3BLHA

Crystal structure of human cdk9/cyclint1
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
318
structure length
291
Chain Sequence
VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVEKEGFPITALREIKILQLLKHENVVNLIEICRTSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYLVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 9
publication title The structure of P-TEFb (CDK9/cyclin T1), its complex with flavopiridol and regulation by phosphorylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 78
structure length 291
sequence length 318
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3blhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3blhA01
3EL8A 3LKMA 2Z60A 3IW4A 3COKA 4ZTLA 4UWBA 3TDWA 2WTJA 3JY9A 2WIHA 4D2RA 3UVQA 2YDIA 3DA6A 3LFFA 4ENYA 2C68A 1UA2A 2XF0A 3O23A 1JKSA 4ALWA 2O0UA 5HIBA 3F7ZA 4HZSA 2WMAA 3O7LB 2R0IA 3QBNA 3O8UA 5EM5A 4BZNA 2XIYA 5F95A 2V62A 4U5JA 4F08A 3F69A 2J6MA 3HV3A 3HP2A 5HG5A 3F6XA 3M1SA 4FYNA 4YUQA 5E90A 4YSJA 4R5YA 3ZEPA 2UZBA 3A7IA 3F3WA 3ROYA 4FKIA 5KKRC 3RHKA 1BYGA 3RZBA 2XUUA 4I94A 3UBDA 3W1FA 2YHVA 5HCYA 4BCJA 3R2YA 3QCYA 5E8SA 4FVRA 5IKWA 4QP1A 2BRHA 4PPCA 3NAXA 4D1SA 5K4JA 3TL8A 3C0IA 2WU7A 1MRVA 5FRIA 4E5AX 3UODA 3QCXA 4LV8A 4FT7A 4ZZMA 5CU6A 1YWVA 4F0FA 2JDSA 2W5BA 2WTCA 4XOYA 3T9TA 4EOKA 4R77A 4QTCA 2C5VA 2ZV2A 4LL5A 3PIXA 4FTLA 4IB1A 2WU6A 5AX9A 2XNPA 2QURA 3FI3A 1M2QA 3E62A 4DTKA 2ITQA 2WMXA 4HCTA 4PP7A 4BCMA 3HLLA 3OBJA 3QX2A 4QMZA 3PVGA 2V0DA 4FTOA 1M17A 3JY0A 1PXIA 4J99A 2UW4A 5I9UA 3SRVB 3IQ7A 3R0TA 4TW9A 3RP9A 5E7RA 3SW4A 3FLWA 4AOIA 3S00A 5JFXA 3KC3A 3U9NA 4RLKA 1OIRA 3ID6C 4NKSA 2ERZE 1TKIA 2QODA 3FMDA 4NM0A 4CFWA 3RMFA 3AC3A 4U40A 2EU9A 2XNEA 5LOHA 2VWYA 3QRKA 4G5JA 2Z2WA 2YWVA 5KMIA 3H9OA 4WA9A 5L3AA 4I6BA 2JKMA 2PVRA 4U9AA 4ANQA 3MYGA 1BL7A 3C4FA 2HOGA 2DQ7X 4KINA 2HW6A 3AC1A 4M69B 3FZOA 5ETFA 3FUPA 5BUEA 2G2FA 4Z9LA 3VBQA 2OZAB 5EM8A 3DBCA 5HNBA 4EQCA 5GIOE 4F1TA 2XEYA 4AA0A 5KMJA 2BFYA 4USDA 5EM7A 4FSUA 3BIZA 4C8BA 3FKLA 2C6EA 2R4BA 3VQHA 2QC6A 5T6KA 5M07A 4BIBA 4WG5A 3LHJA 4AN9A 3H30A 3OT3A 4ASDA 1UWJA 2F2CB 3R02A 3FY2A 3OCTA 4R7IA 5FD2A 1Q3WA 5EOBA 3U54A 1H07A 4CFNA 3GEQA 4UXQA 1Q8ZA 5LVNA 4S32A 4PY1A 1ZOEA 4CMOA 4FZ6A 4KS8A 1OIYA 4X3FB 4F9AA 3MPMA 4J71A 2YM5A 5M55A 4YJTA 1WFCA 3DDPA 1R0PA 3E3PA 2A2AA 2CMWA 4UYNA 5DI1A 4DG0E 3ZXZA 4W8DA 4HPTE 3KK8A 4YJUA 4IACA 3UC3A 4MAOA 4KKEA 2YCRA 5HG7A 3UJGA 3PPJA 3W8QA 3BYVA 4BCFA 4QQJA 3BYSA 2EVAA 5AP6A 4QQCA 5C4LA 3P08A 1NXKA 4E73A 1ZAOA 3LFAA 3PVUA 4RVMA 3D15A 4L45A 5E8WA 3UOHA 3VS7A 2WFYA 1E1XA 1XBBA 4KBKA 3Q96A 4I0SA 2R3OA 3PY1A 4LMNA 3R8UA 1PYXA 3UO5A 1FINA 3KRJA 3HUCA 3PVBA 3W32A 2W17A 5JK3A 2P3GX 4JG6A 1YHWA 3ENHA 3R73A 4M13A 4CFVA 3BEGA 1GJOA 3GT8A 5AUWA 4DGMA 3LLTA 5CSPA 3E87A 2ZV8A 1IEPA 3R30A 4FTAA 4ACDA 4F1MA 5ETIA 4OAVB 4XV9A 4R7HA 2FVDA 5AV3A 1KE9A 4CLIA 4BZDA 5K4IA 2P4IA 1W98A 4DFYA 4ZJIA 4YNEA 4ID7A 2W1EA 2X0GA 3MY1A 4C33A 4ANMA 4YR8A 2YAAA 1ZYJA 5LXMA 4MF1A 2WELA 4AE9A 4RX8A 5AP5A 4TWCA 1CMKE 1LUFA 4RC3A 3O17A 5I4NA 4FNYA 2ZJWA 1YRPA 4R3PA 5KNJA 2C5YA 1OPKA 2HXQA 3EQBA 3NCZA 3R1SA 4JDIA 4NWMA 3ZMMA 3R7YA 2WXVA 4FSWA 2FSMX 3HMPA 5DR9A 4FV4A 2XCKA 3CJFA 4RMZA 4X7QA 3WF5A 3HEGA 2IW8A 3QTIA 5G6VA 2Q0BA 4QMXA 3R04A 4I0TA 4M69A 2OFUA 3FSKA 3WI6A 1V0PA 2UZLA 2OKRA 2LAVA 4BWXA 4FNWA 4XG9A 4B7TA 2GTNA 1IA8A 2OZAA 2YABA 4L7SA 5GJDA 3UPXA 5CF5A 2V7OA 3IS5A 3QKLA 4FV3A 5FTOA 4OT6A 4FKGA 3FLZA 4CYJA 4FTNA 4RWLA 4XOZA 2WMVA 4F7JA 1M7NA 3RAIA 2QO7A 3OS3A 1FBNA 1MRYA 5KX8A 2J2IB 4H1MA 2XB7A 4D9UA 5GINE 1W7HA 1PXKA 3A7GA 3P1AA 4JR3A 2YIXA 3HA8A 3RALA 3W2CA 3MY0A 2GDOA 3RTPA 3ORIA 1DM2A 2E9NA 4BFMA 4HVDA 3I0OA 4S33A 1ND4A 3LMIA 3FWQA 3C5IA 3UG2A 5HLWA 1OBDA 2J0LA 4RIOA 2OIQA 5IA0A 4MVFA 4XG7A 3N4TA 4FV9A 4X3FA 4AZTA 4A4OA 2PZRA 4FZDB 5TE0A 5GJGA 1OPLA 3NIEA 1J3HA 4ZP5A 3JS2A 1XQZA 4BDDA 4XEYA 5CVFA 3RAWA 5J1WA 4KNBA 4F09A 1H26A 3DDQA 2HWOA 5HVYA 4QP9A 1M14A 2GFCA 3CLYA 3V04A 5CALA 5IQDA 4O2PA 4J52A 4EBWA 1Q99A 2BDWA 1XBAA 3ORLA 3E7VA 4OAUC 5IQAA 2OXXA 2R3QA 4NK9A 5IG1A 3QC9A 3IGOA 3MIAA 1WBSA 1H4LA 4RZVA 2OZOA 4ITJA 5F9EA 2BIKB 3KN6A 4IVCA 4YZBA 1U54B 5J95A 3UOJA 2XA4A 3V3VA 2ITPA 5B0XA 4TRLA 2CCHA 4NM7A 4KIQA 4PX6A 3VC4A 4A9TA 5KZ0A 4ZZNA 4MD8E 1KSWA 1KV2A 2GS2A 3GGFA 4FGBA 5GHVA 3AGLA 3B8QA 2BDFA 4MXYA 5ANEA 4EOIA 2R3NA 1PKGA 2JEDA 4B8LA 5AUXA 2C3KA 3LIJA 5HU3A 1QPJA 3MGYA 4FV5A 2C3LA 3QYWA 4GL9A 3A61A 4IZAA 2ITXA 2PY3A 4V05A 4IANA 4NM5A 3COMA 3RAKA 4GK2A 4CT1A 2OSCA 3LJ2A 4G3CA 3FAAA 2B55A 1IR3A 5HORA 1GZOA 4TWOA 4MBJA 1O6LA 3TUCA 1OUYA 3GXLA 2ZM1A 3IK3A 1ZRZA 4EZ7A 4ONAA 2E9OA 3Q9WA 2R3LA 2ITYA 5CAPA 4PDYA 3CCNA 1BI8A 3WIKA 4DTAA 4AXAA 4RSSA 5CF6A 5FQDC 3D7TB 4BBEA 4W4XA 3LPBA 2CGUA 4E7WA 1PF8A 4EBVA 3KFAA 4Z7HA 4D4YA 4Z16A 1W83A 2YM8A 2OU7A 3ORTA 2W1HA 4XUFA 3PJCA 3W2QA 3TUBA 2PUIA 2AYPA 1S9JA 3QLFA 4DFNA 4FA2A 4MEDA 4EC9A 1H8FA 1CKIA 3KXNA 4UWYA 2C30A 1F0QA 2XRUA 2VX0A 3VQUA 3WE4A 3WILA 4EONA 2PUPA 2QHMA 3DXQA 4HYIA 4P90A 5IA1A 3EZVA 2C3JA 3R00A 3RPSA 4L3LA 2IWIA 3KULA 1R1WA 3O51A 2QQ7A 4YPSA 1LR4A 4AGDA 1H0WA 3QA8A 4N4SA 5AR7A 4FT3A 5I9VA 3BI6A 3VRZA 2F49A 3AT2A 4DFXE 4EHZA 4FSYA 1ERKA 2UZNA 3AXWA 2IZSA 3PE2A 3TM0A 2B7AA 2REIA 4NJ3A 3G9NA 3NNXA 4I6QA 5M4IA 1GNGA 3D5UA 4I6HA 3ZLWA 3BCEA 4RVTA 2GCDA 3OD6X 2X4FA 2RGPA 4MTAA 1URWA 1JBPE 3SXSA 3T8OA 3F5XA 3LLAA 3ZFXA 4Q9ZA 4FGRA 3IECA 4M7IA 4PP9A 2IO6A 1K2PA 2NPQA 5ANJA 3WF9A 5JZJA 1PMUA 2WMTA 5KE0A 4QP7A 2OIBA 5TT7A 4KIPA 2W5HA 2I1MA 3L8VA 3TEIA 3A2CA 4FKOA 4FNZA 3QL8A 2PVJA 3QUDA 5BYYA 3BELA 2FA2A 3SV0A 4M15A 4C38A 4EEVA 3BLQA 5DWRA 3ZSGA 4EOLA 3QTSA 5EYKA 5DA3A 4C34A 3R1NA 4U7ZA 4RC4A 4L46A 5CQUA 2YIRA 4LI5A 4BWPA 4IEBA 4PNKA 5ETCA 4BDAA 3MVLA 3G15A 3PJ8A 2W1CA 1UNHA 3WZEA 3FL5A 4GSBA 4JX7A 5DEYA 2O5KA 4G9CA 3CXWA 2ITNA 5FBOA 4RZWA 5T68A 2FSTX 2X2LA 4U3ZA 4FEVA 5DBXA 2H8HA 4TYJA 2WMQA 4DG3E 4GV1A 4YC6A 3SKCA 4EUTA 4NIFA 1YXSA 4Y73A 3PXRA 4FOCA 3NX8A 4UV0A 3LM0A 1OI9A 1UVRA 5ETAA 2NO3A 4B8MA 4PTCA 5DT3A 3U55A 4ZTSA 5E1SA 2C47A 3DGKA 2XCHA 4ASZA 4G34A 4QTEA 2EWAA 1UU9A 2FYSA 3QRTA 3RNYA 4EJ7A 4B99A 4I41A 3QXOA 3A7JA 4A07A 2RFSA 2UW8A 2X4ZA 3QGWA 4GT4A 1ZMVA 2CDZA 4H3PA 4RX7A 3D7TA 3UNZA 1S9IA 3ZC6A 1JKLA 1OITA 5DRBA 1XWSA 3CIKA 1HOWA 4A9YA 4FKUA 4EWHA 2O3PA 3BGQA 3NS9A 4IAAA 4D1XA 4FEQA 4JXFA 4BDJA 1OBGA 4RJ6A 5CEQA 3QTZA 5IQCA 3CTQA 4C0TA 3O71A 2PUNA 3BQRA 4ANSA 4BN1A 4OUCA 3I79A 3LFNA 4OTGA 4DH3A 4UMUA 5EYCA 3AMBA 5BNJA 4S30A 4TN6A 3VS6A 3ZO3A 2CNUA 5JGDA 5L6OA 3KXZA 4AX8A 2O2UA 3D7ZA 4ITHA 4QP6A 3TACA 4AW2A 3FC2A 4YJVA 4QNYA 4L3PA 3TNWA 3QGYA 4YJPA 5M56A 4AOTA 2YDKA 3QRJA 4LV5A 3VBVA 4E4LA 3L9PA 4MXAA 4JBPA 4EOSA 3K3JA 1JOWB 3GU4A 4GIHA 5IUIA 1J1CA 5D1JA 4BDEA 5KMKA 2ITUA 1ZZLA 3TJCA 2YAKA 4G5PA 3KY2A 1OL6A 2RFEA 4GU6A 5E8UA 4LGDA 5AMNA 2VWZA 2A1AB 1JLUE 1ZY5A 2GQRA 3I5ZA 3OY3A 2V55A 1V1KA 2KULA 3C1XA 3MVMA 2WKMA 5KZIA 1WZYA 4FT9A 4C36A 4C61A 3KA0A 3HV5A 3U9CA 2RL5A 3FQHA 3PA4A 4G17A 4HNFA 3W2PA 3FLYA 5CSHA 5M53A 5HLPA 2YISA 3OEZA 4EQMA 1ZYLA 4RX5A 5CEOA 5M09A 5F4NA 3HA6A 2C3IB 4F99A 1XH5A 1QL6A 1M2RA 2ZV7A 4EH3A 4ERWA 4ZY4A 4O7RA 3O50A 2W96B 4BCIA 3EKNA 4D28A 4JQEA 5HX8A 4HYHA 2RG5A 4FIGA 3DFAA 1ZARA 1G5SA 3DKOA 4BCNA 2GS7A 3NYNA 5HIEA 5AV1A 5AUUA 4XMOA 3GCQA 3V51A 3S4QA 5A4EA 5H8EA 2JDTA 4JIAA 3H0ZA 4AUAA 4F7SA 4TXCA 3L1SA 4XG8A 4NFNA 2VTLA 2JAMA 3ENMA 5CSWA 4BCKA 3HAMA 3W2SA 4U8ZA 3EL7A 2XYUA 3OC1A 3QQHA 3RK9A 1Y91A 4E4XA 3ORMA 2R3FA 4FTUA 5ANOA 4DFUA 3VIDA 2E9PA 1YVJA 3W18A 3S1HA 4HJOA 3PFQA 4LRMA 5AP1A 4HGSA 4KIKA 2YZLA 3GFWA 3QD3A 3W2RA 4UMRA 3LZBA 1SVHA 4BDFA 4DHFA 3IW7A 2PU8A 4HZRA 4X2KA 1O6KA 2HIWA 2WO6A 3DPKA 4QMPA 5BUIA 4F6WA 4LOQA 3D14A 2JKOA 4OBQA 4BYJA 5B2LA 4G9RA 3O8TA 3Q53A 4RC2A 4EKLA 1XH8A 3TXOA 4YJRA 3E88A 4C2VA 3D2KA 2GMXA 3H9RA 1OUKA 3LOKA 3QLGA 4OTHA 4RWIA 2FH9A 4RQVA 5BVEA 5HCZA 2H96A 3DU8A 4I5PA 4JDJA 1X8BA 4M14A 3VJNA 1O6YA 5CXZA 3TUDA 3CR0A 3U6HA 3MSSA 3UE4A 3LFSA 5AR5A 1PXLA 5HX6A 4TNBA 3BBWA 5JFVA 3MA6A 3O96A 4IH8A 2OI4X 3BHUA 5A6NA 3FQSA 4D1ZA 4MBIA 1KE7A 3UQGA 4YC8A 5KO1A 4IW0A 4WRGA 3LFCA 3ZBFA 5JT2A 4I23A 3V5LA 2ZAZA 3M2WA 4EH7A 5E92A 4EH8A 4XBUA 3F7WA 2BRGA 3QYZA 1TVOA 4WD5A 3HRBA 5EG3A 1F3MC 2ZM4A 5L8JA 3Q9XA 3PRFA 3A8XA 5D7VA 3R7IA 2VX1A 3LW0A 3HMNA 2V5QA 4ZMFA 4CNHA 5KHXA 2R64A 1H1RA 3P23A 3UIBA 3NW5A 2OJ9A 3HAVA 1NVQA 3VS3A 4H3BA 2BAKA 4RWKA 2A4LA 4ANOA 5TKDA 2G2HA 2BROA 3AMYA 2A19B 2R3GA 1OMWA 3AC4A 3FYKX 2FO0A 4JQ8A 3FLQA 3DBQA 4U80A 5AM7A 3G6GA 1J7IA 5LARA 2BALA 2OBJA 4LOPA 3WZJA 4O81A 3KEXA 4QPSA 5EM6A 5EYDA 4Z3VA 4E8AA 5DT4A 1UKIA 2JD5A 4I20A 3HZTA 4AN2A 1CSNA 3R8PA 4S34A 2R3JA 5BVNA 4DGOA 5IH4A 2WTIA 4ARKA 4IB0A 5A4QA 5IA5A 3VJOA 2VUWA 4NH1A 4MXOA 3TZ9A 1Q5KA 4O22A 2PWLA 3OOGA 4DH7A 3FMMA 3FPMA 2J5FA 4TPTA 5JSMA 4BI1A 3QZIA 5FXSA 2F57A 4FKSA 3HECA 4IBMA 3HL7A 4ZSGA 5EDQA 4CRSA 5LMKA 3U6JA 2C4GA 3MBLA 5JRSA 1UNGA 2IW6A 5HNGA 3ZUTA 1AGWA 4LUEA 2X8DA 5EHYA 3R9DA 3WZKA 1JPAA 2CLXA 3ORNA 3G5DA 5FM3A 3UYTA 4QMUA 1VEBA 5A46A 5J1VA 5IQGA 3LVPA 4TNDA 2Y4IC 4I6FA 2JGZA 1L3RE 4BBMA 2W1DA 1OKWA 5AADA 4I5HA 3ZYAA 2OFVA 4XLIA 5D41A 3GOPA 1Y6BA 5HO7A 3E8CA 3NPCA 2I0YA 3KMMA 2PMIA 3IGGA 4J8NA 4UMTA 2XP2A 3ODZX 3LMHA 3NCGA 3MVJA 4JR7A 3BU6A 3OOMA 3PUPA 4OTWA 4NW6A 5DT0A 1ZMWA 3HVCA 5IEYA 4BCQA 3R01A 1H00A 3VVHA 3WF7A 3ACJA 4MD7E 4JI9A 2WTDA 4CMTA 5CU0A 4QYGA 1UU3A 3UIXA 4AOJA 1T46A 2CGVA 4F6UA 3DLZA 4JJRA 4EYMA 3K54A 3JVSA 4N6ZA 3D83A 2B54A 2F2UA 4DT9A 5FTGA 5HESA 3V6RA 2ZV9A 4E5BA 2VGPA 4UALA 4AZEA 3LCOA 3Q3BA 3CBLA 3KXGA 4CQGA 3NVKI 4L6QA 3VUTA 2G9XA 4OW8A 4BI0A 3DZOA 4FV0A 1H25A 4DLIA 3U4UA 5TO8A 2C69A 3ODYX 2IZUA 4M84A 5AEPA 4O7VA 5HD7A 5CAVA 4WOVA 4FUYA 2YERA 3FHRA 5M51A 5BVDA 2QOOA 2XIRA 3LMGA 4G3EA 3W33A 2VNYA 2OJFE 2GQGA 3F3ZA 4XG4A 1PMEA 3MH1A 4FYOA 4E20A 4NU1A 4BGHA 5FWKK 3W8LA 3UMXA 2JDVA 5HBJA 4KRDA 1WBVA 4F70A 3LFQA 5EQPA 1K3AA 4HVGA 4RQKA 5H8BA 2X7OA 5FEEA 4XRLA 3IKAA 1UNLA 1XH4A 2VWXA 4PDPA 2CKPA 2HYYA 1JSTA 2P0CA 4PMTA 5FP6A 5LWMA 2FSLX 2VTQA 1U5RA 2HCKA 2XMYA 2JIIA 3IW6A 3UNJA 5E4HA 4MXCA 3SHEA 2QLUA 4V04A 5IF1A 4QMOA 5I3RA 5DNRA 2QG5A 4J96A 3MV5A 4X0MA 1J1BA 3OP5A 3P7BA 3I60A 3QXPA 4IVAA 2W0JA 3BYMA 4BHZA 4DAWA 2UW7A 2PVFA 4XH6A 4RLLA 2B1PA 4Y5QA 3U87A 4PRJA 1I44A 3E8NA 4ZY5A 3LXNA 4OGRA 1T45A 5HD4A 4BZOA 5HIDA 2XK3A 4QOXA 4TWNA 4GS6A 4CKRA 2XM9A 4RJ7A 5FXRA 2QOIA 4PDSA 5FDXA 3LJ1A 4BIDA 5BYLA 3P4KA 2WMRA 1TQMA 2X2KA 3K5VA 3FHIA 2GHMA 4O6LA 2W7XA 4IAZA 4EUUA 4ZLYA 5HCXA 4H36A 4FKWA 4EOQA 4FIEA 3ZSIA 4H3QA 3CEKA 4ZZOA 2X9EA 4O27B 5H9BA 2Z7RA 4IX5A 4N70A 4DGLC 5TOZA 3MESA 2YITA 1YDSE 3OMVA 4LL0A 3UDBA 5JEBA 1OB3A 2OO8X 4ANNA 2VTSA 3A4PA 3G9LX 2OIDA 4RPVA 3THBA 2BPMA 2WMUA 5F94A 5AP2A 4E6CA 3OUNB 5KMMA 4DEBA 3FSFA 3RINA 2QONA 3L9NA 5E8XA 1U46A 5IISA 4ACHA 2W5AA 5DG5A 3VF9A 3BHHA 1SZMA 2PZ5A 4O6EA 1JNKA 4BICA 4UX9A 3WZDA 3PJ3A 3ALOA 3HX4A 3PSDA 3ALNA 3R6XA 5IMEA 2X2MA 4O84A 3PWYA 4PDOA 5H8GA 4F6SA 4YC3A 4ZY6A 2CPKE 4UMPA 3CC6A 2QU6A 5CI6A 2X1NA 5IA3A 3MTFA 2VTMA 3PLSA 4GEOA 2C6KA 3VRYA 4AZWA 1MRUA 1DS5A 3HNGA 3OW4A 3OWLA 2UZVA 2W1FA 1IAJA 2EB3A 4EOOA 2QOFA 2P2HA 4AF3A 2XBAA 3QHWA 3UP2A 4AG8A 3FMNA 1QCFA 5BVKA 3OUKA 3ZO1A 3CS9A 4I1ZA 4QMNA 2SRCA 1MP8A 2WHBA 4QNAA 3UO4A 2NRUA 5JFSA 3G6HA 3GU8A 5CF8A 2PVLA 3R8VA 2VX3A 3OCBA 5JN2A 3CGOA 5AP4A 3G0EA 3TKIA 3ZFMA 4FTCA 3DAKA 4K18A 2WMWA 2B9HA 3TZ8A 3VAPA 2PVMA 2PVHA 3ERKA 5CEKA 3B2TA 2AUHA 4PV0A 3V01A 2BZKB 4AE6A 4CZTA 3KN5A 3DJ5A 4IB5A 3ZLYA 2GNIA 4JAIA 4KRCA 4HVIA 3DZQA 2YM3A 2VWVA 1PRYA 2QG7A 4DYMA 3P86A 2OXYA 5LVMA 5DE2A 3R7UA 3QQLA 4R3CA 1YDTE 3UNKA 4GFOA 2XNNA 4YLLA 3WYXA 5AR3A 1RDQE 2RFNA 1WBWA 2PVNA 3DAJA 3PXQA 2C1BA 2H6DA 3IDPA 3FKNA 2YIYA 2YA9A 2OICA 2PZPA 2OW3A 5FEQA 2GHGA 4FODA 2I0EA 3SVVA 3D5XA 3K2LA 3B2WA 4DBXA 4FF8A 3KXHA 4GK4A 1M7QA 2ITWA 4O86A 3BU5A 4RT7A 4MKCA 3NYOA 4G1WA 2BFXA 4KS7A 4OTPA 4Q2AA 4U97A 5L2TA 3AQVA 4FV2A 4F7LA 5KBQA 5CEPA 3A8WA 5HEZA 3RNIA 1GOLA 1IG1A 4LYNA 5HE2A 1JQHA 2JBOA 3A60A 3SRVA 3F5PA 3ZC5A 5EK7A 4ITIA 4WHZA 4ZTQA 5EYMA 1ZWSA 4IFGA 4YURA 3SOCA 1IAHA 5L2SA 2C6LA 4BL1A 4V0GB 4EYJA 5AWMA 4CFUA 2OF2A 4O82A 3PXKA 1JVPP 2WTKC 3KRXA 4O0RA 1J7UA 3MJ1A 4FSTA 4JOAA 5J9LA 3FDNA 3NNUA 3OVVA 5AJQA 3MH2A 4LFIA 5BX0A 3AD6A 3HMIA 3LE6A 2XH5A 4I5MA 4D5HA 5EQYA 1IA9A 2GTMA 4L7FA 3NNVA 4O7SA 1MQ4A 4FSQA 4RFYA 4DEEA 1REJA 5D10A 4QO9A 2XRWA 2IVVA 1ZYDA 3G2FA 4BB4A 2YM7A 4JDHA 2H9VA 4I93A 2JIUA 3NEWA 4QYHA 5ANGA 4Q5EA 4XP3A 1XBCA 4CG8A 4D0XA 2J0KA 3GC7A 4M67A 2XVDA 3IO7A 3QUEA 4JBQA 5CU4A 3GNIB 1XJDA 5FG8A 2WQNA 2CLQA 3ZBXA 2UW9A 5L2IA 2ONLA 3KL8A 4TZRA 1UV5A 4DFZE 3NUAA 5HE1A 2YM6A 3TCPA 4ZLOA 2YCSA 5CX9A 4P7EA 1H01A 2GNFA 3FYJX 3R1QA 2IN6A 4MXXA 5CZIA 3V5JA 2J9MA 2QLQA 5C8KA 3P7CA 3Q2MA 1V0BA 3PG1A 5FTQA 5T3QA 4U42A 1MQBA 4EK5A 3F3TA 4IVDA 4IX6A 5IQFA 3VUMA 1YQJA 2BAQA 2RIOA 1ZZ2A 4K8AA 3OY1A 4OBPA 5JRQA 5KBRA 1BL6A 3PIZA 2VRXA 4LG4A 3PJ2A 1JKTA 3KB7A 4UN0C 4AP7A 3NW7A 1Q61A 4FV8A 3KGAA 5DVRA 4BC6A 2C5OA 4R1VA 5M4CA 3GQIA 3FZPA 4JAJA 2VTOA 4FC0A 5C03A 5KMLA 1M52A 4GJ2A 5IMXA 5LVOA 1JWHA 1PMVA 2BRBA 3POOA 4GFMA 4U79A 5AAEA 2VO6A 4F0IA 3TN8A 4O83A 4CTCA 2G01A 5CAUA 4WO5A 4C4EA 4R6VA 5E8YA 5LCKA 4BBFA 2C6IA 2ESMA 3SQQA 3RCJA 3HRFA 2XKEA 1ZMUA 5F20A 4EJNA 4YGAA 3RKBA 2ZDTA 3RWQA 3QTQA 5CAOA 3VS1A 2UZTA 3RK7A 2RG6A 3MJ2A 4K6ZA 3Q2JA 5TF9A 2QOHA 3AD4A 3FMLA 3TZMA 4R3RA 2JFLA 3H4JA 3I6UA 4C4HA 1GZNA 3SD0A 2CGXA 4EOPA 4ZJVA 3HRCA 2WOUA 4IDTA 4NW5A 3I0QA 5KKRB 3A62A 3FMHA 1G3NA 5I9WA 4W4VA 1NY3A 3FY0A 3GOKA 2CNVA 2WMBA 4G3FA 3DCVA 2HW7A 4LQMA 2B52A 4ERKA 5L8KA 4GCJA 2F7ZE 5HTCA 3QRIA 2VV9A 4UBAA 2X9FA 3MW1A 5LVPA 4A9UA 3DQWA 3POZA 2J5EA 3UQFA 2A27A 5J8IA 5LMBA 2F7XE 3K5UA 1UU7A 4EK3A 4RRVA 3OWJA 1UWHA 2E9VA 1PY5A 3I7CA 3LQ8A 4QMSA 4W4YA 4QTAA 4CLJA 2A0CX 2VGOA 3KCKA 3NLBA 4IAFA 4O0UA 1DAYA 3ZDUA 4ZJJA 3P78A 3GP0A 4ACGA 4C4FA 4E1ZA 5HU9A 1OKZA 3F66A 3Q6WA 2JKKA 4IWDA 3ZEWA 1YXVA 2ETRA 2Z7SA 4O7YA 2BDJA 3CJGA 3GVUA 5L2QA 3FXZA 1PHKA 3CQUA 3RPOA 4DF3A 2HZ4A 5C27A 3QAME 4GW8A 4Y83A 4CZUA 3DOGA 2BILB 4LUDA 3BKBA 1H08A 5HE3A 4IFCA 3EQHA 4AQCA 5D11A 3S95A 4U41A 4J8MA 3RZFA 3MTLA 2Y9QA 2RFDA 3F5GA 4L43A 3ZRKA 3C4WA 3MI9A 2ETMA 4U44A 4AGUA 2GSFA 2PVKA 2CGWA 1M2PA 2BKZA 5I9ZA 4B0GA 3VBWA 4D2TA 3NIZA 3ET7A 1REKA 4O7NA 5HO6A 1OZ1A 4FTRA 4M0ZA 4ZXTA 4YMJA 5GZ8A 4WUNA 1G8AA 4QRCA 1ATPE 1QPCA 4HGTA 4XP2A 4ZIMA 5C9CA 3FZRA 4FVPA 2ZM3A 3AMAA 3KQ7A 3FI4A 4YZCA 4CZYB 5HG8A 4PMMA 1WAKA 3C50A 4MYGA 4C4JA 1DAWA 4QT1A 3LAUA 2OF4A 4RVLA 1U54A 5C26A 2OLCA 3CSVA 4RWJA 3G90X 4EOJA 5AX3A 4CGAA 1URCA 3H0YA 5EKNA 2X81A 3GI3A 4CV8A 1AQ1A 2BHHA 3AC5A 4NEUA 4L68A 5EW3A 5A54A 2VWUA 4C58A 4BTMA 2R7IA 3I81A 1P2AA 1VYWA 2PTKA 4FKJA 3R28A 3ZCLA 3HV7A 4NKAA 5EW8A 4YTFA 4C3PA 4CEGA 3OCSA 5CSXA 5JFWA 4ZS4A 5AR2A 5JKGA 1GZKA 1GZ8A 2BZHB 4WIHA 4ZLZA 4JS8A 4Y46A 5ANIA 3CD8A 4CKJA 3SX9A 4WNKA 4D4RA 5E8TA 2WZJA 3EN7A 3D0EA 2XK9A 3FZ1A 3ZLXA 4ENXA 3CGFA 2ACXA 3OWKA 1KOAA 3QX4A 5EI6A 3G51A 4FSNA 5FEDA 2GQSA 5A4CA 4ALVA 4KUJA 1BX6A 3EQPA 3NUPA 3DBFA 4FUXA 3HV6A 4IZ5A 3VUIA 1K9AA 5HNIX 4CFXA 4AW1A 4FBXA 4E6QA 4RJ8A 3EN6A 2UZUE 1KE5A 2QOLA 5CENA 4IC8A 1Q62A 4IJ9A 2HZ0A 3PPZA 4K0YA 4LGHA 3FKOA 2IPXA 3LXPA 2W1GA 4IAYA 3KKVA 5BMSA 3BV3A 4IC7A 4LRJA 5CAQA 5I0BA 2CKEA 4PMPA 3OEFX 3B8RA 2WD1A 3DTCA 4BVUA 2WQBA 4R5SA 4YZMA 5JMSA 3MH3A 3C4ZA 2VWWA 4TT7A 1Q8YA 3I4BA 3OTVA 2VNWA 3OTUA 5IQIA 4IVBA 3QTWA 2QKWB 2WNTA 3EYGA 4X6QC 3WF8A 3AG9A 4RFMA 3S3IA 3GQLA 4FTQA 2UUEA 4CKIA 3RK5A 3RBWA 1RQQA 3D4QA 4KAOA 4QTDA 3R71A 3VBTA 4DGNA 1A48A 4C2WA 3LJ0A 4CFMA 2YDJA 4P5ZA 2PMNX 3DT1A 1YI3A 3F5UA 3FQEA 4FZAB 4ZOGA 4XV3A 3LXLA 1F5QA 4AGWA 5A14A 2YIQA 3PJ1A 2BIYA 5ANKA 4AS0A 1ZYSA 2W4KA 1B6CB 4FOBA 4UEUA 3P79A 4B9DA 1H0VA 4IWQA 3DY7A 4DINA 2F7EE 1Q3DA 4KABA 5LMAA 4YU2A 4F7NA 2YN8A 3EH9A 3NSZA 5EDPA 2OJIA 1Y6AA 2CCIA 2G2IA 2WMSA 3S2PA 3TTJA 4CD0A 3EQCA 2IVSA 1Y57A 4EH9A 4BR3A 5E91A 3C4XA 4WT6A 1RW8A 3UC4A 2CN8A 2XS0A 3V5WA 4Q5HA 4D2PA 1WVXA 3QKKA 1Q97A 3UGCA 5CEMA 4FTKA 4O91A 4XNEA 3QKMA 1H1QA 4M66A 5K0KA 2XM8A 3JR1A 4AT3A 3R9RA 3OF0A 3FBVA 2VWBA 5DR2A 1FVTA 4N0SA 5HO8A 1FQ1B 3DKGA 3KREA 3R1YA 2R3HA 3ZM9A 2ETKA 2YLEA 2F9GA 3GU5A 4O7WA 3PRIA 1Z9XA 4EK8A 3MFTA 3ORKA 3DK7A 4XYFA 4C62A 3LM5A 4E6AA 4IIRA 3LQ5A 3KRRA 5CT0A 4DFBA 2YZAA 4E4MA 3IDCA 4QYEA 4J53A 4GKHA 3F9NA 1BI7A 3A7HA 2QOCA 3DS6A 4XX9A 4CYIA 1YXTA 2HENA 4PF4A 4O1OA 4G16A 2IZTA 3VWAA 2W06A 3TNHA 1LPUA 5FLFA 3HYHA 5KMOA 4JBVA 4WUAA 2HELA 1LP4A 4EI4A 5JZNA 3DV3A 1O9UA 5M4UA 2WTWA 3KCFA 3FXWA 4I0RA 3BGPA 4FR4A 5K5XA 1J7LA 3GBZA 5J5SA 3RPRA 3FE3A 3PY3A 3P0MA 3EQFA 3UZRA 3VHEA 3ZO2A 1Q8TA 3Q6UA 3Q32A 2XIZA 3LCDA 4MX9A 2QI8A 3RCDA 3EKKA 3KF7A 4BKYA 1Y8GA 2R3MA 4XP0A 3TV6A 1G8SA 1LEZA 2XJ2A 3AOXA 3DFCB 4PL3A 3UZPA 4NSTA 3BLHA 3EMGA 4APPA 1OGUA 4EC8A 2OH0E 2WQOA 2JAVA 1ZOHA 2GFSA 4O96A 2XBJA 3KK9A 4D2SA 4AAAA 1RJBA 2PUUA 4I22A 5HBEA 4TYHB 4PUZA 3ZRMA 4MH7A 3IW5A 3N9XA 1YWRA 2Y6OA 1H1PA 2QVSE 4FL3A 4JG7A 4QMYA 3WE8A 1FOTA 2B9JA 3Q52A 4MNEB 4IZYA 1FMOE 4OT5A 4O0WA 1RE8A 1PJKA 2VTHA 2Z7QA 4IJPA 1EH4A 3BRBA 3FI2A 2CSNA 4LOOA 4X3FC 5AUYA 4II5A 3V6SA 4KKHA 3E92A 3G33A 4C3RA 3BBTB 1OKYA 4NZWB 3LCSA 1BUHA 4K77A 3PLAE 3F2AA 1OM1A 3BEAA 5J7BA 1L8TA 1WBNA 3DJ6A 4FVQA 5IEVA 2ZMCA 1NW1A 3COHA 4X3JA 3RAHA 5FGKA 1PYEA 3E64A 2XK4A 4D2WA 2IVTA 3CPBA 3D2IA 4G3GA 4IB3A 3DQXA 3TTIA 3ZRLA 2RSVA 4PWNA 5FM2A 4FX3A 2PK9A 4CQEA 4HVSA 3ZSHA 1AD5A 3DKCA 1W8CA 5E1EA 5CU2A 1PXPA 2PSQA 5J5TA 4OBOA 3UVRA 5G1XA 4DT8A 4YO6A 3KMUA 1Q24A 4GYIA 1NA7A 4CSVA 4QMWA 1QPDA 2FGIA 4MCVA 4DN5A 3TV4A 3PTGA 3UOLA 2UW6A 3VUDA 5I5ZA 5JGAA 3NMUF 5AFVA 4MF0A 4FT0A 2YEXA 5D12A 3UZTA 4XV2A 2Q0NA 4H05A 4AACA 5FBNC 2PMLX 5IZFA 4O0XA 3ZS5A 5IQEA 2WTVA 4USFA 5BVWA 1ZLTA 3GCPA 4M68A 2CKOA 5L2WA 3BWFA 3RGFA 4AN3A 4B6LA 5A4LA 3KF4A 4TL0A 3ZTXA 5LWNA 2B53A 1ZOGA 5GNKA 1CKPA 1KV1A 3VBYA 2QHNA 1IASA 5I3OA 5BQ0A 4J98A 4BCHA 3NWWA 3DK6A 3ETAA 3OFMA 1PXOA 4M3QA 3PXFA 4PTGA 4FI1A 3C0HA 5AUZA 3TJDA 4BIEA 4DEIA 4DCEA 4EK4A 3N4VA 2UZEA 2X7GA 2X6EA 4ACCA 1OL1A 4FSMA 5AIRA 4QP2A 3C9WA 3GUBA 3FL4A 4ZTHA 2IJMA 4WNPA 2BRNA 3NR9A 2R3PA 3QU0A 2QOQA 4F64A 3UIUA 2Y0AA 1E9HA 3MS9A 1PMNA 3QWKA 4XV1A 2EB2A 4I4EA 3NUNA 4UZDA 3FLNC 4GH2A 3NDMA 3DLSA 4TYIA 4YPDA 3VF8A 3VUHA 4ANBA 4TY1A 2O63A 3AC2A 4AFJA 4TYHA 2BHEA 2GPHA 2XKDA 2P55A 3EJ1A 4BDHA 4A9RA 3GC8A 4FK3A 3Q5ZA 3BQCA 4RGJA 4X2JA 2FSOX 4ZSLA 3V5QA 3WARA 4H39A 4RIWB 4C35A 3AT3A 3VS2A 3ZO4A 3ACKA 2PZIA 2CJMA 4FTTA 2EUFB 3EB0A 3KXXA 4QMTA 3UG1A 4EL9A 3ZH8A 2B4SB 3UTOA 4HCUA 3FEGA 4AA4A 2WB8A 3P5KA 3DB6A 4YJSA 4D2VA 2JFMA 2IW9A 3QUPA 3PVWA 4HYSA 3CD3A 2R0UA 4BDBA 5FP5A 4H1JA 4PNIA 4KBCA 4A9SA 5HI2A 3ROCA 5J9YA 2BVAA 2OH4A 4FICA 2JBPA 3E63A 3QCQA 1B39A 2VTAA 4JL9A 3ZUVA 2B0QA 5DIAA 4ZSJA 4Q9SA 3PXYA 4MD9E 2W9FB 3SOAA 3CY3A 4DEAA 1YXUA 5AP3A 2UZDA 1YI6A 2YWPA 4YLKA 3ZOSA 2J90A 2GNGA 3PIYA 4J1RA 4OTIA 1KE8A 4YJOA 1PXMA 4RJ4A 5D9HA 4AT5A 2GS6A 4QMVA 4F9CA 3C4EA 2GNJA 2I0VA 3E8DA 1U59A 3R9HA 4TKSA 4FEUA 4RA4A 4AGCA 3MH0A 4EZ5A 5D7AA 1DI8A 4O7LA 5BPYA 3R9NA 4K11A 5TR6A 2IG7A 2RF9A 4KWPA 4Z55A 5CYIA 4JNWA 2BZJA 5JQ5A 3E8EA 4AZVA 3BHYA 3QWJA 2CHLA 4JG8A 4IX3A 4FV7A 4U81A 4BGGA 2C5XA 3Q5IA 3QD0A 1PXJA 3PZHA 4JVGA 1H27A 3PZEA 3TNPC 2Y4PA 3QZGA 1CKJA 1YDRE 2J50A 5DGZA 4KKGA 5HQ0A 5AA9A 5IU2A 3DNDA 4E6DA 3WBLA 4CCBA 5DMZA 4K9YA 4DH1A 2XEZA 4MXZA 1U5QA 4WSYA 5CS6A 5F1ZA 4GIIA 5A6OA 5AAGA 3VBXA 4JBOA 4ZK5A 5CEIA 4FV6A 4FKPA 3BWJA 4TYGA 4XBRA 3TZ7A 4EH6A 2QR7A 5HTBA 3WYYA 5GZAA 3TDVA 1SNXA 4M0YA 3QTUA 4EOMA 3F61A 3JUHA 1SVGA 4GVAA 2UVXA 3H9FA 2LGCA 5DRDA 3RHXA 3F88A 4K1BA 4FG8A 5L6PA 3BHTA 5BVFA 1Y8YA 3Q4ZA 3SGCA 5EHOA 1P5EA 2VO3A 5FXQA 3KMWA 5LVLA 4BCGA 4F0GA 4RIWA 3BE2A 4C4GA 5HICA 4EORA 4F9BA 4W9WA 3AT4A 5IEXA 3GU6A 2YACA 5B2KA 3RPYA 2HY0A 2EXMA 4JDKA 4LM5A 4DA5A 4XLVA 3PWDA 4BDCA 4AZFA 4F9WA 3GCUA 4ZS0A 4USEA 4R8QA 4CG9A 2X7FA 2W4OA 3BYUA 4AW0A 4JT3A 3QQJA 4YHJA 3REPA 3PSCA 4I5CA 5HG9A 4FKQA 4FIJA 4HNIA 2HK5A 4FSRA 1GIJA 5CASA 3BYOA 4BKJA 4EWQA 1OECA 5IQBA 4O38A 4XS2A 3I5NA 1GY3A 5B7VA 4IWPA 4CMUA 2BAJA 4EH4A 3UP7A 2Z8CA 4CXAA 1A06A 2AC3A 1Q41A 3MA3A 3QFVA 3EQGA 4P5QA 3NUXA 3VUKA 1JKKA 4WBOA 4U43A 3BPRA 3C0GA 2B9FA 2P2IA 4G3DA 3IOPA 2I7QA 1PW2A 2B9IA 3F82A 5C1QB 3IOKA 4L67A 4FMQA 2C0OA 2C5NA 4CT2A 4JRNA 4BRXA 3Q4TA 2J4ZA 4I92A 5AR4A 5BUJA 3QD2B 3VULA 4LRKA 4EKKA 1WCCA 2F4JA 4FG7A 3TNQB 1R78A 1P14A 4D4SA 1OIQA 3MVHA 3TKUA 4FL2A 4V01A 3GB2A 4IAKA 3ULZA 5DN3A 2R9SA 5AIKA 1OL5A 3O8PA 2E2BA 5AA8A 5GIPE 1W82A 5BMMA 1XH7A 4OLIA 5L6WL 3S0OA 3IDBA 3R63A 3MPTA 5LQFA 3GFEA 3HDNA 2XZSA 3HUBA 4ZEGA 3FMJA 5HBHA 2PPQA 3V8SA 4WG3A 4EQUA 5M06A 4GKIA 2BZIB 5CXHA 1BMKA 2PE2A 4FZ7A 1CDKA 4MBLA 4MWHA 4G31A 2ZVAA 3COIA 2WQEA 2UZOA 3I1AA 4RA5A 4WG4A 3VHKA 5IUGA 4FE2A 3N4UA 2ZMDA 4L3JA 4IXPA 4OR5A 1W0XC 3QQKA 1STCE 2EXEA 4FL1A 3VS5A 5IQHA 3DB8A 2Y4IB 2YM4A 3V5TA 3FMKA 5CF4A 4GT5A 5ACKA 3SG8A 5HVJA 4D9TA 1GIHA 2P33A 4C02A 5FDPA 2XKCA 2HY81 3C7QA 4ZTNA 3NNWA 5HKMA 2XJ0A 2ZOQA 4KB8A 2HXLA 3UIMA 5C8NA 2NRYA 5A3XA 3ORPA 3UOKA 3SA0A 3KVWA 4IMYA 2HAKA 3LCKA 3U8WA 4XG3A 4Y85A 5CT7A 3VNTA 3W55A 2BTRA 3BE9A 4JLCA 4P4CA 4X21A 3MB7A 3E93A 1P4FA 2X39A 3Q9YA 4NM3A 3IONA 4Y95A 3RPVA 5IDPA 2VD5A 4O7TA 4MK0A 3TV7A 5IPJA 4YZNA 3R8LA 5LCJA 1OL7A 3U4WA 4GYGA 4QMQA 3V8TA 4IHPA 4WNMA 4TTHB 1NVSA 5C01A 5CQWA 1SNUA 4RX9A 5DR6A 4NL0A 3JYAA 1HCLA 2GNLA 2V22A 4DFLA 3N51A 4FKRA 3OT8A 5I9XA 4CFFA 3CE3A 3QQFA 4DEDA 4EZ3A 3HMMA 2PYWA 5H2UA 2WGJA 3GENA 5EQEA 3LQ3A 5HLNA 5L8LA 3QZFA 3QQUA 2R3IA 2VTPA 2XNOA 3KULB 3R8MA 1YXXA 5AUVA 3R7VA 4B4LA 3L9LA 3DBDA 4FIFA 2HZNA 1WBPA 5AR8A 3RI1A 2C6MA 4FTIA 4QP4A 2ITOA 4L42A 2BTSA 4PPBA 3BLRA 3DXNA 2VO7A 5CANA 2J51A 5AV0A 1SMHA 3C4CA 2XK7A 2OG8A 3DTWA 2UV2A 4PL4A 5LMKC 1H1SA 1XO2B 4DC2A 4YTCA 4AU8A 4BHNA 4Y8DA 2DUVA 3EFLA 4F9YA 3SC1A 5L4QA 5AUTA 5IH6A 5CU3A 4AFEA 4E26A 4GT3A 1P4OA 2XNBA 5HGIA 4YTIA 3MB6A 1UKHA 3HP5A 4LMUA 4BYIA 5FUTA 4BDKA 2QO9A 1XKKA 3FZSA 4D5KA 4HPUE 5LJJA 3QF9A 2H34A 2HWPA 4KSQA 2PE1A 3SXFA 2VZ6A 3MFSA 3R22A 4O21A 3Q04A 3R7GA 4V0GA 3ZHPC 5E8VA 4ZTMA 4O7ZA 4BDIA 4UXLA 3CTHA 3C13A 3PXZA 3U51A 1APME 2J7TA 3L8XA 2PHKA 5AP0A 4FSZA 4JX3A 4DG2E 3UPZA 4GRBA 3WF6A 5ICPA 4YP8A 1YHSA 5EHLA 1R39A 1V0OA 4Y5HA 3PYYA 4A7CA 3VW8A 3D5WA 2QOBA 3FC1X 4A4XA 3CQEA 1Q8UA 2BUJA 1HCKA 1JAMA 1FGKA 3EWHA 2PMOX 3QTRA 4M8TA 4MHAA 4NIFB 4PMSA 4BKZA 4ZSEA 2XJ1A 1VZOA 4KSPA 4DGGA 3LFBA 3BHVA 4F1OA 3P9JA 4L53A 1YI4A 1YWNA 4ORKA 2XNMA 3I7BA 5GZ9A 1YKRA 2I6LA 4G2FA 4NCTC 5K3YA 5M57A 5EH0A 3CKXA 4PPAA 3JXWA 2VTNA 3NUSA 4L44A 3WOWA 4XHKB 2ZB0A 3MFUA 5HHWA 5K9IA 4C3FA 4NUSA 1FGIA 5EI2A 4BTKA 4DLJA 4FKTA 3NGAA 1W84A 5ACBC 5I9YA 2UW0A 5EOLA 4ZTRA 2GNHA 2JDOA 3O0GA 2UVYA 3A4OX 2AC5A 3BU3A 3FLSA 3PPKA 5J79A 3F3VA 3ATTA 4KD1A 1KWPA 4P2KA 3R2BA 4U45A 2R7BA 3AC8A 4QMMA 4O0SA 3EZRA 5DH3A 5M08A 1FVRA 2YIWA 5KUPA 3ITZA 3TIYA 5CVHA 3EQRA 4GU9A 1LEWA 2C6TA 1ZY4A 3ORXA 2UVZA 5KMNA 4AA5A 3OZ6A 1PXNA 4A4LA 3FZTA 4DITA 3FPQA 4JIKA 4IM0A 5DLSA 5DOSA 3ULIA 4PL5A 4N57A 1SM2A 3E5AA 5EFQA 4HGLA 3Q4UA 3M42A 2Y6MA 4G6NA 3UQCA 2RKUA 5CY3A 3ANQA 5JH6A 4D0WA 4FTMA 4S31A 3SW7A 5CWZA 4ZSAA 2BKKA 2G15A 2O65A 3U6IA 3Q60A 4IX4A 4NFMA 4PTEA 3AD5A 4XG6A 5AV2A 3RM6A 2C0TA 2O8YA 3OHTA 4O0TA 4XG2A 3FV8A 4PQNA 4MQ1A 3M11A 4QYYA 4I4FA 2WAJA 3EFWA 3VN9A 4ANLA 2W1ZA 3GCVA 4D58A 4EHGA 3ZDIA 4L9IA 4AT4A 4HW7A 5HZNA 4ZAUA 2YLFA 3MPAA 3CQWA 4GG5A 4DBNA 3EHAA 4IWOA 4RJ3A 5KHWA 2NNWB 2JLDA 4RIYB 4F63A 4WSQA 1IRKA 4IQ6A 5CI7A 3SLSA 2PZYA 5DFPA 4RJ5A 3PA5A 2WPAA 4G6OA 1VYZA 2OK1A 4UB7A 3IPHA 3NUUA 1QPEA 2ZYBA 4YZDA 3JVRA 2Z7LA 1GIIA 4UWCA 4W4WA 2I40A 4GVJA 3TT0A 1WVYA 5IA4A 4FK6A 2VO0A 5CNNA 3UYSA 1XH9A 5J87A 2V7AA 3K3IA 5BYZA 4KA3A 4YHFA 4DH8A 2QD9A 4R78A 4C4IA 3HV4A 1VR2A 4U3YA 3W2OA 2VTJA 1JSVA 4YLJA 4E93A 2W05A 4KIKB 2DWBA 1XH6A 3IG7A 2CKQA 2JC6A 1WBOA 3R9OA 4ASEA 3ZFYA 4R7BA 5H3QA 4ASXA 1XR1A 4HGEA 3C51A 3EFKA 4NJDA 4QQ5A 3RM7A 3QCSA 4DEGA 4HVHA 2E9UA 2XIKA 3VUGA 4BWKA 3DKFA 4GJ3A 5K5NA 1YHVA 5JGBA 4BTFA 4FG9A 4GFGA 3FMEA 4H58A 4QMLA 4BY9E 3QZHA 4BTJA 4EHEA 2WTKB 2OJJA 4ACMA 4UZHA 1OIUA 3FXXA 3TI1A 4QP3A 4CCUA 5M4FA 3F2RA 4NTTA 2J0IA 4RVKA 3CP9A 4WKQA 4MNFA 2G1TA 3SDJA 2W4JA 3OROA 3EYHA 1CM8A 1J91A 3MFRA 1BLXA 4IM2A 5EDRA 4M97A 2UW5A 4L8MA 5IA2A 1B38A 4TWPA 3RWPA 1TQPA 2Y8OA 1UU8A 3JPVA 1E1VA 2O64A 3L8SA 3ELJA 4IE9A 1U4DA 4BDGA 2W1IA 2W99B 3HGKA 4YBJA 4AWIA 4WRSA 5A4TA 3UVPA 3ORZA 1WVWA 5J9ZA 3HDMA 3L8PA 4QPAA 4CV9A 2QCSA 4O0YA 2OXDA 1CTPE 3ANRA 4MQ2A 2JITA 2OJGA 4RFZA 4TYEA 4Y72A 4YJQA 4UY9A 4ALUA 5J7HA 1YOJA 5DPVA 4FEXA 3QALE 4OTQA 1Z5MA 4U0IA 3T9IA 1WBTA 3D5VA 2I0HA 3VS0A 3F3UA 4IZ7A 2WEVA 3F2NA 3PY0A 4WNOA 1H24A 4KIOA 3QC4A 1TQIA 3TWJA 4C37A 1Z57A 4FKLA 4GG7A 5IUHA 2R3RA 3MDYA 2VTIA 3NAYA 2Y7JA 3OWPA 4QD6A 4K2RA 5HOAA 4CTBA 2YJSA 1PKDA 3MWUA 4FKVA 3SG9A 3PE1A 1QMZA 4C59A 4X6RA 3RJCA 2PL0A 2FB8A 1KOBA 3HMOA 3EN5A 3R7OA 4OTDA 5IH5A 2J0JA 1OPJA 4RIYA 3P7AA 3OXZA 2HZIA 2R5TA 1KE6A 3HKOA 2QOKA 3ZLSA 3BGZA 5KCVA 5HTIA 3PDTA 4FEWA 3DK3A 4NYEA 5A9UA 2BRMA 3EN4A 3SXRA 4BI2A 4G6LA 4EH5A 5ITAA 4LGGA 4QPMA 1NVRA 4RIXB 4U6RA 5AP7A 1FVVA 4DH5A 5M44A 4Z7GA 3PA3A 4YHTA 1Q8WA 2ITVA 5AV4A 4FIHA 2ITZA 2JKQA 4FT5A 4FIIA 2DS1A 2UZWE 3L9MA 1YW2A 4O1PA 1R3CA 3EOCA 2C1AA 4IAIA 4F4PA 4BF2A 3A7FA 2QKRA 2WIPA 3BV2A 3W16A 3D9VA 3CKWA 5CNOA 1NT2A 3T3UA 1R0EA 4JQ7A 2XNGA 5E9EA 3R83A 3GC9A 3PP0A 3QD4A 3EFJA 1Q4LA 2X8EA 3QRUA 2W9ZB 3EQIA 4NT4A 3SAYA 3T3VA 1FMKA 4IDVA 5AAFA 2C0IA 1I09A 4HCVA 1A9UA 1OKVA 2ONLC 3OXIA 3R21A 5E8ZA 1XHAA 4W8EA 3DNEA 3O7LD 2ZDUA 4QQTA 5CLPA 3Q9ZA 5C8MA 3UMWA 4N6YA 4YBKA 4X2FA 3TKHA 3BX5A 4IADA 2JIVA 4M12A 3ZM4A 4DEHA 4YO4A 3FJQE 2YFXA 2FUMA 3UO6A 4J7BA 3ZONA 2NP8A 4XCUA 5EKOA 5K0XA 2CN5A 3NVMB 2KTYA 1OL2A 2VAGA 4DE4A 2XKFA 2QO2A 5BVOA 4FTJA 3II5A 4MWIA 4S2ZA 4E4NA 2BCJA 1ZXEA 4FV1A 4JRVA 4L52A 2VTTA 3VO3A 3MN3A 4C7TA 3LXKA 4HOKA 4EH2A 3WIGA 4CVAA 4L00A 4CRLA 3OG7A 3MIYA 3R7EA 2WOTA 4AZSA 3V8WA 3CPCA 4RBLA 3NUYA 5CSVA 1H1WA 4GK3A 3EQDA 3H3CA 4E5WA 4DTBA 4YSMA 2BR1A 3CY2A 4D55A 3QHRA 2YJRA 4KBAA 3LCTA 3VW6A 2YCQA 4R1YA 1BKXA 3PG3A 3LFDA 2BMCA 4WBBB 5CVGA 2ZB1A 4I24A 3I6WA 3GU7A 5B2MA 3GCSA 3OCGA 5HE0A 3KRWA 4QTBA 4RG0A 3A99A 4EK6A 4YNOA 3ZXTA 3G0FA 4K33A 4XJ0A 3Q4CA 1YOLA 4IM3A 3RVGA 2EXCX 3NRMA 3ZZWA 2IZRA 2PE0A 2QR8A 3KVXA 4OTFA 3AGMA 4I21A 4RIXA 3KRLA 2X8IA 3E7OA 3V5PA 5EW9A 2X6DA 3MY5A 4D4VA 4W9XA 2OWBA 2XYNA 2YCFA 4QP8A 5IDNA 5GJFA 3D94A 2R3KA 2VU3A 1DI9A 2J0MB 2VN9A 5HVKA 4APCA 3WZUA 4YJNA 1FPUA 1SVEA 1VJYA 4J95A 4X2NA 2VWIA 3PSBA 3ATSA 3QA0A 2XIXA 2IVUA 2VTRA 4QYFA 3H10A 4O0VA 1SYKA 2QU5A 3LFEA 3DBEA 3W10A 4A06A 4GUBA 4C57A 1WMKA 3CTJA 1JSUA 3EIDA 4L01A 5ANDA 1KUTA 4GUEA 3EN9A 2DYLA 4J97A 4AW5A 3NYVA 3TG1A 5EI8A 4HYUA 4BCPA 3OBGA 4YTHA 4X2GA 3GC0A 2C6DA 3DAEA 3OW3A 4YZ9A 5CTPA 3O2MA 4F65A 4MNEA 3C5UA 3DJ7A 5CZHA 1YOMA 3TIZA 3ZU7A 4FNXA 3ZUUA 2PULA 2JDRA 2QNJA 3KXMA 5DYJA 3VS4A 1MUOA 1GAGA 2UW3A 4BGQA 3DXPA 3R8ZA 1H28A 3QTXA 4XRJA 2ERKA 5DEWA 3NYXA 2GU8A 4NTSA 3PP1A 4I3ZA 5C4KA 2Z02A 4GMYA 3BZ3A 4OTRA 3ZZEA 5DHJA 4EHVA 3FI8A 4E3CA 3TNIA 2WQMA 2GHLA 2Q83A 4NCTA 1ZYCA 2PVYA 2R2PA 2WEIA 3KU2A 1OVEA 4FZFB 2XK8A 3IW8A 4ZMEA 2XK6A 4BCOA 5JQ8A 4UMQA 4UYAA 4O2ZA 3NZ0A 3QQGA 2ITTA 2CNQA 3E3BX 3OXTA 5AM6A 4DCAA 2OGVA 2C6OA 3NW6A
chains in the Genus database with same CATH superfamily
3EL8A 3LKMA 2Z60A 3IW4A 3BL7A 3COKA 4ZTLA 4UWBA 3TDWA 2WTJA 3JY9A 2WIHA 4D2RA 3UVQA 2YDIA 3DA6A 3LFFA 4ENYA 2C68A 1UA2A 2XF0A 3O23A 1JKSA 4ALWA 2O0UA 5HIBA 3F7ZA 4HZSA 2WMAA 3O7LB 2R0IA 3QBNA 3O8UA 5EM5A 4BZNA 2XIYA 5F95A 2V62A 4U5JA 4F08A 3F69A 2J6MA 3HV3A 3HP2A 5HG5A 3F6XA 3M1SA 4FYNA 4YUQA 5E90A 4YSJA 4R5YA 3ZEPA 2UZBA 3A7IA 3F3WA 3ROYA 4FKIA 5KKRC 3RHKA 1BYGA 3RZBA 2XUUA 4I94A 3UBDA 3W1FA 3PFYA 2YHVA 5HCYA 4BCJA 3R2YA 4O4BB 3QCYA 5E8SA 4FVRA 5IKWA 4QP1A 2BRHA 2X0QA 3NAXA 4PPCA 4D1SA 5K4JA 3TL8A 3C0IA 2WU7A 1MRVA 5FRIA 4E5AX 3UODA 3QCXA 4LV8A 4FT7A 4ZZMA 5CU6A 1YWVA 4F0FA 2JDSA 2W5BA 2WTCA 4XOYA 3T9TA 4EOKA 4R77A 4QTCA 2C5VA 2ZV2A 4LL5A 3PIXA 4FTLA 4IB1A 2WU6A 5AX9A 2XNPA 2QURA 3FI3A 4AXDA 1M2QA 3E62A 4DTKA 2ITQA 2WMXA 4HCTA 4PP7A 4BCMA 1W2DA 3HLLA 3OBJA 3QX2A 4QMZA 3PVGA 2V0DA 4FTOA 1M17A 3JY0A 1PXIA 4J99A 2UW4A 5I9UA 3SRVB 3IQ7A 3R0TA 4TW9A 3RP9A 5E7RA 3SW4A 3FLWA 4AOIA 3S00A 5JFXA 3KC3A 3U9NA 4RLKA 1OIRA 3ID6C 4NKSA 2ERZE 1TKIA 2QODA 3FMDA 4NM0A 4CFWA 3RMFA 3AC3A 4U40A 2EU9A 2XNEA 4BJJA 5LOHA 2VWYA 3QRKA 4G5JA 2Z2WA 2YWVA 3W0PA 5KMIA 3H9OA 4WA9A 5L3AA 4I6BA 2JKMA 2PVRA 4U9AA 4ANQA 3MYGA 1BL7A 3C4FA 2HOGA 2DQ7X 4KINA 2HW6A 3AC1A 4M69B 3FZOA 5ETFA 3FUPA 5BUEA 1ST0A 2G2FA 4Z9LA 3VBQA 2OZAB 5EM8A 3DBCA 5HNBA 4EQCA 5GIOE 4F1TA 2XEYA 4AA0A 5KMJA 2BFYA 4USDA 5EM7A 4FSUA 3BIZA 4C8BA 3FKLA 2C6EA 2R4BA 3VQHA 2QC6A 5T6KA 5M07A 4BIBA 4WG5A 3LHJA 4AN9A 3H30A 3OT3A 4ASDA 1UWJA 2F2CB 3R02A 3FY2A 3OCTA 4R7IA 5FD2A 1Q3WA 5EOBA 3U54A 1H07A 1VLRA 4CFNA 3GEQA 4UXQA 1Q8ZA 5LVNA 4S32A 4PY1A 1ZOEA 4CMOA 4FZ6A 4KS8A 1OIYA 4X3FB 4F9AA 3MPMA 4J71A 2YM5A 5M55A 4YJTA 1WFCA 3DDPA 1R0PA 3E3PA 2A2AA 2CMWA 4UYNA 5DI1A 4DG0E 3ZXZA 4W8DA 4HPTE 3KK8A 4YJUA 4IACA 3UC3A 4MAOA 4KKEA 2YCRA 5HG7A 3UJGA 3PPJA 3W8QA 3BYVA 4BCFA 4QQJA 3BYSA 2EVAA 5AP6A 4QQCA 2XANA 5C4LA 3P08A 1NXKA 4E73A 1ZAOA 3LFAA 3PVUA 4RVMA 3D15A 4L45A 5E8WA 3UOHA 3VS7A 2WFYA 1E1XA 1XBBA 4KBKA 3Q96A 4I0SA 2R3OA 3PY1A 4LMNA 3R8UA 1PYXA 3UO5A 1FINA 3KRJA 3HUCA 3PVBA 3W32A 2W17A 5JK3A 2P3GX 4JG6A 1YHWA 3ENHA 3R73A 4M13A 4CFVA 3BEGA 1GJOA 3GT8A 5AUWA 4DGMA 3LLTA 5CSPA 3E87A 2ZV8A 1IEPA 3R30A 4FTAA 4ACDA 4F1MA 5ETIA 4OAVB 4XV9A 4R7HA 2FVDA 5AV3A 1KE9A 4CLIA 4BZDA 5K4IA 1G8KA 2P4IA 1W98A 4DFYA 4ZJIA 4YNEA 4ID7A 2W1EA 2X0GA 3MY1A 4C33A 4ANMA 4YR8A 2YAAA 1ZYJA 5LXMA 4MF1A 2WELA 4AE9A 4RX8A 5AP5A 4TWCA 1CMKE 1LUFA 4DHZA 4RC3A 3O17A 5I4NA 4FNYA 2ZJWA 1YRPA 4R3PA 5KNJA 2C5YA 1OPKA 2HXQA 3EQBA 3NCZA 3R1SA 4JDIA 4NWMA 3ZMMA 3R7YA 2WXVA 4FSWA 2FSMX 3HMPA 5DR9A 4FV4A 2XCKA 3CJFA 4RMZA 4X7QA 3WF5A 3HEGA 2IW8A 3QTIA 5G6VA 2Q0BA 4QMXA 3R04A 4I0TA 4M69A 2OFUA 3FSKA 3WI6A 1V0PA 2UZLA 2OKRA 2LAVA 4BWXA 4FNWA 4XG9A 4B7TA 2GTNA 1IA8A 2OZAA 2YABA 4L7SA 5GJDA 3UPXA 5CF5A 2V7OA 3IS5A 3QKLA 4FV3A 5FTOA 4OT6A 4FKGA 3FLZA 4CYJA 4FTNA 4RWLA 4XOZA 2WMVA 4F7JA 1M7NA 3RAIA 2QO7A 3OS3A 1FBNA 1MRYA 5KX8A 2J2IB 4H1MA 2XB7A 4D9UA 5GINE 1PXKA 1W7HA 3A7GA 3P1AA 4JR3A 2YIXA 3HA8A 3RALA 3W2CA 3MY0A 2GDOA 3RTPA 3ORIA 1DM2A 2E9NA 4BFMA 4HVDA 3I0OA 4S33A 1ND4A 3LMIA 3FWQA 3C5IA 3UG2A 5HLWA 1OBDA 2J0LA 4RIOA 2OIQA 5IA0A 4MVFA 4XG7A 3N4TA 4FV9A 4X3FA 4AZTA 5BV3A 4A4OA 2PZRA 4FZDB 5TE0A 5GJGA 1OPLA 3NIEA 1J3HA 4ZP5A 3JS2A 1XQZA 4BDDA 4XEYA 5CVFA 3RAWA 5J1WA 4KNBA 4F09A 1H26A 3DDQA 2HWOA 5HVYA 4QP9A 1M14A 2GFCA 3CLYA 3V04A 5CALA 5IQDA 4O2PA 4J52A 4EBWA 1Q99A 2BDWA 1XBAA 3ORLA 3E7VA 4OAUC 5IQAA 2OXXA 2R3QA 4NK9A 5IG1A 3QC9A 3IGOA 3MIAA 1WBSA 1H4LA 4RZVA 2OZOA 4ITJA 5F9EA 2BIKB 3KN6A 4IVCA 4YZBA 1U54B 5J95A 3UOJA 2XA4A 3V3VA 2ITPA 5B0XA 4TRLA 2CCHA 4NM7A 4KIQA 4PX6A 3VC4A 4A9TA 5KZ0A 4ZZNA 4MD8E 1KSWA 1KV2A 2GS2A 3GGFA 4FGBA 5GHVA 3AGLA 3B8QA 2BDFA 4MXYA 5ANEA 4EOIA 2R3NA 1PKGA 2JEDA 4B8LA 5AUXA 2C3KA 3LIJA 5HU3A 1QPJA 3MGYA 4FV5A 2C3LA 3QYWA 4GL9A 3A61A 4IZAA 2ITXA 2PY3A 4V05A 4IANA 4NM5A 3COMA 3RAKA 4GK2A 4CT1A 2OSCA 3LJ2A 4G3CA 3FAAA 2B55A 1IR3A 5HORA 1GZOA 4TWOA 4MBJA 1O6LA 3TUCA 1OUYA 3GXLA 2ZM1A 3IK3A 1ZRZA 4EZ7A 4ONAA 2E9OA 3Q9WA 2R3LA 2ITYA 5CAPA 4PDYA 3CCNA 1BI8A 3WIKA 4DTAA 4AXAA 4RSSA 5CF6A 5FQDC 3D7TB 4BBEA 4W4XA 3LPBA 2CGUA 4E7WA 1PF8A 4EBVA 3KFAA 4Z7HA 4D4YA 4Z16A 1W83A 2YM8A 2OU7A 3ORTA 2W1HA 4XUFA 3PJCA 3W2QA 3TUBA 2PUIA 2AYPA 1S9JA 3QLFA 4DFNA 4FA2A 4MEDA 4EC9A 1H8FA 1CKIA 3KXNA 4UWYA 2C30A 1F0QA 2XRUA 2VX0A 3VQUA 3WE4A 3WILA 4EONA 1TFFA 2PUPA 2QHMA 3DXQA 4LV7A 4HYIA 4P90A 5IA1A 4AXFA 3EZVA 2C3JA 3R00A 3RPSA 4L3LA 2IWIA 3KULA 1R1WA 3O51A 2QQ7A 4YPSA 1LR4A 4AGDA 1H0WA 3QA8A 4N4SA 5AR7A 4FT3A 5I9VA 3BI6A 3VRZA 2F49A 3AT2A 4DFXE 4EHZA 4FSYA 1ERKA 2UZNA 3AXWA 2IZSA 3PE2A 3TM0A 2B7AA 2REIA 4NJ3A 3G9NA 3NNXA 4I6QA 5M4IA 1GNGA 3D5UA 4I6HA 3ZLWA 3BCEA 4RVTA 2GCDA 3W0QA 3OD6X 2X4FA 2RGPA 4MTAA 1URWA 1JBPE 3SXSA 3T8OA 3F5XA 3LLAA 3ZFXA 4Q9ZA 4FGRA 3IECA 1XMLA 4M7IA 4PP9A 2IO6A 1K2PA 2NPQA 5ANJA 3WF9A 5JZJA 1PMUA 2WMTA 5KE0A 4QP7A 2OIBA 5TT7A 4KIPA 2W5HA 2I1MA 3L8VA 3TEIA 3A2CA 4FKOA 4FNZA 3QL8A 2PVJA 3QUDA 5BYYA 3UDTA 3BELA 2FA2A 3SV0A 4M15A 4C38A 4EEVA 3BLQA 5DWRA 3ZSGA 4EOLA 3QTSA 5EYKA 5DA3A 4C34A 3R1NA 4U7ZA 4RC4A 4L46A 5CQUA 2YIRA 4LI5A 4BWPA 4IEBA 4PNKA 5ETCA 4BDAA 3MVLA 3G15A 3PJ8A 2W1CA 1UNHA 3WZEA 3FL5A 4GSBA 4JX7A 5DEYA 2O5KA 4G9CA 3CXWA 4QDEA 2ITNA 5FBOA 4RZWA 5T68A 2FSTX 2X2LA 4U3ZA 4FEVA 5DBXA 2H8HA 4TYJA 2WMQA 4DG3E 4GV1A 4YC6A 3SKCA 4EUTA 4NIFA 1YXSA 4Y73A 3PXRA 4FOCA 3NX8A 4UV0A 3LM0A 1OI9A 1UVRA 5ETAA 2NO3A 4B8MA 4PTCA 5DT3A 3U55A 4ZTSA 5E1SA 2C47A 3DGKA 2XCHA 4ASZA 4G34A 4QTEA 2EWAA 1UU9A 2FYSA 3QRTA 3RNYA 4EJ7A 4B99A 4I41A 3QXOA 3A7JA 4A07A 2RFSA 2UW8A 2X4ZA 3QGWA 4GT4A 1ZMVA 2CDZA 4H3PA 4RX7A 3D7TA 3UNZA 1S9IA 3ZC6A 1JKLA 1OITA 5DRBA 1XWSA 3CIKA 1HOWA 4A9YA 4FKUA 4EWHA 2O3PA 3BGQA 3NS9A 4IAAA 4D1XA 4FEQA 4JXFA 4BDJA 1OBGA 4RJ6A 5CEQA 3QTZA 5IQCA 3CTQA 4C0TA 3O71A 2PUNA 3BQRA 4ANSA 4BN1A 4OUCA 3I79A 3LFNA 4OTGA 4DH3A 4UMUA 5EYCA 3AMBA 5BNJA 4S30A 4TN6A 3VS6A 3ZO3A 2CNUA 5JGDA 5L6OA 2IF8A 3KXZA 4AX8A 2O2UA 3D7ZA 4ITHA 4QP6A 3TACA 4AW2A 3FC2A 4YJVA 4QNYA 4L3PA 3TNWA 3QGYA 2X0PA 4YJPA 4AOTA 2YDKA 3QRJA 4LV5A 3VBVA 5M56A 4E4LA 3L9PA 4MXAA 4JBPA 4EOSA 3K3JA 1JOWB 3GU4A 4GIHA 5IUIA 1J1CA 5D1JA 4BDEA 5KMKA 2ITUA 1ZZLA 3TJCA 2YAKA 4G5PA 3KY2A 1OL6A 2RFEA 4GU6A 5E8UA 4LGDA 5AMNA 2VWZA 2A1AB 1JLUE 1ZY5A 2GQRA 3I5ZA 3OY3A 2V55A 1V1KA 2KULA 3C1XA 3MVMA 2WKMA 5KZIA 1WZYA 4FT9A 4C36A 4C61A 3KA0A 3HV5A 3U9CA 2RL5A 3FQHA 3PA4A 4G17A 4HNFA 3W2PA 3FLYA 5CSHA 5M53A 5HLPA 2YISA 3OEZA 4EQMA 1ZYLA 4RX5A 5CEOA 5M09A 5F4NA 3HA6A 2C3IB 4F99A 1XH5A 1QL6A 1M2RA 2ZV7A 4EH3A 4ERWA 4ZY4A 4O7RA 3O50A 2W96B 4BCIA 3EKNA 4D28A 4JQEA 5HX8A 4HYHA 2RG5A 4FIGA 3DFAA 1ZARA 1G5SA 3DKOA 4BCNA 2GS7A 3NYNA 5HIEA 5AV1A 5AUUA 4XMOA 3GCQA 3V51A 3S4QA 5A4EA 5H8EA 2JDTA 4JIAA 3H0ZA 4AUAA 4F7SA 4TXCA 3L1SA 4XG8A 4NFNA 2VTLA 2JAMA 3ENMA 5CSWA 4BCKA 3HAMA 3W2SA 4U8ZA 4AXCA 3EL7A 2XYUA 3OC1A 3QQHA 3RK9A 1Y91A 4O4DA 4E4XA 3ORMA 2R3FA 4FTUA 5ANOA 4DFUA 3VIDA 2E9PA 1YVJA 3W18A 3S1HA 4HJOA 3PFQA 4LRMA 5AP1A 4HGSA 4KIKA 2YZLA 3GFWA 3QD3A 3W2RA 4UMRA 3LZBA 1SVHA 4BDFA 4DHFA 3IW7A 2PU8A 4HZRA 4X2KA 1O6KA 2HIWA 2WO6A 3DPKA 4QMPA 5BUIA 4F6WA 4LOQA 3D14A 2JKOA 4OBQA 4BYJA 5B2LA 4G9RA 3O8TA 3Q53A 4RC2A 4EKLA 1XH8A 3TXOA 4YJRA 3E88A 4C2VA 3D2KA 2GMXA 3H9RA 1OUKA 3LOKA 3QLGA 4OTHA 4RWIA 2FH9A 4RQVA 5BVEA 5HCZA 2H96A 3DU8A 4I5PA 4JDJA 1X8BA 4M14A 3VJNA 1O6YA 5CXZA 3TUDA 3CR0A 3U6HA 3MSSA 3UE4A 3LFSA 5AR5A 1PXLA 5HX6A 4TNBA 4AQKA 3BBWA 5JFVA 3MA6A 3O96A 4IH8A 2OI4X 3BHUA 5A6NA 3FQSA 4D1ZA 4MBIA 1KE7A 3UQGA 4YC8A 5KO1A 4O4CA 4IW0A 4WRGA 3LFCA 3ZBFA 5JT2A 4I23A 3V5LA 2ZAZA 3M2WA 4EH7A 5E92A 4EH8A 4XBUA 3F7WA 2BRGA 3QYZA 1TVOA 4WD5A 3HRBA 5EG3A 1F3MC 2ZM4A 5L8JA 3Q9XA 3PRFA 3A8XA 5D7VA 3R7IA 2VX1A 3LW0A 3HMNA 2V5QA 4ZMFA 4CNHA 5KHXA 2R64A 1H1RA 3P23A 3UIBA 3NFGB 3NW5A 2OJ9A 3HAVA 1NVQA 3VS3A 4H3BA 2BAKA 4RWKA 2A4LA 4ANOA 5TKDA 2G2HA 2BROA 3AMYA 2A19B 2R3GA 1OMWA 3AC4A 3FYKX 2FO0A 4JQ8A 3FLQA 3DBQA 4U80A 5AM7A 3G6GA 1J7IA 5LARA 2BALA 2OBJA 4LOPA 3WZJA 4O81A 3KEXA 4QPSA 5EM6A 5EYDA 4Z3VA 4E8AA 5DT4A 1UKIA 2JD5A 4I20A 3HZTA 4MUQA 4AN2A 1CSNA 3R8PA 4S34A 2R3JA 5BVNA 4DGOA 5IH4A 2WTIA 4ARKA 4IB0A 5A4QA 5IA5A 3VJOA 2VUWA 4QEBA 4NH1A 4MXOA 3TZ9A 1Q5KA 4O22A 2PWLA 3OOGA 4DH7A 3FMMA 3FPMA 2J5FA 4TPTA 5JSMA 4BI1A 3QZIA 5FXSA 2F57A 4FKSA 3HECA 4IBMA 3HL7A 4ZSGA 5EDQA 4CRSA 5LMKA 3U6JA 3PUFC 2C4GA 3MBLA 5JRSA 1UNGA 2IW6A 5HNGA 3ZUTA 1AGWA 4LUEA 2X8DA 5EHYA 3R9DA 3WZKA 1JPAA 2CLXA 3ORNA 3G5DA 5FM3A 3UYTA 4QMUA 1VEBA 5A46A 5J1VA 5IQGA 3LVPA 4TNDA 2Y4IC 4I6FA 2JGZA 1L3RE 4BBMA 2W1DA 1OKWA 5AADA 4I5HA 3ZYAA 2OFVA 3NFFB 4XLIA 5D41A 3GOPA 1Y6BA 5HO7A 3E8CA 3NPCA 2I0YA 3KMMA 2PMIA 3IGGA 4J8NA 4UMTA 2XP2A 3ODZX 3LMHA 3NCGA 3MVJA 4JR7A 3BU6A 3OOMA 3PUPA 4OTWA 4NW6A 5DT0A 1ZMWA 3HVCA 3P5JC 5IEYA 4BCQA 3R01A 1H00A 3VVHA 3WF7A 3ACJA 4MD7E 4JI9A 2WTDA 4CMTA 5CU0A 4QYGA 1UU3A 3UIXA 4AOJA 1T46A 2CGVA 4F6UA 3DLZA 4JJRA 4EYMA 3K54A 3JVSA 4N6ZA 3D83A 2B54A 2F2UA 4DT9A 5FTGA 5HESA 3V6RA 2ZV9A 4E5BA 2VGPA 4UALA 4AZEA 3LCOA 3Q3BA 3CBLA 3KXGA 4CQGA 3NVKI 4L6QA 3VUTA 2G9XA 4OW8A 4BI0A 3DZOA 4FV0A 1H25A 4DLIA 3U4UA 5TO8A 2C69A 3ODYX 2IZUA 4M84A 5AEPA 4O7VA 5HD7A 5CAVA 4WOVA 4FUYA 2YERA 3FHRA 5M51A 5BVDA 2QOOA 2XIRA 3LMGA 4G3EA 3W33A 2VNYA 2OJFE 2GQGA 3F3ZA 4XG4A 1PMEA 3MH1A 4FYOA 4E20A 4NU1A 4BGHA 5FWKK 4JMQA 3W8LA 3UMXA 2JDVA 5HBJA 4KRDA 1WBVA 4F70A 3LFQA 5EQPA 1K3AA 4HVGA 4RQKA 5H8BA 2X7OA 5FEEA 4XRLA 3IKAA 1UNLA 1XH4A 2VWXA 4PDPA 2CKPA 2HYYA 1JSTA 2P0CA 4PMTA 5FP6A 5LWMA 2FSLX 2VTQA 1U5RA 2HCKA 2XMYA 2JIIA 3IW6A 3UNJA 5E4HA 4MXCA 3SHEA 2QLUA 4V04A 5IF1A 4QMOA 5I3RA 5DNRA 2QG5A 4J96A 3MV5A 4X0MA 1J1BA 3OP5A 1OGYA 3P7BA 3I60A 3QXPA 4IVAA 2W0JA 3BYMA 4BHZA 4DAWA 2UW7A 2PVFA 4XH6A 4RLLA 2B1PA 4Y5QA 3U87A 4PRJA 1I44A 3E8NA 4ZY5A 3LXNA 4OGRA 3UDSA 1T45A 5HD4A 4BZOA 5HIDA 2XK3A 4QOXA 4TWNA 4GS6A 4CKRA 2XM9A 4RJ7A 5FXRA 2QOIA 4PDSA 5FDXA 3LJ1A 4BIDA 5BYLA 3P4KA 2WMRA 1TQMA 2X2KA 3K5VA 3FHIA 2GHMA 4O6LA 2W7XA 4IAZA 4EUUA 4ZLYA 5HCXA 4H36A 4FKWA 4EOQA 4FIEA 3ZSIA 4H3QA 3CEKA 4ZZOA 2X9EA 4O27B 5H9BA 2Z7RA 4IX5A 4N70A 4DGLC 5TOZA 3MESA 2YITA 1YDSE 3OMVA 4LL0A 3UDBA 5JEBA 1OB3A 2OO8X 4ANNA 2VTSA 3A4PA 3G9LX 2OIDA 4RPVA 3THBA 2BPMA 2WMUA 5F94A 5AP2A 4E6CA 3OUNB 5KMMA 4DEBA 3FSFA 3RINA 2QONA 3L9NA 5E8XA 1U46A 5IISA 4ACHA 2W5AA 5DG5A 3VF9A 3BHHA 1SZMA 2PZ5A 4O6EA 1JNKA 4BICA 4UX9A 3WZDA 3PJ3A 4F78A 3ALOA 3HX4A 3PSDA 3ALNA 3R6XA 5IMEA 2X2MA 4O84A 3PWYA 4PDOA 5H8GA 4F6SA 4YC3A 4ZY6A 2CPKE 4UMPA 3CC6A 2QU6A 5CI6A 2X1NA 5IA3A 3MTFA 2VTMA 3PLSA 4GEOA 2C6KA 3VRYA 4AZWA 1MRUA 1DS5A 3HNGA 3OW4A 3OWLA 2UZVA 2W1FA 1IAJA 2EB3A 4EOOA 2QOFA 2P2HA 4AF3A 2XBAA 3QHWA 3UP2A 4AG8A 3FMNA 1QCFA 5BVKA 3OUKA 3ZO1A 2XAOA 3CS9A 4I1ZA 4QMNA 2SRCA 1MP8A 2WHBA 4QNAA 3UO4A 2NRUA 5JFSA 3G6HA 3GU8A 5CF8A 2PVLA 3R8VA 2VX3A 3OCBA 5JN2A 3CGOA 5AP4A 3G0EA 3TKIA 3ZFMA 4FTCA 3DAKA 4K18A 2WMWA 2B9HA 3TZ8A 3VAPA 2PVMA 2PVHA 3ERKA 5CEKA 3B2TA 2AUHA 4PV0A 3V01A 2BZKB 4AE6A 4CZTA 3KN5A 3DJ5A 4IB5A 3ZLYA 2GNIA 4JAIA 4KRCA 4HVIA 3DZQA 3AKLA 2YM3A 2VWVA 1PRYA 2QG7A 4DYMA 3P86A 3TMOA 2OXYA 5LVMA 5DE2A 3R7UA 3QQLA 4R3CA 1YDTE 3UNKA 4GFOA 2XNNA 4YLLA 3WYXA 3BLAA 5AR3A 1RDQE 2RFNA 1WBWA 2PVNA 3DAJA 3PXQA 1XMMA 2C1BA 2H6DA 3IDPA 3FKNA 4DHJA 2YIYA 2YA9A 2OICA 2PZPA 2OW3A 5FEQA 2GHGA 4FODA 2I0EA 3SVVA 3D5XA 3K2LA 3B2WA 4DBXA 4FF8A 3KXHA 4GK4A 1M7QA 2ITWA 4O86A 3BU5A 4RT7A 4MKCA 3NYOA 4G1WA 2BFXA 4KS7A 4OTPA 4Q2AA 4U97A 5L2TA 3AQVA 4FV2A 4F7LA 5KBQA 5CEPA 3A8WA 5HEZA 3RNIA 1GOLA 1IG1A 4LYNA 5HE2A 1JQHA 2JBOA 3A60A 3SRVA 3F5PA 3ZC5A 5EK7A 4ITIA 4WHZA 4ZTQA 5EYMA 1ZWSA 4IFGA 4YURA 3SOCA 1IAHA 5L2SA 2C6LA 4BL1A 4V0GB 4EYJA 5AWMA 4CFUA 2OF2A 4O82A 3PXKA 1JVPP 2WTKC 3KRXA 4O0RA 1J7UA 3MJ1A 4FSTA 4JOAA 5J9LA 3FDNA 3NNUA 3OVVA 5AJQA 3MH2A 4LFIA 5BX0A 3AD6A 3HMIA 3LE6A 2XH5A 4I5MA 4D5HA 5EQYA 1IA9A 2GTMA 4L7FA 3NNVA 4O7SA 1MQ4A 4FSQA 4RFYA 4DEEA 1REJA 5D10A 4QO9A 2XRWA 2IVVA 1ZYDA 3G2FA 4BB4A 2YM7A 4JDHA 2H9VA 1W2FA 4I93A 2JIUA 3NEWA 4QYHA 5ANGA 4Q5EA 4XP3A 1XBCA 4CG8A 4D0XA 2J0KA 3GC7A 4M67A 2XVDA 3IO7A 3QUEA 4JBQA 5CU4A 3GNIB 1XJDA 5FG8A 2WQNA 2CLQA 3ZBXA 2UW9A 5L2IA 2ONLA 3KL8A 4TZRA 1UV5A 4DFZE 3NUAA 5HE1A 2YM6A 3TCPA 4ZLOA 2YCSA 5CX9A 4P7EA 1H01A 2GNFA 3FYJX 3R1QA 2IN6A 4MXXA 5CZIA 3V5JA 2J9MA 2QLQA 5C8KA 3P7CA 3Q2MA 1V0BA 3PG1A 5FTQA 5T3QA 4U42A 1MQBA 4EK5A 3F3TA 4IVDA 4IX6A 5IQFA 3VUMA 1YQJA 2BAQA 2RIOA 1ZZ2A 4K8AA 3OY1A 4OBPA 5JRQA 5KBRA 1BL6A 3PIZA 2VRXA 4LG4A 3PJ2A 1JKTA 3KB7A 4UN0C 4AP7A 3NW7A 1Q61A 4FV8A 3KGAA 5DVRA 4BC6A 2C5OA 4R1VA 5M4CA 3GQIA 3FZPA 4JAJA 2VTOA 4FC0A 5C03A 5KMLA 1M52A 4GJ2A 5IMXA 5LVOA 1JWHA 1PMVA 2BRBA 3POOA 4GFMA 4U79A 5AAEA 2VO6A 4F0IA 3TN8A 4O83A 4CTCA 2G01A 5CAUA 4WO5A 4C4EA 4R6VA 5E8YA 5LCKA 4BBFA 2C6IA 2ESMA 3SQQA 3RCJA 3HRFA 2XKEA 1ZMUA 5F20A 4EJNA 4YGAA 3RKBA 2ZDTA 3RWQA 3QTQA 5CAOA 3VS1A 2UZTA 3RK7A 2RG6A 3MJ2A 4K6ZA 3Q2JA 5TF9A 2QOHA 3AD4A 3FMLA 3TZMA 4R3RA 2JFLA 3H4JA 3I6UA 4C4HA 1GZNA 3SD0A 2CGXA 4EOPA 4ZJVA 3HRCA 2WOUA 4IDTA 4NW5A 3I0QA 5KKRB 3A62A 3FMHA 1G3NA 5I9WA 4W4VA 1NY3A 3FY0A 3GOKA 2CNVA 2WMBA 4G3FA 3DCVA 2HW7A 4LQMA 2B52A 4ERKA 5L8KA 4GCJA 2F7ZE 5HTCA 3QRIA 2VV9A 4UBAA 2X9FA 3MW1A 5LVPA 4A9UA 3DQWA 3POZA 2J5EA 3UQFA 2A27A 5J8IA 5LMBA 2F7XE 3K5UA 1UU7A 4EK3A 4RRVA 3OWJA 1UWHA 2E9VA 1PY5A 3I7CA 3LQ8A 4QMSA 4W4YA 4FRFA 4QTAA 4CLJA 2A0CX 2VGOA 3KCKA 3NLBA 4IAFA 4O0UA 1DAYA 3ZDUA 4ZJJA 3P78A 3GP0A 4ACGA 4C4FA 4E1ZA 5HU9A 1OKZA 3F66A 3Q6WA 2JKKA 4IWDA 3ZEWA 1YXVA 2ETRA 2Z7SA 4O7YA 2BDJA 3CJGA 3GVUA 5L2QA 3FXZA 1PHKA 3CQUA 3RPOA 4DF3A 2HZ4A 5C27A 3QAME 4GW8A 4Y83A 4CZUA 3DOGA 2BILB 4LUDA 3BKBA 1H08A 5HE3A 4IFCA 3EQHA 4AQCA 5D11A 3S95A 4U41A 4J8MA 3RZFA 2XAMA 3MTLA 2Y9QA 2RFDA 3F5GA 4L43A 3ZRKA 3C4WA 3MI9A 2ETMA 4U44A 4AGUA 2GSFA <