4GK4A

Human epha3 kinase domain in complex with ligand 90
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
275
Chain Sequence
VHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITNLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Optimization of Inhibitors of the Tyrosine Kinase EphB4. 2. Cellular Potency Improvement and Binding Mode Validation by X-ray Crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords EPH receptor A3
total genus 87
structure length 275
sequence length 295
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gk4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gk4A01
2CN5A 2IZSA 3LW0A 3UQGA 1FMKA 2WMRA 3RTPA 4DHFA 4ZSEA 3LCDA 4JX7A 2CDZA 3GC9A 4G31A 3KXMA 1TQIA 4NCTA 1W8CA 3AGMA 3V3VA 4FKTA 3ZMMA 5IA3A 1PKDA 4L6QA 2IWIA 5ETIA 5CU4A 4O7ZA 1KUTA 1GZKA 4XV9A 3NMUF 3RK5A 4FV6A 3UO6A 3R83A 4BL1A 2QOQA 3DKGA 1KOBA 3S0OA 1PJKA 2V22A 4A9UA 3MJ2A 3PG1A 2ETKA 2UW4A 2X9FA 4F9WA 4BF2A 2J2IB 4FEXA 3HV3A 2PY3A 4M0ZA 4JAJA 4EYMA 2XYNA 2XK6A 2YITA 3D7TB 3OTUA 5TE0A 4OAUC 3L9MA 1CSNA 3PXZA 4OT6A 3OY1A 4CD0A 2R4BA 3GC7A 2XIYA 4ITIA 4WG4A 4U8ZA 3DDQA 3JR1A 1KV2A 1TQMA 4BFMA 5JZJA 2W5BA 4FEQA 1JWHA 2HY0A 4EHVA 4E4NA 3GXLA 5C8KA 4O21A 4YTHA 2C5XA 2C1AA 4IJ9A 4XBUA 3QX4A 2ITWA 3SLSA 4Y85A 3A60A 2ZV9A 2HCKA 1LPUA 3N4UA 3BWFA 1YWRA 5M07A 5FWKK 2CKEA 2PVMA 5CF6A 3C0HA 3CR0A 3E7OA 4ZSLA 1YRPA 5DEYA 3C4CA 3UIXA 1WFCA 4QTCA 3TUCA 4PDSA 2WPAA 4KKHA 2XK9A 3EZRA 3LOKA 5AADA 1GZ8A 4TXCA 5C9CA 3TIYA 3S3IA 4HVGA 2WTDA 2ZVAA 2GNHA 2OJJA 2YZAA 3VUKA 4FKOA 3PSDA 2Z2WA 3ZO3A 1YHVA 3P79A 2YERA 2DQ7X 1RJBA 2NRUA 3BYUA 3FKOA 5A46A 5I9ZA 3UZTA 5ITAA 4U7ZA 5LVLA 1BI8A 1OMWA 4I6QA 5GJGA 3IGGA 5E8WA 2WEVA 4CCBA 4CNHA 1B38A 3AC8A 3P7CA 1Y8GA 2C6TA 4CQEA 4D2RA 4F70A 5CF5A 5I9WA 4H58A 3A7JA 5FXSA 3TIZA 4CZTA 2Q0BA 1XBCA 3CD8A 5IUIA 1W7HA 3O17A 2R0IA 3NUUA 5AUUA 5CASA 5J1WA 3TDWA 3CC6A 3S4QA 3QRTA 5CXHA 3IQ7A 3K3JA 1P2AA 2WTWA 3MFUA 4I20A 4CFVA 5BMSA 3MYGA 3O8PA 4RJ6A 5EKNA 4OBPA 5AP7A 3ORIA 1FINA 4O0WA 3PVBA 3CE3A 3RPRA 3ZHPC 3C0GA 3FQEA 3BU6A 3GFWA 3W2CA 4FZFB 3DFAA 4II5A 5FG8A 2W99B 2C30A 4ITJA 4NU1A 4U45A 3IG7A 5JFWA 3CQUA 4AP7A 4IMYA 2XNEA 4EOJA 4TYHA 4D2TA 3R2YA 4FZ6A 1XBAA 2QOHA 3U6JA 3PWYA 5AMNA 4G16A 2HZNA 2WMVA 3CTJA 3L8PA 3MGYA 4J8NA 3NYXA 1NVQA 3O8TA 4GFGA 4QRCA 3TTIA 2VTOA 4YU2A 2Z7SA 3NZ0A 1SVHA 5IQCA 4D5KA 3PIZA 2P2HA 2OICA 4K9YA 3RALA 5IQGA 3ZC5A 4EL9A 4O82A 5HO6A 4RBLA 3PRIA 4GIIA 4Z3VA 4LQMA 4BN1A 5KE0A 4NIFB 1RW8A 5HE2A 3CJFA 4G6OA 3PIXA 4BI0A 3HA6A 3RM7A 4PNKA 4ANMA 3F3TA 1QCFA 4PDOA 4Y95A 2JEDA 4PMMA 4YJSA 4O7VA 4QTDA 3D2IA 2O5KA 4C34A 4IWDA 5AIKA 5H8BA 3CLYA 4RC4A 4LYNA 3DXNA 4IVAA 4RIWA 4IEBA 3R7EA 3ANQA 4ZZNA 3BU5A 2IN6A 4CFFA 1MRUA 3GP0A 3EZVA 2IZRA 4PQNA 5J8IA 4FKVA 4EZ5A 4J7BA 5CAQA 5CEOA 3BLHA 2BCJA 4OTQA 4X2FA 5DRBA 5HBHA 2ETRA 4D4VA 2WMWA 2WQEA 3EKKA 2GNLA 2PHKA 2X2LA 3EL8A 1XQZA 4HVDA 4O0VA 3U55A 4QMZA 3OZ6A 3ZZEA 5DNRA 1IAJA 3CKWA 3H10A 3V6RA 2DUVA 5L2SA 1OKVA 4JLCA 5BUJA 2RFEA 4B4LA 4AZSA 2VUWA 5HVYA 1M52A 2BIYA 3AT2A 5FEQA 4HCVA 3R7UA 2QOIA 3R0TA 4EOKA 3C1XA 2YIRA 1ZYLA 4MD7E 3ZLYA 5IQHA 4FTOA 4CTBA 3PXFA 1OIUA 5LCKA 5EHOA 3G5DA 2O65A 4O0XA 4W9WA 5HVJA 4CKRA 3HV6A 5A4QA 3A8WA 5I4NA 4BDBA 2PVKA 3RJCA 4AN2A 2PZRA 3FPMA 4OTPA 3EMGA 4YTCA 5IEYA 3DNEA 4ACMA 4F9AA 4TY1A 2O63A 2J0KA 2R0UA 3QD2B 2PUPA 4FUXA 4U9AA 3M2WA 3EN9A 2WQOA 1ZYCA 5DA3A 3WE8A 3TKHA 5IG1A 4MXOA 3PPKA 4F1TA 4GS6A 1DAYA 5CF4A 3MI9A 5C26A 4BI2A 1FMOE 4DFNA 2FSOX 4LUEA 5IUHA 4BY9E 1JVPP 3ZBXA 4DEEA 4P5QA 3VUTA 2QG7A 2F7XE 4CYIA 2XIXA 1OGUA 3HV7A 3SGCA 3DA6A 2B9FA 5A4CA 3QQHA 5BVNA 2JKKA 4WD5A 4G6NA 2P4IA 3BRBA 1OB3A 2WOTA 1SM2A 2VAGA 1BUHA 3WZEA 2GPHA 3W55A 5FDPA 5HESA 1ZAOA 3COMA 3O7LD 4U0IA 5EYKA 2X1NA 5C27A 1YI6A 3HL7A 2PUIA 4C35A 4BDEA 4YJTA 3KFAA 3COHA 5EI2A 4CZYB 4RGJA 2C3LA 5IH4A 4NL0A 1XO2B 3OS3A 1Q8YA 3E3PA 3UMXA 4BCPA 2BVAA 2GQRA 3RHXA 1XKKA 4DLIA 3COKA 4L3PA 2GHLA 3DKCA 5AR5A 2GNJA 3FLYA 4O2PA 4I21A 2JDTA 2JFMA 2NP8A 4N6ZA 3PVUA 5HCXA 3OG7A 1PYEA 4K77A 2LAVA 3TM0A 3VUIA 5D12A 5J7BA 1Q4LA 4IAZA 3U4WA 1JSTA 2HWOA 4AAAA 5AUTA 3R7OA 5BVWA 3TNHA 3MIYA 1IR3A 1PF8A 3B8RA 3MH2A 4O7NA 5LVNA 2PZIA 2QVSE 4FIIA 4OW8A 1IG1A 3O96A 4W4VA 5CENA 3OC1A 4YO6A 4EUTA 5DGZA 2RSVA 3F9NA 3VO3A 1GAGA 3DBFA 4CQGA 4DH8A 1OL2A 3W32A 1IA8A 1GNGA 1KE6A 3COIA 3Q60A 5EW8A 2FYSA 4CKJA 2BZKB 3GCQA 1MRVA 1IEPA 1DM2A 3QCXA 2C5YA 3NNVA 4FC0A 4FKQA 3I5ZA 4FSQA 1PXMA 3NPCA 2BTRA 1JKKA 4YNEA 3RCJA 4DFXE 2UW5A 4MXCA 2X8IA 4XOYA 5C4LA 3RGFA 4WO5A 4DH1A 2QLQA 4YZNA 4YP8A 1J3HA 3BYMA 4JBPA 1UNLA 2PMNX 5L2QA 3OW4A 5DI1A 2QOOA 5CU3A 2UW7A 2ACXA 3KRXA 4H1JA 4RFZA 3REPA 3W18A 4AZWA 4E6AA 3DU8A 4EH3A 3A99A 4QMUA 4XHKB 3NUYA 1PMEA 5BVEA 5FBNC 3WZUA 1Q24A 2ITNA 5KCVA 4BTMA 1YKRA 2ITPA 4A9TA 4F6SA 3GT8A 3NAYA 1SYKA 5ICPA 3N4VA 3KKVA 5JK3A 2VD5A 3MB6A 3LM0A 2PYWA 2YDIA 4D1XA 4H3BA 5AR7A 3HEGA 3CY3A 2ZM1A 2Z02A 3QTUA 4PP7A 2JFLA 2R3PA 3M1SA 4JDJA 3BE9A 4IBMA 4XMOA 3MWUA 4XRLA 1KV1A 3P7BA 3PVGA 4C0TA 3FXZA 4FZ7A 1CTPE 3POZA 4FT9A 1XWSA 3R9DA 3KREA 3ZS5A 1UKHA 4B8LA 3C4FA 3CEKA 2QO2A 4UX9A 5HE3A 4BCGA 4AW5A 2J51A 4YPSA 3ZBFA 3R9NA 3F3ZA 3MBLA 3QHRA 4AGWA 3LFAA 4OAVB 4IAAA 3SXRA 5FEDA 3RM6A 3Q4CA 3OOGA 3KVWA 3KY2A 4XBRA 4BTJA 2UZNA 3DB8A 4CTCA 5HZNA 2UUEA 5G1XA 4RG0A 5DG5A 5AP1A 4LOQA 4CG8A 3PY0A 2XB7A 3AD4A 3DJ5A 3AC2A 4IQ6A 3SAYA 2J7TA 1YOLA 5HNIX 4E6CA 5B0XA 2X7FA 3PLSA 4NM3A 3L9LA 4FI1A 2BRGA 3PA5A 3HLLA 3A7FA 5CSHA 2H34A 4BCFA 5J9LA 1SMHA 4X3JA 4QMSA 2BHEA 3EKNA 3TV4A 3EN7A 1JBPE 2E9OA 2I40A 2OBJA 3BYOA 3LXLA 1Z57A 2P0CA 4GRBA 5JFVA 5M4CA 5BQ0A 3AT4A 2WB8A 2CJMA 3V6SA 4IFGA 3QGYA 2XKDA 5T3QA 2HENA 2JKOA 3LMGA 4U44A 3TNQB 4IX6A 2WFYA 2FGIA 4BDFA 2REIA 5AEPA 3ZFMA 3P9JA 4XNEA 5DBXA 3ZRKA 3EFJA 5L6OA 4DEGA 2W5AA 4U81A 3ZDIA 3W2RA 4EK5A 4O91A 2XYUA 3KXXA 2VWUA 4IDTA 4LG4A 3WZKA 1OKWA 4CKIA 3E88A 4UWCA 5AP0A 5E8TA 4FKPA 3VBQA 4D55A 4IM3A 4EBVA 1KSWA 5FP6A 5IF1A 3W16A 2W1HA 2YM4A 4HGTA 3SW4A 1YOJA 4HZRA 3AMAA 1ZRZA 4F9CA 3QXOA 5C03A 3UBDA 3MVHA 3BBTB 5J95A 3OF0A 3NUAA 3LCSA 2YM8A 2I7QA 2PWLA 3ORTA 4E8AA 5E7RA 3HYHA 4GJ2A 1HCLA 3OHTA 2OZOA 4GG5A 4BDKA 5EHLA 2WU6A 5D7AA 3QD4A 2O2UA 3KEXA 5CF8A 4Q2AA 2UVYA 3HDNA 3NIEA 4FT5A 3LAUA 3TNIA 5E8UA 5EW9A 5KZ0A 3UVPA 4QPSA 3GOKA 2YIWA 3HP2A 3QRJA 3QTZA 4P2KA 3QRUA 4K1BA 4H3QA 4KKGA 5TR6A 2XEZA 3UO4A 4DGNA 2VU3A 2JDOA 4NM0A 3PWDA 1JQHA 4ZP5A 5IQEA 4X2KA 2CN8A 5CS6A 1F3MC 4EH6A 4KIKA 2JKMA 2B9IA 4JG7A 4MVFA 4AW2A 4AZTA 4I5PA 3V8TA 4DINA 2JITA 2Z8CA 5J7HA 2R7BA 4IM2A 3PXQA 4UMUA 3U87A 1U54A 2HY81 3H4JA 4IJPA 3UOHA 5HX6A 3MSSA 2YAKA 1Y91A 3QCSA 3UQCA 5DR9A 2J0IA 3OEFX 4W4WA 4XLVA 3MPAA 5HICA 3VRZA 4A06A 4YTFA 1H28A 4JBQA 5L2IA 3F5PA 3QKKA 3HGKA 3NCGA 2RF9A 5B7VA 4CZUA 4UMTA 1XR1A 4C4FA 3UO5A 5ANOA 4RZVA 1R0EA 4XV2A 2QR7A 2Y4IB 4AGCA 3D7TA 1ZZLA 3R28A 1QMZA 4Y8DA 2G9XA 4ZS4A 1I09A 3FL5A 4WNMA 5LVPA 5B2MA 2E9UA 2CGVA 3DAJA 2P33A 3HP5A 1O6KA 4M12A 5A4TA 2VTNA 4OT5A 3UQFA 4N57A 4KNBA 3KK8A 3BHHA 4PL5A 4XG7A 4FA2A 4BCOA 2HZ0A 4G6LA 5AUYA 4DFZE 3A7HA 5AUVA 5ANIA 3WARA 4HNIA 2J6MA 4GJ3A 2IO6A 4MKCA 1OL5A 3D9VA 2B4SB 4L67A 5I5ZA 2W7XA 5TO8A 4WHZA 2GNFA 3UIBA 2UVXA 3UVQA 4KABA 4AA5A 4LGDA 3T3VA 5CAUA 2XEYA 4ENYA 5KMJA 2VTLA 3MTFA 3HKOA 4L00A 4RC3A 3RAKA 4XUFA 4EWHA 1R3CA 2R3OA 4JBVA 2AC3A 3UYSA 3ZEWA 2IVTA 4U6RA 4PTGA 2XZSA 4OUCA 3F7ZA 3ALOA 1XHAA 4NUSA 2VN9A 4ZY6A 3AGLA 3ZM4A 1WBVA 4H36A 5HCZA 1JSVA 4A9YA 3SXFA 4QMOA 2XKCA 5IQBA 2Q83A 3FC1X 4EOPA 2QQ7A 3MPTA 2PZYA 3EHAA 3QRIA 4FTKA 5JN2A 3G9LX 5K3YA 2OXYA 3JXWA 5EKOA 3WF6A 2BAJA 1OPLA 4KIQA 2VTAA 3OWLA 1W0XC 5K0XA 1UVRA 2B7AA 4HVHA 4WIHA 5F94A 2F7EE 3SG8A 2W1GA 5KKRB 2FSLX 1PMVA 3G6HA 3DAKA 4IHPA 4L68A 5CTPA 4WG3A 2C5VA 4NH1A 3UIMA 4FR4A 3CTHA 4ZJVA 3V5PA 1DAWA 2HW7A 4FIEA 1H1PA 4O38A 2UZEA 4RC2A 3ZTXA 4RZWA 5BYYA 1L8TA 1R1WA 3PP0A 2X2MA 4D2PA 3FMKA 3LFNA 3I60A 5ANJA 4E1ZA 5GNKA 4DBNA 3FI4A 3CS9A 2JIUA 3ITZA 4IM0A 5CVHA 5GJFA 2B55A 5LWNA 3QL8A 2FA2A 3DY7A 3Q9ZA 4OTDA 3EQRA 3LCTA 4O7LA 2C3KA 4PF4A 5J9YA 1WCCA 2UZWE 3OCBA 4C3PA 5L2WA 1NVRA 4FKWA 5AV2A 3VF8A 4L53A 1ZARA 2CNVA 4E93A 5ANEA 2BRHA 1BYGA 2HAKA 1YXSA 4HYUA 4EI4A 4F7SA 3R30A 2C0IA 2VWXA 2W1IA 4PL3A 3O2MA 4GFMA 3HV4A 2BAKA 2NPQA 3CJGA 3KC3A 3Q4TA 4PMPA 2B52A 3G90X 4AT4A 3UG2A 2HW6A 4BYIA 5DT4A 2OWBA 3QKLA 3TG1A 3P23A 4FF8A 1PXIA 2XKEA 2YABA 3HRCA 3ORNA 4IIRA 2UW8A 4K33A 2AYPA 4R8QA 4RJ3A 5DWRA 4C36A 3UNKA 4FV7A 4HOKA 4IZYA 3RAWA 2BRMA 2C6IA 4HNFA 4QD6A 3DZQA 3EN4A 3H9OA 5J5TA 3P7AA 5HG9A 4ZY4A 4FEUA 4FX3A 3EH9A 2P2IA 4DFUA 3L9NA 2VO3A 2X7OA 3C7QA 3UOKA 3G9NA 3ROCA 4BC6A 3NW7A 3FZOA 2PE0A 4D0WA 2H96A 3DBDA 3IOPA 3PY3A 1U4DA 1YDSE 4O27B 4QYYA 4UN0C 4DT9A 4ERKA 4L45A 2BZIB 3FC2A 3DZOA 4AG8A 4BCIA 3JY0A 5K9IA 3ZSGA 1OIYA 4YC3A 4AGDA 4IAKA 1W83A 3EWHA 4RLKA 4E6DA 2P3GX 4IANA 4V01A 4LRMA 3FLSA 5AM7A 4YSJA 2WTKB 1OECA 5HGIA 3QUPA 4RWIA 4EONA 4QMTA 3QLFA 3QA0A 4OR5A 5IH6A 1U5QA 5CEKA 5HEZA 3R9HA 4AZVA 4G3FA 4ANLA 2BMCA 4RRVA 2YACA 5D9HA 2YN8A 5L6WL 3EQCA 3OBGA 3SDJA 2EXMA 4DC2A 5JMSA 4BDHA 4J71A 2XNPA 5CANA 2YJSA 3OWKA 3V01A 3A62A 3EOCA 4JDHA 2Y9QA 4BDGA 3ORPA 4DCAA 4Y5HA 1CKJA 3GU6A 3KU2A 1Q8UA 3PZHA 3O7LB 4B9DA 4BKYA 3LJ0A 3QWKA 4EH9A 4WOVA 4F65A 2CKQA 4MAOA 4R3PA 5IMXA 2QC6A 4ZZMA 1UWHA 3F5XA 1GIHA 1GY3A 2PVYA 2X81A 2Z7QA 3FMMA 3ANRA 3KCFA 4LMUA 4YO4A 4YHFA 3ZYAA 5J79A 4X7QA 4RX7A 3FZRA 4YLLA 3U51A 4CRLA 4DG3E 1FVRA 3BQCA 3QX2A 1YW2A 3NEWA 1XBBA 3QZHA 4MK0A 5KBRA 3HMNA 4GVJA 1LEZA 1RE8A 3FQHA 5EDRA 4JDIA 4CT1A 2PPQA 5LVOA 4WBBB 5BVOA 3BEAA 4RIXA 3M11A 5AAFA 4CFUA 3GCVA 3IKAA 3OMVA 3CPBA 4QPAA 3FLZA 4D5HA 2W4JA 4AT5A 2CNUA 3FE3A 4B0GA 5ANKA 4I41A 3ZUVA 2HIWA 3N9XA 4M69B 4P5ZA 4EH4A 4IE9A 4AN9A 4GCJA 3L9PA 3VS6A 5GZ8A 3PJ3A 4EZ3A 3P08A 3VF9A 3ZFYA 5AV4A 4ZTHA 2CGWA 3P86A 3VQHA 5EM7A 3WIKA 3ATTA 3UJGA 3CTQA 1V0OA 2C47A 3CGFA 4F7JA 3Q6WA 2HXLA 3ETAA 4NCTC 5E4HA 4IAYA 3QQUA 4APCA 3F2NA 3LFCA 5IPJA 3E8NA 3WYXA 4A7CA 4EK3A 5ACBC 4CV8A 5L6PA 3LCKA 4WA9A 2PU8A 4Z16A 2XK3A 4TWNA 3QQLA 3OUNB 2BPMA 4YGAA 3DB6A 3WBLA 3ODZX 1SNUA 3F5GA 3ORMA 3VS3A 1WBSA 2WD1A 1H07A 5E90A 4LOPA 2G2FA 2ZB0A 3KF7A 4TKSA 1NW1A 3QCYA 4G3GA 1IAHA 3UMWA 3NYVA 5KO1A 4E4LA 3FY2A 4MNFA 3T9TA 3SOCA 2OIQA 4X3FC 5AJQA 3TT0A 3SRVB 5IH5A 4EEVA 2GHMA 4YBKA 4NW6A 2Y4IC 1VJYA 3FJQE 1YI4A 2CPKE 2VTIA 3R63A 3VVHA 5CX9A 3R8LA 3SA0A 1E1XA 3ORLA 4H39A 2R64A 4E7WA 1U59A 4PTEA 4XV1A 5CU2A 4Q5HA 4DEIA 4WUAA 5AP2A 4HW7A 4OTIA 2R3RA 3GU5A 4QP4A 1NY3A 4O7TA 3C4ZA 4UALA 4R78A 4RIYA 3D7ZA 4O81A 2X2KA 4J53A 5FP5A 4EOMA 4F09A 4J52A 1XH8A 4QQCA 5EHYA 4C33A 3C13A 2C69A 4JR7A 3UE4A 1WBOA 1G8SA 1A48A 2XS0A 1YWNA 4GL9A 5CY3A 2B53A 3E63A 3SX9A 1ZMUA 4USDA 4HVIA 4UYNA 1SNXA 4Q5EA 5IEVA 1M2QA 4G2FA 3A8XA 5DRDA 3D94A 4K0YA 4BZOA 3ULZA 5LVMA 3BGZA 3SOAA 4R1VA 4E20A 1F5QA 2WO6A 4PRJA 3AC5A 4O2ZA 4D9TA 4FGBA 5I9VA 3KMUA 3QLGA 5IQDA 2WQMA 1ZMWA 2ZYBA 3BWJA 4QTBA 3ZDUA 3O71A 4GFOA 3ROYA 4EHGA 3C0IA 1VYZA 4I5CA 5KMOA 4X6QC 2IZTA 5JEBA 1ATPE 1H0WA 3SC1A 4EC8A 3E5AA 5D11A 5K5XA 4PX6A 2XNBA 1W98A 3MS9A 1IASA 2W96B 3ZO1A 2Y6OA 4R7BA 3F2AA 3PLAE 3ODYX 4FV0A 3LLTA 3MY5A 5A3XA 5AR3A 1H1SA 2OH0E 3AG9A 3V5JA 5D1JA 1UKIA 3QQKA 2OF2A 4FSUA 3NW6A 4TZRA 4Z9LA 5JRSA 4EK6A 4RPVA 3ERKA 4BGHA 1DI9A 3BGPA 3K3IA 3UG1A 5AX9A 2F2CB 3L8VA 1FQ1B 5DT0A 4E3CA 3U54A 3VN9A 5HCYA 5HE1A 3QD3A 1Q8ZA 3E62A 4TWPA 3FL4A 3V04A 2BZHB 5ANDA 2WQBA 4FTAA 4C57A 2XIZA 4DEBA 3KXNA 3PXKA 4C8BA 4OTFA 4F64A 5IA5A 5AR2A 4DH5A 2W9ZB 3KRJA 4WSYA 4EUUA 3A7GA 4CSVA 5EQEA 3FMLA 3W2SA 3IECA 4Y83A 4C4GA 4MBLA 4YJPA 3R02A 3VAPA 3OXIA 1UU7A 4Q9SA 1XH4A 2BZJA 4PDYA 4QO9A 4TT7A 4IX5A 3DDPA 3LXNA 4M84A 1XH7A 2OI4X 2E9PA 4NSTA 5DHJA 2BALA 4QP2A 1DS5A 3ZU7A 3C9WA 4RIOA 2YHVA 2B9JA 3UNZA 2XM9A 3O51A 5J5SA 1RDQE 5AP3A 3AT3A 2C6DA 3ZOSA 3OXTA 4ZZOA 2PK9A 3EQFA 3ZSHA 3BQRA 2GMXA 1PW2A 2B54A 4D2SA 2VO0A 2W1ZA 1WBTA 4AOJA 4DTBA 4ANOA 1H1QA 1JPAA 1R0PA 3D14A 4V05A 5JQ8A 3H0YA 4ZJJA 5GZAA 4IWQA 1PYXA 3KA0A 5K5NA 2R3FA 2XUUA 4XP0A 5DE2A 2C6KA 3I4BA 1P4FA 3GUBA 1P4OA 3ZLXA 5H2UA 1PXJA 4QQJA 4BIEA 5FTGA 1OZ1A 1Z9XA 2OF4A 3NWWA 4JRVA 3G2FA 3HMMA 3QFVA 1SVEA 4AACA 4AFJA 4YSMA 4C62A 4UZDA 4USFA 1OUYA 4EHEA 3TUBA 1H27A 2QOCA 2IJMA 4L7FA 4I23A 4L3JA 4FL2A 5HLNA 3QALE 4KRDA 4ZJIA 3DBCA 5EK7A 4L52A 3C4XA 3WF8A 5CAOA 4BGQA 3PSCA 2CGUA 3LQ8A 5L8JA 4L44A 1ZY4A 1ND4A 5JFXA 4U40A 3NGAA 3WF7A 4C61A 4Z7HA 3PE1A 4V0GA 4JBOA 4MXXA 4BDCA 1CDKA 4UMPA 4Y46A 2ITQA 5IA1A 3ALNA 3C4EA 2I6LA 3IW5A 4UWYA 4FK3A 4Y5QA 3GU7A 1JKLA 3GFEA 3QGWA 3OFMA 2ZB1A 4H05A 2F9GA 2GCDA 4KKEA 2IW8A 5A6OA 1H0VA 3WILA 4C37A 3WOWA 4BBFA 2PVFA 4QQTA 2I1MA 3CPCA 4RWLA 3FLWA 2UW9A 2EB3A 3ORXA 4FSNA 4J97A 3VULA 3JS2A 5DEWA 4DG0E 2EU9A 3R73A 3EN5A 5A4LA 2VTRA 5CSWA 4CV9A 4GK3A 3ZSIA 3DPKA 3KGAA 4H1MA 4ZMEA 3Q4UA 4MXZA 1OKYA 3HRFA 3BLQA 3I6WA 1UA2A 4JIKA 4AA4A 1WVXA 1H4LA 3NR9A 2E9VA 3PJ1A 2GTMA 2WHBA 2WTIA 4GH2A 4D0XA 1XH9A 4C2VA 3GBZA 4HGEA 2ITOA 5DYJA 1Q62A 2ONLC 4FL3A 3ZRMA 4NYEA 5M09A 2KULA 5LMBA 5HG5A 4ALVA 3EFLA 4FTRA 4F08A 1O6YA 3EQBA 4LRJA 3II5A 3MPMA 2OSCA 4FVPA 4MTAA 5HTIA 3D4QA 5I9YA 5CT0A 5HLPA 1PXOA 1K3AA 3BHUA 3U8WA 4RFMA 2E9NA 4F6WA 1BL7A 3LFEA 3PIYA 5DFPA 1KE7A 1K2PA 4BDJA 2Q0NA 1BI7A 4UMRA 3FQSA 2QOFA 1WMKA 4DAWA 3BU3A 2XCKA 1PKGA 5CT7A 3VUDA 3QUEA 1A06A 4D2VA 3ZH8A 2UW0A 4LM5A 1PHKA 4YZMA 2HXQA 4Q9ZA 3F5UA 4CFMA 3KRWA 3W10A 5FGKA 2QI8A 3GCPA 3VBTA 4C4EA 4TPTA 4RIWB 2GU8A 5F95A 3F82A 2BFXA 3OUKA 4YLKA 1REKA 4KA3A 4N6YA 4M67A 4FTJA 2Y4PA 2VTQA 2XVDA 1YXUA 4NKSA 4C4IA 4F0GA 2B0QA 4IWOA 3GC0A 2VZ6A 1SVGA 5HHWA 1T45A 4DTKA 5JGAA 5KNJA 3QD0A 2PVNA 4BB4A 4W4XA 1W84A 2W4KA 4F4PA 5FUTA 4RWJA 3LQ5A 4IB5A 4ZSGA 5AAGA 4I0SA 4ERWA 3I6UA 5EW3A 4BCHA 1OI9A 3GCUA 4KS7A 3QU0A 5HOAA 3ZO4A 4AGUA 4ZLOA 2WXVA 3LVPA 4W4YA 3SXSA 4NM5A 4O0RA 3VBXA 2WKMA 2UZVA 5GINE 5H9BA 3VS4A 1W82A 4WBOA 5M55A 3EL7A 4I0TA 3T8OA 3UNJA 2F57A 2W1CA 2GQSA 3LJ2A 3Q04A 2UVZA 4EYJA 3EN6A 5IDPA 3H9RA 5AUZA 3PJCA 2J90A 3HMIA 2YWPA 3QHWA 2X39A 3FYKX 3IK3A 5CQWA 1O9UA 5CEPA 4RIXB 4EQCA 3WZDA 2X6EA 3VHEA 3E7VA 1WZYA 2PZPA 3NYOA 4JDKA 1J7LA 1WBPA 4YZCA 4C4JA 1ZOEA 5E8VA 5ACKA 4U97A 1UV5A 5CWZA 5JRQA 4DA5A 4TW9A 3ZO2A 5GIPE 3PG3A 4R3RA 4U3ZA 5FEEA 4F99A 4GUEA 2RKUA 3LFSA 5CEIA 3NSZA 5D41A 2IG7A 3RKBA 2XNOA 3GU8A 2G15A 2ITVA 2VTHA 4ITHA 3MA6A 4HPTE 3F69A 3MDYA 4JG6A 2RL5A 3FZPA 1CM8A 4J96A 2X7GA 3UPXA 4X2GA 3RPYA 3IW6A 5LARA 4CFNA 4DLJA 2HK5A 4L9IA 4P90A 3V5TA 3ENHA 2XNNA 4EQMA 3MW1A 4LMNA 3GGFA 2YM6A 2PTKA 4FSTA 4KS8A 2O64A 3PVWA 1ZOGA 3CD3A 4BR3A 2J50A 3IOKA 5CNOA 2C3JA 2YCRA 4U41A 4BBEA 1M14A 4GK4A 2BDWA 2VX0A 4NW5A 4S34A 5E8ZA 3KCKA 3QTSA 5FM3A 2FB8A 3V5LA 1FBNA 4K2RA 3WF9A 4ANBA 3GB2A 3NUNA 2QKWB 5HD7A 4IX4A 4ZOGA 2CLXA 3L8SA 3BHTA 4GT5A 4KIPA 1NA7A 3RBWA 3VC4A 3ZEPA 2W1EA 4QP1A 4IZ5A 3HVCA 5CYIA 3R7YA 4FTTA 5AV0A 4JNWA 4ALUA 1I44A 3CQEA 3FY0A 4M14A 3ULIA 4BKJA 4RJ5A 1J1CA 2VWYA 3MA3A 3R04A 2ZMCA 4C2WA 4RVLA 4RWKA 1BMKA 4PL4A 3UP2A 2IVVA 4ACDA 4ASXA 1OIRA 3RK9A 1YI3A 3OEZA 4JXFA 3VNTA 5IMEA 5LXMA 4NFNA 2O0UA 4C3RA 3BPRA 3FMDA 3D15A 3FI3A 3HMOA 4K6ZA 4NM7A 4MNEB 4DF3A 3QRKA 4O96A 3A4PA 4PV0A 4CFWA 4YR8A 2QHMA 3DNDA 3EFWA 3FV8A 4QNYA 4FZAB 5ETAA 2YM3A 3UTOA 4QYEA 1E1VA 4M13A 3WF5A 1OPKA 2BROA 3TKUA 5KMIA 3I7BA 4PY1A 3ACKA 2VWIA 4IFCA 2A27A 2UZBA 1AGWA 3NCZA 1STCE 4FKRA 2PE1A 4X0MA 3TI1A 3CGOA 3LXKA 2WMBA 4TL0A 2PE2A 3W1FA 5CQUA 2CMWA 5DIAA 4EZ7A 2YWVA 4QP3A 3OY3A 2G2IA 2RIOA 3NLBA 4YJRA 5H3QA 5B2LA 3G0EA 4NTTA 5HTCA 4AOTA 2OJIA 2XA4A 1UNGA 3RK7A 4A4XA 1JSUA 4R7HA 3FKLA 4HJOA 4JJRA 4G5PA 3R00A 2RFDA 5A54A 4M66A 3UC4A 3P1AA 4ID7A 5HQ0A 4XP2A 4CMOA 4IB3A 4X6RA 3RPOA 3DQXA 4JS8A 1KE8A 4FT0A 1YQJA 3IPHA 3LJ1A 4JIAA 4XCUA 3UOLA 4BICA 4FEWA 1VZOA 2VO7A 5TOZA 2XBAA 3LPBA 3BCEA 4TWOA 3LKMA 4QMVA 4XV3A 2R3QA 3GCSA 5BVDA 2VTTA 4KINA 2QD9A 4HZSA 2A19B 3F7WA 4X2NA 4EKKA 2ZM4A 3GU4A 4QMMA 3SRVA 4FZDB 3HRBA 4F0FA 3K54A 2WMTA 5L2TA 2V7OA 1PXKA 4HYSA 4WKQA 3AMYA 3ZUTA 4KUJA 5HX8A 2QOBA 4FIHA 2CGXA 4EBWA 3D5XA 3NNXA 3IW4A 4G3DA 3BE2A 4DFLA 2VTSA 4RA5A 2NNWB 2R3JA 1UU9A 3CCNA 3JVSA 4XX9A 2PL0A 2VWWA 3K5UA 1P14A 3F66A 4ARKA 3QBNA 2WGJA 1ZMVA 2WNTA 3FUPA 3GVUA 3AC1A 4KAOA 4FOBA 5M44A 5E8XA 2H6DA 5K0KA 4E26A 4RX8A 1H00A 3RAIA 3LE6A 4FNWA 3VUMA 4BHNA 4XRJA 4NKAA 2OGVA 3TDVA 4MXYA 4XG9A 4F9BA 5ETFA 4O7RA 3DK6A 5BUEA 4YC8A 5AR4A 3F88A 2EXCX 4RVMA 5AP5A 2V0DA 2JKQA 4ACHA 2J5FA 2QONA 5KUPA 3H3CA 4RX5A 2BUJA 2GS2A 5E1EA 2O3PA 5HO7A 2VTJA 1TQPA 1YDTE 1Q41A 3QTXA 5HIDA 2YCSA 3FZ1A 4FYOA 4QMQA 5HNBA 3PY1A 4CVAA 4QPMA 2J9MA 3MY1A 5E92A 3VUGA 3UZRA 4ZEGA 3UGCA 4DH3A 4ZSAA 4DFYA 4V04A 1VR2A 4YURA 5DOSA 4O7WA 3L8XA 5EYMA 4DEHA 4R5YA 5E91A 3KF4A 1H26A 1UU3A 2WU7A 4IX3A 3ACJA 4I94A 3QC4A 2BFYA 4FT7A 4LL0A 4ZTSA 5M4IA 4Z7GA 3PA3A 4UZHA 5AAEA 4BCMA 4DGOA 5FTOA 3R22A 3O50A 2WIPA 4I4EA 4OTRA 3P4KA 1KE9A 3K5VA 4U42A 4GV1A 1VEBA 4FKLA 2FSTX 2G2HA 3A7IA 1NXKA 3EB0A 4WNOA 5M56A 5I9UA 3DBQA 4L8MA 4BWXA 4O6LA 1M17A 3SKCA 1H01A 3DJ6A 2WQNA 2C1BA 2OJGA 1R39A 3MIAA 2V55A 4CFXA 4EJNA 3JY9A 4EWQA 5M57A 2R3MA 3MN3A 4TN6A 5J9ZA 3LMHA 4YZBA 3QYWA 3FEGA 4O0TA 4KWPA 4S33A 2UZLA 5EYDA 5L8LA 5A6NA 4XG4A 1Y6AA 2BILB 2ETMA 2WAJA 4QT1A 5DLSA 3FLNC 4YHTA 5L4QA 5BVKA 1M7QA 3PA4A 4YBJA 2Y6MA 3QWJA 1T46A 5CSXA 4JQ7A 4ANQA 3KRLA 4O84A 3I1AA 4ZK5A 3AQVA 3LLAA 3K2LA 4FKGA 3SG9A 3LQ3A 1URWA 2XMYA 4IXPA 3OCTA 3ZUUA 4FSMA 3OW3A 4FYNA 3R8UA 2ZAZA 4D58A 3RHKA 2BRNA 2OG8A 3CP9A 5IA4A 4KBAA 1ZLTA 2OO8X 4G3CA 4XJ0A 2HWPA 3VS1A 1Q5KA 2WOUA 4FTQA 5BVFA 3BYSA 2BDFA 2JIIA 3HZTA 2R3KA 4CCUA 4D4YA 5BYLA 4OLIA 4AE9A 4E5WA 2UV2A 4JG8A 4QP9A 3ZLSA 4FUYA 3U6IA 4LL5A 4EH5A 1UNHA 3F3UA 4DEAA 2OKRA 3KXGA 4JI9A 4NJ3A 4BI1A 2VGOA 3NVMB 3MFSA 2XJ2A 3TZMA 4BCJA 2R3LA 1KE5A 2QKRA 2RG6A 2W17A 4ZIMA 4DGLC 3UPZA 5M06A 5H8GA 3HDMA 4GK2A 1CMKE 5AM6A 5AWMA 1SZMA 3Q5IA 3FYJX 4LFIA 4YZ9A 4DGMA 3WIGA 3TTJA 3VJOA 4YTIA 2RG5A 3B8QA 3D0EA 1GOLA 3OT3A 3MH0A 5FQDC 4BCQA 4NK9A 4UXLA 3G0FA 4WNKA 3LCOA 3B2WA 4I24A 1M2RA 5EDQA 2X9EA 3P5KA 3Q5ZA 1P5EA 4BZNA 5CU0A 5EM8A 4H3PA 4V0GB 4F9YA 4S32A 1IRKA 1Q61A 2YJRA 4LGHA 1S9IA 4MQ2A 3U4UA 1YXXA 1XJDA 3RNYA 3W8LA 4E73A 3LMIA 5EDPA 3VBWA 3R2BA 1QPCA 4R77A 2ZM3A 2YM7A 4U3YA 1G8AA 3ZCLA 3VIDA 3KRRA 3UDBA 4FNXA 2HYYA 3DKFA 4U79A 4WRGA 3S95A 5IISA 4R1YA 5C8NA 2R5TA 3ORZA 3HAMA 3C5UA 3VS2A 2HZIA 3E64A 4BCKA 1YVJA 2X8DA 5T68A 3GEQA 1ZYDA 1FVTA 2E2BA 2IVSA 3Q32A 3G33A 1TVOA 2A1AB 3PZEA 4G9CA 5HG8A 5TT7A 5FM2A 3FHRA 3TV6A 3LHJA 3R1NA 2EWAA 1YXTA 3PRFA 5A4EA 2IZUA 2JAVA 3LZBA 1WBNA 3ZM9A 5LCJA 4PUZA 2QURA 2Y7JA 4RVKA 4B6LA 4JR3A 5I3OA 5IDNA 4AW1A 4EK4A 2YIXA 1H1RA 2V7AA 3RI1A 3ATSA 5IQIA 3UVRA 4NEUA 4XP3A 3DOGA 4DTAA 2XJ0A 1M2PA 4CEGA 2W1FA 3MVJA 4IB1A 4KIOA 2PMLX 4DYMA 3PJ8A 3BHYA 4OBQA 4UY9A 4XG2A 3VBVA 5FTQA 4NFMA 2JDRA 5K4JA 4GSBA 5DVRA 4GW8A 4D28A 2PVLA 4WRSA 4KD1A 4PMTA 4RMZA 2QOKA 5CAPA 3AC3A 3UZPA 3BV2A 2ITTA 3R1SA 4PP9A 1OL6A 3OROA 4C38A 3NS9A 2FSMX 5L3AA 2W9FB 1Y57A 3S2PA 2B9HA 5FRIA 3QQJA 3UP7A 4ZS0A 3CY2A 4TYHB 3R7VA 4P4CA 1ZWSA 4HGSA 5DR6A 4AFEA 5KX8A 4EHZA 4QQ5A 5BUIA 5IEXA 1K9AA 4IZAA 5HG7A 4DITA 3G15A 3A2CA 5ETCA 5HU9A 3PPJA 3HMPA 2FVDA 5EOLA 2PVHA 4ZTRA 3ID6C 2O8YA 4GYGA 5EQPA 2C4GA 5JSMA 4HPUE 3FKNA 1WVWA 2OIDA 3U9CA 2XRUA 4DGGA 2JBOA 4O7SA 1G5SA 1YWVA 3IDCA 4ANSA 5G6VA 4GVAA 1YHWA 3WZJA 4UMQA 5J1VA 3AC4A 4AX8A 1FVVA 3QUDA 3R7GA 3MH3A 4PPBA 4UEUA 4BWKA 4K11A 2JAMA 4YJOA 2YEXA 4G9RA 3FI8A 3KULA 3I0OA 3QAME 4JOAA 4X2JA 5AUWA 5HLWA 3WYYA 5IUGA 1Q3WA 2BR1A 1Y6BA 2J0LA 5GIOE 4HYIA 4QP6A 2BTSA 4W8EA 4BTFA 4D4SA 3QC9A 4ORKA 3JPVA 5C01A 4YJUA 3Q9YA 5IA2A 3RNIA 1XH6A 5CEQA 4DEDA 2NO3A 3OP5A 4D9UA 5DPVA 3QTRA 3E8DA 1WAKA 3O0GA 3KN5A 4FEVA 3IW7A 3QZGA 4M3QA 4XG8A 4EH8A 4BHZA 2XIRA 4K8AA 2WEIA 4FKJA 4A4LA 2DS1A 1BLXA 2WTVA 4FKUA 4FSRA 1JNKA 3RMFA 4BKZA 3QQGA 5EI8A 4IB0A 3TJDA 4LOOA 3MVMA 4NZWB 5BYZA 5M53A 4QP7A 4DG2E 3TN8A 5TKDA 3HUBA 3RCDA 3U9NA 3DTWA 4FIFA 4EK8A 4FG9A 3VUHA 5F9EA 5GHVA 5CZHA 4D2WA 2ERKA 4IAIA 4QMYA 5LJJA 4DE4A 3Q3BA 2R3IA 4E4MA 3FPQA 1YDRE 4FTUA 4PWNA 1MUOA 4O0UA 5HBJA 2JDVA 5BPYA 4AXAA 4QYFA 2I0HA 3QYZA 2W4OA 2W1DA 4W8DA 4Y72A 3LFDA 2ERZE 3ZLWA 4OTGA 4J1RA 1AQ1A 4EH2A 4CG9A 4DT8A 4NIFA 1MQBA 3OWJA 4DCEA 4MBJA 3TXOA 3GOPA 2XKFA 2C5NA 4QMXA 4APPA 2C0OA 1PY5A 3JVRA 2OK1A 2Y0AA 4IACA 4D4RA 3ET7A 2GDOA 2VTMA 2FUMA 4RQKA 4BCNA 3NDMA 5FD2A 4K18A 2CNQA 2OJ9A 4TYJA 3TL8A 2C5OA 4FIJA 3N51A 2VWVA 4QTAA 3R8ZA 4BIDA 4BYJA 4MYGA 3NRMA 3LFQA 2ZDTA 2B1PA 4TNDA 4B8MA 5DH3A 3EQHA 1HCKA 3MJ1A 4E5AX 5JQ5A 3N4TA 3POOA 1WVYA 2UZUE 3NIZA 4TYGA 5JFSA 3RP9A 3SQQA 4ZMFA 2YCFA 1OL7A 2OFVA 1GIIA 4ZLZA 3KL8A 5I3RA 3NUXA 2YM5A 2VNYA 3I79A 4I1ZA 4UBAA 3RVGA 5CALA 2WMAA 5L8KA 2QO7A 4UXQA 4P7EA 2WMSA 3QZFA 2GQGA 4O22A 3TZ9A 3OVVA 1IA9A 3VRYA 4RSSA 3W2QA 4C7TA 4ZY5A 3PJ2A 4I6BA 1H24A 4IWPA 4Z55A 5IQFA 3UODA 3QCQA 4LI5A 3SD0A 4G1WA 4RIYB 5JGBA 3PDTA 4IAFA 2EXEA 3FWQA 2YISA 2RFNA 4FG7A 1MP8A 3BLRA 1V0PA 1WBWA 2ZJWA 4PMSA 2CKPA 3R9RA 2IPXA 1OVEA 4N4SA 3UC3A 5FLFA 2PZ5A 3ZXZA 5CNNA 3FDNA 5AA9A 3F2RA 1BKXA 4FKSA 3DK7A 3GC8A 1LUFA 3R8VA 4IC7A 4X21A 1REJA 3KXHA 4KRCA 2XNGA 2JGZA 4B7TA 5KBQA 3PP1A 2C6MA 4FG8A 3F3VA 5AR8A 3UOJA 1BX6A 3DLZA 2W5HA 1NVSA 3TNWA 3MV5A 3D83A 3FMNA 4NJDA 5AUXA 2GFSA 3DT1A 4E5BA 3R9OA 5JT2A 3W33A 2WTJA 2CSNA 2WTCA 3D5WA 4BZDA 3LIJA 3EQGA 3OD6X 4FV4A 2WMQA 2X4ZA 3BGQA 3BELA 3PXRA 4OTWA 2XNMA 4L7SA 3PE2A 2QG5A 4N70A 3AMBA 5GJDA 4C02A 5BNJA 3PXYA 5EM5A 5AIRA 3TUDA 2R3NA 2QODA 3HNGA 2ITYA 2YIYA 3NNUA 3HUCA 4FTNA 3H30A 2DYLA 4RJ4A 4BGGA 3HX4A 5LMKA 4ZTMA 2PMOX 3H0ZA 4BDAA 4YMJA 4O7YA 4AW0A 3R6XA 1B6CB 2XK4A 3V5WA 3Q52A 4GUBA 4FV2A 2GNIA 2CCIA 4ENXA 4EKLA 4EORA 2VO6A 2GSFA 2GTNA 1PXNA 3DV3A 4FTCA 4ZTNA 3IGOA 2C3IB 3RWPA 4MF0A 4A9SA 3HAVA 3FSFA 1U5RA 4ASDA 3D2KA 3FHIA 5F4NA 4YC6A 5ANGA 2A4LA 4DFBA 1ERKA 4M15A 4J98A 2QU6A 3FSKA 2YLEA 4LGGA 2OLCA 4F0IA 4MD8E 3UIUA 4TWCA 4FE2A 1J7UA 2ZV7A 5EOBA 3KN6A 3OCGA 2AC5A 2KTYA 4FV3A 3HECA 4I22A 5JZNA 1G3NA 4LUDA 4EOSA 2ZV8A 4O6EA 4EJ7A 3RAHA 5H8EA 3PPZA 4JX3A 3S1HA 4ASZA 4KIKB 2CCHA 1L3RE 5AV3A 3BBWA 3MB7A 3WE4A 4A07A 3OCSA 1BL6A 4XG6A 4QMWA 5CI7A 2DWBA 3FXXA 2H8HA 2OJFE 4FBXA 5IA0A 2BKZA 2XCHA 4R6VA 3DBEA 2F4JA 2LGCA 4M7IA 3R7IA 2GNGA 3TEIA 4JRNA 3Q2JA 4L01A 4S2ZA 4CGAA 2HOGA 3MY0A 4ACCA 4I5HA 4O86A 3EQPA 3NW5A 4C3FA 2G1TA 4RFYA 4EQUA 3EYGA 3PUPA 2NRYA 1MQ4A 4JL9A 4PDPA 1YXVA 4IVDA 1PXPA 3NNWA 4WNPA 4I5MA 4ZTLA 3ZZWA 2XJ1A 4ZLYA 3DS6A 5D7VA 3ZRLA 5KMLA 3C4WA 1O6LA 2R3GA 2I0VA 2J5EA 2WTKC 5TF9A 3AXWA 5E1SA 4BDDA 4HGLA 2JD5A 2XRWA 5CAVA 1ZY5A 5AP6A 4AE6A 4I6HA 2GFCA 4JQ8A 3CIKA 4FMQA 5LOHA 2GHGA 1PMNA 5HNGA 5CLPA 4ONAA 3THBA 4GIHA 3AD5A 4IC8A 4FSWA 4M0YA 3GQLA 5A14A 4FV8A 2XM8A 3G51A 4CXAA 4RJ7A 3RPVA 4R7IA 2R3HA 4FTMA 4TRLA 2WZJA 3NUSA 3BKBA 2JIVA 4BBMA 1H08A 3ENMA 4XEYA 4L46A 2FO0A 1J1BA 2QO9A 3NAXA 3MH1A 2XF0A 5F20A 5DN3A 2WELA 1LEWA 5DT3A 5AFVA 1JKSA 3QTWA 4QP8A 2J0MB 4HCUA 1J91A 5HIBA 3BYVA 4YJVA 5T6KA 4F63A 1LR4A 3IDPA 4GYIA 1OITA 4FIGA 4X3FB 4UYAA 2OXXA 1ZYJA 4G17A 2VGPA 3QXPA 4QNAA 2R7IA 5CXZA 2GS6A 2X8EA 3QZIA 3LFBA 5IU2A 1KWPA 2GS7A 2OZAB 2CHLA 3Q2MA 3B2TA 1EH4A 4PTCA 3FMHA 4XLIA 2QHNA 2RFSA 2VWBA 3BHVA 5LMAA 1QPJA 3OTVA 5A9UA 3ZONA 4PPCA 3KQ7A 3L1SA 3VS5A 4FSYA 4HYHA 3VS7A 4F6UA 1PXLA 2UW3A 5FBOA 3HA8A 4WT6A 3D5VA 4CMUA 3DXPA 3CSVA 4GEOA 3SHEA 4AF3A 3VJNA 5JH6A 3G6GA 3PYYA 4IW0A 2C6OA 4KBCA 1ZYSA 4O1PA 5KMKA 1GZOA 1M7NA 1MRYA 3JUHA 3RINA 2VX3A 4JT3A 3V5QA 2QLUA 4FVRA 2OZAA 2JBPA 4N0SA 5M4FA 3CKXA 4FV5A 3IO7A 2XH5A 2XBJA 4U43A 4XOZA 3QQFA 4G34A 2C6LA 2CLQA 4DN5A 5FDXA 2ZDUA 4I0RA 3FLQA 4BTKA 3OT8A 2YDJA 5KMNA 5HD4A 1FGIA 4I92A 5LQFA 3ELJA 3EYHA 4DBXA 4GKHA 3BIZA 3IW8A 4AOIA 4JAIA 3VHKA 2UZDA 1URCA 4W9XA 2F49A 3O23A 4EOOA 3FAAA 3V51A 4TNBA 4YHJA 5C1QB 4G5JA 5KHWA 1OM1A 3BEGA 3EJ1A 3KMMA 2SRCA 3Q96A 3VBYA 4XYFA 4MWHA 5HO8A 3BX5A 4IH8A 1RQQA 2ZV2A 4MH7A 3C50A 4CYJA 1GJOA 2Z60A 5CVFA 3R8MA 5HE0A 3DXQA 2C6EA 4QTEA 2C68A 1A9UA 4XG3A 4YJQA 3TWJA 1V0BA 2W05A 4UB7A 5EM6A 1Q97A 3TZ7A 4AS0A 5I9XA 1NT2A 4MX9A 4R5SA 2PMIA 4FNZA 4XH6A 3RPSA 2F7ZE 4EC9A 3DKOA 3P0MA 4U80A 3QKMA 4F7NA 3R01A 4GMYA 4FT3A 3R1YA 4E4XA 2QNJA 5HTBA 4MXAA 1DI8A 4TTHB 4S30A 3R1QA 5AX3A 4FGRA 3E92A 4GT3A 3A61A 4YUQA 4BDIA 3NYNA 5LWMA 4LV5A 3OBJA 1TKIA 3MFRA 4F1MA 3RWQA 2PSQA 2G01A 3VQUA 5KZIA 4QYHA 1JAMA 4QYGA 3TZ8A 5EH0A 1ZOHA 4MWIA 4Y73A 1U54B 1H1WA 2VRXA 4FL1A 2VWZA 2CKOA 5IQAA 2OU7A 3DFCB 5M51A 4EOLA 3SVVA 1OBDA 2YFXA 4M8TA 5AV1A 3W2OA 4U5JA 3DGKA 4ASEA 1APME 1QL6A 3OOMA 3SW7A 3F6XA 3E8CA 3C51A 3I5NA 4YNOA 2QOLA 3V8SA 4BRXA 3F61A 3F3WA 2YCQA 3VS0A 3VW6A 2R9SA 3PFQA 2PUNA 1F0QA 5DMZA 4BVUA 4EH7A 1Q99A 2I0EA 3M42A 2YAAA 4AWIA 1QPDA 4AA0A 4FNYA 4BWPA 3EFKA 1U46A 1B39A 4RLLA 4XS2A 2V62A 3QTIA 5FXRA 1Q3DA 3DCVA 2WMXA 2PULA 3ZFXA 3GENA 3Q9XA 3TJCA 1AD5A 2Z7RA 4GU6A 5CVGA 4F1OA 4A9RA 5HBEA 4GKIA 4I6FA 4C59A 5HIEA 3T3UA 1UWJA 3FXWA 4KB8A 4WSQA 1YOMA 4O83A 4RJ8A 3FMEA 2C0TA 3FZTA 4YZDA 3NX8A 3DAEA 1Z5MA 4ZXTA 5M08A 3FMJA 3CBLA 4IADA 4QMLA 4D1ZA 1E9HA 3IDBA 4RX9A 2PUUA 3NVKI 4QMPA 2ONLA 4ALWA 4MEDA 2J0JA 4HCTA 3OWPA 4FK6A 4OBOA 5F1ZA 4F7LA 4O0SA 2W0JA 3GI3A 3DLSA 3E93A 2X6DA 3EIDA 3KULB 1Y8YA 3LFFA 1OBGA 2WIHA 3KVXA 2RGPA 5CI6A 3Q53A 3ZXTA 2A0CX 3BZ3A 1XH5A 4GT4A 4YLJA 3TACA 5DR2A 4MF1A 4AN3A 5B2KA 1V1KA 4PNIA 1JOWB 5KMMA 4LRKA 5J87A 2VTPA 5K4IA 1JKTA 3IS5A 4M69A 3I81A 4TYEA 4J95A 3EQIA 5C4KA 4AT3A 4YPDA 3ORKA 1J7IA 2OXDA 4C4HA 2EUFB 3TCPA 3R8PA 2W06A 1JLUE 4PPAA 2ESMA 3VW8A 4ZAUA 2VX1A 2I0YA 4JVGA 5KKRC 2ITZA 2YA9A 3P78A 5AA8A 2UZTA 1OPJA 2QU5A 4MBIA 5E8YA 2HZ4A 4I4FA 3KMWA 3HV5A 4NWMA 4S31A 3KXZA 5HORA 2BDJA 3VWAA 3WI6A 3CXWA 4IVBA 2AUHA 5CU6A 4E6QA 2XK7A 3R71A 4G3EA 5CZIA 4AUAA 2Y8OA 4RVTA 4MD9E 3I7CA 5EYCA 4J8MA 3OXZA 4GG7A 3TKIA 4FODA 2HELA 4RA4A 3T9IA 3DQWA 2XK8A 2BHHA 2JDSA 4LV8A 3TV7A 2PVRA 4JQEA 4AQCA 3U6HA 1FGKA 5BX0A 4ACGA 2QCSA 4L43A 3KB7A 4MHAA 2IW9A 3BV3A 4DH7A 1ZXEA 3PSBA 4L3LA 1OIQA 4B99A 3MTLA 5E9EA 3H9FA 4ANNA 3KK9A 3Q4ZA 3MFTA 4KSQA 4EOIA 5HI2A 1Q8WA 3A4OX 4GU9A 1VYWA 5IZFA 3LXPA 1UU8A 1PRYA 2FH9A 3W2PA 4OTHA 4M97A 1Q8TA 3QTQA 4IZ7A 2XIKA 2WMUA 5D10A 4IDVA 4NT4A 5GZ9A 3CQWA 3IONA 5KHXA 2X0GA 5EFQA 2BAQA 3JYAA 2PVJA 3NUPA 1FOTA 1QPEA 2UW6A 2ITUA 3QF9A 2BKKA 5CSVA 3FI2A 4ZTQA 3EQDA 1CKIA 5AP4A 2BRBA 1OL1A 4AZEA 1X8BA 2F2UA 5LMKC 3GNIB 4UWBA 4FV9A 5C8MA 4ZSJA 3RZFA 4AU8A 4FOCA 5HKMA 4L42A 4FSZA 4WG5A 4USEA 3W8QA 3Q6UA 3I0QA 1H8FA 3GQIA 3V8WA 5M4UA 3S00A 2IVUA 1S9JA 5HU3A 5HVKA 5I0BA 2OW3A 2IW6A 3E8EA 2ITXA 3PTGA 3RZBA 4AZFA 4RT7A 2YZLA 2ZMDA 2J4ZA 2OFUA 5EI6A 3FBVA 4CLJA 5JGDA 4FTIA 4MCVA 4CT2A 4QOXA 4D1SA 3DK3A 2A2AA 2P55A 4RQVA 4O0YA 1YHSA 2QR8A 4YJNA 5EG3A 5BMMA 1CKPA 4QMNA 3DJ7A 3R21A 5EQYA 4A4OA 5CEMA 3C5IA 1KOAA 2YLFA 4CLIA 4FICA 1GIJA 2JLDA 3LM5A 2ZOQA 2VV9A 2BIKB 3Q9WA 4FTLA 4CMTA 1ZZ2A 2YDKA 3AOXA 1LP4A 4FVQA 5CSPA 3TNPC 3UYTA 2EB2A 1OUKA 2JC6A 1HOWA 4FKIA 4I93A 2XP2A 4MNEA 4R3CA 4HVSA 3O8UA 2R2PA 4KSPA 2UZOA 3ZC6A 1PMUA 1FPUA 2OIBA 4FV1A 4IVCA 4KBKA 4TYIA 5IKWA 4C58A 3QA8A 2EVAA 4MQ1A 1GZNA 3FZSA 1R78A 4J99A 1H25A 2YIQA 4I3ZA 1OKZA 4NTSA 5JKGA 2X4FA 4X3FA 4EOQA 3E3BX 5E8SA 3BI6A 2VNWA 2H9VA 3MVLA 2V5QA 3DTCA 4M68A 4WUNA 4CRSA 3MESA 3E87A 2OH4A 5FXQA 2Z7LA 3D5UA 3SV0A 4UV0A 4O1OA 4OGRA 3AD6A 4BIBA
chains in the Genus database with same CATH superfamily
2CN5A 2IZSA 3LW0A 3UQGA 1FMKA 2WMRA 3RTPA 4DHFA 4ZSEA 3LCDA 4JX7A 2CDZA 3GC9A 4G31A 3KXMA 1TQIA 4NCTA 1W8CA 3AGMA 3V3VA 4FKTA 3ZMMA 5IA3A 1PKDA 4L6QA 2IWIA 5ETIA 5CU4A 4O7ZA 1KUTA 1GZKA 4XV9A 3NMUF 3RK5A 4FV6A 3UO6A 3R83A 4BL1A 2QOQA 3DKGA 1KOBA 3S0OA 1PJKA 2V22A 4A9UA 3MJ2A 3PG1A 2ETKA 2UW4A 2X9FA 4F9WA 4BF2A 2J2IB 4FEXA 3HV3A 2PY3A 4M0ZA 4JAJA 4EYMA 2XYNA 2XK6A 2YITA 3D7TB 3OTUA 5TE0A 4OAUC 3L9MA 1CSNA 3PXZA 3W0OA 4OT6A 3OY1A 4CD0A 2R4BA 3GC7A 2XIYA 4ITIA 4WG4A 4U8ZA 3DDQA 3JR1A 1KV2A 1TQMA 4BFMA 5JZJA 2W5BA 4FEQA 1JWHA 2XALA 2HY0A 4EHVA 4E4NA 3GXLA 4O4EA 5C8KA 4O21A 4YTHA 2C5XA 2C1AA 4IJ9A 4XBUA 3QX4A 2ITWA 3SLSA 4Y85A 3A60A 2ZV9A 2HCKA 1LPUA 3N4UA 3BWFA 1YWRA 5M07A 5FWKK 2CKEA 2PVMA 5CF6A 3C0HA 3CR0A 3E7OA 4ZSLA 1YRPA 5DEYA 3C4CA 3UIXA 1WFCA 4QTCA 3TUCA 4PDSA 2WPAA 4KKHA 2XK9A 3EZRA 3LOKA 5AADA 1GZ8A 4TXCA 5C9CA 3TIYA 3S3IA 4HVGA 2WTDA 2ZVAA 2GNHA 2OJJA 2YZAA 3VUKA 4FKOA 3PSDA 2Z2WA 3ZO3A 1YHVA 3P79A 2YERA 2DQ7X 1RJBA 2NRUA 3BYUA 3FKOA 5A46A 5I9ZA 3UZTA 5ITAA 4U7ZA 5LVLA 1BI8A 1OMWA 4I6QA 5GJGA 3IGGA 5E8WA 2WEVA 4CCBA 4CNHA 1B38A 3AC8A 3P7CA 1Y8GA 2C6TA 4CQEA 4D2RA 4F70A 5CF5A 5I9WA 4H58A 3A7JA 5FXSA 3TIZA 4CZTA 2Q0BA 1XBCA 3CD8A 5IUIA 1W7HA 3O17A 2R0IA 3NUUA 5AUUA 5CASA 5J1WA 3TDWA 3CC6A 3S4QA 3QRTA 5CXHA 3IQ7A 3K3JA 1P2AA 2WTWA 3MFUA 4I20A 4CFVA 5BMSA 3MYGA 3O8PA 4RJ6A 5EKNA 4OBPA 5AP7A 3ORIA 1FINA 4O0WA 3PVBA 3CE3A 3RPRA 3ZHPC 3C0GA 3FQEA 3BU6A 3GFWA 3W2CA 4FZFB 3DFAA 4II5A 5FG8A 2W99B 2C30A 4ITJA 4NU1A 4U45A 3IG7A 5JFWA 3CQUA 4AP7A 4IMYA 2XNEA 4EOJA 4TYHA 4D2TA 3R2YA 4FZ6A 1XBAA 2QOHA 3U6JA 3PWYA 5AMNA 4G16A 2HZNA 2WMVA 3CTJA 3L8PA 3MGYA 4J8NA 3NYXA 1NVQA 3O8TA 4GFGA 4QRCA 3TTIA 2VTOA 4YU2A 2Z7SA 3NZ0A 1SVHA 5IQCA 4D5KA 3PIZA 2P2HA 2OICA 4K9YA 3RALA 5IQGA 3ZC5A 4EL9A 4O82A 5HO6A 4RBLA 3PRIA 4GIIA 4Z3VA 4LQMA 4BN1A 5KE0A 4NIFB 1RW8A 5HE2A 3CJFA 4G6OA 3PIXA 4BI0A 3HA6A 3RM7A 4PNKA 4ANMA 3F3TA 1QCFA 4PDOA 4Y95A 2JEDA 4PMMA 4YJSA 4O7VA 4QTDA 3D2IA 2O5KA 4C34A 4IWDA 5AIKA 5H8BA 3CLYA 4RC4A 4LYNA 3DXNA 4IVAA 4RIWA 4IEBA 3R7EA 3ANQA 4ZZNA 3BU5A 2IN6A 4CFFA 1MRUA 3GP0A 3EZVA 2IZRA 4PQNA 5J8IA 4FKVA 4EZ5A 4J7BA 5CAQA 5CEOA 3BLHA 2BCJA 4OTQA 4X2FA 5DRBA 5HBHA 2ETRA 4D4VA 2WMWA 2WQEA 3EKKA 3PUFC 2GNLA 2PHKA 2X2LA 3EL8A 1XQZA 4HVDA 4O0VA 3U55A 4QMZA 3OZ6A 3ZZEA 5DNRA 1IAJA 3CKWA 3H10A 3V6RA 2DUVA 5L2SA 1OKVA 4JLCA 5BUJA 2RFEA 4B4LA 4AZSA 2VUWA 5HVYA 1M52A 2BIYA 3AT2A 5FEQA 4HCVA 3R7UA 2QOIA 3R0TA 4EOKA 3C1XA 2YIRA 1ZYLA 4MD7E 3ZLYA 5IQHA 4FTOA 4CTBA 3PXFA 1OIUA 5LCKA 5EHOA 3G5DA 2O65A 4O0XA 4W9WA 5HVJA 4CKRA 3HV6A 5A4QA 3A8WA 5I4NA 4BDBA 2PVKA 3RJCA 4AN2A 2PZRA 3FPMA 4OTPA 3EMGA 4YTCA 5IEYA 3DNEA 4ACMA 4F9AA 4TY1A 2O63A 2J0KA 2R0UA 3QD2B 2PUPA 4FUXA 4U9AA 3M2WA 3EN9A 2WQOA 1ZYCA 5DA3A 3WE8A 3TKHA 5IG1A 4MXOA 3PPKA 4F1TA 4GS6A 1DAYA 5CF4A 3MI9A 5C26A 4BI2A 1FMOE 4DFNA 2FSOX 4LUEA 5IUHA 4BY9E 1JVPP 3ZBXA 4DEEA 4P5QA 3VUTA 2QG7A 2F7XE 4CYIA 2XIXA 1OGUA 3HV7A 3SGCA 3DA6A 2B9FA 5A4CA 3QQHA 5BVNA 2JKKA 4WD5A 4G6NA 2P4IA 3BRBA 1OB3A 2WOTA 1SM2A 2VAGA 1BUHA 3WZEA 2GPHA 3W55A 5FDPA 5HESA 1ZAOA 3COMA 3O7LD 4U0IA 5EYKA 2X1NA 5C27A 1YI6A 3HL7A 2PUIA 4C35A 4BDEA 4YJTA 3KFAA 3COHA 5EI2A 4CZYB 4RGJA 2C3LA 5IH4A 4NL0A 1XO2B 3OS3A 1Q8YA 3E3PA 3UMXA 4BCPA 2BVAA 3W0NA 2GQRA 3RHXA 4O4CA 1XKKA 4DLIA 3COKA 4L3PA 2GHLA 3DKCA 5AR5A 2GNJA 3FLYA 4O2PA 4I21A 2JDTA 2JFMA 2NP8A 4N6ZA 3PVUA 5HCXA 3OG7A 1PYEA 4K77A 2LAVA 3TM0A 3VUIA 5D12A 5J7BA 1Q4LA 4IAZA 3U4WA 1JSTA 2HWOA 4AAAA 5AUTA 3R7OA 5BVWA 3TNHA 3MIYA 1IR3A 1PF8A 3B8RA 3MH2A 4O7NA 5LVNA 2PZIA 2QVSE 4FIIA 4OW8A 1IG1A 3O96A 4W4VA 5CENA 3OC1A 4YO6A 4EUTA 5DGZA 2RSVA 3F9NA 3VO3A 1GAGA 3DBFA 4CQGA 4DH8A 1OL2A 3W32A 1IA8A 1GNGA 1KE6A 3COIA 3Q60A 5EW8A 2FYSA 4CKJA 2BZKB 3GCQA 1MRVA 1IEPA 1DM2A 3QCXA 2C5YA 3NNVA 4FC0A 4FKQA 3I5ZA 4FSQA 1PXMA 3NPCA 2BTRA 1JKKA 2AQXA 4YNEA 3RCJA 4DFXE 2UW5A 4MXCA 2X8IA 4XOYA 5C4LA 3RGFA 4WO5A 4DH1A 2QLQA 4YZNA 4YP8A 1J3HA 3BYMA 4JBPA 1UNLA 2PMNX 5L2QA 3OW4A 5DI1A 2QOOA 5CU3A 2UW7A 2ACXA 3KRXA 4H1JA 4RFZA 3REPA 3W18A 4AZWA 4E6AA 3DU8A 4EH3A 3A99A 4QMUA 4XHKB 3NUYA 1PMEA 5BVEA 5FBNC 3WZUA 1Q24A 2ITNA 5KCVA 4BTMA 1YKRA 2ITPA 4A9TA 4F6SA 3GT8A 3NAYA 1SYKA 5ICPA 3N4VA 3KKVA 5JK3A 2VD5A 3MB6A 3LM0A 2PYWA 2YDIA 4I6LA 3UDZA 4D1XA 4H3BA 5AR7A 3HEGA 3CY3A 2ZM1A 2Z02A 3QTUA 4PP7A 2JFLA 2R3PA 3M1SA 4JDJA 3BE9A 4IBMA 4XMOA 3MWUA 4XRLA 1KV1A 3P7BA 3PVGA 4C0TA 3FXZA 4FZ7A 1CTPE 3POZA 4FT9A 1XWSA 3R9DA 3KREA 3ZS5A 1UKHA 4B8LA 3C4FA 3CEKA 2QO2A 4UX9A 5HE3A 4BCGA 4AW5A 2J51A 4YPSA 3ZBFA 3R9NA 3F3ZA 3MBLA 3QHRA 4AGWA 2IEWA 3LFAA 4OAVB 4IAAA 3SXRA 5FEDA 3RM6A 3Q4CA 3OOGA 3KVWA 3KY2A 4XBRA 4BTJA 2UZNA 3DB8A 4CTCA 5HZNA 2UUEA 5G1XA 4RG0A 5DG5A 5AP1A 4LOQA 4CG8A 3PY0A 2XB7A 3AD4A 3DJ5A 3AC2A 4IQ6A 2XANA 3SAYA 2J7TA 1YOLA 5HNIX 4E6CA 5B0XA 2X7FA 3PLSA 4NM3A 3L9LA 4FI1A 2BRGA 3PA5A 3HLLA 3A7FA 5CSHA 2H34A 4BCFA 5J9LA 1SMHA 4X3JA 1OGYA 4QMSA 2BHEA 3EKNA 3TV4A 3EN7A 1JBPE 2E9OA 2I40A 2OBJA 3BYOA 3LXLA 1Z57A 2P0CA 4GRBA 5JFVA 5M4CA 5BQ0A 3AT4A 2WB8A 2CJMA 3V6SA 4IFGA 3QGYA 2XKDA 5T3QA 2HENA 2JKOA 3LMGA 4U44A 3TNQB 4IX6A 2WFYA 2FGIA 4BDFA 2REIA 5AEPA 3ZFMA 3P9JA 4XNEA 5DBXA 3ZRKA 3EFJA 5L6OA 4DEGA 2W5AA 4U81A 3ZDIA 3W2RA 4EK5A 4O91A 2XYUA 3KXXA 2VWUA 4IDTA 4LG4A 3WZKA 1OKWA 4CKIA 3E88A 4UWCA 5AP0A 5E8TA 4FKPA 3VBQA 4D55A 4IM3A 4EBVA 4O4FA 1KSWA 5FP6A 5IF1A 3W16A 2W1HA 2YM4A 4HGTA 3SW4A 1YOJA 4HZRA 3AMAA 1ZRZA 4F9CA 3QXOA 5C03A 3UBDA 3MVHA 3BBTB 5J95A 3OF0A 3NUAA 3LCSA 2YM8A 2I7QA 2PWLA 3ORTA 4E8AA 5E7RA 3HYHA 4GJ2A 1HCLA 3OHTA 2OZOA 4GG5A 4BDKA 5EHLA 2WU6A 5D7AA 3QD4A 2O2UA 3KEXA 5CF8A 4Q2AA 2UVYA 3HDNA 3NIEA 4FT5A 3LAUA 3TNIA 5E8UA 5EW9A 5KZ0A 3UVPA 4QPSA 3GOKA 2YIWA 3HP2A 3QRJA 3QTZA 4P2KA 3QRUA 4K1BA 4H3QA 4KKGA 5TR6A 2XEZA 3UO4A 4DGNA 2VU3A 2JDOA 4NM0A 3PWDA 1JQHA 4ZP5A 5IQEA 4X2KA 2CN8A 5CS6A 1F3MC 4EH6A 4KIKA 2JKMA 2B9IA 4JG7A 4MVFA 4AW2A 4AZTA 4I5PA 3V8TA 4DINA 2JITA 2Z8CA 5J7HA 2R7BA 4IM2A 3PXQA 4UMUA 3U87A 1U54A 2HY81 3H4JA 4IJPA 3UOHA 5HX6A 4AQKA 3MSSA 2YAKA 1Y91A 3QCSA 3UQCA 5DR9A 2J0IA 3OEFX 4W4WA 4XLVA 3MPAA 5HICA 3VRZA 4A06A 4YTFA 1H28A 4JBQA 5L2IA 3F5PA 3QKKA 3HGKA 4AXEA 3NCGA 2RF9A 5B7VA 4CZUA 4UMTA 1XR1A 4C4FA 3UO5A 5ANOA 4RZVA 1R0EA 4XV2A 2QR7A 2Y4IB 4AGCA 3D7TA 1ZZLA 3R28A 1QMZA 4Y8DA 2G9XA 4ZS4A 1I09A 3FL5A 4WNMA 5LVPA 5B2MA 2E9UA 2CGVA 3DAJA 2P33A 3HP5A 1O6KA 4M12A 5A4TA 2VTNA 4OT5A 3UQFA 4N57A 4KNBA 3KK8A 3BHHA 4PL5A 4XG7A 4FA2A 4BCOA 2HZ0A 4G6LA 5AUYA 4DFZE 3A7HA 5AUVA 5ANIA 3WARA 4HNIA 2J6MA 4GJ3A 2IO6A 4MKCA 1OL5A 3D9VA 2B4SB 4L67A 5I5ZA 2W7XA 5TO8A 4WHZA 2GNFA 3UIBA 2UVXA 3UVQA 4KABA 4AA5A 4LGDA 3T3VA 5CAUA 2XEYA 4ENYA 5KMJA 2VTLA 3MTFA 3HKOA 4L00A 4RC3A 3RAKA 4XUFA 4EWHA 1R3CA 2R3OA 4JBVA 2AC3A 3UYSA 3ZEWA 2IVTA 4U6RA 4PTGA 2XZSA 4OUCA 3F7ZA 3ALOA 1XHAA 4NUSA 2VN9A 4ZY6A 3AGLA 3ZM4A 1WBVA 4H36A 5HCZA 1JSVA 4A9YA 3SXFA 4QMOA 2XKCA 5IQBA 2Q83A 3FC1X 4EOPA 2QQ7A 3MPTA 2PZYA 3EHAA 3QRIA 4FTKA 5JN2A 3G9LX 5K3YA 2OXYA 3JXWA 5EKOA 3WF6A 2BAJA 1OPLA 4KIQA 2VTAA 3OWLA 1W0XC 5K0XA 1UVRA 2B7AA 4HVHA 4WIHA 5F94A 2F7EE 3SG8A 2W1GA 5KKRB 2FSLX 1PMVA 3G6HA 3DAKA 4IHPA 4L68A 5CTPA 4WG3A 2C5VA 4NH1A 3UIMA 4FR4A 3CTHA 4ZJVA 3V5PA 1DAWA 2HW7A 4FIEA 1H1PA 4O38A 2UZEA 4RC2A 3ZTXA 4RZWA 5BYYA 1L8TA 1R1WA 3PP0A 2X2MA 4D2PA 3FMKA 3LFNA 3I60A 5ANJA 4E1ZA 5GNKA 4DBNA 3FI4A 3CS9A 2JIUA 3ITZA 4IM0A 1XMMA 5CVHA 5GJFA 2B55A 5LWNA 3QL8A 2FA2A 3DY7A 3Q9ZA 4BJJB 3BLAA 4OTDA 3EQRA 3LCTA 4O7LA 2C3KA 4PF4A 5J9YA 1WCCA 2UZWE 3OCBA 4C3PA 5L2WA 1NVRA 4FKWA 5AV2A 3VF8A 4L53A 1ZARA 2CNVA 4E93A 5ANEA 2BRHA 1BYGA 2HAKA 1YXSA 4HYUA 4EI4A 4F7SA 3R30A 2C0IA 2VWXA 2W1IA 4PL3A 3O2MA 4GFMA 3HV4A 2BAKA 2NPQA 3CJGA 3KC3A 3Q4TA 4PMPA 2B52A 3G90X 4AT4A 3UG2A 2HW6A 4BYIA 5DT4A 2OWBA 3QKLA 3TG1A 3P23A 4FF8A 1PXIA 2XKEA 2YABA 3HRCA 3ORNA 4IIRA 2UW8A 4K33A 2AYPA 4R8QA 4RJ3A 5DWRA 4C36A 3UNKA 4FV7A 4HOKA 4IZYA 3RAWA 2BRMA 2C6IA 4HNFA 4QD6A 3DZQA 3EN4A 3H9OA 5J5TA 3P7AA 5HG9A 4ZY4A 4FEUA 4FX3A 3EH9A 2P2IA 4DFUA 3L9NA 2VO3A 2X7OA 3C7QA 3UOKA 3G9NA 3W0PA 3ROCA 4BC6A 3NW7A 3FZOA 2PE0A 3O5AA 4D0WA 2H96A 3DBDA 3IOPA 3PY3A 1U4DA 1YDSE 4O27B 4QYYA 4UN0C 4DT9A 4ERKA 4L45A 2BZIB 3FC2A 3DZOA 4AG8A 4BCIA 3JY0A 5K9IA 3ZSGA 1OIYA 4YC3A 4AGDA 4IAKA 1W83A 3EWHA 4RLKA 4E6DA 2P3GX 4IANA 4V01A 4LRMA 3FLSA 5AM7A 4YSJA 2WTKB 1OECA 5HGIA 3QUPA 4RWIA 4EONA 4QMTA 3QLFA 5KX8A 3QA0A 4OR5A 5IH6A 1U5QA 5CEKA 5HEZA 3R9HA 4AZVA 4G3FA 4ANLA 2BMCA 4RRVA 2YACA 5D9HA 2YN8A 5L6WL 3EQCA 3OBGA 3SDJA 2EXMA 4DC2A 5JMSA 4BDHA 4J71A 2XNPA 5CANA 2YJSA 3OWKA 3V01A 3A62A 3EOCA 4JDHA 2Y9QA 4BDGA 3ORPA 4DCAA 4Y5HA 1CKJA 3GU6A 3KU2A 1Q8UA 3PZHA 3O7LB 4B9DA 4BKYA 3LJ0A 3QWKA 4EH9A 4WOVA 4F65A 2CKQA 4MAOA 4R3PA 5IMXA 2QC6A 4ZZMA 1UWHA 1GIHA 1GY3A 2PVYA 2X81A 2Z7QA 3F5XA 3FMMA 3ANRA 3KCFA 4LMUA 4YO4A 4YHFA 3ZYAA 5J79A 4X7QA 4RX7A 3FZRA 4YLLA 3U51A 4CRLA 4DG3E 1FVRA 3BQCA 3QX2A 1YW2A 3NEWA 1XBBA 3QZHA 4MK0A 5KBRA 3HMNA 2AEGA 4GVJA 1LEZA 1RE8A 3FQHA 5EDRA 4JDIA 4CT1A 2PPQA 5LVOA 4WBBB 5BVOA 3BEAA 4RIXA 3M11A 5AAFA 4CFUA 3GCVA 3IKAA 3OMVA 3CPBA 4QPAA 3FLZA 4D5HA 2W4JA 4AT5A 2CNUA 3FE3A 4B0GA 5ANKA 4I41A 3ZUVA 2XARA 2HIWA 3N9XA 4M69B 4P5ZA 4EH4A 4IE9A 4AN9A 4GCJA 3L9PA 3VS6A 5GZ8A 3PJ3A 4EZ3A 3P08A 3VF9A 3ZFYA 5AV4A 3BL9A 4ZTHA 2CGWA 3P86A 3VQHA 5EM7A 3WIKA 3ATTA 3UJGA 3CTQA 1V0OA 2C47A 3CGFA 4F7JA 3Q6WA 2HXLA 3ETAA 4NCTC 5E4HA 4IAYA 3QQUA 4APCA 3F2NA 3LFCA 5IPJA 3E8NA 3WYXA 4A7CA 4EK3A 5ACBC 4CV8A 5L6PA 3LCKA 4WA9A 2PU8A 4Z16A 2XK3A 4TWNA 3QQLA 3OUNB 2BPMA 4YGAA 3DB6A 3WBLA 3ODZX 1SNUA 3F5GA 3ORMA 3VS3A 1WBSA 2WD1A 1H07A 5E90A 4LOPA 2G2FA 2ZB0A 3KF7A 4TKSA 1NW1A 3QCYA 4G3GA 1IAHA 3UMWA 3NYVA 5KO1A 4E4LA 3FY2A 4MNFA 3T9TA 3SOCA 2OIQA 4X3FC 5AJQA 3TT0A 3SRVB 5IH5A 4AXCA 4EEVA 2GHMA 4YBKA 3NFFB 4NW6A 2Y4IC 1VJYA 3FJQE 1YI4A 2CPKE 2VTIA 3R63A 3VVHA 3P5JC 5CX9A 1W2CA 3R8LA 3SA0A 1E1XA 3ORLA 4H39A 2R64A 4E7WA 1U59A 4PTEA 4XV1A 5CU2A 4Q5HA 4DEIA 4WUAA 5AP2A 4HW7A 4OTIA 2R3RA 3GU5A 4QP4A 1NY3A 4O7TA 3C4ZA 4UALA 4R78A 4RIYA 3D7ZA 4O81A 2X2KA 4J53A 5FP5A 4EOMA 4F09A 4J52A 1XH8A 4QQCA 5EHYA 4C33A 3C13A 2C69A 4JR7A 3UE4A 1WBOA 1G8SA 1A48A 2XS0A 1YWNA 4GL9A 5CY3A 2B53A 3E63A 3SX9A 1ZMUA 4USDA 4HVIA 4UYNA 1SNXA 4Q5EA 5IEVA 1M2QA 4G2FA 3A8XA 5DRDA 3D94A 4K0YA 4BZOA 3ULZA 5LVMA 3BGZA 3SOAA 4R1VA 4E20A 4DHZA 3KIOC 1F5QA 2WO6A 4PRJA 3AC5A 4O2ZA 4D9TA 4FGBA 5I9VA 3KMUA 3QLGA 5IQDA 2WQMA 1ZMWA 2ZYBA 3BWJA 4QTBA 3ZDUA 3O71A 4GFOA 4MUQA 3ROYA 4DHJA 4EHGA 3C0IA 1VYZA 4I5CA 5KMOA 4X6QC 2IZTA 5JEBA 1ATPE 1H0WA 3SC1A 4EC8A 3E5AA 5D11A 5K5XA 4PX6A 2XNBA 1W98A 3MS9A 1IASA 2W96B 3ZO1A 2Y6OA 4R7BA 3F2AA 3AKKA 3ODYX 4FV0A 3LLTA 3MY5A 5A3XA 5AR3A 1H1SA 2OH0E 3AG9A 3V5JA 5D1JA 1UKIA 3QQKA 2OF2A 4FSUA 3NW6A 4TZRA 4Z9LA 5JRSA 4EK6A 4RPVA 3ERKA 4BGHA 1DI9A 3BGPA 3K3IA 3UG1A 5AX9A 2F2CB 3L8VA 1FQ1B 5DT0A 4E3CA 3U54A 3VN9A 5HCYA 5HE1A 3QD3A 1Q8ZA 3E62A 4TWPA 3FL4A 3V04A 2BZHB 5ANDA 2WQBA 4FTAA 4C57A 2XIZA 4DEBA 3KXNA 3PXKA 4C8BA 4OTFA 4F64A 5IA5A 5AR2A 4DH5A 2W9ZB 3KRJA 4WSYA 4EUUA 3A7GA 4CSVA 5EQEA 3FMLA 3W2SA 3IECA 4Y83A 4C4GA 4MBLA 4YJPA 3R02A 3VAPA 3OXIA 1UU7A 4Q9SA 1XH4A 2BZJA 4PDYA 4QO9A 4TT7A 4IX5A 3DDPA 3LXNA 1TZDA 1XH7A 2OI4X 2E9PA 4M84A 4NSTA 2BALA 4QP2A 1DS5A 5DHJA 3ZU7A 3C9WA 4RIOA 2YHVA 2B9JA 3UNZA 2XM9A 3O51A 5J5SA 1RDQE 5AP3A 3AT3A 2C6DA 3ZOSA 3OXTA 4ZZOA 2PK9A 3EQFA 2X0QA 3BQRA 3ZSHA 2GMXA 1PW2A 2B54A 4D2SA 2VO0A 2W1ZA 1WBTA 4AOJA 4DTBA 4ANOA 1H1QA 1JPAA 1R0PA 3D14A 4V05A 5JQ8A 3H0YA 4ZJJA 5GZAA 4IWQA 1PYXA 3KA0A 5K5NA 2R3FA 2XUUA 4XP0A 5DE2A 2C6KA 3I4BA 1P4FA 3GUBA 1P4OA 3ZLXA 5H2UA 1PXJA 4QQJA 4BIEA 5FTGA 1OZ1A 1Z9XA 2OF4A 3NWWA 4JRVA 3G2FA 3HMMA 3QFVA 1SVEA 4AACA 4AFJA 4YSMA 4C62A 4UZDA 4USFA 1OUYA 4EHEA 3TUBA 1H27A 2QOCA 2IJMA 4L7FA 4I23A 4L3JA 4FL2A 5HLNA 3QALE 4KRDA 4ZJIA 3DBCA 5EK7A 4L52A 3C4XA 3WF8A 5CAOA 4BGQA 3PSCA 2CGUA 3LQ8A 5L8JA 4L44A 1ZY4A 1ND4A 5JFXA 4U40A 3NGAA 3WF7A 4C61A 4Z7HA 3PE1A 4V0GA 4JBOA 4MXXA 4BDCA 1CDKA 4UMPA 4Y46A 2ITQA 5IA1A 3TYKA 3UDTA 3ALNA 4QDEA 3C4EA 2I6LA 3IW5A 4UWYA 4FK3A 4Y5QA 3GU7A 1JKLA 3GFEA 3QGWA 3OFMA 2ZB1A 4H05A 2F9GA 2GCDA 4KKEA 2IW8A 5A6OA 1H0VA 3WILA 4C37A 3WOWA 4DHIB 4BBFA 2PVFA 4QQTA 2I1MA 3CPCA 4RWLA 3FLWA 2UW9A 2EB3A 3ORXA 4FSNA 4J97A 3VULA 3JS2A 5DEWA 4DG0E 2EU9A 3R73A 3ML1A 3EN5A 5A4LA 2VTRA 5CSWA 4CV9A 4GK3A 3ZSIA 3DPKA 3KGAA 4H1MA 4ZMEA 3Q4UA 4MXZA 1OKYA 3HRFA 3BLQA 3I6WA 1UA2A 1VLRA 4JIKA 4AA4A 1WVXA 1H4LA 3NR9A 2E9VA 3PJ1A 2GTMA 2WHBA 2WTIA 4GH2A 4D0XA 1XH9A 4C2VA 3GBZA 4HGEA 2ITOA 5DYJA 1Q62A 2ONLC 4FL3A 3ZRMA 4NYEA 5M09A 2KULA 5LMBA 5HG5A 4ALVA 3EFLA 4FTRA 4F08A 1O6YA 3EQBA 4LRJA 3II5A 3MPMA 2OSCA 4FVPA 4MTAA 5HTIA 3D4QA 5I9YA 5CT0A 5HLPA 1PXOA 1K3AA 3BHUA 3U8WA 4RFMA 2E9NA 4F6WA 1BL7A 3LFEA 3PIYA 5DFPA 1KE7A 1K2PA 4BDJA 2Q0NA 1BI7A 4UMRA 3FQSA 2QOFA 1WMKA 4DAWA 3BU3A 2XCKA 1PKGA 5CT7A 3VUDA 3QUEA 1A06A 4D2VA 3ZH8A 2UW0A 4LM5A 1PHKA 4YZMA 2HXQA 4Q9ZA 3F5UA 4CFMA 3KRWA 3W10A 5FGKA 2QI8A 3GCPA 3VBTA 4C4EA 4TPTA 4RIWB 2GU8A 5F95A 3F82A 2BFXA 3OUKA 4YLKA 1REKA 4KA3A 4N6YA 4M67A 4FTJA 2Y4PA 2VTQA 2XVDA 1YXUA 4NKSA 4C4IA 4F0GA 2B0QA 4IWOA 3GC0A 2VZ6A 1SVGA 5HHWA 1T45A 4DTKA 5JGAA 5KNJA 3QD0A 2PVNA 4BB4A 4W4XA 1W84A 2W4KA 4F4PA 5FUTA 4RWJA 3LQ5A 4IB5A 4ZSGA 5AAGA 4I0SA 4ERWA 3I6UA 5EW3A 4BJJA 4BCHA 1OI9A 3GCUA 4KS7A 3QU0A 5HOAA 3ZO4A 4AGUA 4ZLOA 2WXVA 3LVPA 4W4YA 1XMLA 3SXSA 4NM5A 4O0RA 3VBXA 2WKMA 3W0QA 2UZVA 5GINE 5H9BA 3VS4A 1W82A 4WBOA 5M55A 3EL7A 4I0TA 3T8OA 3UNJA 2F57A 2W1CA 2GQSA 3LJ2A 3Q04A 2UVZA 4EYJA 3EN6A 5IDPA 3H9RA 5AUZA 3PJCA 2J90A 3HMIA 2YWPA 3QHWA 2X39A 3FYKX 4AXDA 3IK3A 5CQWA 1O9UA 5CEPA 4RIXB 4EQCA 3WZDA 2X6EA 3VHEA 3E7VA 1WZYA 2PZPA 3NYOA 4JDKA 1J7LA 1WBPA 4YZCA 4C4JA 1ZOEA 5E8VA 2A98A 5ACKA 4U97A 1UV5A 5CWZA 5JRQA 4DA5A 4TW9A 3ZO2A 5GIPE 3PG3A 4R3RA 4U3ZA 5FEEA 4F99A 4GUEA 2RKUA 3LFSA 5CEIA 3NSZA 5D41A