4GK4A

Human epha3 kinase domain in complex with ligand 90
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
275
Chain Sequence
b'VHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITNLLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPH receptor A3
publication title Optimization of Inhibitors of the Tyrosine Kinase EphB4. 2. Cellular Potency Improvement and Binding Mode Validation by X-ray Crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 275
sequence length 295
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gk4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gk4A01
3DAEA 5CSHA 3HGKA 2RFDA 5EW8A 1W82A 2HXLA 2WU7A 3LFNA 4BC6A 1AD5A 3OD6X 3V51A 3O0GA 4X2GA 5H2UA 3PXQA 2XA4A 1H1PA 4ZZNA 4EJ7A 1JVPP 3P86A 4BN1A 4DEIA 2YM8A 1GY3A 4QMOA 2ZAZA 4EBVA 2VNWA 4XLIA 4YHFA 4G31A 4KKHA 2QHNA 3HP2A 3SG8A 3L9LA 3PE1A 2W1FA 4CYJA 2Z7RA 4AA0A 4J71A 1KE8A 1UNHA 3JUHA 3SV0A 1F3MC 2OFUA 3DGKA 2CN8A 3DZQA 4P4CA 4ZS4A 1H24A 4DFXE 4FNZA 2XNEA 3IW8A 2REIA 3KVWA 3EFWA 3FLQA 3VW6A 5KBQA 3SVVA 4GFGA 4DCEA 2VUWA 4JG7A 4CQEA 2G9XA 2W5AA 3UTOA 4C34A 4FT5A 3Q52A 1PYEA 3RBWA 4IC7A 3ZMMA 4EZ3A 5IUHA 5HOAA 4BGQA 3U4UA 5CQUA 4HZSA 2PWLA 3MYGA 2J4ZA 4BDKA 4C4JA 2B53A 2JITA 4KBCA 4DGMA 4I22A 4XEYA 3TNIA 3QF9A 3S4QA 5KMMA 2BROA 3DB6A 4J1RA 4O0RA 1JWHA 4RWJA 4C38A 3GVUA 3R9DA 2I6LA 3D83A 3S3IA 2BHHA 1H4LA 4QP2A 3AC5A 2CNUA 2GS2A 4X7QA 1FVTA 3PY1A 4D1ZA 2VTHA 3P0MA 4DEAA 3I7CA 1UWHA 5FBOA 3QQHA 5K4IA 4Y5HA 2W5HA 2JDRA 2VTAA 1OZ1A 1VZOA 5I9XA 3D9VA 3QWKA 4BCMA 5CSXA 3VS0A 3ZRLA 1VEBA 2QR7A 4RZWA 3LFSA 5HIEA 3AGLA 3O51A 4RC3A 2PE1A 3TKUA 5JGBA 1ZRZA 2BMCA 2WXVA 3BPRA 5KZ0A 2X6DA 3EQBA 3VRYA 5HBJA 4YLLA 3HL7A 3MSSA 2FSOX 4QMNA 4ANBA 3ODZX 2E9VA 3QAME 4LOQA 4B99A 4ZZMA 2XP2A 4EUTA 2LGCA 4CLJA 2PE2A 5CENA 2IZSA 3NDMA 2JKOA 3U51A 3CC6A 3E63A 5CS6A 5BVKA 2XVDA 5DVRA 5HLPA 4KIKA 3VUDA 2JIVA 3VUMA 5I3RA 4FKPA 4NW5A 4QMMA 4BDHA 5K5XA 2WGJA 4MEDA 3EZRA 4MXAA 4RRVA 4GK3A 3A62A 2JEDA 3D2KA 3FZSA 4YPSA 3PIYA 3DBFA 3DLZA 3IS5A 4EZ5A 4EBWA 5JFSA 4YJSA 4AQCA 4KS8A 2VTOA 4OBOA 2Y6MA 4DFYA 3W55A 4KBKA 3P9JA 3E87A 3ZEWA 3PIZA 3VBYA 2Q0NA 4ANSA 3TACA 4EQCA 3E88A 1WVYA 3MPAA 2WO6A 4GG7A 5CSWA 4APPA 1OITA 2Z60A 2JIIA 3TZ9A 4F9BA 5HTCA 5L8JA 4L42A 4PMSA 4S30A 3BYOA 5HHWA 5HO8A 4NTTA 2GNHA 4RIOA 4EC9A 5CF8A 2GHGA 2V55A 2F7ZE 4FZDB 4O7YA 5JKGA 3EL8A 2C6EA 3O2MA 2XCKA 3OWLA 4ITJA 4E6QA 4GW8A 2ITUA 3RM7A 4ANOA 1FOTA 2WOUA 4R7IA 2WD1A 4U45A 1PJKA 1W98A 4QYFA 3ZFXA 4ERWA 2WELA 1ZY5A 4CV8A 4JBOA 5EDRA 3W2OA 4CXAA 2ZDTA 3HRFA 4X6RA 4XJ0A 5LXMA 3UG2A 3QHWA 3C51A 4B8LA 2UVXA 1A06A 2OJFE 3G9NA 3A7FA 3FZ1A 4KA3A 1HCKA 2EUFB 1G8SA 3EQCA 5TT7A 2HXQA 4WBOA 4TZRA 5D11A 1E9HA 2NPQA 1L3RE 2UW3A 4FUYA 1SYKA 4C37A 3W2QA 2H9VA 3FUPA 3M1SA 4U0IA 4QYGA 3BGPA 3JXWA 4PPCA 2J0KA 2VD5A 2ITWA 3NW5A 3W32A 3F3ZA 5M55A 5J9ZA 1OMWA 3ZM4A 1DI9A 3W8LA 2YIYA 3OTVA 4YNEA 5CVHA 2WIPA 2Y6OA 4CFFA 5CAOA 4CRLA 4F1TA 2C6LA 2WMVA 3LFEA 4FIFA 3BU3A 4TWOA 2BR1A 2ZDUA 2IVUA 2QKWB 1K3AA 2P4IA 4JQ7A 5CWZA 2IG7A 1GZNA 5FP5A 4FC0A 4B9DA 4F1OA 1FVVA 2Y9QA 4E6DA 1WAKA 4LRMA 3DKOA 4IX5A 5AP7A 4HCVA 2IN6A 1Q61A 3GB2A 4G2FA 4IM3A 4D28A 2GNFA 3DV3A 3FKOA 3FMHA 4FSNA 3ENMA 4ZTHA 3S2PA 1G3NA 3L8VA 3SXRA 4LG4A 2WIHA 5L6OA 5KMJA 4IBMA 3VBXA 4MXCA 3FQEA 4NW6A 3IDPA 4C4HA 2ITVA 4RVTA 3KQ7A 3TDWA 3R02A 1VJYA 2H8HA 2BFXA 4LL0A 3UVPA 5HX8A 4YSJA 1BI7A 1I09A 2VNYA 4IAYA 4TYJA 4B8MA 5HLNA 2F7XE 2WQBA 2YIRA 3SG9A 4ACGA 1U54A 3ERKA 4KINA 5IUIA 4UWYA 4J8NA 4CCUA 4EORA 1WBTA 4TTHB 2VWUA 1M7QA 3NYOA 5EDPA 2PPQA 3OY1A 2JDTA 5EKNA 3BEAA 1IA9A 4FK6A 4TNDA 5HI2A 3O8UA 1WBSA 5AR7A 3L8XA 3HAVA 5EG3A 3FC2A 3DS6A 4PX6A 3WZJA 5BVFA 4GCJA 3F66A 3RPOA 2UW8A 3F2RA 1Y57A 2QOFA 5ICPA 1PMNA 3EZVA 4UYAA 3EQIA 4HW7A 3BZ3A 3SGCA 1GZ8A 5IH4A 3FY0A 4PUZA 3MVMA 4GMYA 4XV1A 3ATSA 2ZM4A 3AD4A 2R3GA 3ZBXA 2C3JA 2P0CA 4DEHA 2IJMA 4E6CA 5DR2A 4AZEA 4C59A 1UNLA 4AWIA 4FKRA 1F0QA 3C4CA 1ZYLA 5H3QA 5AP4A 3BQCA 1PXLA 3TNQB 2VWYA 3QZIA 4AZFA 3QX2A 2XK6A 2YWPA 3AD5A 3ENHA 3KMWA 4YJUA 4ENXA 2JBPA 2XH5A 4GYGA 4BBFA 1H1SA 2ETRA 4FTJA 4M84A 4L68A 5CNOA 5EKOA 4Z9LA 4D5KA 3K3IA 4DH5A 4FNWA 1W8CA 2AC3A 1O6KA 2IVSA 3QC9A 4IVCA 3QCQA 2PVLA 3OUKA 2PY3A 4ZTRA 5C1QB 5IDPA 2Y7JA 5HEZA 2JGZA 3FDNA 3AOXA 5B2MA 3BYUA 3T3VA 4G17A 2FVDA 3O7LB 4EH7A 4AE9A 2W5BA 4USFA 4FEVA 1B6CB 1BL7A 3FI8A 1CTPE 4ALUA 3PA3A 2W96B 2VTLA 4FODA 4YSMA 3NWWA 3PXYA 4QPSA 1UU7A 3DBDA 4XRLA 3WZDA 2G1TA 4KB8A 2BTRA 4PNKA 3QZHA 4DCAA 3A8WA 5EW9A 1ZMWA 4JIKA 2EB3A 2QI8A 2YABA 4JDHA 3LXKA 4KS7A 4I6QA 4YO6A 5DR6A 2OJGA 4BL1A 2C6KA 1KUTA 4OTHA 1R78A 4L01A 3WF6A 3U6JA 4GSBA 4G5JA 4I0RA 4YZCA 3VS7A 3UODA 4JQEA 4MQ2A 5CLPA 3UNJA 4BWKA 4ZZOA 4QP4A 2OIQA 2VTMA 1LEWA 2R9SA 3D0EA 5IA4A 2W1EA 1WBOA 3VULA 5L8LA 2QCSA 4K6ZA 4S2ZA 3T3UA 4FA2A 2C0TA 3KF7A 4IZ5A 3QRKA 5BNJA 4NM7A 1Q8YA 2ZV8A 3KRXA 4UBAA 4U44A 4D4RA 3V04A 3PDTA 3RPRA 3KRWA 2W4JA 3EN9A 5LCKA 3P5KA 5LMBA 1M2RA 1O9UA 3Q2MA 4E73A 1H08A 2RF9A 5AX9A 4CZUA 2X7OA 4PL3A 2I7QA 4X2JA 3CQWA 4G16A 4GYIA 1PMVA 2R3HA 3M42A 1T46A 4MNEA 4G9CA 2XYUA 3PY3A 1YXTA 2YN8A 5AAEA 1OPKA 5L6WL 2VTSA 4LFIA 3DTCA 4JL9A 4C58A 4IFCA 4BWXA 4AF3A 4GJ2A 3V8SA 5E9EA 4J95A 5E8SA 4NM3A 4F7JA 1JSUA 3F88A 3ZLYA 2UZNA 5ANKA 3BCEA 4BHNA 2UV2A 3D5UA 3EHAA 4UWBA 2VWIA 4O0WA 5HORA 1J1BA 1IA8A 3OWPA 2IW9A 2BILB 4DITA 4IACA 2C3KA 4D58A 5AA9A 3V8WA 3NW7A 5K3YA 4QP7A 3COIA 3LIJA 5ANOA 4O2ZA 4MQ1A 4HVGA 4FNXA 4J8MA 3ZEPA 3HA6A 1M52A 3S95A 3HMNA 3V5JA 5IKWA 4AT5A 4FV9A 4IE9A 4F6UA 4O7WA 4HNIA 3TKHA 3ZRKA 4XBUA 2UUEA 4HGEA 4IADA 3AC8A 2VO6A 3NAYA 4OTFA 3ROYA 3KK9A 5C8MA 4JJRA 5BYYA 4YP8A 3MY0A 5HNBA 3JYAA 4L3LA 2C47A 4QQ5A 2H34A 4O21A 4JAIA 4RA5A 1QPCA 4B7TA 3HA8A 1OL5A 1TQMA 4KIPA 3FZRA 5GJDA 4WBBB 2GDOA 2X9FA 3RZFA 4NIFB 4Z55A 3NVMB 2QQ7A 1JSTA 2QOCA 2OZAA 4K11A 3N9XA 5E92A 1IG1A 4RWKA 1PXKA 3H9RA 4Y72A 4L7FA 5M56A 4NJDA 4EH8A 1ZYDA 3ZONA 5IH5A 2E9PA 2OXDA 1STCE 1QMZA 1SVEA 4QMXA 3GGFA 4XG3A 5IG1A 4EOPA 4PDOA 4XLVA 3GU5A 3B2TA 3KVXA 3FE3A 3NYVA 3FKLA 4NUSA 5EFQA 4PMMA 4LGHA 3FPQA 2OF2A 3UIMA 4BI2A 2H6DA 3PSCA 4EWHA 3F3TA 3Q6WA 2UVYA 3I60A 3U54A 4RWLA 4FT9A 4MAOA 4S32A 2ZJWA 3EQHA 2XJ1A 4WUNA 1JSVA 4C36A 4QP3A 3DK6A 1Q3WA 3TNPC 4PPAA 4GEOA 2VTJA 3BKBA 4FVQA 4MWHA 1WVWA 2P2HA 3ULIA 3BGZA 3BBTB 3HMOA 4OW8A 3TWJA 3W1FA 2QO7A 3P79A 4WT6A 1SVGA 3M2WA 5HICA 5JH6A 2NRUA 4FSMA 4FTRA 4G3FA 5BVOA 3UOLA 1BUHA 4RT7A 3KXHA 3EH9A 3HV4A 4YZBA 3R7UA 5DT3A 3SOAA 3HAMA 4YURA 4XG6A 3MB6A 3TT0A 3PPKA 5A54A 2J6MA 4RIYB 2WQOA 3JVSA 4LL5A 2WEIA 1OVEA 1EH4A 4FIHA 4A4XA 3N4UA 2UW5A 1XHAA 1ZY4A 3PXZA 5TE0A 3D4QA 5KBRA 5I9WA 4EKLA 1OKVA 3WZUA 4NCTC 2IW8A 1Z5MA 2PVNA 2RSVA 3FI4A 2HYYA 3PJ1A 4BFMA 2GS6A 5G6VA 3SC1A 2C0IA 4DT9A 3GT8A 4FGBA 4FTUA 3IO7A 3CXWA 4FIIA 3SXFA 3SRVB 5BVWA 2OSCA 2BZHB 1OM1A 3LFAA 4PRJA 2WQNA 4BCIA 2B54A 3E7OA 2W1ZA 3LJ0A 2ZOQA 3ZYAA 4C4EA 2X8DA 4BKZA 4JS8A 5JZJA 2RFNA 2HY81 3RHKA 5BVEA 3VN9A 3EN6A 4O0VA 4ASZA 5EI2A 3VIDA 2QD9A 4AACA 4HZRA 4YJRA 4UXQA 4K0YA 3R0TA 4YTIA 5CAQA 2VX3A 1SMHA 5KMNA 4Z7HA 4OAUC 1DS5A 2HWOA 1CKPA 4UMPA 4ONAA 4JI9A 5L8KA 1ATPE 4S33A 3QTQA 4R1YA 4AX8A 3PWDA 3IW4A 1H1RA 3PVWA 3KRJA 4LM5A 3ZDIA 2C6MA 3NR9A 3GFWA 2C5NA 5HNGA 4GVAA 3ZBFA 2WMUA 3L8PA 4I4EA 2OJ9A 3Q5IA 5KO1A 4ZY5A 3UZTA 3EFLA 2X9EA 4EOLA 2CCHA 2GFSA 1XH7A 2GNIA 4IQ6A 3G6HA 4WG5A 4DFBA 4O1PA 3VVHA 4EYMA 2W1DA 3LW0A 3E8CA 2WTWA 4LV8A 5J5TA 4PDPA 4CSVA 3DKGA 4IFGA 5JFXA 4O82A 2PYWA 4H1MA 1Q41A 4O7NA 3AG9A 4ZJVA 1R0EA 3COMA 5ETFA 3RPVA 3CTHA 1NXKA 2BDFA 3QTIA 3HMIA 3Q9WA 2CCIA 1KSWA 2P33A 2G2IA 4QMWA 3NCZA 2C1AA 3RWQA 3GCQA 2HK5A 2WTDA 3FQSA 2ITTA 4KRDA 2YCFA 3ACJA 5CF5A 3W16A 4AOTA 5DT0A 4IH8A 4FV8A 3ZLSA 5IQEA 2GTNA 2NRYA 3QCYA 2JC6A 3RALA 3DLSA 1WVXA 3QGYA 4FKUA 4FT0A 5IA0A 4KIQA 3FZTA 2UW4A 3HUCA 5EI8A 4R78A 2OIBA 3ZFMA 4FEQA 4GUEA 3GU8A 4BCQA 3MY5A 3DDQA 1HOWA 3PVBA 5AR4A 3PSDA 1F5QA 3LFQA 5E4HA 4JX3A 1RJBA 4QTEA 4IMYA 1ZYCA 5KNJA 3TI1A 4R7BA 3R83A 4GT4A 2XKCA 4MK0A 4I0TA 3ZUTA 4RIWB 3ZS5A 2XUUA 2KTYA 4G34A 4EUUA 4JDKA 3ZU7A 3A2CA 1XBCA 3I5ZA 4ACHA 3VQUA 3QQUA 4B0GA 4XV3A 1OPLA 4F64A 1WFCA 2YM4A 3HRCA 4FKQA 5AUXA 2ONLC 3UNKA 2AYPA 3EIDA 4FSZA 5A9UA 2Y4IB 4UYNA 4A4LA 3GI3A 1PYXA 4OTRA 2I0HA 4DTAA 5E90A 3PUPA 1XR1A 2C5OA 4FVRA 2YM7A 5ACKA 5HCXA 4FL3A 3TV6A 2IWIA 2QR8A 4E4NA 4EHVA 4EONA 5BX0A 2PMNX 3RCDA 4EYJA 3L9MA 5DWRA 2JFMA 1PMUA 4N0SA 4YZ9A 3WILA 3ZDUA 4C3FA 2CMWA 2XJ0A 4FG9A 5FRIA 4C61A 2CGXA 4FKVA 4W9WA 5AMNA 4MH7A 2JBOA 2V62A 4KNBA 3MWUA 2YDKA 1YQJA 2GHLA 2BIYA 3JY0A 2JDVA 4FKLA 1H07A 2VO3A 3GU7A 3Q4UA 4AZWA 5ETAA 2BZKB 1PXNA 2WMQA 4BCNA 5A4LA 4USEA 4RMZA 4E3CA 4LMNA 5J5SA 2O8YA 4I5CA 4FKIA 4O7SA 2XK9A 3CQEA 1CKIA 1V0PA 3QQLA 5M51A 2F2CB 3AQVA 1GIIA 4CYIA 3SA0A 2R3PA 1SZMA 3LMHA 1YVJA 5HG9A 3R9RA 5L2IA 4NH1A 3QXOA 2CKEA 3CEKA 5I4NA 5AV3A 3WF7A 2PMIA 3MN3A 1U5RA 1IAJA 2W0JA 2WMXA 2RG5A 4YR8A 5DA3A 1ZYJA 4G6NA 3UO5A 3DBEA 5DR9A 1DM2A 2YIXA 4U41A 1PXIA 3MFUA 2XRWA 3HECA 2R7BA 1OKYA 3RP9A 2GNGA 4M15A 1Y8YA 4DTKA 5I9ZA 1JPAA 4WRSA 3F3WA 4FF8A 2YCRA 2WMAA 2Y4IC 4F7LA 3CE3A 4BCOA 2YJSA 3GCSA 4QQTA 2QURA 4FZAB 4E8AA 4TWCA 5CEMA 3MI9A 2VTPA 4YTHA 5EM5A 3NMUF 4AGWA 5FWKK 2UZEA 4BGHA 1WBWA 3BE9A 4OTPA 4DGLC 4KIOA 1DAWA 4HYHA 2XM8A 2BKZA 4YGAA 4BDEA 4BY9E 4RJ8A 1IR3A 2XKEA 1OB3A 5E8ZA 4BDDA 1UU3A 1XWSA 4O7ZA 3KL8A 2OH4A 3DKCA 4ANNA 5KHWA 2OU7A 4WO5A 4O1OA 2X4ZA 2UZOA 2F4JA 4ZLZA 4CZTA 1QPJA 3EL7A 1H1QA 3QTSA 2OXXA 5D9HA 4O91A 5CTPA 4O83A 3BI6A 3VUKA 2ITNA 4I1ZA 2HW7A 4TWNA 4X2NA 3TKIA 3VAPA 4I92A 3UG1A 2VV9A 1J3HA 4C3RA 4ORKA 2W1GA 3GFEA 4M13A 3TCPA 5K0KA 5LJJA 4CFVA 4IVDA 2IW6A 2FB8A 4JVGA 3QA8A 3C4ZA 4OLIA 5HNIX 2BVAA 3FMKA 4OR5A 3NUSA 5DHJA 4M0ZA 4F9AA 3RAHA 4BCFA 3U9NA 4ZJIA 3FLWA 5CEKA 5FTQA 4BDIA 4D2VA 2BTSA 2CSNA 2JKMA 3LM5A 3MFSA 3OS3A 4KD1A 4BZNA 5KMLA 3TUDA 5CXZA 2F2UA 4FL2A 5HCZA 2R3MA 2VX1A 2NP8A 3KN5A 5FTOA 5CAUA 5K4JA 1YWNA 2GNJA 5A14A 4FTMA 5TR6A 3WYYA 4WKQA 3VBTA 2OK1A 4CKRA 3GQIA 3MJ2A 3MESA 3C13A 1R0PA 2A1AB 3K5UA 4QMTA 3C5IA 3P08A 4MBIA 4YLKA 3E92A 3DJ5A 5HVKA 5JGDA 5GIOE 3QA0A 3P4KA 1YOLA 4K77A 1H8FA 5AR2A 5IPJA 4FZ6A 3Q9XA 2V22A 5EYMA 3AC1A 1JKKA 4MCVA 2PUNA 4OBQA 4AP7A 3ZZWA 1OPJA 5HD7A 1M14A 3PXRA 2J5EA 3I0QA 1LP4A 4TPTA 2PHKA 3ANRA 2YZAA 3CD3A 1JQHA 2BALA 3RZBA 1RW8A 3SW7A 2OGVA 3DAKA 3FI3A 4I41A 5DMZA 4M97A 2OFVA 2OI4X 3LMIA 4I93A 4QRCA 3BLQA 5AJQA 5FBNC 3E64A 4GK2A 4IVAA 3DNEA 3QHRA 3EMGA 4AU8A 5D10A 3FHIA 5B0XA 4RFYA 5IMXA 1R39A 1X8BA 4FZFB 3Q2JA 4FEXA 4QNYA 5EOBA 4AZSA 5JMSA 2XKFA 3VC4A 4A9YA 4HCTA 4U9AA 4DH8A 1Q8TA 4ASDA 2PZYA 3QCXA 4FV3A 4PQNA 4R3CA 4CFXA 4DBNA 4UN0C 4CKJA 3OP5A 2PE0A 1AGWA 2X2KA 4O0TA 4NL0A 5JEBA 3FSKA 3LM0A 4C35A 4AN3A 3C5UA 2BRGA 1Z9XA 1KE5A 4ZAUA 4W8EA 3RK5A 2YWVA 1GJOA 3RJCA 4MNFA 5J95A 4L67A 5AP3A 3FMEA 4DEDA 5F95A 3LLAA 3Q9YA 1I44A 5B2LA 3C7QA 3ZSGA 5LVMA 4RJ4A 3ORNA 4AFJA 4CFMA 3VS1A 3A4OX 2EVAA 1YWVA 2PL0A 4E1ZA 4FL1A 2BZJA 1H01A 4MX9A 4N57A 1H1WA 2HOGA 3R1SA 4D9TA 5CEOA 2VTIA 2YITA 3B8RA 3NAXA 3POZA 2B7AA 3LHJA 4FTAA 2GMXA 2XNNA 2HAKA 3PY0A 3R7IA 3WF9A 5LVOA 1Y91A 2B55A 4J52A 5CVFA 2YISA 2A27A 4E6AA 1LEZA 4FKWA 3H3CA 2ACXA 3DK7A 3IGOA 4RBLA 1YKRA 4ZXTA 3ORKA 4FG7A 1J7UA 1VR2A 2PVKA 2FSTX 4L00A 1YI6A 5E8VA 5JRQA 4Y85A 3HYHA 3PVGA 5HVYA 4FV5A 3EN4A 4R5SA 3F9NA 4U81A 3PJ2A 4D2RA 4MBLA 1GIHA 3R7OA 1MRYA 3CR0A 2BAJA 5EQPA 4BGGA 2J90A 5J7HA 4QMVA 4IJ9A 3MV5A 3CP9A 4NEUA 1H26A 2QO2A 3Q6UA 2GNLA 4NIFA 4J97A 4IZ7A 3TEIA 3K2LA 2JD5A 3H4JA 3A7IA 4JDJA 1YXSA 4EZ7A 4YTFA 4XG2A 3OTUA 1FVRA 1Q97A 4GIIA 3PPJA 2XNBA 4IDTA 3NPCA 4RWIA 4RJ5A 4UWCA 3KXMA 4CNHA 5IQAA 3CTJA 3DBCA 2VO0A 5DLSA 5CNNA 1KOBA 1GAGA 2ZB0A 4E4LA 3U87A 2R3FA 2PU8A 4IZAA 4UZDA 5IQBA 5LWNA 3GC9A 4PV0A 1NVRA 2B9FA 4ZTSA 5IUGA 3FZPA 4ACCA 1MRVA 3H0YA 3Q04A 5CXHA 4MD9E 4QQJA 5LARA 2WAJA 2X4FA 4P90A 4L52A 3IW5A 2I40A 2G15A 2EWAA 3FJQE 4I23A 4UB7A 4I21A 3D5WA 4G3GA 4YUQA 4BB4A 4BWPA 4TWPA 4TYGA 3TJCA 3AT3A 2YM6A 5KUPA 2VTQA 3ATTA 4C0TA 4XS2A 4O7RA 3JVRA 3D14A 5L2WA 4EKKA 5GZ8A 4Y46A 3CKWA 5LCJA 5I9YA 1LUFA 3O7LD 3RPSA 3FXXA 4FTTA 4ZP5A 3VUGA 3UMXA 1UU9A 1S9IA 4HYSA 1S9JA 3EQFA 4CG9A 4R3PA 4PTEA 3CGFA 5CX9A 2WB8A 4MKCA 4WOVA 4RX5A 4RIYA 4AA5A 4EOSA 2WQEA 5EH0A 3CPCA 4O7LA 1H28A 3OEZA 3SLSA 4A4OA 3E7VA 3DJ7A 1BMKA 4MD7E 2PVMA 3R9NA 5LMKC 2GQGA 2G2HA 3E8EA 3L8SA 4EOQA 3LZBA 3ZHPC 4J98A 1JKSA 4ZTMA 2WPAA 3QTUA 1XBBA 2PZ5A 4JOAA 3UBDA 3QZGA 3FXZA 3K5VA 1ERKA 3TL8A 1Q8WA 3HNGA 4IW0A 5AUVA 4AE6A 3OC1A 5GJGA 4A06A 5KZIA 3EWHA 4ZIMA 2ZV2A 4C4IA 2W4KA 3R2BA 2CKPA 3KK8A 4QMSA 1O6YA 2G2FA 3F7WA 3C1XA 5DFPA 2PMLX 3DZOA 4FSQA 2ZMDA 1GZKA 4ITIA 3UIBA 2JKKA 3NIZA 4WUAA 3UQCA 3K3JA 5L6PA 4LQMA 5HBHA 1Y6BA 4R1VA 4M8TA 4MHAA 4M14A 5BVNA 3GU6A 5HE1A 3OZ6A 4NYEA 4WSQA 4JLCA 5TO8A 2Z2WA 4MF1A 5EQEA 3LXPA 2WTCA 3MA6A 3PP0A 2WOTA 2W7XA 4D2TA 4NSTA 3H0ZA 4S31A 1VYZA 5JFVA 3OW3A 4ENYA 3QBNA 5B2KA 3GBZA 3QKLA 4X3FA 5DIAA 4E93A 3BHUA 2HIWA 2IZUA 5CQWA 2BRNA 5EHLA 1G8AA 3JPVA 3UGCA 1ZXEA 4LV5A 3ZO1A 1SNUA 4DEGA 3QWJA 2YERA 3CGOA 3LXNA 4W9XA 3RAWA 3LCOA 1REKA 3R30A 3RNYA 4DLIA 2W9ZB 3SDJA 3G15A 4ZJJA 4R3RA 3HV7A 3LQ5A 4AXAA 4C7TA 2YEXA 4GU6A 4UY9A 4D0XA 4F0GA 4X6QC 4FEUA 4XG7A 4KUJA 2I0VA 4ZS0A 5AAFA 3R8LA 2PMOX 2YDJA 3LAUA 1YDSE 1OECA 3PZEA 5TF9A 4XCUA 3QYWA 3F3VA 3L9PA 1J7LA 5CU0A 3GCPA 4MWIA 2Z7QA 1ZMUA 5E8TA 4FV7A 2XNOA 2J0LA 2WMBA 3PSBA 3R01A 5AV4A 2JAVA 1T45A 3CD8A 3PVUA 5CEIA 2C6DA 4FSUA 4FT3A 3B2WA 2ZYBA 2Q83A 3F6XA 3WIGA 3EJ1A 1PY5A 3RINA 3RK9A 2XK3A 3MPMA 4JX7A 3VNTA 4BDAA 4DHFA 1J1CA 4MXOA 5BPYA 2O3PA 5HTBA 3NUAA 3QYZA 5I0BA 4W4VA 4QYHA 5DEYA 3VHEA 3EYHA 3BGQA 4QNAA 3LKMA 2BFYA 4V05A 4N6YA 5A6NA 5GIPE 3NVKI 5CYIA 3DOGA 2CHLA 4GRBA 1NY3A 1PKGA 4C57A 4I24A 1KV2A 5GNKA 2O2UA 2X2LA 5C01A 3LCDA 4MVFA 2OICA 3F2NA 4FV2A 5EM6A 4NFNA 4EOMA 2WTIA 3RTPA 4G3EA 3BLRA 4IB1A 4XG4A 4BVUA 3BRBA 3IONA 5C4KA 4G3DA 2B9HA 1RQQA 3P7AA 4FTKA 1FPUA 5C8NA 3OBJA 3RK7A 1WBVA 4F9YA 4RJ6A 3D7TB 1WBNA 2PVHA 4I5HA 3F3UA 4FKGA 5BMMA 4QP9A 5H8EA 3FL4A 5H8GA 2UZDA 1E1XA 5AUYA 3HP5A 4TRLA 4YC8A 3HMMA 3ZXTA 5A4TA 1H25A 3HRBA 2GPHA 4DGOA 1PRYA 4L46A 4K33A 4K1BA 2J2IB 2BDJA 3AMBA 3P78A 4O0UA 4O27B 4UX9A 4FI1A 1H0WA 2YM5A 4G6OA 4K2RA 4YC3A 3D5VA 3ORXA 3P7BA 4QPAA 4CV9A 4IX3A 4DF3A 3VO3A 1ZOEA 5I5ZA 4QMUA 3DFCB 2P55A 4ZSJA 1FMOE 3FBVA 5DRDA 4IM2A 4NJ3A 4RSSA 4D5HA 1H0VA 3DNDA 2Y4PA 1OUKA 3H9FA 4EL9A 3ORMA 4ASXA 5CALA 2XNPA 3Q5ZA 5F1ZA 2R3KA 4FK3A 2XIRA 2UW0A 4L3PA 2XIZA 3UIUA 4FUXA 4Y83A 3KEXA 3FY2A 3RVGA 4I94A 4KRCA 3R73A 2JLDA 4ZSEA 3C4FA 1UKHA 3QTXA 3QZFA 5FD2A 4AAAA 2VO7A 2PZPA 2W1HA 5J7BA 4AT3A 4TYIA 3KMMA 3C4EA 1OGUA 4WNKA 3BHVA 4GJ3A 5FDPA 2NO3A 4QTAA 3AT4A 5CEQA 2Z7LA 3C9WA 4L53A 2ETMA 4F6WA 5JN2A 5CVGA 3NW6A 3DKFA 3H9OA 3MDYA 4W8DA 3CS9A 3U6IA 3OXIA 2PUIA 2C69A 2X7FA 4FMQA 4V0GA 2C5XA 4N70A 2JIUA 3DQWA 4FV0A 3TNHA 4CT2A 2B9JA 1XBAA 4TW9A 4E5BA 3I0OA 3QGWA 1BYGA 4ZK5A 1PKDA 2R4BA 3MA3A 3KRRA 3OOMA 4M69A 4EH9A 4ZSLA 3ZM9A 1PHKA 4AT4A 2R3RA 2WFYA 4NKSA 1AQ1A 3KU2A 4WNPA 4JQ8A 4AGDA 4KSPA 4X3JA 3W8QA 4EH5A 3WE8A 4BBEA 4AN9A 3BE2A 3PXFA 3QQKA 2ESMA 5J79A 4TXCA 3MPTA 3OY3A 3W2RA 2JFLA 1FINA 1XQZA 3BHYA 3A7JA 4YJPA 5DNRA 2W1IA 4XOYA 3SX9A 3LJ1A 3F82A 4U3YA 5DEWA 4U5JA 2VWZA 3DBQA 4HGTA 3EOCA 5FLFA 1P14A 2PUUA 3PG3A 4BI1A 4X21A 3UOHA 1ZOGA 4G1WA 2P3GX 2OKRA 3EQPA 3PJ8A 3NRMA 4MTAA 2FSLX 3PXKA 4DG2E 2ZV7A 5IQHA 5ITAA 4YBKA 4G5PA 5H9BA 3FQHA 4OTWA 5DI1A 1ZOHA 3ZC5A 4EK3A 3QRJA 5D41A 1YWRA 3BELA 2X39A 3SQQA 5C03A 4ANMA 2Z8CA 3UYSA 3KKVA 1W83A 3O17A 2ITXA 3FC1X 4BTKA 3GC0A 4BTFA 2R3NA 2X6EA 3V5QA 2VAGA 1Q24A 4NU1A 4XNEA 2BAKA 2GS7A 4D4SA 1FGIA 2UZTA 5DG5A 3ORZA 2XNMA 1KE9A 3IPHA 2UZBA 4IM0A 4C2VA 5IQDA 3GC8A 3ITZA 3ZOSA 3C4XA 4II5A 2ITOA 2RIOA 3VS4A 2W17A 4HYIA 4ZEGA 1YHVA 4LUDA 5FGKA 4CGAA 1XJDA 1YDRE 3L1SA 2FSMX 3OUNB 4GUBA 5E8UA 3TG1A 4ZOGA 2CGUA 3CY2A 4KWPA 3TNWA 4HGLA 4AZVA 3F61A 4RQKA 3LOKA 3V5PA 1U54B 2VWVA 3KMUA 3IK3A 4X2FA 5FM2A 2W9FB 4HVSA 4J96A 4HYUA 4BIEA 3FL5A 3I5NA 4CMUA 1ND4A 2R64A 2GHMA 4ERKA 3CQUA 2RL5A 2VTRA 3D2IA 5CU2A 4Z3VA 2QNJA 4FSTA 4AW2A 1OL1A 2XK7A 3W10A 3R6XA 4XRJA 3MIAA 2VTTA 5FDXA 4EWQA 5LVLA 3KFAA 2WKMA 2PZRA 3PA4A 3R2YA 4BDGA 4BYJA 5JSMA 4PY1A 3HKOA 4EHGA 1QPEA 3RKBA 1KOAA 4PWNA 3D7ZA 4BCPA 3KREA 2YA9A 3I79A 3TDVA 3QCSA 2VWBA 1XH5A 3P1AA 3HUBA 4F7NA 3REPA 4P2KA 5CU4A 3LQ3A 4FV1A 4DG0E 5M4CA 4LRKA 4M68A 2X1NA 2R3OA 2W99B 5KMIA 2BPMA 3DK3A 4FT7A 5EHYA 4BIBA 4JG8A 3IW7A 2OIDA 3KRLA 3P7CA 3R7EA 5AP5A 4IHPA 3AXWA 4GS6A 5ANEA 3R28A 5JT2A 5BYLA 3HMPA 5KX8A 4HVHA 4RVLA 3ET7A 5E8WA 4I5PA 3S00A 3KC3A 3V5TA 3O71A 3O23A 3TTJA 1CMKE 2RFSA 5FXSA 4YNOA 3SXSA 2XS0A 5HBEA 4GL9A 4EK5A 3VRZA 4JT3A 3QRUA 3H10A 4TYEA 3RGFA 3QU0A 5EHOA 1Y6AA 4FNYA 2CLQA 3I6WA 2QO9A 3T8OA 4F70A 4RQVA 1U59A 2C5VA 2PK9A 3FLYA 4WIHA 4EOOA 5E8XA 5LQFA 3GCUA 2PVYA 4JXFA 5ANDA 2XYNA 3UO4A 3ZRMA 4I5MA 1UNGA 2QOQA 2QU6A 4WNMA 3BV3A 5IEVA 4U6RA 3QTRA 2V0DA 5D7AA 4IWDA 3ANQA 4U3ZA 2C3LA 5IMEA 3BHHA 5CU6A 4FYOA 5IQGA 4DA5A 3SW4A 5HD4A 4DTBA 2IVVA 3VS6A 5IQCA 1XH9A 4BYIA 5KE0A 1BX6A 2FYSA 4JAJA 2XBJA 3FMMA 3ORLA 5KMOA 4EH4A 1BLXA 2XKDA 3QD4A 1Y8GA 3R7VA 4UMRA 5CEPA 5AP6A 4FTQA 4D2PA 2FA2A 5HZNA 5CF6A 5E91A 3MH0A 3R71A 4AW5A 2VGPA 4HVDA 4ANQA 4HPTE 3QKMA 3NYNA 2AUHA 2WHBA 3ORIA 4LYNA 1FQ1B 2VZ6A 3UO6A 2HZNA 5AEPA 4AA4A 1GIJA 4ITHA 4TY1A 4UXLA 3SD0A 3UP7A 4FSYA 4FTIA 4LMUA 3QRIA 1TKIA 4IWPA 5G1XA 4DFUA 3V3VA 3TUCA 2YM3A 4IIRA 5E8YA 5AUWA 4MNEB 3G33A 4NZWB 4FKSA 2WNTA 1R3CA 3I6UA 4M7IA 2CN5A 3FXWA 3PTGA 3W2CA 3C0IA 2V5QA 3GXLA 4FZ7A 4DN5A 4UMUA 3G5DA 1A9UA 3VWAA 3NEWA 5AIRA 4A9SA 3ACKA 3IQ7A 4DE4A 3OG7A 4F9WA 3MTFA 4N6ZA 5L4QA 2X8EA 3K54A 4FOCA 2OZOA 4JBQA 4YJNA 4EH3A 5BUIA 3V6SA 3LVPA 3RWPA 4RJ7A 3LFDA 3OOGA 4YZMA 2R3QA 4A9RA 2I0EA 3TZMA 2EXCX 3OCBA 4L3JA 4QTBA 4J99A 3AT2A 5AP1A 5EI6A 5A4QA 2R3JA 4H05A 4RLKA 2X2MA 5AWMA 4IZYA 5ANIA 2QOBA 4H3QA 2BRMA 4GKHA 3TN8A 1OIYA 4RA4A 1OIQA 3CY3A 2YLEA 4QD6A 4YZDA 4ALVA 3A4PA 4L9IA 5K5NA 5DH3A 1UU8A 4XP0A 3BHTA 2EU9A 3NNXA 5HE2A 4YHJA 4D2WA 4C33A 2PULA 2VX0A 5AM7A 4YJVA 3WE4A 5HU3A 2NNWB 3VBWA 2DQ7X 2O5KA 3FMJA 4IB0A 5ETCA 1YW2A 3ZZEA 4XUFA 4CZYB 4DGNA 4MYGA 5DPVA 5JZNA 1L8TA 4ASEA 3SHEA 3BYSA 4ZTLA 5HESA 2RFEA 3Q53A 3UOKA 3UQGA 4UV0A 5LWMA 3E3PA 4H3PA 5TKDA 4LRJA 5AP0A 3PIXA 3UIXA 5IF1A 3F5PA 4XG8A 2OZAB 4Q2AA 5CZIA 4W4XA 2WMTA 4JRVA 4EK8A 3OEFX 4KBAA 5T6KA 5M4FA 1XO2B 2J5FA 2BRBA 5LVNA 4IAAA 3U9CA 2QG5A 4J53A 4K9YA 4V04A 5A4CA 4DGGA 3C0GA 4CKIA 1FGKA 4O2PA 2B9IA 4I4FA 3RHXA 4ACDA 4AN2A 3R00A 3ELJA 3E93A 5HGIA 4EI4A 1E1VA 2QONA 2WTVA 3BQRA 4IX6A 4D1XA 5CI6A 2C4GA 3EFJA 4DBXA 1NVQA 3L9NA 4BTMA 5KHXA 1Q4LA 3ZFYA 3Q4TA 3ZO2A 2UW7A 5AADA 1NW1A 4OBPA 1PW2A 3TV7A 5M09A 1V0OA 5EOLA 4EHEA 4GT5A 4PL5A 3LQ8A 4XX9A 2HY0A 4WHZA 4ANLA 3NYXA 3Q4ZA 5CU3A 1PXOA 1Q3DA 2RGPA 1J7IA 5IQFA 3GOPA 3QUEA 4AOIA 3UOJA 3P23A 1APME 2C6OA 2R3IA 4XP3A 1OIRA 2R3LA 1OL2A 2R7IA 3NUUA 4FICA 4TKSA 4CTBA 2QLUA 4XBRA 3VQHA 3QTWA 5EYKA 4F9CA 5AUZA 4BR3A 5L2SA 4O81A 2IZRA 2YJRA 2J0IA 1WZYA 3G9LX 3QUDA 5M57A 1XH8A 3E8DA 3KXZA 4DFZE 4M66A 1U5QA 2HCKA 4I6HA 4UMTA 5DE2A 4EQMA 2ZM3A 3G51A 3ORTA 4BRXA 4RIXB 4CT1A 4EOKA 5JFWA 4BF2A 2Q0BA 3IOKA 3O8TA 4TN6A 3MB7A 4IVBA 4UEUA 4GIHA 4XP2A 4OTIA 1M2QA 2XMYA 3HZTA 5CI7A 3EKKA 3NUPA 3OROA 5CSPA 4A7CA 2EXMA 4CMTA 2F57A 2IPXA 3TXOA 4H58A 3KULB 1YDTE 2OG8A 3F69A 4TNBA 5GHVA 4Y95A 2OJJA 3KN6A 3NUXA 3NLBA 3QALE 4IX4A 4U80A 4BIDA 5JQ8A 2EB2A 3LCKA 5D1JA 1FMKA 3F5UA 2XIXA 5FG8A 1KE6A 4FBXA 4WD5A 4CEGA 3DY7A 4DT8A 3Q4CA 1Q8UA 1OL7A 4L7SA 2VWXA 2DYLA 4USDA 2LAVA 1MQBA 3WZKA 4C62A 3D7TA 3UP2A 1YI4A 2XIYA 3U6HA 5EW3A 1J91A 2PZIA 3EYGA 4QTCA 3PA5A 2J7TA 4QTDA 4Y5QA 4DFNA 5IA2A 5F94A 3CSVA 2W05A 5FEEA 4Y8DA 2ERKA 4I3ZA 5A3XA 4ARKA 2B4SB 4U40A 5F9EA 4LI5A 5J8IA 1W7HA 2VN9A 2XZSA 4KSQA 4HVIA 3OCGA 4NFMA 1YI3A 1GNGA 4IAKA 2CPKE 2C6TA 3TZ7A 2CGWA 3OXTA 5AA8A 1KE7A 1MP8A 4YHTA 4WRGA 3UZPA 4A9UA 3UZRA 3CCNA 3EN5A 5BVDA 3I7BA 2F7EE 4O6LA 4WNOA 4L6QA 3IDBA 2G01A 2VU3A 3FAAA 1ZAOA 1P4FA 3UVRA 1XH6A 4FOBA 5I9VA 4HCUA 1SNXA 5FEQA 3D5XA 3WARA 4QOXA 3UE4A 3MGYA 4BBMA 4D2SA 4EJNA 3A61A 3DU8A 4IANA 3R9HA 4RX9A 3PG1A 3PYYA 5M44A 4O38A 4OT6A 3VBVA 4ZMFA 4CFNA 4D0WA 1XH4A 2QOLA 2ITYA 1OKZA 3QFVA 3QD0A 5AV0A 1JLUE 2CKOA 3WI6A 5CAPA 2QOHA 2E9OA 3WYXA 1GOLA 4LGGA 5L2TA 5KKRB 5IQIA 5I9UA 2X81A 4EOJA 4JDIA 3ZO3A 4EK6A 3TZ8A 4J7BA 5GZ9A 2GFCA 2WMRA 2ZM1A 4BDFA 2GTMA 1QPDA 4XV2A 4DEBA 4CRSA 4ZSAA 3QXPA 2PUPA 4I0SA 4O84A 3MVLA 3OW4A 2FH9A 5LVPA 4NCTA 2QKRA 1QL6A 3FMNA 4MBJA 4RFMA 3C50A 3FYJX 4GVJA 3DJ6A 3VJNA 3OCTA 2CKQA 4QT1A 2OJIA 3KXXA 1SM2A 4GV1A 1K2PA 4YC6A 1UWJA 3QQGA 4XYFA 5I3OA 5DYJA 4DH7A 2GQSA 2XNGA 2Y0AA 3BV2A 2J9MA 5L3AA 4QMYA 4IAFA 4H3BA 1PXPA 2WMSA 3DDPA 1NT2A 3GENA 3IKAA 4E7WA 4GK4A 3EQRA 2YCSA 1LR4A 3QC4A 4CD0A 4L45A 4F0FA 3UJGA 5IEXA 3GOKA 4C02A 4OUCA 4BI0A 2QOIA 3UYTA 4BTJA 2E2BA 2YFXA 3R21A 4Y73A 3G0FA 3LE6A 1SVHA 2EXEA 5AR5A 3QTZA 4ZTQA 5KKRC 1UV5A 2V7AA 3LPBA 1UVRA 1MRUA 3M11A 4HJOA 3OFMA 3OHTA 2YLFA 3EN7A 4F7SA 5K0XA 2J50A 2B52A 2BKKA 3GUBA 4U97A 4FX3A 1CKJA 1YXXA 5KCVA 2O64A 3LMGA 5IH6A 1WCCA 1ZMVA 2OBJA 3GC7A 4K8AA 2XF0A 3GQLA 2XK4A 2IVTA 2PVJA 4QMPA 2VTNA 5AX3A 1OL6A 3SRVA 3KY2A 3NUNA 4M12A 2SRCA 2WTKB 4DAWA 2X0GA 4HOKA 2H96A 4AG8A 4FSWA 3NNVA 4KABA 3VUTA 1IEPA 3SKCA 2ITZA 1ZARA 3MS9A 3HDMA 3PLSA 5HCYA 5FXQA 3IECA 3V5LA 4DYMA 3Q96A 5KMKA 4F4PA 3O50A 4YLJA 3CJFA 1PMEA 2BHEA 4EEVA 5AP2A 4F99A 1H00A 4IJPA 2DUVA 4RPVA 4X0MA 3PWYA 4E5AX 3KB7A 4TYHB 5GJFA 3V01A 4IDVA 4KKEA 3AD6A 4L44A 2A19B 4RJ3A 3UMWA 2CDZA 4RGJA 5D12A 1KWPA 1BKXA 1UKIA 1URCA 3BIZA 1JKLA 1HCLA 3OBGA 4IXPA 5AR8A 5FUTA 2C0OA 3H30A 3KA0A 2RG6A 3R1NA 3DB8A 3QUPA 4WSYA 5IU2A 3B8QA 3LCSA 3FPMA 3OWJA 4OT5A 5JRSA 1URWA 2UVZA 3KF4A 4HNFA 5H8BA 4BDBA 5HO7A 4GKIA 5EK7A 4CFUA 3VW8A 5JK3A 3RPYA 4OTGA 3BU5A 4IWQA 3LLTA 5M53A 3RI1A 3SOCA 3UPXA 3ZTXA 2YACA 2UZUE 4NWMA 3NIEA 4XMOA 5HIDA 3C0HA 2UZLA 5BYZA 2E9NA 3JY9A 2ITPA 4D1SA 2HZIA 2ONLA 2R2PA 3A7GA 2HWPA 3E62A 3IG7A 3CKXA 3POOA 4H36A 2XEZA 5EQYA 4XOZA 4R6VA 5ACBC 2WTKC 4O96A 2PSQA 3R8UA 4BKYA 4O0YA 5M4IA 4PPBA 4XHKB 3NUYA 3BWFA 4G3CA 5HO6A 4FTLA 1MQ4A 4AZTA 3U55A 3FV8A 4NT4A 3VBQA 3OCSA 2XJ2A 4MD8E 2WU6A 4PMPA 2X8IA 4IB3A 3THBA 3Q9ZA 4XV9A 4RC2A 5C26A 5IEYA 2WTJA 3CLYA 3GCVA 1G5SA 4I6BA 5CT7A 3RNIA 3FLNC 4B4LA 4FG8A 3RAIA 3ZSHA 3BYMA 3MH1A 4Z7GA 4NKAA 2P2IA 4MXYA 4F63A 2XIKA 4JR7A 3FI2A 2OWBA 4G6LA 4E20A 4R5YA 2ZMCA 2HW6A 3KGAA 1ZWSA 4W4YA 4RIWA 2AC5A 2WQMA 4YZNA 2PVRA 5E7RA 3A99A 2V7OA 1YXVA 4A9TA 2B0QA 4OTQA 3ID6C 2ERZE 4LOOA 3PRIA 3D94A 4AW0A 4U7ZA 1ZYSA 3PJCA 2B1PA 3LFFA 1OBGA 4E4XA 5AUUA 3RM6A 1W84A 3COHA 2HZ0A 3HLLA 5CY3A 5ANGA 1OBDA 5EM8A 5IA1A 4JR3A 4IEBA 4O7TA 3NCGA 3UDBA 3ZLWA 3BEGA 3I81A 5CF4A 1V1KA 4AGUA 2HZ4A 1P5EA 4IAIA 1JAMA 3DTWA 4MXZA 4NM0A 5JQ5A 5HE0A 4FGRA 3ZXZA 4KKGA 5J9LA 1JKTA 4LGDA 5HE3A 4DLJA 3BU6A 1PXMA 2F9GA 5IISA 2JDOA 3ALNA 4RFZA 2CNVA 3UPZA 4F08A 4D55A 2CGVA 2YHVA 2GSFA 3MFRA 4R8QA 4KAOA 1PF8A 4BICA 4AOJA 2OLCA 2XEYA 5EM7A 4FVPA 5BUJA 4KIKB 4DH1A 4JIAA 3LFBA 3R1QA 3RAKA 1M7NA 5EYDA 3VS5A 5BMSA 5CSVA 2CLXA 5EDQA 4EC8A 5HLWA 3GEQA 4WA9A 4EH6A 5CANA 2BCJA 4Q5HA 3ROCA 4DG3E 4FIEA 5BQ0A 3G90X 4PDSA 3R7YA 3TV4A 3WOWA 3FEGA 3OF0A 2C3IB 1R1WA 4ACMA 2WMWA 2I0YA 5C8KA 5A6OA 4R77A 1OIUA 3MW1A 5DT4A 2R0UA 5IA3A 4UMQA 2JKQA 3D15A 3COKA 4YJQA 1Z57A 4BZOA 5AM6A 5C9CA 3FYKX 4F1MA 3O8PA 2YAKA 1OUYA 3HV6A 4M3QA 4DINA 4EOIA 4I6FA 2R5TA 4O0XA 1H27A 4DC2A 4YU2A 3R9OA 4BCJA 5AV1A 2ETKA 3KCFA 4EK4A 5HQ0A 2HELA 2BUJA 4CFWA 3G6GA 3LXLA 2ITQA 2R0IA 4MF0A 3OT8A 3PFQA 4FYNA 5HG5A 4S34A 5F20A 1VYWA 4ALWA 5A4EA 3FWQA 3S1HA 3ETAA 3NNWA 3OT3A 4IAZA 3HV5A 5AIKA 3AC2A 3C4WA 3UVQA 4YTCA 3WIKA 5CASA 3PPZA 3IDCA 3QD2B 4U79A 3DPKA 4C3PA 4CVAA 1P2AA 2A0CX 3ULZA 3QRTA 3SAYA 4RG0A 1ZLTA 4FKOA 4RX7A 3UNZA 3OMVA 4AFEA 3N4VA 3DCVA 5DRBA 2I1MA 3PZHA 4I20A 3U8WA 2C1BA 3W33A 3I4BA 3HEGA 3V6RA 3GU4A 4FIGA 4PP7A 2C30A 4FV6A 4FTNA 4AS0A 3PJ3A 3FLZA 5C4LA 4XG9A 3W2PA 3N4TA 2X7GA 2CJMA 1Q8ZA 1DI8A 4V01A 5FQDC 5J1WA 5F4NA 1KV1A 3AC4A 4RC4A 4FKTA 2FGIA 3F5XA 3ODYX 4QYEA 3CBLA 5D7VA 3KCKA 5E1SA 4HGSA 1M17A 3QD3A 3CIKA 1QCFA 4DEEA 1IASA 2YIWA 3MH2A 4OGRA 5DGZA 3U4WA 3ZCLA 5HG8A 2DS1A 1A48A 5J1VA 1OI9A 1U46A 3PP1A 4E5WA 4JG6A 5HVJA 2ZB1A 3QQJA 2QVSE 2QC6A 2IZTA 2QLQA 3HV3A 4PL4A 3IOPA 4RIXA 4RVKA 1ZZLA 4UZHA 4BKJA 4CCBA 5DN3A 3T9TA 2DWBA 3HDNA 2WZJA 4Q5EA 5FM3A 2XM9A 3VS3A 1JBPE 4GFOA 2YIQA 1YRPA 3BX5A 3R8ZA 4YPDA 3WBLA 3DFAA 5FEDA 2GCDA 4CQGA 4C2WA 1REJA 5M4UA 4PNIA 1DAYA 4ZLYA 5GINE 1B39A 2A2AA 3KULA 1IRKA 3TTIA 1ZZ2A 4JBPA 4ZY4A 4YBJA 4TT7A 5IDNA 2GQRA 4NTSA 4D9UA 3QLGA 4EQUA 3E5AA 2OF4A 3EKNA 3LCTA 3ZSIA 4FV4A 3O96A 4JNWA 4CTCA 3Q3BA 1WBPA 5K9IA 1P4OA 4NK9A 3VHKA 4YO4A 4L8MA 4FTOA 2XB7A 1V0BA 4PTCA 2C5YA 1YOMA 3BWJA 4EH2A 3MFTA 3JS2A 2OO8X 2OW3A 3DQXA 4QP1A 5AUTA 4EHZA 2VRXA 2Y8OA 3A60A 3FSFA 3TUBA 3R8MA 2VWWA 3HVCA 3OXZA 5BUEA 2Z02A 5FTGA 3FMDA 3WF5A 3ZLXA 3G0EA 2BIKB 3OWKA 3TIZA 3TJDA 5AR3A 5CT0A 1OKWA 1YOJA 2O63A 2XCHA 4FR4A 3CTQA 4BDCA 3UQFA 1TQPA 2W06A 3MH3A 4DFLA 3ZUVA 2QOKA 3R8VA 3VJOA 5A46A 3PLAE 3GP0A 4C4FA 4ZLOA 1BI8A 4X3FB 2HENA 4ZY6A 3WZEA 3GNIB 5FXRA 2O0UA 3N51A 4FEWA 4A07A 4GH2A 1K9AA 3JR1A 4OTDA 1YXUA 3QKKA 3VF9A 5AAGA 3VUIA 4GT3A 4IC8A 4E4MA 4IWOA 3VF8A 3T9IA 3E8NA 4QO9A 3BYVA 3ALOA 4K18A 4F09A 2QODA 5M08A 1NVSA 4FIJA 2OXYA 3BBWA 3V5WA 1JOWB 4FSRA 4NM5A 3DXNA 5HKMA 4E26A 3NGAA 3AC3A 3TM0A 3KXNA 3EQGA 1FBNA 1IAHA 5J9YA 3F7ZA 3CPBA 5FP6A 4APCA 1MUOA 4MXXA 4O86A 2UW9A 2J51A 4F65A 4P7EA 4DH3A 2A4LA 1Q99A 2KULA 3ORPA 4YJOA 2WEVA 3BLHA 3QX4A 1JNKA 4P5QA 2JDSA 5DBXA 3VUHA 3KXGA 3CJGA 3UC4A 4FTCA 4OAVB 1U4DA 4B6LA 2QOOA 5M06A 5T3QA 3NZ0A 3F5GA 3MVJA 4QPMA 5J87A 1RDQE 2ZV9A 1NA7A 2BAQA 5LMKA 4BHZA 2UZVA 4WG3A 3HX4A 4U8ZA 4AGCA 4YJTA 4PDYA 3AMAA 4PP9A 2C6IA 2UW6A 3FKNA 3MJ1A 4QP8A 3LJ2A 1PXJA 3PRFA 3PE2A 2C68A 4O7VA 3R63A 4ID7A 4X3FC 4AW1A 3IGGA 3ZH8A 3ZO4A 2W4OA 4IB5A 1YHWA 4JBVA 2YDIA 3MTLA 3QLFA 4M67A 2YCQA 4QP6A 2XRUA 1M2PA 3II5A 3E3BX 3F2AA 4O22A 4CMOA 3AGMA 3R04A 4U43A 2YAAA 4U42A 1LPUA 5B7VA 4TL0A 2UZWE 4LOPA 2E9UA 1O6LA 4F6SA 3MVHA 3A8XA 3W18A 4H1JA 4HPUE 2BRHA 3Q32A 3MY1A 5JGAA 3ZUUA 2VGOA 4UALA 5CZHA 4Z16A 1WMKA 2XBAA 4PTGA 4ZTNA 4XH6A 3R22A 3IW6A 4RVMA 1RE8A 3NSZA 5LMAA 1CDKA 4CLIA 3WF8A 4QMZA 3FMLA 4BCKA 2Z7SA 4C4GA 4R7HA 2J0JA 4RX8A 4BCGA 1W0XC 3DT1A 1Q62A 2CNQA 1Q5KA 3R7GA 2XK8A 4P5ZA 5TOZA 1B38A 4FE2A 2PVFA 3EQDA 2FO0A 3R8PA 2QG7A 1XKKA 5DOSA 3FZOA 4C8BA 5CAVA 4PF4A 3NNUA 4BZDA 3DA6A 2IO6A 3UC3A 2JAMA 5L2QA 2OH0E 4ZMEA 2FUMA 2PTKA 2F49A 3QL8A 5ETIA 2YZLA 4Q9SA 5AFVA 4N4SA 3DXPA 5LOHA 4QYYA 4W4WA 3S0OA 3Q60A 4L43A 4D4YA 4CG8A 4X2KA 5HX6A 5E1EA 4RZVA 4FKJA 3NX8A 3TIYA 3G2FA 3VS2A 4QMQA 1YHSA 4O0SA 4O6EA 4PMTA 4LUEA 5GZAA 4RLLA 1GZOA 5ANJA 4AUAA 3QQFA 5M07A 4QQCA 4BDJA 2QHMA 3NS9A 1TVOA 2BDWA 3MBLA 5HU9A 5HTIA 2QU5A 4QMLA 3RCJA 3MIYA 4F0IA 3AMYA 2RKUA 4H39A 2GU8A 3FHRA 4G9RA 5AV2A 3OVVA 4GFMA 5IZFA 3R1YA 3I1AA 5HIBA 1UA2A 2BZIB 4TYHA 4Q9ZA 4GG5A 3W2SA 5IA5A 5T68A 5EYCA 3RMFA 4ZSGA 3EB0A 4GU9A 3A7HA 4JRNA 4M0YA 4V0GB 1BL6A 3ZC6A 1CM8A 2W1CA 4YMJA 4WG4A 2ZVAA 2O65A 4BCHA 2J0MB 3DAJA 5HG7A 5C27A 4M69B 3V8TA 4D4VA 3FLSA 3EFKA 1TQIA 3DXQA 3LFCA 1CSNA
chains in the Genus database with same CATH superfamily
3DAEA 5CSHA 3HGKA 2RFDA 5EW8A 1W82A 2HXLA 2WU7A 3LFNA 4BC6A 1AD5A 3OD6X 3V51A 3O0GA 4X2GA 5H2UA 3PXQA 2XA4A 1H1PA 4ZZNA 4EJ7A 1JVPP 3P86A 4BN1A 4DEIA 2YM8A 1GY3A 4QMOA 2ZAZA 4EBVA 2VNWA 4XLIA 4YHFA 4G31A 4KKHA 2QHNA 3HP2A 3SG8A 3L9LA 3PE1A 2W1FA 4CYJA 2Z7RA 4AA0A 5BV3A 4J71A 1KE8A 1UNHA 3JUHA 3SV0A 1F3MC 2OFUA 3DGKA 2CN8A 3DZQA 4P4CA 4ZS4A 1H24A 4DFXE 4FNZA 2XNEA 3IW8A 2REIA 3KVWA 3EFWA 3FLQA 3VW6A 5KBQA 3SVVA 4GFGA 4DCEA 2VUWA 4JG7A 4CQEA 2G9XA 2W5AA 3UTOA 4C34A 4FT5A 3Q52A 1PYEA 3RBWA 4IC7A 3ZMMA 4EZ3A 5IUHA 5HOAA 4BGQA 3U4UA 5CQUA 4HZSA 2PWLA 3MYGA 2J4ZA 4BDKA 4C4JA 2B53A 2JITA 4KBCA 4DGMA 4I22A 4XEYA 3TNIA 3QF9A 3S4QA 5KMMA 2BROA 3DB6A 4J1RA 4O0RA 1JWHA 4RWJA 4C38A 3GVUA 3R9DA 2I6LA 3D83A 3S3IA 2BHHA 1H4LA 4QP2A 3AC5A 2CNUA 2GS2A 4X7QA 1FVTA 3PY1A 4D1ZA 2VTHA 3P0MA 4DEAA 3I7CA 1UWHA 5FBOA 3QQHA 5K4IA 4Y5HA 2W5HA 2JDRA 2VTAA 1OZ1A 1VZOA 5I9XA 3D9VA 3QWKA 4BCMA 5CSXA 3VS0A 3ZRLA 1VEBA 2QR7A 4RZWA 3LFSA 5HIEA 3AGLA 3O51A 4RC3A 2PE1A 3TKUA 5JGBA 1ZRZA 2BMCA 2WXVA 3BPRA 5KZ0A 2X6DA 3EQBA 3VRYA 5HBJA 4YLLA 3HL7A 3MSSA 2FSOX 4QMNA 4ANBA 3ODZX 2E9VA 3QAME 4LOQA 4B99A 4ZZMA 2XP2A 4EUTA 2LGCA 4CLJA 2PE2A 5CENA 2IZSA 3NDMA 2JKOA 3U51A 3CC6A 3E63A 5CS6A 5BVKA 4AAYA 2XVDA 5DVRA 5HLPA 4KIKA 3VUDA 2JIVA 3VUMA 5I3RA 4FKPA 4NW5A 4QMMA 4BDHA 5K5XA 2WGJA 4MEDA 3EZRA 4MXAA 4BJJB 4RRVA 4GK3A 3A62A 2JEDA 3D2KA 3FZSA 4YPSA 3PIYA 3DBFA 3DLZA 3IS5A 4EZ5A 4EBWA 5JFSA 4YJSA 4AQCA 4KS8A 2VTOA 4OBOA 2Y6MA 4DFYA 3W55A 4KBKA 3P9JA 3E87A 3ZEWA 3PIZA 3VBYA 2Q0NA 4ANSA 3TACA 4EQCA 3E88A 1WVYA 3MPAA 2WO6A 4GG7A 5CSWA 4APPA 1OITA 2Z60A 2JIIA 3TZ9A 4F9BA 5HTCA 5L8JA 4L42A 4PMSA 3AKKA 4S30A 3BYOA 5HHWA 5HO8A 4NTTA 2GNHA 4RIOA 4EC9A 5CF8A 2GHGA 2V55A 2F7ZE 4FZDB 4O7YA 5JKGA 3EL8A 2C6EA 3O2MA 2XCKA 3OWLA 4ITJA 4E6QA 4GW8A 2ITUA 3RM7A 4ANOA 1FOTA 2WOUA 4R7IA 2WD1A 4U45A 1PJKA 1W98A 4QYFA 3ZFXA 4ERWA 2WELA 1ZY5A 4CV8A 4JBOA 5EDRA 3W2OA 4CXAA 2ZDTA 3HRFA 4X6RA 4XJ0A 3TMOA 5LXMA 3UG2A 3QHWA 3C51A 4B8LA 2UVXA 1A06A 2OJFE 3G9NA 3A7FA 3FZ1A 4KA3A 1HCKA 2EUFB 1G8SA 3EQCA 5TT7A 2HXQA 4WBOA 4TZRA 5D11A 1E9HA 2NPQA 1L3RE 2UW3A 4FUYA 1SYKA 4C37A 4FJVA 3W2QA 2H9VA 3FUPA 3M1SA 4U0IA 4QYGA 3BGPA 3JXWA 4PPCA 2J0KA 2VD5A 2ITWA 3NW5A 3W32A 3F3ZA 5M55A 5J9ZA 1OMWA 3ZM4A 1DI9A 3W8LA 2YIYA 3OTVA 4YNEA 5CVHA 2WIPA 2Y6OA 4CFFA 5CAOA 4CRLA 4F1TA 2C6LA 2WMVA 3LFEA 4FIFA 3BU3A 4TWOA 2BR1A 2ZDUA 2IVUA 2QKWB 1K3AA 2P4IA 4JQ7A 5CWZA 2IG7A 1GZNA 5FP5A 4FC0A 4B9DA 4F1OA 1FVVA 2Y9QA 4E6DA 1XMLA 1WAKA 4LRMA 3DKOA 4IX5A 5AP7A 4HCVA 2IN6A 1Q61A 3GB2A 4G2FA 4IM3A 4D28A 2GNFA 3DV3A 3FKOA 3FMHA 4FSNA 3ENMA 4ZTHA 3S2PA 1G3NA 3L8VA 3SXRA 4LG4A 2WIHA 5L6OA 5KMJA 4IBMA 3VBXA 4MXCA 3FQEA 4NW6A 3IDPA 4C4HA 2ITVA 4RVTA 3KQ7A 3TDWA 3R02A 1VJYA 2H8HA 2BFXA 4LL0A 3UVPA 5HX8A 4YSJA 1BI7A 1I09A 2VNYA 4IAYA 4TYJA 4B8MA 5HLNA 2F7XE 2WQBA 2YIRA 3W0OA 3SG9A 4ACGA 1U54A 3ERKA 4KINA 5IUIA 4UWYA 4J8NA 4CCUA 4EORA 1WBTA 4TTHB 2VWUA 1M7QA 3NYOA 5EDPA 2PPQA 3OY1A 4O4EA 2JDTA 5EKNA 3BEAA 1IA9A 4FK6A 4TNDA 5HI2A 3O8UA 1WBSA 2XAMA 5AR7A 3L8XA 3HAVA 5EG3A 3FC2A 3DS6A 4PX6A 3WZJA 5BVFA 4GCJA 3F66A 3RPOA 2UW8A 3F2RA 1Y57A 2QOFA 5ICPA 1PMNA 3EZVA 4UYAA 3EQIA 4HW7A 3BZ3A 3SGCA 1GZ8A 5IH4A 3FY0A 4PUZA 3MVMA 4GMYA 4XV1A 3ATSA 2ZM4A 3AD4A 2R3GA 3ZBXA 2C3JA 2P0CA 4DEHA 2IJMA 4E6CA 5DR2A 4AZEA 4C59A 1UNLA 4AWIA 2XALA 4FKRA 1F0QA 3C4CA 1ZYLA 5H3QA 5AP4A 3BQCA 1PXLA 3TNQB 2VWYA 3QZIA 4AZFA 3QX2A 2XK6A 2YWPA 3AD5A 3ENHA 3KMWA 4YJUA 4ENXA 2JBPA 2XH5A 4GYGA 4BBFA 1H1SA 2ETRA 4FTJA 4M84A 4L68A 5CNOA 5EKOA 4Z9LA 4D5KA 3K3IA 4DH5A 4FNWA 1W8CA 2AC3A 1O6KA 2IVSA 3QC9A 4IVCA 3QCQA 2PVLA 3OUKA 2PY3A 4ZTRA 5C1QB 5IDPA 2Y7JA 5HEZA 2JGZA 3FDNA 3AOXA 5B2MA 3BYUA 3T3VA 4G17A 2FVDA 3O7LB 4EH7A 4AE9A 2W5BA 4USFA 4FEVA 1B6CB 1BL7A 3FI8A 1CTPE 4ALUA 1G8JA 3PA3A 2W96B 2VTLA 4FODA 4YSMA 3NWWA 3PXYA 4QPSA 1UU7A 3DBDA 4XRLA 3WZDA 2G1TA 4KB8A 2BTRA 4PNKA 3QZHA 4DCAA 3A8WA 5EW9A 1ZMWA 4JIKA 2EB3A 2QI8A 2YABA 4JDHA 3LXKA 4KS7A 4I6QA 4YO6A 5DR6A 2OJGA 4BL1A 2C6KA 1KUTA 4OTHA 2A98A 1R78A 4L01A 3WF6A 3U6JA 4GSBA 4G5JA 4I0RA 4YZCA 3VS7A 3UODA 4JQEA 4MQ2A 5CLPA 3UNJA 4BWKA 4ZZOA 4QP4A 2OIQA 2VTMA 1LEWA 2R9SA 3D0EA 5IA4A 2W1EA 1WBOA 3VULA 5L8LA 2QCSA 4K6ZA 4S2ZA 3T3UA 4FA2A 2C0TA 3KF7A 4IZ5A 3QRKA 5BNJA 4NM7A 1Q8YA 2ZV8A 3KRXA 4UBAA 3TDVA 4U44A 4D4RA 3V04A 3PDTA 3RPRA 3KRWA 2W4JA 3EN9A 5LCKA 3P5KA 5LMBA 1M2RA 1O9UA 3Q2MA 4E73A 1H08A 2RF9A 5AX9A 4CZUA 2X7OA 4PL3A 2I7QA 4X2JA 3CQWA 4G16A 4GYIA 1PMVA 2R3HA 3M42A 1T46A 4MNEA 4G9CA 2XYUA 3PY3A 1YXTA 2YN8A 5AAEA 1OPKA 5L6WL 1ST0A 2VTSA 4LFIA 3DTCA 4JL9A 4C58A 4IFCA 4BWXA 4AF3A 4GJ2A 3V8SA 5E9EA 4J95A 5E8SA 4NM3A 4F7JA 1JSUA 3F88A 3ZLYA 2UZNA 5ANKA 3BCEA 4BHNA 2UV2A 3D5UA 3EHAA 4UWBA 2VWIA 4O0WA 5HORA 3P5JC 1J1BA 1IA8A 3OWPA 2IW9A 2BILB 4DITA 4IACA 2C3KA 4D58A 5AA9A 3V8WA 3NW7A 5K3YA 4QP7A 3COIA 3LIJA 5ANOA 4O2ZA 4MQ1A 4HVGA 4FNXA 4J8MA 3ZEPA 3HA6A 1M52A 3S95A 3HMNA 3V5JA 5IKWA 4AT5A 4FV9A 4IE9A 4F6UA 4O7WA 4HNIA 3TKHA 3ZRKA 4XBUA 2UUEA 4HGEA 4IADA 3AC8A 2VO6A 3NAYA 4OTFA 3ROYA 3KK9A 5C8MA 4JJRA 5BYYA 4YP8A 3MY0A 5HNBA 3JYAA 4L3LA 2C47A 4QQ5A 2H34A 4O21A 4JAIA 4RA5A 1QPCA 4B7TA 3HA8A 1OL5A 1TQMA 4KIPA 3FZRA 4LV7A 5GJDA 4WBBB 2GDOA 2X9FA 3RZFA 4NIFB 4Z55A 3NVMB 2QQ7A 1JSTA 2QOCA 2OZAA 4K11A 3N9XA 5E92A 1IG1A 4RWKA 1PXKA 3H9RA 4Y72A 4L7FA 5M56A 4NJDA 4EH8A 1ZYDA 3ZONA 5IH5A 2E9PA 2OXDA 1STCE 1QMZA 1SVEA 4QMXA 3GGFA 4XG3A 5IG1A 4EOPA 4PDOA 4XLVA 3GU5A 3B2TA 3KVXA 3FE3A 3NYVA 3FKLA 4NUSA 5EFQA 4PMMA 4LGHA 3FPQA 2OF2A 3UIMA 4BI2A 2H6DA 3PSCA 4EWHA 3F3TA 3Q6WA 2UVYA 3I60A 3U54A 4RWLA 4FT9A 4MAOA 4S32A 2ZJWA 3EQHA 2XJ1A 4WUNA 1JSVA 4C36A 4QP3A 3DK6A 1Q3WA 3TNPC 4PPAA 3KIOC 4GEOA 2VTJA 3BKBA 4FVQA 4MWHA 1WVWA 2P2HA 3ULIA 3BGZA 3BBTB 3HMOA 4OW8A 3TWJA 3W1FA 2QO7A 3P79A 4WT6A 1SVGA 3M2WA 5HICA 5JH6A 2NRUA 4FSMA 4FTRA 4G3FA 5BVOA 3UOLA 1BUHA 4RT7A 3KXHA 3EH9A 3HV4A 4YZBA 3R7UA 5DT3A 3SOAA 3HAMA 4YURA 4XG6A 3MB6A 3TT0A 3PPKA 5A54A 2J6MA 4RIYB 2WQOA 3JVSA 4LL5A 2WEIA 1OVEA 1EH4A 4FIHA 4A4XA 3N4UA 2UW5A 1XHAA 1W2FA 1ZY4A 3PXZA 5TE0A 3D4QA 5KBRA 5I9WA 4EKLA 1OKVA 3WZUA 4NCTC 2IW8A 1Z5MA 2PVNA 2RSVA 3FI4A 2HYYA 3PJ1A 4BFMA 2GS6A 5G6VA 3SC1A 2C0IA 4DT9A 3GT8A 4FGBA 4FTUA 3IO7A 3CXWA 4FIIA 3SXFA 3SRVB 5BVWA 2OSCA 2BZHB 3TYKA 1OM1A 3LFAA 4PRJA 2WQNA 4BCIA 2B54A 3E7OA 2W1ZA 3LJ0A 2ZOQA 3ZYAA 4C4EA 2X8DA 4BKZA 4JS8A 5JZJA 2RFNA 2HY81 3RHKA 5BVEA 3VN9A 3EN6A 4O0VA 2IF8A 5EI2A 4ASZA 3VIDA 2QD9A 4AACA 4HZRA 4YJRA 4UXQA 4K0YA 3R0TA 4YTIA 5CAQA 2VX3A 1SMHA 5KMNA 4Z7HA 4OAUC 1DS5A 2HWOA 1CKPA 4UMPA 4ONAA 4JI9A 5L8KA 1ATPE 4S33A 3QTQA 4R1YA 4AX8A 3PWDA 3IW4A 1H1RA 3PVWA 3KRJA 4LM5A 3ZDIA 2C6MA 3NR9A 3GFWA 2C5NA 5HNGA 4GVAA 3ZBFA 2WMUA 3L8PA 4I4EA 2OJ9A 3Q5IA 5KO1A 4ZY5A 3UZTA 3EFLA 2X9EA 4EOLA 2CCHA 2GFSA 1XH7A 2GNIA 4IQ6A 3G6HA 4WG5A 4DFBA 4O1PA 3VVHA 4EYMA 2W1DA 3LW0A 3E8CA 2WTWA 4LV8A 5J5TA 4PDPA 4CSVA 3DKGA 4IFGA 5JFXA 4O82A 2PYWA 4H1MA 1Q41A 4O7NA 3AG9A 4ZJVA 1R0EA 3COMA 5ETFA 3RPVA 3W0SA 3CTHA 1NXKA 2BDFA 3QTIA 3HMIA 3Q9WA 2CCIA 1KSWA 2P33A 2G2IA 4QMWA 3NCZA 2C1AA 3RWQA 3GCQA 2HK5A 1W2DA 2WTDA 2ITTA 3FQSA 4KRDA 2YCFA 3ACJA 5CF5A 3W16A 4AOTA 5DT0A 4IH8A 4FV8A 3ZLSA 5IQEA 2GTNA 2NRYA 3QCYA 2JC6A 3RALA 3DLSA 1WVXA 3QGYA 4FKUA 4FT0A 5IA0A 4KIQA 3FZTA 2UW4A 3HUCA 5EI8A 3O5AA 2OIBA 4R78A 3ZFMA 4FEQA 4GUEA 3GU8A 4BCQA 3MY5A 3DDQA 1HOWA 2X0OA 3PVBA 5AR4A 3PSDA 1F5QA 3LFQA 5E4HA 4JX3A 1RJBA 4QTEA 4IMYA 1ZYCA 5KNJA 3TI1A 4R7BA 3R83A 4GT4A 2XKCA 4MK0A 4I0TA 3ZUTA 4RIWB 3ZS5A 2XUUA 2KTYA 4G34A 4EUUA 4JDKA 3ZU7A 3A2CA 1XBCA 3I5ZA 4ACHA 3VQUA 3QQUA 4B0GA 4XV3A 1OPLA 4F64A 1WFCA 2YM4A 3HRCA 4FKQA 5AUXA 2ONLC 3UNKA 2AYPA 3EIDA 4FSZA 5A9UA 2Y4IB 4UYNA 4A4LA 4DDGA 3GI3A 1PYXA 4OTRA 2I0HA 4DTAA 5E90A 3PUPA 1XR1A 2C5OA 4FVRA 2YM7A 5ACKA 5HCXA 4FL3A 3TV6A 2IWIA 2QR8A 4E4NA 4EHVA 4EONA 5BX0A 2PMNX 3RCDA 4EYJA 3L9MA 5DWRA 2JFMA 1PMUA 4N0SA 4YZ9A 3WILA 3ZDUA 4C3FA 2CMWA 2XJ0A 4FG9A 5FRIA 4C61A 2CGXA 4FKVA 4W9WA 5AMNA 4MH7A 2JBOA 2V62A 4KNBA 3MWUA 2YDKA 1YQJA 2GHLA 2BIYA 3JY0A 2JDVA 4FKLA 1H07A 2VO3A 3GU7A 3Q4UA 4AZWA 5ETAA 2BZKB 1PXNA 2WMQA 4BCNA 5A4LA 4USEA 4RMZA 4E3CA 4LMNA 5J5SA 2O8YA 4I5CA 4FKIA 4O7SA 2XK9A 3CQEA 1CKIA 1V0PA 3QQLA 5M51A 2F2CB 3AQVA 1GIIA 4CYIA 3SA0A 2R3PA 1SZMA 3LMHA 1YVJA 5HG9A 3R9RA 5L2IA 4NH1A 3QXOA 2CKEA 3CEKA 5I4NA 5AV3A 3WF7A 2PMIA 3MN3A 1U5RA 1IAJA 2W0JA 2WMXA 3UDTA 2RG5A 4YR8A 5DA3A 1ZYJA 4G6NA 3UO5A 3DBEA 5DR9A 1DM2A 2YIXA 4U41A 1PXIA 3MFUA 2XRWA 3HECA 2R7BA 1OKYA 3RP9A 2GNGA 4M15A 1Y8YA 4DTKA 5I9ZA 1JPAA 4WRSA 3F3WA 4FF8A 2YCRA 2WMAA 2Y4IC 4O4DA 4F7LA 3CE3A 4BCOA 2YJSA 3GCSA 4QQTA 2QURA 4FZAB 4E8AA 4TWCA 5CEMA 3MI9A 2VTPA 4YTHA 5EM5A 3NMUF 4AGWA 5FWKK 2UZEA 4BGHA 1WBWA 3BE9A 4OTPA 4DGLC 4KIOA 1DAWA 4HYHA 2XM8A 2BKZA 4YGAA 4BDEA 4BY9E 4RJ8A 1IR3A 2XKEA 1OB3A 5E8ZA 4BDDA 1UU3A 1XWSA 4O7ZA 3KL8A 2OH4A 3DKCA 4ANNA 5KHWA 2OU7A 4WO5A 4O1OA 2X4ZA 2UZOA 2F4JA 4ZLZA 4CZTA 1QPJA 3EL7A 1H1QA 3QTSA 2OXXA 5D9HA 4O91A 5CTPA 4O83A 3BI6A 3VUKA 2ITNA 4I1ZA 2HW7A 4TWNA 4X2NA 3TKIA 3VAPA 4I92A 3UG1A 2VV9A 1J3HA 4C3RA 4ORKA 2W1GA 3GFEA 4M13A 3TCPA 5K0KA 5LJJA 4CFVA 4IVDA 2IW6A 2FB8A 4JVGA 3QA8A 3C4ZA 4OLIA 5HNIX 2BVAA 3FMKA 4OR5A 3NUSA 5DHJA 4M0ZA 4F9AA 3RAHA 4BCFA 3U9NA 4ZJIA 3FLWA 5CEKA 5FTQA 4BDIA 4D2VA 2BTSA 2CSNA 2JKMA 3LM5A 3MFSA 3OS3A 4KD1A 4BZNA 5KMLA 3TUDA 5CXZA 2F2UA 4FL2A 5HCZA 2R3MA 2VX1A 2NP8A 3KN5A 5FTOA 5CAUA 5K4JA 1YWNA 2GNJA 5A14A 4FTMA 5TR6A 3WYYA 4WKQA 3VBTA 2OK1A 4CKRA 3GQIA 3MJ2A 3MESA 3C13A 1R0PA 2A1AB 3K5UA 4QMTA 3ML1A 3C5IA 3P08A 4MBIA 4YLKA 3E92A 3DJ5A 5HVKA 5JGDA 5GIOE 3QA0A 3P4KA 1YOLA 4K77A 1H8FA 5AR2A 5IPJA 4FZ6A 3Q9XA 2V22A 5EYMA 3AC1A 1JKKA 4MCVA 2PUNA 4OBQA 4AP7A 3ZZWA 1OPJA 5HD7A 1M14A 3PXRA 2J5EA 3I0QA 1LP4A 4TPTA 2PHKA 3ANRA 2YZAA 3CD3A 1JQHA 2BALA 3RZBA 1RW8A 3SW7A 2OGVA 3DAKA 3FI3A 4I41A 5DMZA 4M97A 2OFVA 2OI4X 3LMIA 4I93A 4QRCA 3BLQA 5AJQA 5FBNC 3E64A 4GK2A 4IVAA 3DNEA 3QHRA 3EMGA 4AU8A 5D10A 3FHIA 5B0XA 4RFYA 5IMXA 1R39A 1X8BA 4FZFB 3Q2JA 4FEXA 4QNYA 5EOBA 4AZSA 5JMSA 2XKFA 3VC4A 4A9YA 4HCTA 4U9AA 4DH8A 1Q8TA 4ASDA 3W0NA 2PZYA 3QCXA 4FV3A 4PQNA 4R3CA 4CFXA 4DBNA 4UN0C 4CKJA 3OP5A 2PE0A 1TZDA 1AGWA 2X2KA 4O0TA 4NL0A 5JEBA 3FSKA 3LM0A 4C35A 4AN3A 3C5UA 2BRGA 1Z9XA 1KE5A 4ZAUA 4W8EA 3RK5A 2YWVA 1GJOA 3RJCA 4MNFA 5J95A 4L67A 5AP3A 3FMEA 4DEDA 5F95A 3LLAA 3Q9YA 1I44A 5B2LA 3C7QA 3ZSGA 5LVMA 4RJ4A 3ORNA 4AFJA 4CFMA 3VS1A 3A4OX 2EVAA 1YWVA 2PL0A 4E1ZA 4FL1A 2BZJA 1H01A 4MX9A 4N57A 1H1WA 2HOGA 3R1SA 4D9TA 5CEOA 2VTIA 2YITA 3B8RA 3NAXA 3POZA 2B7AA 3LHJA 4FTAA 2GMXA 2XNNA 2HAKA 3PY0A 3R7IA 3WF9A 5LVOA 1Y91A 2B55A 4J52A 5CVFA 2YISA 2A27A 4E6AA 1LEZA 4FKWA 3H3CA 2ACXA 3DK7A 3IGOA 4RBLA 1YKRA 4ZXTA 3ORKA 4FG7A 1J7UA 1VR2A 2PVKA 2FSTX 4L00A 1YI6A 5E8VA 5JRQA 4Y85A 3HYHA 3PVGA 5HVYA 4FV5A 3EN4A 4R5SA 3F9NA 4U81A 3PJ2A 4D2RA 4MBLA 1GIHA 3R7OA 1MRYA 2IEWA 3CR0A 2BAJA 5EQPA 4O4BB 4BGGA 2J90A 5J7HA 4QMVA 4IJ9A 3MV5A 3CP9A 4NEUA 1H26A 2QO2A 3Q6UA 2GNLA 4NIFA 4J97A 4IZ7A 3TEIA 3K2LA 2JD5A 3H4JA 3A7IA 4JDJA 1YXSA 4EZ7A 4YTFA 4XG2A 3OTUA 1FVRA 1Q97A 4GIIA 3PPJA 2XNBA 4IDTA 3NPCA 4RWIA 4RJ5A 4UWCA 3KXMA 4CNHA 5IQAA 3CTJA 3DBCA 2VO0A 5DLSA 5CNNA 1KOBA 1GAGA 2ZB0A 4E4LA 3U87A 2R3FA 2PU8A 4IZAA 4UZDA 5IQBA 5LWNA 3GC9A 4PV0A 1NVRA 2B9FA 4ZTSA 5IUGA 3FZPA 4ACCA 1MRVA 3H0YA 3Q04A 5CXHA 4MD9E 4QQJA 5LARA 2WAJA 2X4FA 4P90A 4L52A 3IW5A 2I40A 2G15A 2EWAA 3FJQE 4I23A 4UB7A 4I21A 3D5WA 4G3GA 4YUQA 4BB4A 4BWPA 4TWPA 4TYGA 3TJCA 3AT3A 2YM6A 2AQXA 5KUPA 2VTQA 3ATTA 4C0TA 3BL9A 4XS2A 4O7RA 3JVRA 3D14A 5L2WA 4EKKA 5GZ8A 4Y46A 3CKWA 5LCJA 5I9YA 1LUFA 3O7LD 3RPSA 3FXXA 4FTTA 4ZP5A 3VUGA 3UMXA 1UU9A 1S9IA 4HYSA 1S9JA 3EQFA 4CG9A 4R3PA 4PTEA 3CGFA 5CX9A 2WB8A 2XANA 4MKCA 4WOVA 4RX5A 4RIYA 4AA5A 4EOSA 2WQEA 5EH0A 3CPCA 4O7LA 1H28A 3OEZA 3SLSA 4A4OA 3E7VA 3DJ7A 1BMKA 4MD7E 2PVMA 3R9NA 5LMKC 2GQGA 2G2HA 3E8EA 3L8SA 4EOQA 3LZBA 3ZHPC 4J98A 1JKSA 4ZTMA 2WPAA 3QTUA 1XBBA 2PZ5A 4JOAA 3UBDA 3QZGA 3FXZA 3K5VA 1ERKA 3TL8A 4QDVA 1Q8WA 3HNGA 4IW0A 5AUVA 4AE6A 3OC1A 5GJGA 4A06A 5KZIA 3EWHA 4ZIMA 2ZV2A 4C4IA 2W4KA 3R2BA 2CKPA 3KK8A 4QMSA 1O6YA 2G2FA 3F7WA 3C1XA 5DFPA 2PMLX 3DZOA 4FSQA 2ZMDA 1GZKA 4ITIA 3UIBA 2JKKA 3NIZA 4WUAA 3UQCA 3K3JA 5L6PA 4LQMA 5HBHA 1Y6BA 4R1VA 4M8TA 4MHAA 4M14A 5BVNA 4DDIA 3GU6A 5HE1A 3OZ6A 4NYEA 4WSQA 4JLCA 5TO8A 2Z2WA 4MF1A 5EQEA 3LXPA 2WTCA 3MA6A 3PP0A 2WOTA 2W7XA 4D2TA 4NSTA 3H0ZA 4S31A 1VYZA 5JFVA 3OW3A 4ENYA 3QBNA 5B2KA 3GBZA 3QKLA 4X3FA 5DIAA 4E93A 3BHUA 2HIWA 2IZUA 5CQWA 2BRNA 5EHLA 1G8AA 3JPVA 3UGCA 1ZXEA 4LV5A 3ZO1A 1SNUA 4DEGA 3QWJA 2YERA 3CGOA 3LXNA 4W9XA 3RAWA 3LCOA 1REKA 3R30A 3RNYA 4DLIA 2W9ZB 3SDJA 3G15A 4ZJJA 4R3RA 3HV7A 3LQ5A 4AXAA 4C7TA 2YEXA 4GU6A 4UY9A 4D0XA 4F0GA 4X6QC 4FEUA 4XG7A 4KUJA 2I0VA 4ZS0A 5AAFA 3R8LA 2PMOX 2YDJA 3LAUA 1YDSE 1OECA 3PZEA 5TF9A 4XCUA 3QYWA 3F3VA 3L9PA 1J7LA 5CU0A 3GCPA 4MWIA 2Z7QA 1ZMUA 5E8TA 4FV7A 2XNOA 2J0LA 2WMBA 3PSBA 3R01A 5AV4A 2JAVA 1T45A 3CD8A 3PVUA 5CEIA 2C6DA 4FSUA 4FT3A 3B2WA 2ZYBA 2Q83A 3F6XA 3WIGA 3EJ1A 1PY5A 3RINA 3RK9A 2XK3A 3MPMA 4JX7A 3VNTA 4BDAA 4DHFA 1J1CA 4MXOA 5BPYA 2O3PA 5HTBA 3NUAA 3QYZA 5I0BA 4W4VA 4QYHA 5DEYA 3VHEA 3EYHA 3BGQA 4QNAA 3LKMA 2BFYA 4V05A 4N6YA 5A6NA 5GIPE 3NVKI 5CYIA 3DOGA 2CHLA 4GRBA 1NY3A 1PKGA 4C57A 4I24A 1KV2A 5GNKA 2O2UA 2X2LA 5C01A 3LCDA 4MVFA 2OICA 3F2NA 4FV2A 5EM6A 4NFNA 4EOMA 2WTIA 3RTPA 4G3EA 3BLRA 4IB1A 4XG4A 4BVUA 3BRBA 3IONA 5C4KA 4G3DA 2B9HA 1RQQA 3P7AA 4FTKA 1FPUA 5C8NA 3OBJA 3RK7A 1WBVA 4F9YA 4RJ6A 3W0MA 3D7TB 1WBNA 2PVHA 4I5HA 3F3UA 4FKGA 5BMMA 4QP9A 5H8EA 3FL4A 5H8GA 2UZDA 1E1XA 5AUYA 4LDTA 3HP5A 4TRLA 4YC8A 3HMMA 3ZXTA 5A4TA 1H25A 3HRBA 2GPHA 4DGOA 1PRYA 4L46A 4K33A 4K1BA 2J2IB 2BDJA 3AMBA 3P78A 4O0UA 4O27B 4UX9A 4FI1A 1H0WA 2YM5A 4G6OA 4K2RA 4YC3A 3D5VA 3ORXA 3P7BA 4QPAA 4CV9A 4IX3A 4DF3A 3VO3A 1ZOEA 4AQKA 5I5ZA