4GK4A

Human epha3 kinase domain in complex with ligand 90
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
275
Chain Sequence
VHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITNLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords EPH receptor A3
publication title Optimization of Inhibitors of the Tyrosine Kinase EphB4. 2. Cellular Potency Improvement and Binding Mode Validation by X-ray Crystallography.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 275
sequence length 295
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gk4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gk4A01
3AT2A 4S32A 1H08A 4E5BA 4RIYA 5B2MA 4FNZA 2GMXA 4BGGA 1UU3A 1WFCA 1Q41A 3IGGA 1O6LA 1YVJA 3IS5A 4II5A 4V01A 3WZEA 4TKSA 4AT5A 4BZOA 3B8RA 4W4VA 2WOTA 2PVKA 3OTUA 3KK9A 3Q9YA 3R02A 4I6BA 3VHKA 2GNJA 4AGCA 4C02A 1ZY5A 1BL7A 3E8NA 5IQDA 3ZSGA 5AV3A 5E1EA 3BHHA 3PDTA 3ZEWA 1Q8WA 1LR4A 3R7UA 3RNIA 4DG2E 1UU7A 5I9ZA 3K2LA 3DDQA 2ITXA 3NNXA 3R1NA 3ODYX 3RBWA 5FTGA 2G2IA 3KRXA 3ALOA 3PWDA 4P7EA 5FD2A 3PE1A 5HI2A 2QLQA 2H9VA 4GK2A 3BE9A 3K5UA 5ACBC 3DBEA 3ELJA 3EQFA 3HVCA 3MI9A 3NZ0A 1GZ8A 4B99A 2R4BA 3KMWA 4GEOA 3I7BA 4FKIA 4OBOA 4XMOA 1OVEA 4AU8A 2XYUA 3V5QA 3FKOA 4YZMA 5AP6A 5AR8A 2X81A 2R9SA 5KMOA 4FEWA 3GI3A 5M09A 3LXKA 4O2PA 4IEBA 4MNEB 5AUTA 2YDJA 3FV8A 3FMMA 2PU8A 2Y4IB 2HK5A 4MCVA 4UMQA 5IPJA 1OKYA 3DAJA 5DHJA 2JD5A 2YM5A 3E92A 2OO8X 2ZMDA 4NKSA 2Y8OA 4FL1A 3KKVA 4AACA 1JQHA 3P7AA 5CWZA 4BY9E 3LFAA 4XCUA 2HENA 2OW3A 3OCBA 1LPUA 4N70A 3GU8A 1XH7A 1KWPA 3F7WA 2AUHA 5CSHA 5CAUA 4CFVA 4ZY6A 3QD4A 4FIJA 3KN6A 4Q9ZA 4D2WA 4M7IA 4U42A 2YM8A 1F5QA 3O23A 4ANBA 4CGAA 5IEVA 2H6DA 4RA5A 1PJKA 3R83A 1FGKA 1Q8ZA 4X0MA 4EJNA 4DH8A 3ROYA 5J1VA 4PNKA 3DBDA 4OUCA 4YBKA 3RK9A 3PRIA 4PTGA 2ZM1A 3BU6A 2C5XA 5F94A 4AZSA 1ZYJA 4GIIA 4EOPA 3OCTA 5AR4A 4BCFA 4YO4A 3AMBA 3H9OA 3FQHA 3EL8A 1J1CA 4FV0A 4IW0A 4D4VA 2X4FA 2WZJA 3OT3A 4ANSA 4KS7A 5A54A 4GH2A 3KXMA 4QMTA 4PDYA 3D7TA 3E63A 2HYYA 2VTIA 3HA6A 4AZWA 1I44A 1U54A 2CCHA 3HGKA 3FYKX 2I0HA 2XNBA 4ZTNA 4Y72A 4M84A 4BCHA 4L46A 3PVUA 4WRGA 3A7HA 4RZVA 4IZAA 3ZO4A 4C37A 1GZKA 4X21A 5HD4A 1VYWA 2GU8A 2R3FA 3CJGA 3MW1A 4YJPA 2ITUA 3BV2A 3HLLA 5CVHA 2QD9A 2BZJA 3ZLYA 1FGIA 5L6OA 4AW1A 4Z55A 4MWHA 3ACJA 3C4XA 1NXKA 3MPMA 3OXIA 3R00A 5D7VA 4C36A 3VS0A 2R3OA 3MS9A 3TNWA 5LOHA 2YWVA 2EXEA 2P33A 4CVAA 4LV8A 4HVHA 4CFXA 3MH2A 4IDVA 3L8SA 4YNEA 2C5OA 4ZXTA 3OEFX 4BDDA 3GCPA 3NIZA 5HE2A 3FMDA 5KMNA 3NCZA 1WVWA 1JSVA 2YN8A 5KE0A 4YHFA 4BHZA 2C6MA 3FC1X 1CTPE 4EOMA 4K18A 5JKGA 4G17A 5HG8A 1BX6A 4F9CA 3TJCA 4JDHA 3UE4A 3PA3A 2HZIA 2WGJA 3C9WA 4BDIA 1OL2A 3VVHA 4F08A 4DT8A 4EH6A 4F64A 1XH4A 5HG7A 3DA6A 3EFWA 3HV6A 3OF0A 4D2PA 1APME 3PVWA 1PYXA 5AR5A 3U54A 2BROA 2UZWE 4BB4A 2VD5A 5A4EA 4L53A 2J4ZA 3TV6A 1GAGA 4FL2A 2B9FA 5HBEA 5A4QA 2XM8A 3O8UA 3AD4A 4FIEA 3CQUA 5DN3A 3C51A 1PMEA 2UZVA 4BDHA 4DH5A 2QO9A 5GINE 1GIHA 3FUPA 3P7CA 3ZBXA 4D2SA 3E62A 4DBNA 5IQFA 4EK3A 4FKVA 4YNOA 4FTQA 2OXXA 3UNZA 4MD7E 3PXQA 4BF2A 3SC1A 2BCJA 2VX3A 1CMKE 3OTVA 4QPMA 5HNGA 3PLAE 4X3FA 5D11A 2F2CB 4XG4A 3W18A 3QX2A 2PZ5A 5EFQA 4DEAA 5JQ8A 3ERKA 2HWOA 2XNEA 3C5UA 3TIYA 4M15A 1MP8A 4I0TA 4S2ZA 2J50A 2ITWA 3FL4A 4XYFA 3SRVB 4DTBA 2HOGA 4RJ4A 4O0XA 3NW5A 1YOJA 3VUTA 3HRBA 2F49A 3E7VA 4F1OA 1H0WA 3KCKA 4LMUA 5ETIA 3DJ5A 5A3XA 5FXRA 2W05A 2PZIA 5LMAA 2V5QA 2PMLX 1O6KA 4L3LA 1NVQA 4IMYA 4JQ8A 5DNRA 5I9VA 3KRLA 1GOLA 3L8PA 4G3DA 2C1BA 2VWBA 2O2UA 2Z7SA 2GTMA 3NYXA 4J97A 1GNGA 3ZFMA 4F7NA 1KUTA 4ORKA 4MXCA 4BBMA 3M1SA 4JI9A 2SRCA 2WQEA 2IZSA 3NUNA 5CT0A 5KMLA 2GFCA 3BHTA 3HZTA 3LIJA 3F69A 5L2QA 1H24A 2XH5A 4FSQA 4D0WA 2HW6A 4WBBB 2F2UA 4QMOA 4D1ZA 4DH3A 4GUBA 5IA4A 3C4WA 1ZAOA 4MD8E 1OKZA 1YHWA 2VWYA 3QZIA 1OZ1A 3G0EA 4DITA 3AT3A 4RPVA 3ZXZA 2QKWB 1PHKA 2Z7QA 3JY9A 5AIRA 4ANLA 4DGMA 2OLCA 2VWVA 2E9NA 1WAKA 3L9LA 3QUEA 3TJDA 1ZOHA 5AX3A 4JDIA 3LCKA 3PXKA 5L4QA 2ETKA 3Q9XA 3C4EA 4FKLA 4KIKB 3P7BA 5HCXA 2C6TA 3FPQA 3BWJA 5AP0A 2GNGA 2GDOA 4GU9A 5AJQA 5LQFA 3GC9A 3FXXA 4QT1A 4W9WA 4MNEA 4QMZA 5F20A 4KUJA 4PL4A 4V04A 1UV5A 4MQ1A 3OXZA 2VUWA 4YP8A 5LVOA 4O1OA 5GJFA 1OL7A 2HY0A 4PL3A 1IG1A 3QD3A 5BUJA 3O7LB 4F65A 4O7NA 3PXYA 4RJ3A 5ANKA 4JR7A 3PA4A 3DB6A 2C6DA 4FMQA 4GJ3A 2PMNX 4EH7A 3QGWA 3CGFA 2EWAA 2XNPA 3IPHA 3ZM9A 3M11A 2PVYA 3DDPA 2BAQA 2R2PA 3DK7A 3HL7A 4QP2A 4XRJA 5EYCA 3UG1A 4CKJA 2C0TA 2XK3A 2UW3A 4ZSGA 2WKMA 5GNKA 4EQMA 3A4PA 3BHYA 3P86A 2HIWA 2JDRA 3GQLA 3OHTA 3VJOA 2Q0NA 5CSWA 4DG0E 5B7VA 1JKKA 3U6HA 3O17A 5HZNA 3GT8A 2EB3A 2JLDA 4A06A 2PULA 4BN1A 4DTAA 4HGLA 3A8WA 3P0MA 2G1TA 2J51A 2XKCA 2HXLA 2QOHA 3DAEA 4FV1A 2BR1A 4RJ7A 4XV1A 4BHNA 2CNUA 3PA5A 2ZDTA 4X3JA 3AQVA 4BICA 5KCVA 2YIWA 5HU9A 5EQEA 4CKIA 4MF1A 5C1QB 4C4GA 5IA0A 5LWMA 5HESA 2PE1A 3SW7A 1DS5A 3IW5A 5A4CA 5AP2A 1XWSA 2XEZA 3EOCA 1L3RE 2JDOA 1FVVA 4ACDA 2ITZA 1X8BA 3QBNA 4UN0C 5LWNA 4I6FA 3LHJA 4C4HA 3TXOA 4FSRA 4QPSA 4TWOA 3C4FA 4AOJA 4LGGA 5M55A 4EHVA 3FWQA 3UQCA 4EJ7A 5IQGA 1QPDA 2CGUA 3UVRA 3RPRA 4BYIA 4HCUA 5E8XA 3PJ2A 3QCQA 2FGIA 2DWBA 2O65A 4EK4A 2X2LA 2V7AA 3ORNA 2JBPA 3TUBA 2UZLA 2PHKA 3KXXA 3WZDA 1RJBA 3CC6A 2X7FA 3QTXA 4I6QA 4XJ0A 5LMKC 4ALWA 1E9HA 2PVLA 2RG6A 3GU6A 4GW8A 3DQWA 4WOVA 2ESMA 5CU0A 4CFNA 2YLFA 4A4LA 3MVHA 4M68A 3ZBFA 2HZ4A 3LJ0A 4BCNA 4GU6A 4XP3A 2I0EA 3H9RA 1YWNA 5I9UA 1QPCA 5IQIA 2E9OA 4USDA 2ITVA 3A62A 3CPCA 4FICA 4KNBA 3BE2A 4ITJA 5CTPA 3HMMA 4F7LA 5CU6A 3DKFA 4W8DA 4PDPA 2BTSA 1YQJA 2JAMA 5CNNA 5HE3A 4G34A 4BBEA 2CKPA 2VWWA 4EOLA 4CRSA 3NVKI 5AV0A 5BUEA 2WAJA 3W2RA 2ZM4A 3MPTA 4JBQA 3TKHA 2I6LA 4D55A 4RWJA 4Q5HA 4L42A 3S3IA 3SV0A 2QURA 3S2PA 3UG2A 2ZJWA 3NCGA 5J8IA 4A9SA 2WQOA 2R7IA 2QU5A 3OC1A 2OZAB 3MFSA 3FLNC 5EI2A 2Z8CA 3NUSA 3RKBA 3LFFA 3VBTA 4A9TA 2F9GA 4BCOA 3CY3A 2VZ6A 2IVTA 3E8CA 4MQ2A 3RJCA 3LOKA 4Z7GA 5CEOA 5KX8A 1YHVA 2CKQA 2Y4PA 2QOFA 3LM5A 3CIKA 3F3VA 4C58A 4RT7A 4ZTMA 3PXRA 1OL5A 2G01A 3TTIA 5CSXA 2BDFA 2B1PA 1BUHA 4GSBA 4U41A 4U6RA 4H3BA 4DGNA 4Z7HA 4OTIA 2XKDA 2W1IA 3TDVA 3HP5A 1KSWA 4YTFA 1XO2B 5HOAA 4RVTA 4EYJA 2UVYA 4TPTA 2XEYA 3AT4A 3R7OA 3SRVA 4E4MA 2J6MA 4YMJA 4L9IA 4C4FA 5EOBA 3I5NA 3IOKA 4JQEA 3FC2A 4O7RA 3QZFA 3V5WA 3VUGA 3EQHA 2PY3A 3OXTA 2Z7LA 4FNWA 5J7HA 3QRUA 4C61A 3I60A 4R1VA 2WO6A 4F0FA 3R2BA 3PP1A 4IX6A 4JBOA 3RHKA 3UZPA 4Z16A 1OIYA 5KZIA 4RRVA 5KZ0A 5K9IA 5CS6A 5JEBA 5JGDA 3FI8A 3QXOA 4YJTA 2OWBA 5AEPA 3A4OX 2BIKB 3BYSA 1HOWA 2WB8A 2FSOX 3E88A 3LQ8A 4OTDA 4OT6A 4AE6A 4E6CA 5IH5A 4JAJA 1LEZA 5M44A 2X8IA 1J1BA 3ULIA 1GIJA 4MBLA 3ZYAA 3E87A 3DCVA 4YHTA 4EK8A 4MTAA 3FZ1A 4WO5A 3OFMA 2Z60A 4B4LA 4JIKA 4NKAA 3RI1A 3P23A 2AC3A 1GZOA 3F3UA 2R5TA 1P5EA 4Y5QA 3Q4TA 3E93A 4G2FA 3W8LA 4ARKA 4O0RA 2O63A 2PK9A 2VNWA 4GUEA 4MXZA 4WNOA 5EM8A 2H34A 3GC8A 3EN6A 2I0VA 3R1YA 3NMUF 3ZRKA 4BTMA 2PVRA 3O51A 4O86A 3BLRA 1KE7A 2CKOA 2XK4A 3UIUA 3F5PA 2Y6MA 4IDTA 4KSQA 3BLHA 4WNMA 4EORA 3R9RA 2PVHA 4QTEA 4B6LA 4IAIA 4EONA 5ANDA 3FEGA 2ITOA 2IW8A 5EQYA 4CMTA 4EWHA 3HP2A 3QL8A 3SA0A 4FKOA 3RM7A 3MVJA 2V55A 4PP9A 5HQ0A 2GSFA 3F3ZA 4O1PA 4EH4A 3COKA 1JOWB 4CRLA 4NCTC 2XMYA 3RTPA 1ZY4A 4CXAA 5KHXA 5L8LA 3U6IA 5EYMA 2QO2A 4EBWA 3DOGA 2QR8A 3ITZA 4JQ7A 2RGPA 2WMBA 3K3JA 4IANA 5HLPA 4GFMA 2F7ZE 1ZMUA 5HIBA 2B9HA 4R7IA 4FT3A 4BIEA 1V0BA 4USEA 3ZSHA 4P2KA 4GL9A 4EOIA 5L2WA 4X2JA 4EHGA 3PSDA 3MGYA 2WTJA 5L2IA 3EN9A 4I5MA 5AR2A 2PMOX 2QG7A 2BAJA 4AAAA 5M51A 3D5UA 3NNUA 3D0EA 2QOKA 3W16A 4EQUA 5LMBA 3QD0A 2W0JA 4NM7A 4XHKB 3A60A 5FRIA 5KUPA 3ZFXA 4XV2A 4I5HA 3UNJA 4LMNA 2WTDA 1P4FA 4I3ZA 5DT0A 3WI6A 4C33A 5C4KA 4GVJA 4BDEA 2C68A 2W96B 4ZSJA 4EKKA 4C2WA 5CI6A 4JS8A 3CLYA 3BYOA 2QKRA 3MWUA 4YURA 5CF8A 5C9CA 1NY3A 3BQRA 3PZEA 5JRQA 3DXNA 4V05A 4D1XA 5CSPA 5DR9A 3RGFA 2JKKA 4FKGA 3DBQA 4YLLA 4FF8A 1HCLA 4G1WA 2PUPA 5DRDA 5FWKK 3UO4A 2BKZA 3Q9WA 3UC4A 3KB7A 1QL6A 2YM7A 5EHLA 4O0SA 4AW5A 3ET7A 5LVNA 4IM3A 5FEEA 2OG8A 2YCFA 2X7GA 5AUZA 1CKIA 3MBLA 4XS2A 5KMJA 1YWVA 3QAME 4JR3A 1ERKA 3DKCA 4H3QA 2UZDA 2IVSA 4B8MA 3WF5A 3O8TA 4AFEA 2NO3A 4C57A 3QU0A 3U4WA 2XUUA 2ONLA 1RQQA 3TZ9A 4HNIA 2ONLC 3G6GA 4TYJA 4UMUA 4IX4A 2Y9QA 3VQUA 2C69A 2YFXA 3QQFA 5L2TA 5J95A 4LRJA 3HNGA 4FVQA 1M17A 2B7AA 5BVOA 2OICA 2Y7JA 4L01A 5KMIA 3QTUA 2LAVA 4AZTA 4O7VA 3TNPC 2DS1A 1SMHA 2OJ9A 4J99A 4IWPA 3GUBA 4TT7A 5DVRA 4AUAA 3AMAA 5LXMA 4O0YA 4RVMA 4ANQA 4EH8A 5AUVA 2C5NA 4O0VA 4S31A 4QMUA 4O38A 3ORMA 4EOSA 4EH5A 4O2ZA 2ERKA 4XG3A 1L8TA 4H58A 2C47A 5B2KA 2UUEA 4O81A 1ZYDA 3OWPA 4UX9A 3ORKA 5E7RA 5IQCA 4FT5A 5EW8A 5D7AA 4I5CA 4E4XA 4RLKA 2GHLA 3POZA 3ZUVA 5JFVA 3PG3A 3MH3A 5HX8A 3VBYA 2XJ2A 2UW6A 4P5QA 4BGHA 5DEWA 3LCDA 3UJGA 1IA9A 3QX4A 1FVTA 5AP7A 3D83A 2Q83A 4NFNA 4FEXA 1GY3A 3O71A 4ZOGA 2X8EA 1XR1A 3GENA 2B52A 2RFDA 4WUAA 1KV1A 4YPSA 1E1VA 1XH9A 4U44A 3KGAA 4EBVA 3ZCLA 2JITA 3Q4CA 4ZZMA 3QTWA 3WF6A 4EOQA 5IF1A 3LJ1A 4QMYA 3F9NA 3MY1A 4HYUA 4IB5A 2VNYA 1E1XA 3R8LA 5L8JA 3WE4A 5CNOA 3QTIA 3UTOA 4TYHB 4YC6A 3WOWA 4QQTA 4ASDA 2YEXA 3OVVA 4PQNA 5AV2A 4A4OA 2FYSA 4F9AA 3ZZWA 1BL6A 3VWAA 4H1JA 1V0OA 4YO6A 4N0SA 3WYYA 3BGQA 3RCJA 3AC1A 5HE0A 4BFMA 5TKDA 2VTAA 3TM0A 3PJ1A 1VZOA 5ETAA 4WKQA 4ZLYA 5M08A 3T9TA 1YOMA 2O5KA 4J53A 4X3FB 4BCPA 3R1QA 4G9RA 4XV9A 3EFLA 1H00A 4CV8A 2NRYA 4FV7A 2WU7A 3I5ZA 5HG9A 1ZLTA 4GK4A 4ZSAA 3VC4A 1PXJA 2W1CA 3FZOA 3QCSA 3GGFA 3PY1A 2O0UA 3EZRA 4G3EA 3UIMA 2C0OA 2W1FA 2ZV8A 3NIEA 2JBOA 2XBJA 3KEXA 2QOIA 4U80A 2XIYA 4C4EA 3UOKA 2R3RA 1YXTA 3QFVA 3RK5A 1UNLA 4BIBA 2ZMCA 3VS4A 3MV5A 2JIVA 4GIHA 4TYEA 4AT4A 3K54A 2O8YA 3OY1A 2W1ZA 4RWIA 4L3PA 3SDJA 5E9EA 1OGUA 2OSCA 2KULA 2B4SB 4BR3A 4CG9A 5C8KA 4DEDA 4D2VA 5FDPA 5DT3A 4OTFA 4ZTLA 3BYMA 3RWQA 3D2KA 3E3BX 2XA4A 3TL8A 5JZJA 4DFUA 3G0FA 3GC0A 2QODA 4YC3A 2BPMA 2FO0A 4O27B 4M69A 5AM7A 4EQCA 3JVSA 1B6CB 3PY3A 2YM3A 4BWKA 5DGZA 2WTWA 1SVHA 3V5LA 1J7LA 5EQPA 5HNIX 5FP6A 2B9IA 4D0XA 4DFYA 4GCJA 4I1ZA 4MK0A 3QALE 4K1BA 4QPAA 5FG8A 2HCKA 5I9YA 4XNEA 3GXLA 4DEHA 2PWLA 4IFCA 1PXLA 3FI3A 1OKWA 4GYGA 3ZTXA 3C4ZA 4JRNA 1YI6A 4CTCA 3E8EA 3ZLWA 4G3CA 4IB1A 4NEUA 2XNNA 2XRUA 4OT5A 4DCEA 2BDJA 2YABA 3MA6A 3PUPA 3RINA 4UV0A 5FUTA 3KQ7A 3TNQB 1OITA 5CU3A 5TE0A 2VGOA 3W2QA 1OECA 3QCYA 3D14A 4IM2A 4QQCA 4PMPA 4E4LA 3PJ8A 3SVVA 3R30A 2I1MA 3D9VA 3MB6A 3UOLA 4UWCA 1W0XC 3CCNA 3DTCA 4XG7A 3VW6A 1URWA 4E5AX 3NDMA 2JC6A 4DGGA 5I0BA 2OF2A 2W5AA 3UP2A 4RVLA 2WIPA 1G8SA 5HCZA 3W2PA 4GVAA 4RIXB 5FTQA 3NWWA 2A1AB 3RK7A 3CTJA 5HU3A 3MIYA 4PDSA 3OWJA 5IQEA 3PSBA 5CAOA 4OAUC 4O7WA 3D2IA 1XJDA 3ZLXA 4WD5A 4CMUA 3LKMA 2C1AA 4FTIA 4FKSA 3C0GA 4RSSA 4E4NA 4EEVA 2CNQA 1W98A 4X2FA 4NYEA 5ANJA 4DF3A 5CT7A 4ERKA 1SVEA 1GZNA 4G6OA 5C27A 1G3NA 4RVKA 4YLKA 1YI4A 4AS0A 1XH6A 1H26A 4A9UA 3LFNA 3FZSA 5ACKA 2RL5A 4L3JA 3FZTA 3R22A 4GV1A 4CYJA 2YACA 4MD9E 4DCAA 3IW4A 4UBAA 4W4WA 5L6PA 3V8TA 1WZYA 2XK8A 2CGWA 4DTKA 4IAKA 4Y83A 2XK6A 3ZOSA 1PMVA 4FKPA 5EM5A 3VHEA 4AN3A 4M13A 2X4ZA 1HCKA 4WG4A 4EK6A 3AXWA 4IZ5A 1R1WA 1EH4A 4YHJA 4IC8A 1ZWSA 5KKRC 2R3QA 4FV2A 5EW3A 4N4SA 3LXLA 4KKHA 4J98A 3EQPA 3GOKA 3IONA 5JZNA 2HAKA 3P08A 4U8ZA 3TUDA 2O3PA 3KXNA 3ZC5A 4BCKA 2WEVA 2GQGA 4GKHA 5BYYA 3BPRA 2IW6A 2B54A 5EI8A 5JK3A 3KN5A 4I0RA 4RQKA 4XLIA 3RAHA 3QQKA 4R1YA 2CHLA 3GB2A 1RE8A 4AW2A 5ANOA 4NJDA 3O8PA 4BI2A 3GOPA 1Y57A 4FV5A 1AQ1A 3GU5A 1WBPA 4GJ2A 3FQSA 3RPOA 2ACXA 2WTKC 4MVFA 2G2HA 2GFSA 5A4LA 2OK1A 3R6XA 3KFAA 5KO1A 5J9LA 2GNHA 4OTHA 3CTQA 4X7QA 1PXKA 3MTFA 5F9EA 2OIBA 2WMTA 4EUUA 2W9FB 4ANOA 3R9HA 5D41A 2B53A 2F57A 4KA3A 3F6XA 5EDRA 5EKNA 3JYAA 3SKCA 3V6SA 2BUJA 5J5SA 1Q8TA 3SLSA 4FKRA 4F6SA 3E7OA 2PYWA 5LCJA 4LUEA 5DA3A 5IEYA 4ZS4A 2F7XE 3Q53A 1PXMA 3ODZX 3BU3A 5A9UA 3ZO2A 4L43A 4BGQA 4E6QA 4R3CA 4D5HA 5M53A 2XK9A 2GS6A 4K11A 4QMWA 3KRWA 4TYHA 2P0CA 3NNVA 4PPAA 3V5TA 2GNFA 1AGWA 2R0UA 3PWYA 1WCCA 1UNHA 3EYGA 3QHRA 2VTHA 4ZMFA 2CJMA 3TCPA 4FR4A 4ZLZA 5CY3A 1PF8A 4O7LA 4CYIA 4KSPA 5GIPE 2R3JA 1W84A 4KIOA 5AUWA 3U87A 4IWDA 2E9VA 4PMMA 5FBNC 2JIUA 4FSTA 3ZH8A 1OL6A 3ZHPC 4C34A 3D5WA 4KBCA 1VEBA 3FHIA 4GYIA 2B55A 3PIXA 3LXNA 4UWYA 3DGKA 5EM7A 5GJGA 2YJRA 1M7QA 2IO6A 3EWHA 3MFRA 3V51A 2J9MA 3FKLA 4CFFA 1R3CA 3QGYA 4QP4A 3FL5A 2AYPA 4FIFA 4FTUA 4HYIA 1U59A 5EDQA 3LMIA 5KMMA 5J7BA 3LFCA 4J8MA 4TYGA 3WE8A 1GJOA 4FIHA 1RW8A 3NEWA 4AWIA 4EOJA 3KVXA 2YCQA 3MTLA 3Q6WA 4FV3A 2C0IA 3EN4A 4FEVA 4CKRA 2X7OA 4HVDA 3P9JA 3NUXA 4HCVA 3F5UA 2Z2WA 4FNXA 4ZTRA 3IQ7A 1H25A 4FA2A 4RLLA 1OI9A 5K3YA 3S4QA 4WG3A 2C6LA 4IQ6A 3UZTA 3FAAA 1FMOE 4G6LA 3W32A 3IK3A 4DN5A 4MXOA 4UY9A 3V8WA 4CLIA 5K4JA 1FVRA 5DWRA 5HLNA 4IVAA 3HMIA 3IGOA 4TRLA 4FSWA 3LMGA 3DLZA 2GQSA 2BRGA 4MWIA 4NU1A 2GS7A 3OUNB 5CZHA 4ERWA 4N6ZA 3MESA 4QO9A 1V0PA 2RFSA 2VWIA 4FNYA 4NWMA 4IBMA 3UVQA 1JKSA 3OBJA 4TWNA 3LFQA 4FZDB 4OTQA 2W17A 3EYHA 1WMKA 4ZTSA 2VWZA 1W83A 3F2AA 2J0KA 3HV4A 3ENHA 3Q04A 4A4XA 4NM0A 3AGLA 1OKVA 1P14A 2QOCA 3FE3A 4MAOA 3LZBA 5JFWA 1J7UA 4RX9A 4ZAUA 4FV8A 1A9UA 1OPKA 5DBXA 4FGRA 4AOIA 1ZYLA 4YJOA 1OIRA 5LVPA 3UIBA 3SX9A 3DZQA 2J5EA 3GEQA 5F4NA 4DINA 5L8KA 3TWJA 2C30A 4S30A 2UZOA 4JG7A 4H05A 4QP9A 4EZ7A 4DYMA 3FPMA 3WF8A 5AWMA 4FYOA 3L9NA 4RIXA 1PXPA 4NJ3A 4ZSEA 3W2SA 5JGAA 4IZ7A 3OWLA 3U9NA 4WT6A 5HIEA 5FBOA 2GNIA 3TDWA 2PL0A 4H39A 4JAIA 3QUPA 3NUPA 4J52A 1Q62A 4QTBA 4YJRA 1LUFA 2C6IA 3SHEA 3G2FA 1NW1A 5M4IA 2A2AA 2C3KA 4UMTA 4FUXA 4OR5A 2WQNA 2PTKA 4NUSA 5IKWA 2VTNA 2J2IB 2HZNA 3VUDA 2J5FA 4F6WA 2YHVA 5A6OA 3TIZA 4C8BA 5BVNA 4I5PA 4I94A 3ORPA 1SNXA 1Q97A 2CGXA 3A7IA 3VS2A 4BDAA 2X8DA 3O2MA 4FOBA 5AADA 3W2OA 2ZDUA 4DEGA 3KY2A 4M3QA 1TQIA 4D9TA 3Q2JA 4JIAA 2UVXA 4K0YA 3V01A 2WOUA 3GFWA 4O7YA 4YJVA 4ZZNA 4G5JA 4APPA 3OROA 3Q5ZA 4YTHA 3A61A 3I79A 3UP7A 4CV9A 3VS5A 5BVDA 4O96A 4WRSA 2QQ7A 2VWUA 4CQEA 2OJGA 2XRWA 2XNGA 5IA5A 5EYDA 4NH1A 3UPXA 5LMKA 4BI1A 2W1EA 1ZARA 2W4OA 3OZ6A 5DE2A 3EMGA 1JWHA 4FZ7A 1ZOGA 2OFVA 4CCUA 2ITNA 3BX5A 1Q8YA 3V04A 3AC2A 1R0EA 2V7OA 4UXQA 4UZDA 1K3AA 3RZFA 3A99A 2BTRA 4BDBA 4BKJA 5CF5A 3TZ8A 2PUIA 4EI4A 2Z02A 3EQGA 2J7TA 5A6NA 1I09A 5BPYA 4PDOA 3OP5A 4PWNA 5KBQA 4G5PA 1MRYA 2KTYA 2PVJA 4BTFA 3CEKA 5CF4A 5AFVA 4G31A 2XNOA 1BI8A 2J0IA 4ACCA 3UZRA 5D1JA 3WBLA 3BBTB 4ASZA 4D4SA 5K0XA 5ITAA 4TWPA 4I4EA 3VRYA 4JT3A 4CZTA 3BCEA 4QMPA 3UOJA 4MX9A 2UW0A 4KKGA 2J0LA 4DT9A 3D5VA 4LOOA 4YUQA 3LXPA 4FG9A 2VX0A 3QLFA 2C6KA 3VBVA 2OJFE 3M2WA 3L8VA 3NUAA 2QCSA 1ATPE 4M66A 1Q99A 3FQEA 3BEGA 2WTIA 4GT4A 4HJOA 3CQEA 4QYYA 3BGPA 3SXSA 3UYSA 3QQJA 3FLZA 4G3GA 4ITIA 2QOBA 3RAIA 4L7FA 3COHA 1PMUA 3AC5A 2WMXA 5EM6A 3IDBA 4JG8A 2XS0A 2W1DA 4M0YA 3W10A 4IJ9A 5HTCA 4PNIA 5AIKA 4GKIA 3R1SA 3IO7A 3RWPA 2H96A 2BFXA 3FY2A 2VTPA 2YERA 5I3OA 4AE9A 1PKDA 2VV9A 2OIQA 3BWFA 4MEDA 3R21A 2R3NA 3FZPA 1Q24A 4FC0A 4XBRA 4BDKA 4FEUA 3SW4A 5I5ZA 1DI9A 3NAXA 1QCFA 2VTSA 2YISA 5E8ZA 3O50A 4YZ9A 3JR1A 1QPEA 3NPCA 3WZJA 2PE0A 2QR7A 2GHMA 4NT4A 5AMNA 4EH9A 4LV5A 3QA0A 1W8CA 4YSJA 4EKLA 3VUHA 4F1MA 4O84A 3NAYA 4L7SA 2BMCA 5K0KA 5E4HA 4UYAA 5M07A 3ATSA 1VYZA 4WNPA 2ZYBA 2W4JA 3MIAA 4NW6A 3KA0A 4EK5A 5IA2A 5E8VA 4ZP5A 5AP5A 3OBGA 2GCDA 2GPHA 3WIGA 1P4OA 2UZEA 3VAPA 4AOTA 3RPYA 3E64A 3G5DA 4JDJA 1T45A 3PXZA 3MH0A 4LYNA 3DPKA 4DC2A 4ENXA 2OJIA 4QMLA 3CBLA 4RJ8A 5B0XA 4YZBA 5FGKA 4Q9SA 4ACMA 5DR2A 3THBA 4FV9A 5HCYA 2FUMA 4CMOA 2PZRA 5K5XA 4K2RA 3C5IA 3FZRA 3DXQA 3T3UA 4NL0A 1Y6BA 4WIHA 4UMRA 3E5AA 2WFYA 1Q4LA 2GNLA 4FTOA 3OEZA 1UKHA 2CMWA 2V22A 5HTBA 3MH1A 4QMVA 2DYLA 4BIDA 4D2TA 4TTHB 3T8OA 5G1XA 5BQ0A 5H8GA 3N51A 4ZJJA 4IVDA 3RM6A 2XYNA 5AV1A 1MUOA 2HY81 3DK6A 3KVWA 4QMSA 1O6YA 3OG7A 3KXHA 2R64A 3ZXTA 1SZMA 3KK8A 5CEKA 2QONA 5IUGA 1YW2A 3GP0A 4U97A 4RFMA 5H2UA 4FSMA 4G16A 4F0GA 4M69B 1DM2A 3HRFA 5TT7A 4NCTA 3LQ3A 3P79A 4RC3A 3SD0A 2YIQA 2XP2A 2CNVA 3H3CA 1KOBA 4FE2A 5IQAA 2EU9A 4F70A 4BCQA 4AZEA 4J95A 1H0VA 4TYIA 2PVFA 4S33A 4W9XA 1IAHA 1R39A 4QP3A 4RMZA 1PMNA 2W06A 3HX4A 1YHSA 3ROCA 3E8DA 2J0JA 3Q3BA 4ZZOA 4RX5A 2YM4A 4XOYA 4FTCA 4H36A 2BFYA 5CQWA 5D10A 4KIPA 4ZJVA 3DKOA 4HOKA 4IXPA 3EQCA 5LCKA 3R8PA 2X2MA 3NUYA 2YZLA 1KE9A 3ORXA 4RFZA 3TKIA 4MXYA 5BUIA 3MB7A 4ZK5A 4O22A 1M2QA 4QNYA 3T3VA 3R7VA 2IZUA 1SNUA 4QRCA 2ZV9A 2UZNA 2HW7A 4FG8A 4AQCA 1Q5KA 4IACA 4FVPA 1PYEA 4U9AA 3P5KA 4BVUA 4HZRA 2R3HA 3R8ZA 4AT3A 4HGSA 3EQDA 4Y46A 3FXWA 4O7TA 4YLJA 4AXAA 2ZV2A 4IADA 1CKJA 1YOLA 3BRBA 1SVGA 4PMTA 4PP7A 2BRNA 1PW2A 2HXQA 2XJ0A 1S9IA 4QTDA 3WZKA 3LMHA 2F7EE 4GG7A 5I4NA 1MRUA 3NSZA 3DB8A 3DT1A 5GZ9A 2XJ1A 4DGLC 3BZ3A 2VN9A 5AV4A 4XX9A 2WQMA 4CD0A 2BRBA 2BAKA 3NGAA 4RC2A 1PKGA 4M12A 5D9HA 5HICA 3AC8A 3MFUA 5G6VA 3G9LX 4H1MA 3FI4A 3TT0A 3EJ1A 4X2GA 4DLIA 3UVPA 3ZUUA 1KOAA 4TWCA 4QYHA 3BI6A 4BDJA 4YU2A 3IECA 1RDQE 1W7HA 5A4TA 3QRIA 4C4IA 3I6UA 3ZONA 3DBFA 3FMNA 3QTSA 4QYEA 2XZSA 2R3PA 4UZHA 4JX7A 5DEYA 3HKOA 3PLSA 3SG9A 2WMQA 2ZB0A 2GTNA 4APCA 3LQ5A 2XCKA 4QYFA 4D4YA 5AAEA 5HO7A 1A06A 4F9YA 3IW8A 1QMZA 3S1HA 4FI1A 4EC8A 3AMYA 2Z7RA 3BKBA 2EVAA 1R78A 1UKIA 5AP3A 4FK6A 2YIYA 4GRBA 5FTOA 1UWJA 3NUUA 4F7JA 3ORIA 3DXPA 4FKWA 5JRSA 5DYJA 5IZFA 3ID6C 5CAVA 5DH3A 5CU2A 5GIOE 3C50A 5DI1A 1BI7A 3MDYA 3MJ1A 3LVPA 5BYZA 2QC6A 3C7QA 4WNKA 4LI5A 3B2WA 2E2BA 2UW5A 4IAAA 4NIFA 1V1KA 3F3TA 3MY0A 3F2NA 5HG5A 4FSNA 1UNGA 2HELA 3F61A 3MN3A 4B8LA 5BMMA 3NYOA 2W9ZB 3G15A 4LL5A 4E1ZA 2JDTA 3QQHA 4F6UA 2WTKB 2BALA 5E8UA 3M42A 4R5YA 5BMSA 3NX8A 5ANEA 3R9OA 3GBZA 5IG1A 5BVKA 4Y5HA 4CFMA 3ATTA 2W1GA 1H1PA 1OL1A 2JAVA 3TZMA 2VTRA 5JH6A 3U55A 4AA0A 3CD8A 1NVRA 1ZOEA 3JVRA 3Q60A 2W99B 4FSUA 5L6WL 4E7WA 4BKYA 1BKXA 4I93A 4CLJA 1DAWA 3NNWA 4E5WA 2I40A 3GQIA 3QXPA 5EHYA 4GFOA 3W8QA 4GMYA 4N6YA 4IB3A 5AR3A 4OBPA 4IC7A 4OTPA 2UZUE 3QYWA 1WVYA 2OZOA 2IZRA 4M97A 4D5KA 3BHVA 5GHVA 4NTTA 1F0QA 4R3PA 5EW9A 2PZPA 3C13A 2W4KA 3MY5A 4IWOA 3QKMA 4A9RA 4BC6A 3AC4A 4RC4A 4CTBA 4DLJA 3H0ZA 4UMPA 5K4IA 3S00A 4KKEA 5L2SA 2ITPA 4CNHA 5JSMA 1URCA 1OIUA 2WMUA 5DOSA 4P90A 2VRXA 3FSFA 4MHAA 5EYKA 1FINA 2WTCA 3LFDA 2REIA 3KMMA 2YAAA 3VUIA 3QHWA 4OGRA 2ITQA 3TNHA 3EHAA 3N4TA 2H8HA 4FTRA 4ZIMA 3EQBA 1M7NA 2PMIA 4BTKA 3TUCA 3BBWA 4PPCA 4YBJA 2VO7A 2NNWB 1H1WA 3HAMA 3LLTA 5ETCA 4AX8A 4IWQA 4XP2A 3R2YA 2XIZA 3FLYA 3I6WA 4RA4A 4E73A 2C6OA 3LJ2A 4DGOA 4IVBA 3SGCA 4RG0A 4HVGA 3OOGA 3ORLA 3OWKA 4QMQA 4WHZA 4RWKA 1NVSA 4HVIA 2A0CX 4O7ZA 4FV4A 4HW7A 2FSLX 2JFLA 3ANRA 3QZHA 5T3QA 4LL0A 5CVGA 3FMEA 2W7XA 3NR9A 5JN2A 4F1TA 5CYIA 3H9FA 1U5RA 3FMJA 1YRPA 4M0ZA 2WD1A 5CI7A 2JKQA 3IDCA 3OS3A 4JL9A 2PVMA 3JXWA 3MVMA 4ZS0A 3VS6A 4WSQA 1Y91A 4DFBA 4RFYA 1JVPP 3EKNA 2YITA 3F3WA 5IDNA 1YDTE 2J0MB 3PTGA 4XBUA 4UEUA 2RFNA 1Z9XA 3AGMA 3OD6X 1SM2A 5J87A 5EHOA 4D4RA 2X9EA 1UVRA 5CEQA 2PE2A 3CSVA 4R77A 1OUKA 1XQZA 5AUXA 3UC3A 4C2VA 4WG5A 3WARA 3K5VA 1BMKA 4L52A 3QRJA 2JKOA 3R7IA 4L44A 3O96A 2WU6A 5FEQA 5HNBA 2OH4A 5CANA 3WILA 3OY3A 4BZNA 1PXNA 2BHEA 3REPA 4DA5A 1H28A 1TQPA 5AP1A 5HO8A 4AZVA 3TEIA 5M57A 4CZUA 5J9YA 4QTAA 4JOAA 3CKXA 2CCIA 1DI8A 1CDKA 3FHRA 2BHHA 3EN5A 4Q5EA 3FY0A 4WUNA 4IHPA 3UGCA 4PX6A 1ZYSA 4BWPA 4C38A 4C3FA 4IX3A 1CM8A 4XG9A 4EOOA 4K8AA 4USFA 3QC4A 4KAOA 3PY0A 5FM2A 4J71A 3VW8A 3ZDUA 4O7SA 3GCUA 3CXWA 3L9MA 4D58A 5HGIA 3DY7A 5AR7A 3I4BA 1F3MC 3FMHA 4Y95A 4F4PA 4DFXE 1YKRA 2CLQA 3GCQA 3JPVA 3LCTA 3RPVA 4DE4A 1KV2A 4DH7A 2QU6A 2QOLA 2WMAA 3S0OA 3PIZA 5FDXA 1Q3WA 4O0TA 1FMKA 2R0IA 4HPUE 3DTWA 1JNKA 3TG1A 4AA4A 2WPAA 3COIA 4CQGA 4QP8A 2VTQA 4MF0A 2C5VA 2P3GX 4U7ZA 3UMXA 4CFUA 1O9UA 2WQBA 3QZGA 4E6DA 2C3LA 4IB0A 3CR0A 4DEIA 4ASXA 2JFMA 1IAJA 1U5QA 3PJ3A 4F09A 3CE3A 4PL5A 3NYNA 4DFLA 3KRJA 4CEGA 3P1AA 3SXRA 2EB2A 4CG8A 2ZB1A 4LGDA 5CSVA 4QMNA 3HUCA 5KNJA 5HHWA 1VR2A 3FLWA 3I0QA 3ZRLA 4WBOA 4EZ5A 4F99A 2GQRA 3Q2MA 4P5ZA 5JGBA 2VWXA 2JEDA 5C8NA 5F95A 3DJ7A 3RVGA 3OW4A 4NZWB 3C0HA 3DNEA 4PV0A 3TACA 2AC5A 4XG8A 2XBAA 3EZVA 3QTRA 4FYNA 5AAGA 4YZDA 4I23A 2C4GA 3R8VA 2IZTA 3SXFA 2R3KA 3ORTA 2F4JA 1OB3A 4V0GB 4BCMA 5FEDA 5ETFA 3G9NA 5CEPA 4FBXA 3QQUA 2YAKA 5E92A 1T46A 4QQJA 4M8TA 1IA8A 4NM5A 5B2LA 4ZSLA 5JQ5A 2VTLA 5T6KA 3L8XA 2VGPA 3PIYA 1MQ4A 5BVEA 5AA9A 5IH6A 4LRKA 3LPBA 5ICPA 4O0UA 5E8YA 3OCGA 3II5A 4CT2A 5A14A 2Q0BA 3LLAA 2R3IA 4FKUA 3UMWA 5IA3A 3WF9A 3TV4A 5C03A 4J96A 4ITHA 3TTJA 3VQHA 3GC7A 4K6ZA 3GU4A 3QF9A 3R7GA 4L00A 2XCHA 4HPTE 3VF8A 1XBAA 5IMEA 5EG3A 3L1SA 3PFQA 2XB7A 3HMOA 2UV2A 4PTEA 4XUFA 5AM6A 1BYGA 1AD5A 2UW4A 2CKEA 4L67A 4XG6A 4E3CA 3BIZA 3CGOA 5F1ZA 2IN6A 5DIAA 5E90A 2CLXA 3GCSA 4G3FA 4NFMA 2OU7A 3R63A 4IAYA 3TN8A 3PPZA 3FXZA 4PMSA 2VO0A 3HEGA 3KCFA 4FSYA 3HV7A 5CEMA 4I22A 2XIRA 1H1QA 3ANQA 4IAFA 4XOZA 3B8QA 1G8AA 3MA3A 4R78A 2VU3A 3NYVA 2RKUA 5IQHA 3QRTA 3CS9A 2C6EA 4FEQA 4C59A 1R0PA 1PRYA 5GJDA 3HMNA 4L45A 3PVGA 2FB8A 3C4CA 4FTAA 3UQFA 2YDKA 3ZM4A 3EFJA 5DRBA 2CGVA 3BELA 3HYHA 3KXZA 1XH8A 1OPLA 4IE9A 5AP4A 3IW6A 3KF7A 3W2CA 5LVMA 3KREA 4FX3A 1OMWA 1B38A 1Z57A 3MJ2A 1B39A 4P4CA 2YCSA 3A7JA 1Q3DA 3PVBA 4R8QA 3GCVA 5CZIA 1LP4A 4I0SA 2UW9A 3F82A 3OW3A 5M4UA 2VTMA 4YJNA 4FV6A 4OW8A 5GZAA 5DFPA 3R7YA 4K77A 4TNDA 3PXFA 3FSKA 5EKOA 4C3RA 5HLWA 4DFZE 3TNIA 2ETRA 4RIOA 2VTOA 4JRVA 4EHZA 3VS3A 3KF4A 4BWXA 4U3YA 4DHFA 2W5BA 4KABA 4X3FC 1FQ1B 3Q52A 4FIGA 1IEPA 3VBWA 1PXOA 2BRMA 3N9XA 4K9YA 2XVDA 5A46A 4R7BA 3O7LD 3BEAA 4IM0A 2JDVA 4JXFA 5C8MA 3ORZA 3R28A 2XM9A 4R3RA 4BCIA 5IQBA 4S34A 3WF7A 1YWRA 2RFEA 2QHMA 2OXYA 3TI1A 5DG5A 3QTQA 4PPBA 3RPSA 4D9UA 5C4LA 5AUYA 3VUKA 4FZFB 2OFUA 1YDSE 4FT7A 3S95A 3TV7A 4IH8A 4UALA 3C1XA 4FKTA 2QO7A 4Y8DA 4Y85A 4EL9A 4O21A 3D94A 3U4UA 3HMPA 4UXLA 5HKMA 3QWKA 4GT3A 1JSTA 4X2NA 2PUNA 1WBOA 4F9BA 3SOCA 5M06A 3NS9A 4PY1A 3COMA 5E8SA 3UPZA 3GVUA 1ZYCA 4EC9A 2WMSA 4OAVB 2FH9A 2FVDA 4FTTA 3R7EA 5DR6A 3K3IA 5IU2A 2PZYA 4E8AA 5FXQA 2YA9A 2LGCA 3IOPA 5CX9A 4O0WA 1MRVA 1FBNA 4AGUA 3PPKA 4BZDA 2W5HA 1OIQA 1REJA 2QI8A 4MNFA 4U43A 3ZO3A 5J5TA 1ND4A 3AC3A 1SYKA 5J79A 3ZFYA 1KE5A 3BHUA 3PJCA 3SAYA 2WHBA 2PPQA 1DAYA 3QC9A 2ZAZA 3Q6UA 4Z3VA 2CDZA 5E8WA 5H8EA 4YJSA 1Y8YA 4LOPA 4LM5A 5EK7A 3R71A 3VBQA 3EKKA 4EZ3A 3D15A 3DS6A 3PPJA 3ZSIA 3I1AA 5I3RA 4ZTHA 2JGZA 1ZXEA 3I7CA 4TN6A 1ZZ2A 4AGDA 3BLQA 4FUYA 2WXVA 2QOQA 4RQVA 4BBFA 4JBPA 5HBJA 5IH4A 2UVZA 3HAVA 4CT1A 4ID7A 2C5YA 2QHNA 1WVXA 2XF0A 3F7ZA 3IDPA 2Y4IC 2XIKA 2IW9A 2HZ0A 5D12A 4DEEA 4E20A 4EHEA 3LFBA 1WBTA 3A7FA 3AOXA 2GHGA 3NW6A 3POOA 4KS8A 5CLPA 4YGAA 3HV3A 3VJNA 2ITYA 2PUUA 3F5GA 3FMKA 4FT9A 2R3MA 4HZSA 4OTWA 2UZBA 3ZZEA 2A19B 4I20A 1BLXA 4FK3A 5CXHA 4DH1A 5CF6A 4TW9A 2CPKE 1YXXA 3OCSA 3R8MA 4AN2A 4Y73A 3V5PA 2YIRA 4ZY4A 3HDMA 1YDRE 4YJUA 3MVLA 2VO6A 5HIDA 4BCJA 4M67A 4QMMA 2ZVAA 3ZUTA 1TQMA 3LCSA 3BGZA 1JKLA 4GG5A 4TXCA 4XEYA 4B0GA 4M14A 3QCXA 3QUDA 3PE2A 4D28A 1QPJA 3IKAA 4FZAB 2P4IA 3H0YA 3QKKA 1H1RA 3HUBA 4BDCA 4X6QC 4FSZA 4V0GA 3LM0A 5EDPA 3UIXA 3SOAA 1IR3A 5AA8A 5IISA 3GU7A 1WBWA 5DLSA 1W82A 5M4FA 4FZ6A 3ZS5A 2QG5A 4KD1A 4UB7A 4EYMA 2OF4A 3A7GA 1M14A 4O6EA 1ZMVA 3DZOA 3HECA 4LUDA 4MH7A 1YI3A 3GFEA 5CQUA 4ZEGA 4QP7A 4E6AA 4OTGA 5CALA 3KC3A 4XRLA 3VIDA 5J9ZA 2QLUA 4TY1A 2ITTA 4RIWB 5GZ8A 3VS7A 4R5SA 4O6LA 2DQ7X 5M4CA 1U46A 1TKIA 3D5XA 3DV3A 3ENMA 4AGWA 4FVRA 2CN5A 3BYUA 2ZOQA 1YXUA 4FKJA 5LJJA 3Q9ZA 5JT2A 5JMSA 4YZNA 3BV3A 4F9WA 4MBJA 4ASEA 1OPJA 4YTCA 2PVNA 3V3VA 4C3PA 4CSVA 2P2IA 4IFGA 2VTJA 2YLEA 2XKEA 3LAUA 3WIKA 4QYGA 1UWHA 5IUHA 1ZRZA 5KMKA 4RJ6A 2BVAA 4YR8A 3LW0A 5C26A 3QQLA 4EUTA 2ZM3A 4ZMEA 4ANMA 3F66A 4FKQA 4AFJA 4KB8A 4C7TA 4I41A 4ZTQA 4PF4A 1XBCA 4AZFA 3FKNA 2IVUA 4NIFB 4N57A 2FSMX 4JLCA 2EXCX 4WSYA 3BU5A 4NK9A 2RG5A 3UO5A 4A07A 5EH0A 3CP9A 2B0QA 1JAMA 5J1WA 1CKPA 5HORA 2X39A 2Y0AA 2OXDA 2X9FA 2VX1A 1JLUE 4FG7A 4FGBA 4MBIA 4MYGA 4NM3A 2NP8A 4G9CA 5HVJA 2G2FA 4AA5A 2JKMA 5LARA 3SQQA 3EB0A 4EH3A 2X2KA 5CENA 2J90A 3MYGA 3Q32A 3EQIA 3PRFA 4ONAA 4RGJA 4O91A 4KRDA 1OM1A 3ETAA 3LE6A 2YZAA 4BYJA 2G9XA 1U4DA 4X6RA 3Q4UA 2Y6OA 3OT8A 5ANGA 3O0GA 2RF9A 2A4LA 3N4VA 4L68A 2YWPA 3VF9A 2IPXA 3H4JA 5TF9A 3VO3A 4JNWA 1MQBA 1PXIA 3G51A 4JJRA 5KBRA 5C01A 5FM3A 3G90X 2CN8A 3OOMA 4QTCA 1IASA 3P78A 5BNJA 4QQ5A 4NTSA 2OJJA 5FQDC 5JFSA 3VBXA 1A48A 3SG8A 4YJQA 1WBSA 4C35A 1K2PA 2RIOA 5K5NA 3QWJA 3W1FA 5IA1A 4KBAA 3F5XA 3VULA 5E91A 3U6JA 3D7ZA 3KULB 3E3PA 4GS6A 3F2RA 4TZRA 4BCGA 3RMFA 4FTNA 4IX5A 3MFTA 3CPBA 4U40A 5CU4A 1J3HA 4ACGA 4BKZA 1NT2A 2G15A 1Q61A 2E9PA 3U8WA 3UQGA 5IEXA 3DJ6A 5EI6A 1FPUA 4XH6A 4D2RA 2IJMA 4NSTA 2P2HA 4ZLOA 5I9WA 3G33A 3A8XA 2WELA 2R3GA 5AUUA 5TO8A 3GNIB 3IW7A 4YSMA 4QOXA 5IDPA 3CKWA 2V0DA 3QD2B 3HV5A 4C4JA 3H10A 2X6DA 3CQWA 3HRCA 3PG1A 2EXMA 2QVSE 4LOQA 5M56A 2YDIA 3ACKA 2WMWA 4EOKA 4I24A 3PP0A 3ZO1A 3UDBA 1JBPE 4IVCA 3FJQE 4LFIA 2WTVA 4B9DA 2X0GA 1H01A 5HVKA 4C62A 5HE1A 4O82A 1H8FA 3V6RA 3ZC6A 3R8UA 3WZUA 4KIQA 4AG8A 3QQGA 2BZIB 3EH9A 4MXAA 4AP7A 4I92A 2YJSA 2HWPA 3R9NA 2JIIA 3KRRA 4YTIA 4EH2A 3CJFA 2OGVA 5H9BA 2OIDA 4LGHA 5CAPA 2BDWA 5HD7A 3Q4ZA 3Q5IA 5HX6A 1WBNA 4NW5A 2VAGA 5IMXA 4MXXA 3QRKA 2RSVA 3RZBA 4RIYB 4IZYA 4C0TA 3UNKA 2YIXA 5HTIA 4WA9A 4KIKA 1G5SA 3ZRMA 1OUYA 4XP0A 3NVMB 4HGTA 4X2KA 3IG7A 2IWIA 4XG2A 3QTZA 4RJ5A 5HO6A 2BRHA 4R7HA 2QOOA 4TNBA 3I0OA 4DEBA 5I9XA 2I0YA 4U79A 1XH5A 3NW7A 5AAFA 2BZKB 1UU8A 3FLSA 3LCOA 4I4FA 2BILB 3T9IA 3NLBA 4IJPA 4W8EA 3C0IA 3LFSA 4J8NA 3RP9A 1J91A 4R6VA 4DBXA 4J7BA 2WIHA 3CTHA 4FTLA 1ZZLA 3A2CA 5JFXA 2FA2A 3DK3A 5DT4A 4ZY5A 3CY2A 2R3LA 3DFCB 4KRCA 5DMZA 4FIIA 1Z5MA 4BTJA 4W4YA 4JDKA 4LQMA 1XHAA 4QNAA 2GS2A 1PY5A 1Q8UA 4I21A 4HYHA 2XNMA 4E93A 1M2PA 5KHWA 1YXSA 4AW0A 2R7BA 3VS1A 3JUHA 3P4KA 2XKFA 3AG9A 3QLGA 5DPVA 2WNTA 3UYTA 3QYZA 4U45A 4BDGA 1S9JA 2WEIA 4KINA 4ZJIA 4UYNA 3BQCA 4AF3A 2WMVA 3DBCA 4KBKA 2JDSA 3AD6A 1VJYA 4JVGA 3DLSA 3FMLA 4J1RA 2IVVA 1REKA 3ZLSA 4OTRA 4ALUA 4F7SA 2W1HA 4LRMA 4CFWA 3D4QA 3PZHA 1FOTA 4QMXA 3R04A 3TKUA 2OBJA 5HVYA 2IG7A 2DUVA 2WMRA 2ZV7A 4A9YA 2O64A 4CCBA 1TVOA 4QP1A 1UA2A 4U3ZA 4RIWA 4JG6A 4U5JA 3FI2A 2BIYA 5FLFA 5CASA 3R01A 3RAKA 4BI0A 5CAQA 4DG3E 2VTTA 5BVWA 1OBDA 3PSCA 5T68A 2YM6A 5KKRB 1STCE 2B9JA 2ERZE 3Q96A 3RCDA 4Z9LA 4YC8A 5BYLA 4OBQA 4GT5A 4MKCA 1CSNA 4BRXA 3DQXA 4U0IA 3OUKA 4L8MA 3MSSA 4KWPA 4EWQA 1K9AA 3QKLA 3ZDIA 4ALVA 5L3AA 3HA8A 3VNTA 2YCRA 3D7TB 5BVFA 2NRUA 1U54B 2UZTA 5ANIA 4O83A 3EFKA 4ENYA 3KXGA 5IUIA 4RX7A 4A7CA 4JBVA 4E26A 4JX3A 4GK3A 3VUMA 4FODA 2I7QA 3R0TA 3FLQA 4B7TA 2CSNA 4K33A 3V5JA 4I6HA 3ALNA 1IRKA 1M2RA 1J7IA 4FL3A 4HYSA 5H3QA 4HGEA 4IAZA 4XV3A 1XKKA 3U9CA 3KMUA 5HBHA 2XIXA 4L6QA 3U51A 4W4XA 2OZAA 2E9UA 5CXZA 1H1SA 1JPAA 3FBVA 3EIDA 3TZ7A 3H30A 3QA8A 5LVLA 4PTCA 2VO3A 4DAWA 4OLIA 5CVFA 1YXVA 3LFEA 3KL8A 3UOHA 3RALA 3EQRA 2EUFB 4F0IA 4AN9A 2ETMA 4LG4A 3EL7A 5E8TA 3ZU7A 2P55A 4DFNA 5HEZA 3RNYA 3PYYA 3V8SA 2A27A 1H4LA 5TR6A 4IIRA 5EOLA 4BL1A 2OH0E 3DFAA 3KULA 4D1SA 3L9PA 4PRJA 4RZWA 3MPAA 4ACHA 5FP5A 1P2AA 4GFGA 4YPDA 4XLVA 1ZMWA 3NRMA 3R73A 1KE6A 5TOZA 4BDFA 3F88A 3DNDA 4Q2AA 4HVSA 3RAWA 3DU8A 1Y6AA 3BYVA 4G6NA 2BZHB 3UBDA 2C3JA 5CEIA 1OBGA 3FDNA 3JY0A 3DKGA 3KU2A 4FTJA 3ULZA 1JSUA 4CZYB 4YZCA 2NPQA 5E1SA 2BKKA 4F63A 4RX8A 3G6HA 3ZMMA 1XBBA 1JKTA 2X6EA 4RWLA 4FTKA 1Y8GA 3ZEPA 2OI4X 1M52A 2UW8A 4HCTA 3W33A 4H3PA 3EN7A 3CD3A 4QP6A 3VRZA 1KE8A 3B2TA 4RBLA 2PSQA 1UU9A 4ANNA 2FSTX 4FTMA 5FXSA 2OKRA 5H8BA 3JS2A 5BX0A 4FOCA 3DAKA 2X1NA 1H07A 3N4UA 3WYXA 5AX9A 4QD6A 3R9DA 1LEWA 4UWBA 4HNFA 3VN9A 4U81A 2UW7A 1H27A 1WBVA 4TL0A 3UODA 3UO6A 3W55A 1GIIA 2XK7A 3RHXA 1NA7A 2V62A 2QNJA 4PUZA 3HDNA 2C3IB 3OMVA 4FT0A 3I81A 3FYJX 3AD5A
chains in the Genus database with same CATH superfamily
3AT2A 4S32A 1H08A 4E5BA 4RIYA 5B2MA 4FNZA 2GMXA 4BGGA 1UU3A 1WFCA 1Q41A 3IGGA 1O6LA 1YVJA 3IS5A 4II5A 4V01A 3WZEA 4TKSA 4AT5A 4BZOA 3B8RA 4W4VA 2WOTA 2PVKA 3OTUA 3KK9A 3Q9YA 3R02A 4I6BA 3VHKA 2GNJA 4AGCA 4C02A 1ZY5A 1BL7A 3E8NA 5IQDA 3ZSGA 5AV3A 5E1EA 3BHHA 3PDTA 3ZEWA 1Q8WA 1LR4A 3R7UA 3RNIA 4DG2E 1UU7A 5I9ZA 3K2LA 3DDQA 2ITXA 3NNXA 3R1NA 3ODYX 3RBWA 5FTGA 2G2IA 3KRXA 3ALOA 3PWDA 4P7EA 5FD2A 3PE1A 5HI2A 2QLQA 2H9VA 4GK2A 3BE9A 3K5UA 5ACBC 3DBEA 3ELJA 3EQFA 3HVCA 3MI9A 3NZ0A 3AKLA 1GZ8A 4B99A 2R4BA 3KMWA 4GEOA 3I7BA 4FKIA 4OBOA 4XMOA 1OVEA 4AU8A 2XYUA 3V5QA 3FKOA 4YZMA 5AP6A 5AR8A 2X81A 2R9SA 5KMOA 4FEWA 3GI3A 5M09A 3LXKA 4O2PA 4IEBA 4MNEB 5AUTA 3BL9A 2YDJA 3FV8A 3FMMA 2PU8A 2Y4IB 2HK5A 4MCVA 4UMQA 5IPJA 1OKYA 3DAJA 5DHJA 2JD5A 2YM5A 3E92A 2OO8X 2ZMDA 4NKSA 2Y8OA 4FL1A 3KKVA 4AACA 1JQHA 3P7AA 5CWZA 4BY9E 3LFAA 4XCUA 2HENA 2OW3A 3OCBA 1LPUA 4N70A 3GU8A 1XH7A 1KWPA 3F7WA 2AUHA 1W2CA 5CSHA 5CAUA 4CFVA 4ZY6A 3QD4A 4FIJA 3KN6A 4Q9ZA 4D2WA 4M7IA 4U42A 2YM8A 1F5QA 3O23A 4ANBA 4CGAA 5IEVA 2H6DA 4RA5A 1PJKA 3P5JC 3R83A 1FGKA 1Q8ZA 4X0MA 4EJNA 4DH8A 3ROYA 5J1VA 4PNKA 2X0PA 3DBDA 4OUCA 4YBKA 3RK9A 3PRIA 4PTGA 2ZM1A 3BU6A 2C5XA 5F94A 4AZSA 1ZYJA 4GIIA 4EOPA 3OCTA 5AR4A 4BCFA 4YO4A 3AMBA 3H9OA 3FQHA 3EL8A 1J1CA 4FV0A 4IW0A 4D4VA 2X4FA 2WZJA 3OT3A 4ANSA 4KS7A 5A54A 4GH2A 3KXMA 4QMTA 4PDYA 3D7TA 3E63A 2HYYA 2VTIA 3HA6A 4AZWA 1I44A 1U54A 2CCHA 3HGKA 3FYKX 2I0HA 2XNBA 4ZTNA 4Y72A 4M84A 4BCHA 4L46A 3PVUA 4WRGA 3A7HA 4RZVA 4IZAA 3ZO4A 4C37A 1GZKA 4X21A 5HD4A 1VYWA 2GU8A 2R3FA 3CJGA 3MW1A 4YJPA 2ITUA 3BV2A 3HLLA 5CVHA 2QD9A 2BZJA 3ZLYA 1FGIA 5L6OA 4AW1A 4Z55A 4MWHA 3ACJA 3C4XA 1NXKA 3MPMA 3OXIA 3R00A 5D7VA 4C36A 3VS0A 2R3OA 3MS9A 3TNWA 5LOHA 2YWVA 2EXEA 2P33A 4CVAA 1W2DA 4LV8A 4HVHA 4CFXA 3MH2A 4IDVA 3L8SA 4YNEA 2C5OA 4ZXTA 3OEFX 4BDDA 3GCPA 3NIZA 5HE2A 3FMDA 5KMNA 3NCZA 1WVWA 1JSVA 2YN8A 5KE0A 4YHFA 4BHZA 2C6MA 3FC1X 1CTPE 4EOMA 4K18A 5JKGA 4G17A 5HG8A 1BX6A 4F9CA 3TJCA 4JDHA 3UE4A 3PA3A 2HZIA 2WGJA 3C9WA 4BDIA 1OL2A 3VVHA 4F08A 4DT8A 4EH6A 4F64A 1XH4A 5HG7A 3DA6A 3EFWA 3HV6A 3OF0A 4D2PA 1APME 3PVWA 1PYXA 5AR5A 3U54A 2BROA 2UZWE 4BB4A 2VD5A 5A4EA 4L53A 2J4ZA 3TV6A 1GAGA 4FL2A 2B9FA 5HBEA 5A4QA 2XM8A 3O8UA 3AD4A 4FIEA 3CQUA 5DN3A 3C51A 1PMEA 2UZVA 4BDHA 4DH5A 2QO9A 5GINE 1GIHA 3FUPA 3P7CA 3ZBXA 4D2SA 3E62A 4DBNA 5IQFA 4EK3A 4FKVA 4YNOA 4FTQA 2OXXA 3UNZA 4MD7E 3PXQA 4BF2A 3SC1A 2BCJA 2VX3A 1CMKE 3OTVA 4QPMA 3PUFC 5HNGA 3PLAE 4X3FA 5D11A 2F2CB 4XG4A 3W18A 3QX2A 2PZ5A 4O4FA 5EFQA 4DEAA 5JQ8A 3ERKA 2HWOA 2XNEA 3C5UA 3TIYA 4M15A 1MP8A 4I0TA 4S2ZA 2J50A 4QDVA 2ITWA 3FL4A 4XYFA 3SRVB 2ZFYA 4DTBA 2HOGA 4RJ4A 4O0XA 3NW5A 1YOJA 3VUTA 3HRBA 2F49A 3E7VA 4F1OA 1H0WA 3KCKA 4LMUA 5ETIA 3DJ5A 5A3XA 5FXRA 2W05A 2PZIA 5LMAA 2V5QA 2PMLX 1O6KA 4L3LA 1NVQA 4IMYA 4JQ8A 5DNRA 5I9VA 3KRLA 1GOLA 3L8PA 4G3DA 2C1BA 2VWBA 2O2UA 2Z7SA 2GTMA 3NYXA 4J97A 1GNGA 3ZFMA 4F7NA 1KUTA 4ORKA 4MXCA 4BBMA 3M1SA 4JI9A 2SRCA 2WQEA 2IZSA 3NUNA 5CT0A 5KMLA 2GFCA 3BHTA 3HZTA 3LIJA 3F69A 5L2QA 1H24A 2XH5A 4FSQA 4D0WA 2HW6A 4WBBB 2F2UA 4QMOA 4D1ZA 4DH3A 4GUBA 5IA4A 1TZDA 3C4WA 1ZAOA 4MD8E 1OKZA 1YHWA 2VWYA 3QZIA 1OZ1A 3G0EA 4DITA 3AT3A 4RPVA 3ZXZA 2QKWB 1PHKA 2Z7QA 3JY9A 5AIRA 4ANLA 4DGMA 2OLCA 2VWVA 2E9NA 1WAKA 3L9LA 3QUEA 3TJDA 1ZOHA 5AX3A 4JDIA 3LCKA 3PXKA 5L4QA 2ETKA 3Q9XA 3C4EA 4FKLA 4KIKB 3P7BA 5HCXA 2C6TA 3FPQA 3BWJA 5AP0A 2GNGA 2GDOA 4GU9A 5AJQA 5LQFA 3GC9A 3FXXA 4QT1A 4W9WA 4MNEA 4QMZA 5F20A 4KUJA 4PL4A 4V04A 1UV5A 4MQ1A 3OXZA 2VUWA 4YP8A 5LVOA 4O1OA 5GJFA 1OL7A 2HY0A 4PL3A 1IG1A 3QD3A 5BUJA 3O7LB 3TMOA 4F65A 4O7NA 3PXYA 4RJ3A 5ANKA 4JR7A 3PA4A 3DB6A 2C6DA 4FMQA 4GJ3A 2PMNX 4EH7A 3QGWA 3CGFA 3W0PA 2EWAA 2XNPA 3IPHA 3ZM9A 3M11A 2PVYA 3DDPA 2BAQA 2R2PA 3DK7A 3HL7A 4QP2A 4XRJA 5EYCA 3UG1A 4CKJA 2C0TA 2XK3A 2UW3A 4ZSGA 2WKMA 5GNKA 4EQMA 3A4PA 3BHYA 3P86A 2HIWA 2JDRA 3GQLA 3OHTA 3VJOA 2Q0NA 5CSWA 4DG0E 5B7VA 1JKKA 3U6HA 3O17A 5HZNA 3GT8A 2EB3A 2JLDA 4O4CA 4A06A 2PULA 4F78A 4BN1A 3BL7A 4HGLA 3A8WA 4DTAA 3P0MA 2G1TA 2J51A 2XKCA 2HXLA 2QOHA 3DAEA 4FV1A 2BR1A 4RJ7A 4XV1A 4BHNA 1ST4A 2CNUA 3PA5A 2ZDTA 4X3JA 3AQVA 4BICA 5KCVA 2YIWA 5HU9A 5EQEA 4CKIA 4MF1A 5C1QB 4C4GA 5IA0A 5LWMA 5HESA 2PE1A 3SW7A 1DS5A 3IW5A 5A4CA 5AP2A 1XWSA 2XEZA 3EOCA 1L3RE 2JDOA 1FVVA 4ACDA 2ITZA 1X8BA 3QBNA 4UN0C 5LWNA 4I6FA 3LHJA 4C4HA 3TXOA 4FSRA 4QPSA 4TWOA 3C4FA 4AOJA 4LGGA 5M55A 4EHVA 3FWQA 3UQCA 4EJ7A 5IQGA 1QPDA 2CGUA 3NFFB 3UVRA 3RPRA 4BYIA 4HCUA 5E8XA 3PJ2A 3QCQA 2FGIA 2DWBA 2O65A 4EK4A 2X2LA 2V7AA 3ORNA 2JBPA 3TUBA 2UZLA 2PHKA 3KXXA 3WZDA 1RJBA 3CC6A 2X7FA 3QTXA 4I6QA 4XJ0A 5LMKC 4ALWA 1E9HA 2PVLA 2RG6A 3GU6A 4GW8A 3DQWA 4WOVA 2ESMA 5CU0A 4CFNA 2YLFA 4A4LA 3MVHA 4M68A 3ZBFA 2HZ4A 3LJ0A 4BCNA 4GU6A 4XP3A 2I0EA 3H9RA 4DDIA 1YWNA 5I9UA 1QPCA 5IQIA 2E9OA 4USDA 2ITVA 3A62A 3CPCA 4FICA 4KNBA 3BE2A 4ITJA 5CTPA 3HMMA 4F7LA 5CU6A 3DKFA 4W8DA 4PDPA 2BTSA 1YQJA 2JAMA 5CNNA 5HE3A 4G34A 4BBEA 2CKPA 2VWWA 4EOLA 4CRSA 3NVKI 5AV0A 5BUEA 2WAJA 3W2RA 2ZM4A 3MPTA 4JBQA 3TKHA 2I6LA 4D55A 4RWJA 4Q5HA 4L42A 3S3IA 3SV0A 2QURA 3S2PA 3UG2A 2ZJWA 3NCGA 5J8IA 4A9SA 2WQOA 2R7IA 2QU5A 3OC1A 2OZAB 3MFSA 3FLNC 5EI2A 2Z8CA 3NUSA 3RKBA 3LFFA 3VBTA 4A9TA 2F9GA 4BCOA 3CY3A 2VZ6A 2IVTA 3E8CA 4MQ2A 3RJCA 3LOKA 4Z7GA 5CEOA 5KX8A 1YHVA 2CKQA 2Y4PA 2QOFA 3LM5A 3CIKA 3F3VA 4C58A 4RT7A 4ZTMA 3PXRA 1OL5A 2G01A 3TTIA 5CSXA 2BDFA 2B1PA 1BUHA 4GSBA 4U41A 4U6RA 4LV7A 4H3BA 4DGNA 4Z7HA 4OTIA 2XKDA 2W1IA 3TDVA 3HP5A 1KSWA 4YTFA 1XO2B 5HOAA 4RVTA 4EYJA 2UVYA 4TPTA 2XEYA 3AT4A 3R7OA 3SRVA 4E4MA 2J6MA 4YMJA 4DHZA 4L9IA 4C4FA 5EOBA 3I5NA 3IOKA 4JQEA 3FC2A 4O7RA 3QZFA 3V5WA 3VUGA 3EQHA 2PY3A 3OXTA 2Z7LA 4FNWA 5J7HA 3QRUA 4C61A 3I60A 4R1VA 2WO6A 4F0FA 3R2BA 3PP1A 4IX6A 4JBOA 3RHKA 3UZPA 4Z16A 1OIYA 5KZIA 4RRVA 5KZ0A 5K9IA 5CS6A 5JEBA 5JGDA 3FI8A 3QXOA 4YJTA 2OWBA 5AEPA 3A4OX 2BIKB 3BYSA 1HOWA 2WB8A 2FSOX 3E88A 3LQ8A 4OTDA 4OT6A 4AE6A 4E6CA 5IH5A 4JAJA 1LEZA 5M44A 2X8IA 1J1BA 3ULIA 1GIJA 4MBLA 3ZYAA 3E87A 3DCVA 4YHTA 4EK8A 4MTAA 3FZ1A 4WO5A 3OFMA 2Z60A 4B4LA 4JIKA 4NKAA 3RI1A 3P23A 2AC3A 1GZOA 3F3UA 2R5TA 1P5EA 4Y5QA 3Q4TA 3E93A 4G2FA 3W8LA 4ARKA 4O0RA 2O63A 2PK9A 2VNWA 4GUEA 4MXZA 4WNOA 5EM8A 2H34A 3GC8A 3EN6A 2I0VA 3R1YA 3NMUF 3ZRKA 4BTMA 2PVRA 3O51A 4O86A 3BLRA 1KE7A 2CKOA 2XK4A 3UIUA 3F5PA 2Y6MA 4IDTA 4KSQA 3BLHA 4WNMA 4EORA 3R9RA 2PVHA 4QTEA 4B6LA 4IAIA 4EONA 5ANDA 3FEGA 2ITOA 2IW8A 5EQYA 4CMTA 4EWHA 3HP2A 3QL8A 3SA0A 4FKOA 3RM7A 3MVJA 2V55A 4PP9A 5HQ0A 2GSFA 3F3ZA 4O1PA 4EH4A 3COKA 1JOWB 4CRLA 4NCTC 2XMYA 3RTPA 1ZY4A 4CXAA 5KHXA 5L8LA 3U6IA 5EYMA 2QO2A 4EBWA 3DOGA 2QR8A 3ITZA 4JQ7A 2RGPA 2WMBA 3K3JA 4IANA 5HLPA 4GFMA 2F7ZE 1ZMUA 5HIBA 4MUQA 2B9HA 4R7IA 4FT3A 1XMLA 4BIEA 2XARA 1V0BA 4USEA 3ZSHA 4P2KA 4GL9A 4EOIA 5L2WA 4X2JA 4EHGA 3PSDA 3MGYA 2WTJA 5L2IA 3EN9A 4I5MA 5AR2A 2PMOX 2QG7A 2BAJA 4AAAA 5M51A 3D5UA 3NNUA 3D0EA 2QOKA 3W16A 4EQUA 5LMBA 3QD0A 2W0JA 4NM7A 4XHKB 3A60A 5FRIA 5KUPA 3ZFXA 4XV2A 4I5HA 3UNJA 4LMNA 2WTDA 1P4FA 4I3ZA 5DT0A 3WI6A 4C33A 5C4KA 4GVJA 4BDEA 2C68A 2W96B 4ZSJA 4EKKA 4C2WA 5CI6A 4JS8A 3CLYA 3BYOA 2QKRA 3MWUA 4YURA 5CF8A 5C9CA 1NY3A 3BQRA 3PZEA 5JRQA 3DXNA 4V05A 4D1XA 5CSPA 5DR9A 3RGFA 2JKKA 4FKGA 3DBQA 4YLLA 4FF8A 1HCLA 4G1WA 2PUPA 5DRDA 5FWKK 3UO4A 2BKZA 3ML1A 3Q9WA 3UC4A 3KB7A 1QL6A 2YM7A 5EHLA 4O0SA 4AW5A 3ET7A 5LVNA 4IM3A 5FEEA 2OG8A 2YCFA 2X7GA 5AUZA 1CKIA 3MBLA 4XS2A 5KMJA 1YWVA 3QAME 4JR3A 1ERKA 3DKCA 4H3QA 2UZDA 2IVSA 4B8MA 3WF5A 3O8TA 4AFEA 2NO3A 4C57A 3QU0A 3U4WA 2XUUA 2ONLA 1RQQA 3TZ9A 4HNIA 2ONLC 3G6GA 4TYJA 4UMUA 4IX4A 2Y9QA 3VQUA 2C69A 2YFXA 3QQFA 5L2TA 5J95A 4LRJA 3HNGA 4FVQA 1M17A 2B7AA 5BVOA 2OICA 2Y7JA 4L01A 5KMIA 3QTUA 2LAVA 4AZTA 4O7VA 3TNPC 2DS1A 1SMHA 2OJ9A 4J99A 4IWPA 3GUBA 4TT7A 5DVRA 4AUAA 3AMAA 5LXMA 4O0YA 4RVMA 4ANQA 4EH8A 5AUVA 2C5NA 1OGYA 4O0VA 4S31A 4QMUA 4O38A 3ORMA 4EOSA 4I6LA 4EH5A 4O2ZA 2ERKA 4XG3A 1L8TA 4H58A 2C47A 5B2KA 2UUEA 4O81A 1ZYDA 3OWPA 4UX9A 3ORKA 5E7RA 5IQCA 4FT5A 5EW8A 5D7AA 4I5CA 4E4XA 4RLKA 2GHLA 3POZA 3ZUVA 5JFVA 3PG3A 3MH3A 5HX8A 3VBYA 2XJ2A 2UW6A 4P5QA 4BGHA 5DEWA 3LCDA 3UJGA 1IA9A 3QX4A 1FVTA 5AP7A 3D83A 2Q83A 4NFNA 4FEXA 1GY3A 3O71A 4ZOGA 2X8EA 1XR1A 3GENA 2B52A 2RFDA 4WUAA 1KV1A 4YPSA 1E1VA 1XH9A 4U44A 3KGAA 1G8JA 4EBVA 3ZCLA 2JITA 3Q4CA 4ZZMA 3QTWA 3WF6A 4EOQA 5IF1A 3LJ1A 4QMYA 3F9NA 3MY1A 4HYUA 4IB5A 2VNYA 1E1XA 3R8LA 5L8JA 3WE4A 5CNOA 3QTIA 3UTOA 4TYHB 4YC6A 3WOWA 4QQTA 4ASDA 2YEXA 3OVVA 4PQNA 5AV2A 4A4OA 2FYSA 4F9AA 3ZZWA 1BL6A 3VWAA 4H1JA 1V0OA 4YO6A 4N0SA 3WYYA 3BGQA 3RCJA 3AC1A 5HE0A 4BFMA 5TKDA 2VTAA 3TM0A 3PJ1A 1VZOA 5ETAA 4WKQA 4ZLYA 5M08A 3T9TA 1YOMA 2O5KA 4J53A 4X3FB 4BCPA 3R1QA 4G9RA 4XV9A 3EFLA 1H00A 4CV8A 2NRYA 4FV7A 2WU7A 3I5ZA 5HG9A 1ZLTA 4GK4A 4ZSAA 3VC4A 1PXJA 2W1CA 3FZOA 3QCSA 3GGFA 3PY1A 2O0UA 3EZRA 4G3EA 3UIMA 2C0OA 2W1FA 2ZV8A 3NIEA 2JBOA 2XBJA 3KEXA 2QOIA 4U80A 2XIYA 4C4EA 3UOKA 2R3RA 1YXTA 3QFVA 3RK5A 1UNLA 4BIBA 2ZMCA 3VS4A 3MV5A 2JIVA 4GIHA 4TYEA 4AT4A 3K54A 2O8YA 3OY1A 2W1ZA 4RWIA 4L3PA 3SDJA 5E9EA 1OGUA 2OSCA 2KULA 2B4SB 4BR3A 4CG9A 5C8KA 4DEDA 4D2VA 5FDPA 3PFYA 5DT3A 4OTFA 4ZTLA 3BYMA 3RWQA 3D2KA 3E3BX 2XA4A 3TL8A 5JZJA 4DFUA 3G0FA 3GC0A 2QODA 4YC3A 2BPMA 2FO0A 4O27B 4M69A 5AM7A 4EQCA 3JVSA 1B6CB 3PY3A 2YM3A 4BWKA 5DGZA 2WTWA 1SVHA 1W2FA 3V5LA 1J7LA 5EQPA 5HNIX 5FP6A 2B9IA 4D0XA 4DFYA 4GCJA 4I1ZA 4MK0A 3QALE 4K1BA 4QPAA 5FG8A 2HCKA 5I9YA 4XNEA 3GXLA 4DEHA 2PWLA 4IFCA 1PXLA 3FI3A 1OKWA 4GYGA 3ZTXA 3C4ZA 4JRNA 1YI6A 4CTCA 3UDTA 3E8EA 3ZLWA 4G3CA 4IB1A 4NEUA 2XNNA 2XRUA 4OT5A 4DCEA 2BDJA 2YABA 3MA6A 3PUPA 3RINA 4UV0A 5FUTA 3KQ7A 3TNQB 1OITA 5CU3A 5TE0A 2VGOA 3W2QA 1OECA 3QCYA 4DDGA 3D14A 4IM2A 4QQCA 4PMPA 4E4LA 3PJ8A 3SVVA 3R30A 2I1MA 3D9VA 3MB6A 3UOLA 4UWCA 1W0XC 3CCNA 3DTCA 4XG7A 3VW6A 1URWA 4E5AX 3NDMA 2JC6A 4DGGA 5I0BA 2OF2A 2W5AA 3UP2A 4RVLA 2WIPA 1G8SA 5HCZA 3W2PA 4GVAA 4RIXB 5FTQA 3NWWA 2A1AB 4FJVA 3RK7A 3CTJA 5HU3A 3MIYA 4PDSA 3KIOC 3OWJA 5IQEA 3PSBA 5CAOA 4OAUC 4O7WA 3D2IA 1XJDA 3ZLXA 4WD5A 4CMUA 3LKMA 2C1AA 4FTIA 4FKSA 3C0GA 4RSSA 4E4NA 4EEVA 2CNQA 1W98A 4X2FA 4NYEA 5ANJA 4DF3A 5CT7A 4ERKA 1SVEA 1GZNA 4G6OA 5C27A 1G3NA 4RVKA 4YLKA 1YI4A 4AS0A 1XH6A 1H26A 4A9UA 3LFNA 3FZSA 4QEBA 5ACKA 2RL5A 2X0QA 3FZTA 3R22A 4GV1A 4L3JA 2YACA 4MD9E 4CYJA 3IW4A 4UBAA 4W4WA 5L6PA 3V8TA 1WZYA 4DCAA 2XK8A 2CGWA 2XANA 4DTKA 4IAKA 4Y83A 2XK6A 3ZOSA 1PMVA 4FKPA 5EM5A 3VHEA 4AN3A 4M13A 2X4ZA 1HCKA 4WG4A 4EK6A 3AXWA 4IZ5A 1R1WA 1EH4A 4YHJA 4IC8A 1ZWSA 5KKRC 2R3QA 4FV2A 5EW3A 4N4SA 3LXLA 4KKHA 4J98A 3EQPA 3GOKA 3IONA 5JZNA 2HAKA 2XALA 2A98A 3P08A 4U8ZA 3TUDA 2O3PA 3KXNA 3ZC5A 4BCKA 2WEVA 2GQGA 4GKHA 5BYYA 3BPRA 2IW6A 2B54A 4AXEA 5EI8A 5JK3A 3KN5A 4I0RA 4RQKA 4XLIA 3RAHA 3QQKA 4R1YA 2CHLA 3GB2A 1RE8A 4AW2A 5ANOA 4NJDA 3O8PA 4BI2A 3GOPA 1Y57A 4FV5A 1AQ1A 3GU5A 1WBPA 4GJ2A 3FQSA 3RPOA 2ACXA 2WTKC 4MVFA 2G2HA 2GFSA 5A4LA 2OK1A 3R6XA 3KFAA 5KO1A 5J9LA 2GNHA 4OTHA 3CTQA 4X7QA 1PXKA 3MTFA 5F9EA 2OIBA 2WMTA 4EUUA 2W9FB 4ANOA 3R9HA 5D41A 2B53A 2F57A 4KA3A 3F6XA 5EDRA 5EKNA 3JYAA 3SKCA 3V6SA 2BUJA 5J5SA 1Q8TA 3SLSA 4FKRA 4F6SA 3E7OA 2PYWA 5LCJA 4LUEA 5DA3A 5IEYA 4ZS4A 2F7XE 3Q53A 1PXMA 3ODZX 3BU3A 5A9UA 3ZO2A 4L43A 4BGQA 4E6QA 4R3CA 4D5HA 5M53A 2XK9A 2GS6A 4K11A 4QMWA 3KRWA 4TYHA 2P0CA 3NNVA 4PPAA 3V5TA 2GNFA 1AGWA 2R0UA 3PWYA 1WCCA 1UNHA 3EYGA 3QHRA 2VTHA 4ZMFA 2CJMA 3TCPA 4FR4A 4ZLZA 5CY3A 1PF8A 4O7LA 4CYIA 4KSPA 5GIPE 2R3JA 1W84A 4KIOA 5AUWA 3U87A 4IWDA 2E9VA 4PMMA 5FBNC 2JIUA 4FSTA 3ZH8A 1OL6A 3ZHPC 4C34A 3D5WA 4KBCA 1VEBA 3FHIA 4GYIA 2B55A 3PIXA 3LXNA 4UWYA 3DGKA 5EM7A 5GJGA 2YJRA 1M7QA 2IO6A 3EWHA 3MFRA 3V51A 2J9MA 3FKLA 4CFFA 1R3CA 3QGYA 4QP4A 3FL5A 2AYPA 4FIFA 4FTUA 4HYIA 1U59A 5EDQA 3LMIA 5KMMA 5J7BA 3LFCA 4J8MA 4TYGA 3WE8A 1GJOA 4FIHA 1RW8A 3NEWA 4AWIA 4EOJA 3KVXA 2YCQA 3MTLA 3Q6WA 4FV3A 2C0IA 3EN4A 4FEVA 4CKRA 2X7OA 4HVDA 3P9JA 3NUXA 4HCVA 3F5UA 2Z2WA 4FNXA 4ZTRA 3IQ7A 1H25A 4FA2A 4RLLA 1OI9A 5K3YA 3S4QA 4WG3A 2C6LA 4IQ6A 3UZTA 3FAAA 1FMOE 4G6LA 3W32A 3IK3A 4DN5A 4MXOA 4UY9A 3V8WA 4CLIA 5K4JA 1FVRA 5DWRA 5HLNA 4IVAA 3HMIA 2XAMA 3IGOA 4TRLA 4FSWA 3LMGA 3DLZA 2GQSA 2BRGA 4MWIA 4NU1A 2GS7A 3OUNB 5CZHA 4ERWA 4N6ZA 3MESA 4QO9A 1V0PA 2RFSA 2VWIA 4FNYA 4NWMA 4IBMA 3UVQA 1JKSA 3OBJA 4TWNA 3LFQA 4FZDB 4OTQA 2W17A 3EYHA 1WMKA 4ZTSA 2VWZA 1W83A 3F2AA 2J0KA 3HV4A 3ENHA 3Q04A 4A4XA 4NM0A 3AGLA 1OKVA 1P14A 2QOCA 3FE3A 4MAOA 3LZBA 5JFWA 1J7UA 4RX9A 4ZAUA 4FV8A 1A9UA 1OPKA 5DBXA 4FGRA 4AOIA 1ZYLA 4YJOA 1OIRA 5LVPA 3UIBA 3SX9A 3DZQA 2J5EA 3GEQA 5F4NA 4DINA 5L8KA 3TWJA 2C30A 4S30A 2UZOA 4JG7A 4H05A 4QP9A 4EZ7A 4DYMA 3FPMA 3WF8A 5AWMA 4FYOA 3L9NA 4RIXA 1PXPA 4NJ3A 4ZSEA 3W2SA 5JGAA 4IZ7A 3OWLA 3U9NA 4WT6A 5HIEA 5FBOA 2GNIA 3TDWA 2PL0A 4H39A 4JAIA 3QUPA 3NUPA 4J52A 1Q62A 4QTBA 4YJRA 1LUFA 2C6IA 3SHEA 3G2FA 1NW1A 5M4IA 2A2AA 2C3KA 4UMTA 4FUXA 4OR5A 2WQNA 2PTKA 4NUSA 5IKWA 2VTNA 2J2IB 2HZNA 3VUDA 2J5FA 4F6WA 2YHVA 5A6OA 3TIZA 4C8BA 5BVNA 4I5PA 4I94A 3ORPA 1SNXA 1Q97A 2CGXA 2IF8A 3A7IA 3VS2A 4BDAA 2X8DA 3O2MA 4FOBA 5AADA 3W2OA 2ZDUA 4DEGA 3KY2A 4M3QA 1TQIA 4D9TA 3Q2JA 4JIAA 2UVXA 4K0YA 3V01A 2WOUA 3GFWA 4O7YA 4YJVA 4ZZNA 4G5JA 4APPA 3OROA 3Q5ZA 4YTHA 3A61A 3I79A 3UP7A 4CV9A 3VS5A 5BVDA 4O96A 4WRSA 2QQ7A 2VWUA 4CQEA 3AKKA 2OJGA 2XRWA 2XNGA 5IA5A 5EYDA 4NH1A 3UPXA 5LMKA 4BI1A 1TFFA 2W1EA 1ZARA 2W4OA 3OZ6A 5DE2A 3EMGA 1JWHA 4FZ7A 1ZOGA 2OFVA 4CCUA 2ITNA 3BX5A 1Q8YA 3V04A 3AC2A 1R0EA 2V7OA 4UXQA 4UZDA 1K3AA 3RZFA 3A99A 2BTRA 4BDBA 4BKJA 5CF5A 3TZ8A 2PUIA 4EI4A 2Z02A 3EQGA 2J7TA 5A6NA 1I09A 5BPYA 4PDOA 3OP5A 4PWNA 5KBQA 4G5PA 1MRYA 2KTYA 2PVJA 4BTFA 3CEKA 5CF4A 5AFVA 4G31A 2XNOA 1BI8A 2J0IA 4ACCA 3UZRA 5D1JA 3WBLA 3BBTB 4ASZA 4D4SA 5K0XA 5ITAA 4TWPA 4I4EA 3VRYA 4JT3A 4CZTA 3BCEA 4QMPA 3UOJA 4MX9A 2UW0A 4KKGA 2J0LA 4DT9A 3D5VA 4LOOA 4YUQA 3LXPA 4FG9A 2VX0A 3QLFA 2C6KA