO7A 4K2RA 2PWLA 3R8ZA 2Y4IB 3OROA 4A4XA 2R3QA 2XK6A 5J1WA 1M2PA 4WUAA 2XARA 4QDVA 2GNGA 2RIOA 4R6VA 4X2FA 2R64A 4MXAA 4FK3A 4RIWB 1HCLA 5DLSA 4CYJA 4R3RA 3EFKA 2BDWA 5I9UA 3NDMA 3MJ1A 3RM6A 2Z8CA 4KIKB 5FXRA 3KN5A 4ZMEA 2WGJA 2V55A 3DJ5A 3IDPA 4FTAA 3KQ7A 3WYYA 2GS6A 3FWQA 4N6ZA 3ZFXA 3R28A 4DFUA 4FKWA 2W1EA 4RC2A 5IA2A 3BV3A 2GS7A 3BGQA 2ITQA 5FUTA 5IH4A 2A19B 4BKJA 3SGCA 4OTDA 4YLKA 2UVZA 4FSQA 2WFYA 4C4HA 5L3AA 2G2IA 2VO0A 3DAJA 3NYNA 2UW9A 2OXDA 3A7FA 1JSTA 4TWNA 5CU3A 3KF7A 2QG7A 3D14A 3CXWA 4BDCA 1ZOEA 2YM4A 4O7ZA 2OJ9A 4CFXA 3KCFA 4QT1A 3BBTB 4FTUA 4XUFA 3GFEA 4BTKA 5HU9A 3DA6A 5JQ5A 5E90A 5DT3A 3VQUA 3COMA 3OCSA 3W0NA 4IAFA 4NFNA 4CKRA 4WD5A 4F9CA 2XJ2A 4F65A 4IM3A 3OT3A 4FTTA 2ZAZA 2PE2A 4LG4A 4QMYA 4EKKA 2HAKA 4MQ1A 2ETMA 4UWYA 3R8VA 3SA0A 4FTMA 3DFCB 3SW7A 3ZFMA 4EJNA 2UZVA 2ITPA 4ASEA 5KBQA 3Q2JA 1P5EA 4FV1A 4LI5A 4RPVA 5L8JA 3SAYA 4YJRA 1QPEA 1OPKA 4ZZNA 4P90A 3CD8A 3DKCA 1TKIA 4AF3A 1QCFA 1MRVA 5IUGA 2GNLA 4I3ZA 1I09A 3NYVA 4ANMA 4JAIA 3C9WA 1U5RA 3FMJA 3O23A 4YTHA 3LMIA 4OBPA 4MTAA 5CNOA 2QI8A 4IZAA 3O7LB 4S31A 3RPRA 3G6HA 2ONLC 4E1ZA 4Z3VA 3TNPC 3TMOA 4OUCA 5IQDA 4F1TA 3RK5A 1SZMA 2VTIA 3U4UA 1ZAOA 3ZO1A 3O8TA 1GIIA 3QL8A 3TCPA 4F0IA 3PXYA 1R78A 2ITVA 3PUPA 4AZVA 5M57A 2C5VA 1OL5A 4QRCA 4HPTE 1YWNA 3MPAA 1OGUA 1J3HA 3QZFA 3R0TA 2OU7A 4MAOA 4Y5HA 2XK9A 2Z7LA 4XLIA 1QL6A 4XG9A 5HOAA 4AOJA 3LFFA 4GK2A 4L3JA 4X3FC 5F4NA 2VTJA 3E8NA 3OWPA 4QMSA 1TQPA 3PA4A 5KMKA 4O4EA 4JNWA 2QOFA 4FV0A 2ZDTA 3KXZA 4PQNA 3V5QA 3NUSA 3PXQA 4Z55A 4IJ9A 5JFWA 2CKPA 3R8UA 3FE3A 3FLQA 3QTUA 1U54B 1MUOA 4RFZA 4RIOA 3OS3A 4AP7A 3UO5A 3R04A 5A46A 2WU6A 2O3PA 3B2WA 3E7VA 5CAVA 4R1YA 3R9HA 2DS1A 5EW3A 4TW9A 3PG3A 2R2PA 5FDXA 3UMXA 3HV6A 4OBQA 3LHJA 4LM5A 3AQVA 1PXJA 4Y8DA 5ANJA 3W2PA 4DH1A 2CN8A 2E9VA