3BLHA

Crystal structure of human cdk9/cyclint1
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
318
structure length
291
Chain Sequence
VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVEKEGFPITALREIKILQLLKHENVVNLIEICRTSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYLVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Cell division protein kinase 9
publication title The structure of P-TEFb (CDK9/cyclin T1), its complex with flavopiridol and regulation by phosphorylation
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 291
sequence length 318
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3blhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3blhA01
2O64A 2QNJA 3GENA 1FQ1B 4X2JA 3AC8A 3R7YA 2UZVA 3RBWA 3RZBA 2GNGA 4IVDA 4CFMA 5CF8A 3FHRA 1V0PA 4FKPA 3AD4A 3R1QA 3V3VA 4XV1A 3S00A 4XV9A 5M4IA 3UO5A 2GTNA 3WF5A 3ATTA 3R8VA 3ZOSA 4EHZA 2B9JA 3L9MA 4AN9A 3W55A 4AGCA 3PVWA 4PNIA 3A4PA 4BCQA 5GJDA 1WMKA 2G1TA 2B9HA 2VTQA 1CKJA 4FV6A 4DEDA 5M44A 2YN8A 3G0FA 4S30A 5AV2A 3V5WA 4OTGA 3ZM4A 2EB3A 3CQEA 1PJKA 4TN6A 5ETAA 2ITUA 4IB1A 4XOYA 2CN8A 4UZHA 5EW3A 4O21A 3LMIA 3AC5A 3AT4A 4GS6A 3L8SA 1Q61A 4GK4A 3O2MA 1JSVA 5CAQA 3E88A 3ZS5A 3R21A 1UU8A 4DG2E 4F70A 5HG8A 2HW7A 4CZYB 5KNJA 3IONA 3F7WA 2J0JA 3QD0A 1PMEA 1PKDA 3EJ1A 3EN6A 3SHEA 2C47A 1JBPE 2PYWA 3QUDA 2OXYA 3KF7A 2R64A 5KBRA 3NYVA 3MWUA 5BVEA 4O83A 2WMVA 4RQKA 2OJJA 2XUUA 4QTCA 4NJDA 3ORKA 4UXQA 2ZM3A 3KQ7A 3W33A 2AYPA 2RG5A 5BX0A 4EQCA 1UU9A 4EHGA 4E4XA 4M14A 3S2PA 3BYVA 4C61A 3TJCA 4CXAA 3BQCA 3DPKA 4CD0A 5CU3A 3FWQA 5ETFA 1OUYA 4FTAA 5AAFA 2UZBA 3OOGA 5A4CA 1GNGA 2UZOA 5AR4A 5HNBA 3E7OA 3HMMA 4TWPA 2R3HA 4B0GA 1BUHA 4OTDA 4JX3A 2C5OA 2ITPA 5HCZA 4AOTA 3VS0A 1OPJA 1FINA 1ZAOA 5FEDA 4I22A 3AMBA 3G0EA 2BZIB 4I21A 5JZJA 4ANNA 1W82A 2VD5A 3G6HA 3HRFA 4BZOA 4B4LA 3CEKA 1ZXEA 4RIWB 4RGJA 3QA0A 3WZKA 4D1ZA 3E3PA 2HAKA 3LLTA 5DR9A 4OT6A 5DBXA 2WQNA 4Q9SA 5CQWA 4BYJA 4I92A 3UYTA 3GBZA 2VO0A 4ZZMA 5E8XA 5BYLA 3MVLA 2W1CA 3QZHA 1H24A 4K77A 3QTUA 4AF3A 4N0SA 2BVAA 1PXLA 1NT2A 3GU4A 4LL5A 4DT8A 2CNVA 4R7HA 4BI0A 1EH4A 3ZFXA 4D4VA 2WGJA 5H2UA 4ORKA 5HO8A 3BEAA 3ENHA 3JR1A 3NCZA 2HOGA 3MY5A 1Y57A 3ELJA 3NUAA 2X9EA 1Q8WA 4DGNA 3VF8A 4Y5QA 4XS2A 4KABA 4YP8A 4CFFA 3BV2A 1XH4A 3ZDIA 3NUNA 1XH8A 4I0TA 5D9HA 3K3IA 1YWRA 2BDJA 4DGLC 5BNJA 1OI9A 3HUCA 5J87A 3GXLA 4QNYA 1JQHA 4FT7A 3E3BX 2H8HA 2HZ0A 3QTQA 3UGCA 3ZUUA 4V05A 2PULA 4KA3A 4U44A 5DIAA 3NVMB 4EQUA 2J6MA 4DH1A 3B2TA 4U0IA 5EHYA 1R1WA 4L43A 3ORIA 3OEFX 3UIUA 3VRYA 4UMPA 4H05A 5TT7A 5FEQA 3QQJA 4QYGA 2CSNA 1IASA 2FGIA 4E5BA 4XG3A 3IOKA 2XNGA 4QMXA 4ALUA 2UZDA 4IAAA 3MV5A 3FMJA 3VNTA 2EXCX 2W0JA 2OSCA 3CS9A 5DI1A 4YZMA 3GP0A 3SV0A 2JITA 4BZNA 1H4LA 2YWVA 4GVAA 3LMHA 3NCGA 4O7WA 2JBPA 3SW7A 3F3UA 4FT3A 1PXMA 2KULA 4FR4A 4QYFA 3F9NA 3G51A 4FTKA 1KV2A 3QTRA 4H39A 3FMDA 4IAKA 4EOQA 1KV1A 4RJ8A 1NVQA 1O6LA 4F9CA 5FM2A 4AZFA 2GMXA 1VZOA 3RJCA 1W98A 1KWPA 2ITYA 2VWWA 5JT2A 2WTKC 3MH1A 3WILA 2QONA 2JDRA 2BRMA 4RVMA 4L53A 4OR5A 3TIYA 3GU6A 4MWIA 4FKVA 1PYXA 3DJ7A 4PWNA 5HIBA 4ZJIA 3V5LA 4YTCA 3RALA 2R3FA 4ITHA 4YNOA 2QODA 2RL5A 4X3FB 3TJDA 5IQBA 1H01A 2VTLA 3UNKA 4W8EA 2C6KA 1U59A 2C0IA 2VTAA 5C27A 1M7QA 3Q52A 4TYJA 5HO6A 3ORLA 3S95A 1YVJA 1ZMWA 2BRBA 2F4JA 4WG4A 4Z7HA 4BWPA 4FSUA 3W32A 2BTRA 3BELA 3SLSA 3B8QA 1ZOHA 2BRNA 3EZVA 4Q5EA 5FXRA 3I0QA 1L8TA 5CSHA 4BKZA 2VUWA 1MRUA 3ANRA 4RFZA 5IA5A 1KE6A 3BGQA 3HZTA 2O0UA 2E9UA 2ITWA 5A4LA 2CCHA 3EKNA 5L3AA 4YJUA 1LUFA 2XJ2A 4HYSA 3SQQA 2W06A 2PVFA 1ZYJA 3F6XA 3HEGA 3IK3A 3DXPA 3UBDA 3BBTB 3V51A 4RA5A 4ANOA 4DN5A 4EOLA 1OZ1A 3U4UA 4RC4A 2XK9A 1SNUA 3KN6A 5EKOA 3FXZA 4Q9ZA 4ZTMA 4FUXA 2YLFA 4BL1A 1URCA 2O5KA 3MH0A 2UVYA 3KGAA 4R5SA 4HYUA 3R7IA 4GJ2A 2J51A 2V62A 2VWYA 3AG9A 5KBQA 5M53A 4BDGA 3KL8A 3FMEA 4MX9A 4TW9A 2A4LA 3COIA 3ULZA 5E8ZA 2B4SB 4ZY6A 3U9CA 1OM1A 3QCQA 4NCTA 3SRVB 4IAYA 3SX9A 4KIKB 4KKGA 3UOJA 5JGBA 1MQBA 1BMKA 3C51A 3PJ8A 4FEVA 5FGKA 2VWUA 3IW7A 2VWZA 4JIKA 3CJFA 3FI2A 3U87A 3IS5A 3OXTA 5CEMA 5E8TA 5HU9A 4CMTA 4L7SA 4PMSA 2HZ4A 2XKCA 3LM5A 4D2SA 3FAAA 3NUXA 3COKA 5K0KA 5HE1A 4BF2A 5BYZA 3VS3A 3P9JA 5L2IA 2B1PA 2RFEA 5KX8A 3ZLYA 1UNGA 2VO6A 3NSZA 3NW6A 4C4IA 1QPDA 3D5UA 2JDVA 1HCLA 3OCGA 4AS0A 5CF6A 3MH2A 2VGOA 3HV6A 3GCSA 3EQIA 4OTQA 5A6NA 5C03A 4DEEA 5CNNA 4WD5A 1X8BA 3FDNA 2YM7A 2BDFA 2W96B 5A54A 4EZ5A 1OKVA 2OO8X 2JDOA 5E8WA 5CY3A 3TNWA 4O82A 4EH3A 3HVCA 3ZO1A 3EFJA 5GNKA 4O27B 4BC6A 4E4LA 2ZM4A 4C3PA 3OWJA 4CFNA 3PY0A 5HX8A 5IDNA 3TNQB 2OW3A 3ALNA 5LVLA 1G8AA 4D9UA 3P79A 4YTIA 1U54A 3BYUA 3R7OA 3ZONA 5DOSA 4WG5A 4FTTA 4MWHA 3NX8A 5I5ZA 4FT5A 2XKFA 3PSDA 2NPQA 3QZFA 4D1XA 4HZSA 2BKKA 3Q6WA 3ZBXA 4X6RA 2QOBA 1FGIA 5KMOA 1SVEA 2QR7A 2FO0A 2GNFA 4RVTA 3GEQA 1VR2A 1Q8YA 3QGWA 5HIDA 5KCVA 3EL8A 5C9CA 2P0CA 1XHAA 2PMNX 3F66A 4OW8A 4BFMA 5K9IA 5A6OA 3OP5A 1Q8ZA 3NNVA 4RSSA 4FV4A 4PDYA 4PTEA 2GQSA 3ZRMA 2BCJA 2VX1A 4U43A 2BMCA 1WVYA 4LYNA 4MBLA 1H1WA 5HLWA 2W1DA 4GIIA 4PF4A 2IZRA 4K8AA 4NWMA 4Z3VA 3QXOA 4FZ7A 2UZWE 2XK6A 3E7VA 4P2KA 4AT3A 1JKKA 5L2TA 2YWPA 2GTMA 3PIZA 4ALWA 4BCIA 5EM5A 3H3CA 4ZK5A 3V8WA 3WE4A 1CKIA 2WTWA 3LFSA 4WG3A 3UNZA 5J79A 4DFUA 3LQ3A 3UPXA 2CKPA 2OJ9A 3EL7A 3RHXA 2W7XA 3MIAA 2XNPA 4FIEA 2VNYA 3TV4A 2WQOA 3DCVA 3F5UA 3DQXA 3LZBA 4Q2AA 5DR2A 2E9VA 5IQAA 2LAVA 3H0YA 2I40A 4A9YA 3KVXA 3HV5A 4AG8A 3EN4A 1IRKA 1QCFA 4GL9A 5AIKA 3UOKA 5IEXA 3T9TA 4V04A 2WTJA 3HV3A 3QAME 3LXPA 2YABA 4DBNA 1MUOA 2GPHA 2UUEA 4PDPA 4QP2A 4NYEA 3MYGA 4U41A 1BL7A 4FVPA 3RAHA 3BWFA 5CYIA 3C1XA 4EOOA 4C58A 4WHZA 2QHNA 3OF0A 3BU3A 3K5UA 4AZEA 2CGVA 1H28A 1HOWA 4OTHA 4BZDA 3QUPA 3I79A 4O7SA 3MPMA 4JDJA 4IX3A 2WTKB 2X0GA 3FYJX 2C69A 4KIOA 4M12A 5DLSA 1YKRA 4EUUA 1PXJA 1JWHA 3KEXA 3NW7A 4IB5A 4O6LA 5T6KA 3CGFA 4O7ZA 3TI1A 2BTSA 2PL0A 4N6YA 2R3QA 4D1SA 4BIEA 4YJNA 5LCJA 1GY3A 5EYKA 1XBBA 4O0SA 4I20A 1RDQE 5HO7A 5D12A 3WI6A 4TT7A 3I0OA 1R78A 2W5HA 2OH0E 3TTJA 4R1YA 3D7ZA 5AUTA 1IAJA 2CKOA 5IA1A 3QL8A 3FZPA 4V0GA 4QPSA 1E1XA 3FKNA 1RJBA 2V22A 4GFOA 4ZLYA 4MXCA 4I3ZA 1QL6A 4IZ5A 4APCA 1IAHA 4DYMA 3ZHPC 2B55A 4PNKA 3FMHA 1H0WA 5JFVA 3QRJA 2ESMA 3R9HA 5M57A 3UQCA 1OL5A 3COMA 3PSBA 2BAQA 4GVJA 4OTFA 2WXVA 4CFXA 2WEIA 4C38A 2WU7A 3IGGA 3QALE 2XB7A 5LMKA 1JOWB 4USEA 4J96A 4JAJA 5C4LA 4F7NA 2QHMA 4HJOA 3DJ5A 2O2UA 3OW4A 4TYGA 4GSBA 2OKRA 3PIXA 4FKQA 4TPTA 5BVDA 4GMYA 5CAUA 3DAEA 3UNJA 5AP7A 5CSVA 5DRBA 4C33A 4Z16A 4TYEA 5HNIX 3NNXA 5L6OA 4IAIA 4U45A 2X7OA 1ND4A 5CVHA 5IMXA 3ZUTA 4YU2A 2ZAZA 4OBOA 4WUNA 3ORXA 4BBFA 4DLJA 4M7IA 4FIIA 2PVMA 4BR3A 2J5FA 3FLQA 4TWCA 4B9DA 2GS7A 1GIJA 3FY2A 4C36A 2J0KA 4NM7A 5CI7A 3C13A 2JLDA 2R0IA 3Q4UA 3PZEA 2C5VA 5FM3A 4Y95A 3QQHA 4KBKA 1T46A 4DGMA 2G2FA 4RPVA 4ACCA 4AT4A 4DITA 3SDJA 2C68A 3R01A 2XK3A 1J7IA 4J97A 1IG1A 3D7TB 3TKHA 4D9TA 5JRQA 3HA6A 3VBYA 3IQ7A 4LOQA 4DTBA 3Q96A 1ZY4A 3E92A 4RG0A 3GU7A 4FKJA 4HNFA 4FKIA 3BWJA 1BKXA 1JKTA 2Y4IC 3G90X 1ZY5A 5GZAA 2OGVA 3BHTA 3F82A 3O8UA 4YC8A 3PVGA 4MK0A 5F20A 2O65A 2GU8A 1VYWA 5AP1A 4I4EA 2X6EA 1Q97A 3V8TA 1I44A 2XCKA 3M42A 5DWRA 5I9UA 5ANKA 3AT2A 5L6PA 3CY2A 3ZM9A 5KMNA 4CRLA 5DPVA 4F9AA 4D4SA 4PPBA 5D11A 4XG8A 3TUCA 3KXHA 4EL9A 5ACBC 4U40A 4KKEA 4UN0C 5EOBA 4IZAA 4GYIA 5HTIA 3QZIA 5JK3A 4G3CA 4ZTHA 3A8WA 5ANIA 3I1AA 3OW3A 3DKGA 4GK3A 2ZV8A 3VS1A 3I7CA 1U5RA 4F65A 1U5QA 5M56A 2R3OA 3L8VA 4GKHA 3DB8A 3V5JA 4FKSA 4K11A 3AXWA 4U42A 3GC0A 2Y8OA 3WZJA 3M2WA 4AE9A 5ITAA 1S9IA 1M2RA 4FIFA 4E3CA 3FMKA 4DT9A 3Q6UA 4ZTLA 4G3FA 4I6BA 1RW8A 1GZNA 2C0TA 4OUCA 1YOLA 4L3LA 1Y6AA 2VGPA 2O3PA 2XNBA 2G9XA 5AMNA 1W8CA 4YZ9A 2PUIA 2FSOX 4L6QA 4DAWA 4DEBA 4BI2A 4R3PA 4R5YA 1R3CA 4FTJA 4MVFA 2QKRA 4V01A 4F08A 4JRVA 4QP9A 3BRBA 2QOQA 4CKIA 2Z8CA 3ORPA 3QC4A 2VU3A 2P4IA 5IU2A 2YM5A 4U97A 5CT7A 1Q4LA 4UALA 2QC6A 3KA0A 4R1VA 4LG4A 3MY1A 4MD9E 4Y72A 5H9BA 4O0XA 5AJQA 1A48A 4NT4A 4NFMA 5CEIA 5ICPA 3F5PA 5J9LA 4YNEA 3Q60A 3QYWA 4BRXA 3GOKA 3OBJA 3MB6A 2BHEA 3NUPA 4RBLA 5L8JA 4BCPA 5AX3A 4L8MA 5EG3A 4FL1A 2WEVA 4QMYA 4XRJA 3JVSA 2W9ZB 3NLBA 2OU7A 4PL3A 5M51A 3FLNC 3HMIA 4ZZOA 2W1EA 1KOBA 4G5PA 4IH8A 4QD6A 4W8DA 1Q3WA 2WIPA 4NIFA 4RWJA 3VW8A 1KE8A 1UA2A 4G2FA 5IZFA 4J7BA 5AP6A 4IFGA 4YZBA 5B2MA 4NH1A 4S34A 2J5EA 3ORTA 4IJPA 4N70A 4XRLA 3VWAA 3ZSHA 5A4QA 4O7YA 5IMEA 4ZSGA 4MAOA 4N6ZA 4W4VA 3TXOA 3MY0A 4YTHA 5IH5A 1H00A 4TYHB 2YDKA 2VX0A 1VEBA 3K3JA 3CKWA 4IIRA 3LXLA 4XP3A 2B0QA 3C4WA 4D0WA 2I7QA 1YI4A 1TQIA 2HZNA 3NUYA 4YJTA 3VHEA 1H1QA 1ZYDA 3F5GA 3F5XA 4EH2A 3EQGA 3QTWA 4GK2A 4PY1A 4RFMA 4C37A 3R2YA 5EDPA 3ACJA 3T3UA 4ERWA 3QQLA 4BDJA 4CVAA 3GI3A 5JEBA 5C1QB 4ZZNA 1Q5KA 3F88A 5CZHA 4PDOA 4X2FA 2IWIA 1NVSA 2VTOA 3RVGA 5J9ZA 4EH5A 5KHXA 4AZTA 2GHGA 4GG7A 1FPUA 3UZTA 4HYIA 1GZOA 3SOAA 1R0PA 3DK7A 3W8LA 3D5XA 3QFVA 3HDNA 4FIJA 4AW5A 3OWLA 4FSNA 4KRCA 4M8TA 2XYUA 2ZMDA 3RP9A 5J7BA 1PXKA 3FYKX 3QTZA 3R8UA 2QU6A 4ANSA 4ERKA 4FYOA 5CU6A 4JR7A 2R3PA 4WKQA 1XBCA 1DAWA 4YBJA 4I4FA 4X2NA 5CSWA 4RQVA 1DS5A 3PDTA 2VV9A 2V7OA 3LCTA 3VW6A 4QTBA 3QRIA 4I5MA 5GZ8A 3O0GA 3MGYA 4GRBA 4F9WA 3PA4A 1PW2A 3AC2A 4FSTA 2ITNA 4GT4A 4HVIA 3PWYA 4BVUA 1YWNA 1CMKE 2W4KA 5DN3A 5GJFA 3VS6A 3WYXA 4AFJA 3LJ2A 3IW5A 3BLQA 3LJ0A 3DFCB 3QTIA 2IPXA 5EYDA 4A7CA 5J1VA 3UTOA 3LPBA 3TL8A 5DE2A 2UZUE 2CLQA 2PE2A 4KBAA 4H1MA 4IWOA 5B2KA 3WBLA 4FK6A 1U4DA 4EI4A 5AV4A 3OHTA 5AP2A 2OK1A 3MSSA 3JYAA 3HP2A 3N9XA 2WQBA 4FSWA 4ASZA 1H0VA 5BMSA 3TZMA 4RMZA 4UMQA 4F64A 4NM0A 2RIOA 1JSTA 1ZARA 2WU6A 3ZC5A 2BILB 5JRSA 3R9DA 4A4LA 5IISA 2Z02A 3SG9A 2PVJA 4CKJA 3KXMA 3P78A 5HLPA 4W4XA 4ACHA 2F2CB 2QKWB 2EU9A 2QU5A 3BU5A 3OWKA 2OIDA 2UZTA 3S3IA 2UZEA 3ROCA 3AC3A 2JD5A 4CCBA 2AC5A 1YXSA 1OUKA 1UU3A 3MN3A 5TR6A 5DVRA 1YRPA 4CQGA 2UVZA 2SRCA 1QPJA 5DEWA 3MTLA 4CTBA 4U8ZA 4M0ZA 3ETAA 4LMUA 1RE8A 4PP9A 4EORA 4I24A 2WMSA 4RWLA 1XWSA 3OXZA 4FKUA 4J8NA 1YW2A 2I1MA 5I9YA 4J8MA 1H1PA 3KXGA 4JAIA 5HKMA 3VUHA 2F57A 2AC3A 1ZLTA 2HW6A 3IG7A 3C4FA 4DEIA 3DKOA 2IVTA 2VN9A 4WBOA 4NM5A 4CMUA 4I41A 1XH5A 3U8WA 3P1AA 2Z7LA 5T68A 4CT1A 5H8GA 1YOJA 3BHVA 3CY3A 4UZDA 4LGHA 4F7SA 3QCSA 3U54A 2XA4A 2XBAA 3DB6A 4ZMFA 4JDIA 4NZWB 2R9SA 3CJGA 3BHUA 3E8CA 5K5XA 3GCPA 5BQ0A 2P55A 3UZPA 5HI2A 2OFVA 2J9MA 4ZTQA 4B99A 3I5ZA 3IW6A 2FB8A 3PJCA 4GT5A 3R71A 2I0YA 3PIYA 4I6HA 4K33A 5HIEA 4BDHA 5J8IA 4E4NA 4GYGA 2F7ZE 2RFDA 5LVPA 3Q4CA 3JY0A 4EBVA 3I6UA 4UY9A 5H8EA 4IC7A 1IA8A 2JAMA 4IB0A 4F0GA 5LQFA 3KFAA 3DKFA 4WOVA 4AUAA 2WB8A 3BKBA 4DCEA 3SKCA 3I81A 2P3GX 5L8LA 2X6DA 3NZ0A 4FIHA 4ASEA 4USDA 4FA2A 3KN5A 2ZDUA 3K2LA 4A9SA 4YLKA 2G15A 4FZ6A 3RNIA 1WVXA 3KMUA 5IDPA 2RFSA 4EZ7A 3SW4A 4AE6A 4AWIA 4XH6A 4BCKA 1KSWA 4QQ5A 4YSMA 4G34A 3SXRA 1YXUA 5AAGA 4M15A 3KRRA 4YLLA 2JFLA 2ZM1A 1PY5A 3A7HA 1APME 3O50A 5FD2A 4M13A 4CZUA 4AZVA 4HVHA 5HHWA 3DU8A 3LQ5A 4DA5A 3GFEA 4BN1A 4I94A 4GFMA 2R5TA 5CENA 3PVBA 2X7GA 3BX5A 4LV8A 3SA0A 4ANLA 1FMOE 1KE7A 3VQUA 2YCSA 5JFSA 3OBGA 2A27A 3C4XA 4MKCA 3IDBA 1Z9XA 4ZTSA 1XH7A 4XG6A 2J90A 4WA9A 5HCXA 5BUJA 3HA8A 1PMVA 3LMGA 5CTPA 4A9UA 2OXDA 4Y8DA 4PRJA 3A8XA 4DH5A 4PTCA 1KE9A 3ORZA 3OG7A 3PSCA 3CPCA 1G3NA 4XEYA 3FI8A 4CKRA 1SVGA 4RA4A 5D41A 4O91A 1VJYA 2C30A 4LUDA 5ANDA 2CN5A 2X2KA 3VJNA 1HCKA 2B53A 1SYKA 2WMAA 2R4BA 4JBOA 1WBTA 2HCKA 3R73A 4FV0A 3LLAA 4HPTE 2PVLA 3EOCA 4EH8A 5I9XA 5KMIA 2YM6A 5LVMA 3TKUA 2HY81 3R7GA 5DT3A 4D28A 4H3BA 4YTFA 4MNFA 4QYEA 4MHAA 3IW4A 5DMZA 4MBJA 1M2PA 3R9NA 4O96A 3QTXA 2Y6MA 3NRMA 3Q32A 4RJ5A 5EHOA 3PVUA 3TN8A 4EYJA 4CYJA 3HECA 4QMUA 1JPAA 2QG7A 4IWDA 3R63A 1PHKA 3FV8A 2JGZA 4YO4A 4AOJA 3II5A 3U6JA 4KIQA 4NTTA 5EHLA 3OD6X 1UNLA 3WOWA 4H3QA 5BMMA 4C02A 4FTUA 4EQMA 2VWXA 3G33A 3HP5A 2B7AA 3E64A 4PL4A 1JNKA 2Y9QA 2ZVAA 3EN9A 1Y91A 4KBCA 2W1FA 4S31A 4BDBA 2P2HA 4EJNA 3P4KA 4DHFA 3KCKA 4IFCA 4DFNA 5L4QA 2UZNA 5H3QA 2PZPA 5CT0A 4YHFA 2XNNA 2E9NA 4GU6A 4M84A 2PVHA 4XBRA 3UOHA 2E9PA 5EYMA 3FY0A 3NAYA 2WTDA 3S0OA 2BUJA 2UW3A 4JX7A 2JIUA 4KWPA 2C3IB 3IGOA 5LVOA 5GJGA 2IW8A 3W2OA 3QX2A 2R3RA 3OT8A 2C1BA 5AFVA 1XJDA 4FV9A 4D5KA 5E8VA 3F3VA 3GT8A 2BR1A 3TEIA 5CXHA 4JVGA 3WIKA 4A07A 3WE8A 4MXYA 5ANEA 5KZIA 4D2VA 1W83A 4YGAA 4C4EA 4C3RA 4FBXA 4FMQA 4HGLA 2Y6OA 3ZH8A 4FUYA 2Z60A 3E62A 4O0UA 3VF9A 4I93A 3QXPA 3Q9WA 4CCUA 4FE2A 3ALOA 4K0YA 3FXWA 4EOMA 2WPAA 4DGOA 2QVSE 3A7GA 3LKMA 5D1JA 4RZVA 4X2GA 3V5QA 5AR2A 3VQHA 4Y5HA 1PRYA 4E6QA 2YJRA 3IOPA 1WAKA 4GW8A 3VBVA 3G9LX 3DZOA 1WVWA 4USFA 3F61A 3QTSA 4GUBA 4PPAA 3DY7A 4QP7A 4CQEA 4PMMA 5IQGA 4AA0A 1WFCA 4KSQA 4FTMA 4WBBB 3MBLA 1PXPA 5TKDA 2XJ1A 1DM2A 1GJOA 1WBVA 1Q99A 3FXXA 3G5DA 3LIJA 3WIGA 1OKWA 2YM4A 3W2PA 2PU8A 2OFUA 4APPA 4UBAA 2VTJA 1B38A 3O17A 3TIZA 4L52A 5DEYA 3NNWA 3HNGA 4EH6A 2VO7A 4QRCA 4BCHA 3EFLA 2ERKA 3FMNA 4YO6A 2VWBA 4IWQA 2XIKA 4RX7A 3R8ZA 3PZHA 2YIXA 4QMVA 4C57A 4EUTA 5KO1A 1M52A 1ATPE 4O0TA 3W8QA 2YDJA 4FTQA 5D7AA 3GNIB 4R6VA 3ZSGA 5AADA 3WZDA 4LRKA 4YBKA 2YFXA 3MA6A 4AX8A 3DT1A 3ID6C 4NKAA 1GZ8A 1W7HA 1YHVA 5EDRA 3LJ1A 5IA2A 5IQHA 4A9RA 4GIHA 3LFQA 2YACA 3UG1A 4F6SA 3KKVA 3TT0A 3UP2A 2HENA 3HX4A 3IPHA 4FSQA 4I6FA 1IEPA 4MNEA 2XK8A 3RNYA 5HNGA 4AXAA 2QOHA 3ZRLA 2BHHA 2R3LA 2VTNA 5M4FA 4RIYA 5C4KA 3CXWA 5DGZA 3TUDA 2BFXA 3ENMA 2GNIA 4XG2A 4C7TA 4HVGA 3H4JA 4NCTC 3SXFA 2YA9A 4FSMA 3MFRA 4F6WA 4G16A 2F7XE 3VS4A 5GINE 2VWIA 4R3RA 2Q0BA 3CTHA 4RIOA 4PMTA 4IAZA 2YIWA 5FDPA 4DH3A 4U6RA 3ZO4A 5C26A 5M08A 3EMGA 4EKKA 3AD5A 2V7AA 4OGRA 3LVPA 5AAEA 4QQJA 3LCDA 3I7BA 3TNHA 2H34A 1H1SA 4D4YA 2ETKA 5K4JA 4XJ0A 3F69A 3A7FA 2OG8A 2RG6A 3KXXA 4RIXA 2F9GA 1J7LA 4X6QC 2I6LA 3RGFA 4CTCA 3NAXA 3UO4A 5AA9A 4XG7A 3C50A 5CQUA 4QMPA 1T45A 1ZOGA 3QZGA 4MD8E 2X9FA 3PG1A 4FOBA 4UV0A 3DTCA 3RZFA 2X7FA 3PWDA 1OIRA 5JKGA 3RPVA 2A0CX 4L01A 4GCJA 4IM3A 5H8BA 3N51A 4ACDA 4HCTA 4KB8A 4TKSA 3M1SA 5FLFA 5IEVA 2VWVA 4ZTNA 2VTSA 4XV2A 3FKLA 4GV1A 4BDFA 3QLFA 3Q5IA 1W84A 3N4TA 5HG5A 5I3RA 3UO6A 4NW6A 1M14A 3V04A 4B7TA 5HQ0A 4O1OA 3C0IA 3NS9A 3HKOA 2GS6A 1ERKA 2QOCA 3RI1A 4CSVA 2YM8A 3O71A 4OTRA 3QRTA 3WF9A 5CALA 1Q62A 3QUEA 3UG2A 4EOJA 3LFAA 4FODA 4ZJJA 3EFKA 3V6RA 4FG8A 3UC3A 2W5AA 3C0HA 4E93A 2G2HA 4JBVA 3OY3A 3FSKA 2ACXA 3PUPA 2WTIA 4DCAA 4OAUC 4DFBA 4I0SA 4HVDA 5KMJA 1WBNA 2XKEA 3HMOA 4EOKA 2W1ZA 3VULA 4WSYA 4FV7A 2GCDA 2WQMA 5JZNA 3W16A 3OVVA 2FYSA 3D14A 4TYHA 3UC4A 4D2PA 4FV2A 4E7WA 5HGIA 5HD7A 4FG9A 3PJ1A 3GU8A 1SVHA 3MH3A 3NIZA 2B9FA 2PSQA 2VTIA 3QWKA 2I0HA 3DAJA 3EH9A 4I5PA 4MXAA 4NW5A 5IA4A 2J4ZA 1K3AA 3Q9YA 3FZSA 2B54A 3FZRA 5CU0A 4L9IA 4JS8A 5IH6A 3H0ZA 3ZUVA 5BVWA 4AN2A 5HLNA 4M69A 5GHVA 4F7LA 1STCE 3RCJA 2FVDA 5CEOA 3QC9A 4AGDA 4EOPA 2KTYA 4PPCA 4CLJA 1E1VA 4ANMA 5CS6A 1O6KA 1GAGA 2V5QA 3A60A 3C4EA 3FSFA 5EH0A 1FVVA 3WYYA 5HVJA 3BQRA 3O51A 3CQUA 1Q8UA 2AUHA 3VS5A 4BCNA 5EI6A 3L9NA 4EYMA 1OL7A 4FKRA 2IG7A 4S2ZA 3GFWA 2QI8A 3R1NA 3DLZA 1MRVA 3LFFA 3ODZX 4ZSAA 4IQ6A 4XHKB 4NM3A 2ZYBA 5AA8A 3UPZA 3OEZA 4P5QA 3BYOA 1P4FA 2XRUA 3KULA 4XG4A 3B2WA 4XYFA 1Y8GA 5JQ5A 4RJ3A 2XS0A 4CG8A 1F3MC 2VZ6A 4FICA 5A46A 4UX9A 1ZZ2A 4XLVA 3PXQA 2FSMX 4Y73A 3UIXA 4QTEA 2G2IA 2XJ0A 5A4TA 1CDKA 3DK3A 1FMKA 1ZRZA 2W9FB 2QOKA 3MVJA 3D9VA 3D94A 5F1ZA 1ZYLA 1KUTA 1DAYA 3FMLA 3ORNA 4RWKA 5I3OA 3E5AA 5K4IA 4X2KA 4L46A 1PYEA 5L2QA 2IZTA 3TZ9A 3U51A 2J0IA 2Z7SA 3GC7A 3NYXA 4ITIA 4X7QA 3KF4A 5IEYA 2X39A 3D5VA 4YPDA 5TE0A 3POZA 3GC9A 4KINA 4R7IA 3ORMA 2XEZA 3T8OA 4NJ3A 3GU5A 4JNWA 5FQDC 5LMKC 3BBWA 4BGGA 3MJ1A 3KRXA 1U46A 3BLHA 4AGWA 2ONLA 4F0FA 4ZLOA 3FBVA 4ZXTA 4PL5A 1OECA 4F7JA 1AD5A 1FVTA 2BRGA 2R3MA 3MB7A 4FGBA 4J71A 3JVRA 5EDQA 4TL0A 3LHJA 4EEVA 4EWHA 3O8PA 5ANGA 5EM8A 1QPCA 5BVOA 5CVGA 1UKHA 3ZZEA 4G17A 2ITZA 2ZDTA 3RAIA 4G1WA 2DUVA 3AGMA 4FZFB 4P5ZA 4BDAA 1R0EA 4FEUA 4DINA 3AC4A 5AX9A 4RZWA 3GQIA 4YHJA 5J5TA 2IVSA 4L3PA 4DLIA 1YDTE 5FWKK 2C6DA 5HVYA 2ZJWA 4W4WA 4LI5A 5C01A 4IX6A 2V0DA 3MVHA 3VUMA 1GIHA 4BGQA 4BBEA 3NGAA 3SAYA 4AW1A 5KHWA 4NL0A 1PXNA 1Y6BA 2C5NA 2E9OA 1M7NA 5CZIA 3I5NA 4L67A 4ASXA 3BGPA 3G9NA 2RFNA 4IVCA 3WF8A 2LGCA 2JIIA 4FNXA 3ZCLA 4GEOA 1XO2B 4O6EA 5LJJA 2ONLC 2OZOA 3TCPA 3DXQA 3SG8A 1NA7A 3ULIA 2ITTA 1H1RA 4PMPA 2ITOA 4JDHA 4U3YA 4QMQA 5KUPA 1ZMUA 3THBA 2IO6A 4FV1A 4XOZA 5LOHA 5CAVA 2EWAA 5AUVA 4DFZE 5M07A 1JSUA 4U79A 3C5UA 4G31A 5AUYA 4O81A 5CXZA 4BDEA 3DBEA 4D5HA 5C8KA 5M4UA 4WRSA 1JKLA 3ZTXA 2YM3A 4FG7A 1I09A 4I1ZA 4IX5A 2YZLA 2UW5A 3NUSA 4C62A 2YIYA 4IJ9A 4IMYA 4QP1A 5FP5A 4BTKA 4KD1A 1W0XC 2WMBA 3R00A 5G6VA 1YDRE 3GGFA 4BCOA 3VBQA 2WNTA 3ACKA 4U81A 4N4SA 1PKGA 2BZKB 2GSFA 5CEQA 2BROA 3DNDA 3JY9A 2PE1A 2CJMA 1U54B 4FV3A 2ZOQA 3LCKA 4MH7A 4Z7GA 5CF4A 2A1AB 3EQFA 4LFIA 2IZUA 5TOZA 4FTNA 4JBQA 3RTPA 3P5KA 4D2RA 1Q41A 1OPKA 2UW7A 3HUBA 2EVAA 3EB0A 4RIWA 5I9WA 2C6EA 3H9RA 3M11A 3L9PA 5GZ9A 4E5WA 3WZEA 5LXMA 2ETRA 4LRJA 4YUQA 3OT3A 3PP0A 1Q8TA 5AUXA 1LEZA 3R04A 4CEGA 2CMWA 5F4NA 4H58A 1YXXA 3ERKA 5JQ8A 4ENYA 3Q53A 5HEZA 3SGCA 2W4OA 4QYHA 3ZMMA 2NP8A 4AA4A 5EQEA 1PF8A 2VTPA 3QYZA 3OCSA 3VUKA 5EK7A 3UZRA 4L68A 2H6DA 4I5CA 4FVRA 2YIQA 2ZMCA 2P2IA 3E63A 3P23A 3QBNA 4FC0A 4HZRA 4MCVA 2YEXA 2OBJA 1BYGA 4RWIA 3HDMA 1M2QA 2R2PA 3GUBA 2OH4A 5CAPA 2X4FA 4O7VA 1OITA 5LMBA 2WQEA 3BIZA 3GCVA 4DTKA 5LMAA 5IQIA 2WTCA 1WCCA 2ZV7A 4QP6A 4CNHA 3EKKA 3KMWA 3ZFMA 4E6CA 2XVDA 4FT9A 4C2WA 4F6UA 4GJ3A 2GQRA 2PWLA 3HYHA 4FTLA 2J50A 1DI9A 1PMUA 4I0RA 2PVKA 3W10A 1O9UA 2X2MA 3OC1A 1KE5A 3PXRA 4FTIA 2NRUA 1TKIA 2ZV9A 4EK5A 5JMSA 4HGEA 3AD6A 4KUJA 5HCYA 2IVVA 2RSVA 2QOLA 4E6AA 4QT1A 3FMMA 3FZ1A 3NYNA 4G9RA 4Y83A 3DA6A 5FXSA 4MTAA 4QO9A 4RX9A 1OIUA 3UJGA 3FUPA 1CKPA 1YQJA 1SM2A 3UVRA 4Y46A 4P7EA 2C6OA 2HXLA 2YERA 4K18A 4C3FA 1LP4A 3PRIA 2WELA 4F99A 4QMNA 4NKSA 3NVKI 4RVLA 3SC1A 2PUPA 2X4ZA 4FGRA 4YC6A 1JLUE 3ZDUA 2G01A 3DOGA 4DEAA 1JKSA 4J53A 3ZFYA 4FTOA 2FUMA 2PMLX 4DEGA 1JAMA 2JAVA 3NWWA 4O1PA 5HOAA 2O63A 2DWBA 3AOXA 5CU2A 4IVBA 4A4OA 4ZP5A 3RM6A 4II5A 1UWJA 1NVRA 2FH9A 3TDVA 3BEGA 3CD8A 3HMNA 4MXOA 3PG3A 4FSYA 2W99B 5ETIA 4HGSA 3JS2A 1WZYA 3ZEPA 3V5PA 3TZ7A 5JSMA 2GS2A 4FKLA 1Q3DA 5E8SA 4BWKA 4RX5A 4X3FA 2YDIA 5LWNA 4AU8A 4O0RA 4DFYA 2BDWA 1WBOA 2W1IA 3PE2A 4G3GA 5HBJA 5CI6A 4EK8A 3JXWA 3HMPA 5CEKA 3A99A 3NW5A 2ITXA 2I0EA 4ID7A 4S33A 3DGKA 2R3KA 3PJ2A 4JLCA 5LVNA 2JKQA 3BI6A 4ZEGA 4BGHA 1YI3A 3KK9A 3KK8A 2XBJA 2Y4IB 2OF2A 3CTJA 4Z9LA 3DTWA 3HAVA 5DRDA 2CPKE 2GNJA 4WRGA 4YJRA 4MXXA 3UDBA 3O23A 4YZNA 2QD9A 4FIGA 3AMYA 4OT5A 5IQEA 1F5QA 3ZLXA 4EH9A 4BHZA 4I5HA 3EN5A 4DTAA 2XMYA 1QPEA 3C4CA 3MIYA 4M67A 3R8MA 1H26A 3KREA 4H1JA 4QQCA 1BLXA 3TUBA 4ZLZA 2XYNA 3FLZA 5HTCA 4RLLA 1TQMA 3HAMA 2GQGA 2YITA 2HIWA 5CANA 1L3RE 2R3NA 4FI1A 4FOCA 4MXZA 3L8XA 3RPRA 2WMUA 3PY3A 4G3DA 2OZAB 2GNLA 2BZJA 4UB7A 4D4RA 3ZEWA 3MDYA 3A4OX 1BX6A 5L6WL 2WMWA 2XKDA 2YCRA 5EOLA 4LM5A 4RC2A 4BTJA 1G8SA 2QR8A 1G5SA 4DE4A 4PTGA 1XQZA 3CGOA 3SRVA 3EHAA 4TY1A 3LFDA 2Q0NA 2B9IA 4E6DA 4S32A 4KIKA 1SNXA 3EQDA 5KMMA 2CDZA 3Q04A 3VC4A 5EYCA 4FVQA 2NRYA 4YURA 3ET7A 4DF3A 5IQDA 3NR9A 5EM6A 4CFVA 4ZSLA 4I23A 3A7IA 4IANA 4UMRA 5BYYA 3F3TA 4ZAUA 2XK7A 4QYYA 5FDXA 4TWNA 3DK6A 5ETCA 4R7BA 2PVNA 3C7QA 4DGGA 3C9WA 4JDKA 4OTIA 3W2SA 2YIRA 4XMOA 5EW9A 3I4BA 4JQ8A 5DFPA 4AW0A 2C3KA 1H27A 1WBWA 3MFUA 4C4GA 3CR0A 3Q9ZA 4YLJA 2PVYA 3QRUA 5IG1A 5DT4A 3DAKA 3KC3A 3TACA 4EK4A 5K0XA 2HWPA 4W9WA 4O7LA 4CGAA 3GB2A 4WNOA 3ZXTA 3FQSA 2WO6A 3OZ6A 4ZIMA 4IZYA 2UV2A 2UW8A 1UVRA 3MVMA 3TKIA 3RKBA 2ZB1A 3HLLA 4YC3A 3A62A 1OGUA 4O0WA 3VAPA 5HORA 5FTGA 4ZS4A 5JH6A 2YCFA 2RF9A 2UW4A 2HWOA 5DH3A 2EUFB 5HTBA 3R7UA 5JGDA 2JBOA 2E2BA 4OTWA 5TO8A 3FC2A 3R83A 3FL4A 4DH7A 3ZU7A 4DFXE 5JGAA 4XNEA 3R8LA 4M0YA 1OBDA 4E4MA 2EXMA 1F0QA 3UIBA 3UVQA 5IKWA 3G2FA 3RPSA 3WF7A 3CCNA 3QQUA 4BCMA 2ZB0A 4LL0A 2WMXA 2XF0A 4MEDA 4MF1A 5M4CA 1J1CA 2GNHA 2UW0A 4FNZA 5ANJA 3EQPA 2NO3A 3O7LD 4RFYA 4Z55A 2VAGA 2JDSA 4TNDA 5M09A 5KE0A 3TM0A 4BYIA 1Z5MA 3PYYA 3UQFA 3FHIA 4L44A 3PRFA 4QP4A 1GIIA 4XX9A 5IH4A 3QHRA 4WNKA 2QURA 4X3JA 3G6GA 4C35A 2FA2A 5HE2A 3MTFA 3F3WA 2WHBA 3R0TA 3D15A 4ZS0A 2XM8A 3QKKA 4YHTA 4KS8A 3VBWA 1YDSE 3LCOA 3QWJA 4FF8A 4O2PA 4FSZA 4Q5HA 3KB7A 4GG5A 4RJ6A 4EONA 3LQ8A 3EQBA 1OMWA 2Z7QA 3FPMA 3JUHA 3VS7A 4YMJA 3OTUA 5A14A 4FKGA 5E1EA 2PPQA 2C6IA 2ITVA 4NIFB 2HK5A 3DQWA 1IR3A 1OKZA 2PUNA 5J95A 2PMOX 2XNMA 3QD3A 1J3HA 2X81A 3IDPA 2VTTA 2BAKA 5JN2A 2CKQA 4RC3A 4ZSEA 5F95A 4IDTA 5G1XA 5HESA 3QCXA 4DC2A 4J1RA 4K1BA 4X21A 3ZC6A 4HW7A 5KMLA 3ZBFA 3DBCA 1Q24A 5KMKA 5IPJA 1R39A 4AQCA 5GIPE 3R8PA 4YPSA 3MPTA 1AGWA 3OWPA 4OBPA 4QMLA 2PZ5A 1OVEA 3IO7A 3QD4A 4ZOGA 3S4QA 3OCBA 3D2KA 2YZAA 4N57A 3H9OA 5AR8A 2QCSA 4QPAA 2C1AA 3A61A 4D0XA 4FL2A 2C5XA 3R22A 3Q2JA 2IW6A 1OL6A 4FL3A 5I9ZA 2UVXA 2GHLA 2VO3A 4QMZA 3QRKA 2V55A 4UMUA 2Y0AA 3VUDA 2X8IA 4JJRA 3VS2A 1UKIA 2RKUA 3E8DA 4EHEA 4K9YA 3QD2B 4TYIA 1NXKA 3L1SA 5CNOA 3V01A 3TNPC 3GCUA 4ASDA 3VO3A 4R3CA 1OB3A 2XM9A 5KZ0A 1OIYA 4HCVA 3TZ8A 4R77A 2QOOA 4QMTA 1NW1A 2J7TA 3D5WA 3QGYA 5K5NA 1NY3A 3PFQA 3Q4TA 5HBEA 2BIKB 2OF4A 2PK9A 2O8YA 3F3ZA 3KRJA 3LM0A 3FLSA 3DS6A 2OIQA 3PLSA 4RVKA 3V8SA 3WF6A 5L2SA 2NNWB 3DFAA 3BYSA 3PE1A 3NNUA 1PMNA 5DT0A 1OIQA 1UWHA 4L45A 4F63A 2QG5A 3BCEA 3UMWA 4GUEA 4PQNA 5EM7A 3OMVA 5AR3A 2BAJA 1PXOA 5HICA 4B8LA 4YSJA 3NEWA 2JFMA 2PZYA 3BV3A 4G6NA 4IM0A 2QQ7A 3EQRA 5CX9A 4CV9A 3PJ3A 1XR1A 3BHHA 4NK9A 4WT6A 1J7UA 3E8EA 2CKEA 4JQEA 4JBPA 5AV3A 4D2TA 4WIHA 1FVRA 2VNWA 4R78A 2XIXA 4ACMA 4EC8A 1URWA 3U55A 2R3JA 3FE3A 4P90A 1K9AA 2YISA 1ZYSA 2WTVA 4ZY5A 3VN9A 3ZZWA 4UEUA 3OROA 3SVVA 4O84A 3R02A 3FJQE 2HZIA 3D7TA 5EFQA 5E4HA 3NUUA 3E8NA 3DBFA 4NFNA 4OAVB 4A4XA 2HELA 4BI1A 5CSXA 5DR6A 3KVWA 3LXNA 3EYHA 5E90A 3QKMA 4MQ2A 5IQFA 3TG1A 4F1TA 1V1KA 4IADA 4IXPA 5CEPA 5ACKA 3NIEA 4GKIA 2REIA 3C4ZA 3IDCA 4F0IA 4RX8A 5AUWA 4EBWA 3A7JA 3OUNB 4FEXA 4BTFA 3POOA 5CWZA 3RWQA 2IJMA 1OL1A 4C59A 2C4GA 1H07A 4BIBA 1CTPE 3UIMA 3MA3A 2DYLA 1CSNA 2DS1A 4BICA 3GQLA 4PDSA 4ANBA 4C2VA 3EQCA 2A2AA 4IBMA 4WUAA 5E92A 4O0YA 3RK9A 3P7BA 4QNAA 5FBOA 5HU3A 4LQMA 4O7TA 3CC6A 4IDVA 4EHVA 3LOKA 4EK6A 2JC6A 2PVRA 2UZLA 3BGZA 3E87A 3PXKA 5T3QA 3SOCA 5F9EA 1MP8A 3P86A 4LOPA 3CD3A 3R30A 2PUUA 4UMTA 5E91A 3HV7A 3KXZA 3P7CA 2UW9A 3V6SA 5F94A 3QHWA 3KU2A 4U5JA 4WNMA 4FT0A 5AR5A 4O0VA 4EZ3A 3RINA 4NU1A 4XG9A 3VIDA 2JEDA 4FZDB 2CNQA 3ZO2A 4JG7A 2B52A 2C6MA 3BLRA 5D10A 5TF9A 1SMHA 4IZ7A 1ZYCA 2H9VA 2J0MB 4KS7A 5FTQA 2BIYA 2QO9A 3D2IA 3EWHA 4HGTA 5I9VA 4QMWA 3QKLA 1BI7A 5C8NA 2FSLX 3QQKA 4JI9A 4D55A 3Q4ZA 4BCJA 2VTRA 5BVNA 4ARKA 4TXCA 2HXQA 2I0VA 4FEQA 4UXLA 3UODA 3U6IA 3U9NA 3Q9XA 4MD7E 2XIZA 2PY3A 4OLIA 4ZSJA 4FK3A 2ZV2A 3ZXZA 5IA0A 3D4QA 2H96A 4Y85A 1WBPA 2WIHA 4BKJA 4QQTA 5A9UA 2X1NA 4YJOA 2WAJA 1YI6A 4AW2A 2J2IB 3PXFA 4XBUA 3VJOA 4K2RA 3HRBA 4CG9A 3DDQA 4AN3A 5DA3A 1TQPA 3SXSA 4A9TA 3RK7A 3RAWA 4QPMA 5AP4A 4DFLA 2GFCA 4ZMEA 4CT2A 4JRNA 4RT7A 3EZRA 1OBGA 4IC8A 4CZTA 3KMMA 2BPMA 5HX6A 2UW6A 4IX4A 4J95A 5AP5A 3NPCA 3EFWA 3KY2A 1XH9A 3NYOA 4NEUA 2XIRA 5IUGA 3FLWA 2X2LA 3VUGA 3CE3A 2XNEA 4C4FA 1P4OA 4O86A 2OXXA 3MS9A 1MQ4A 5B2LA 3N4UA 4HCUA 3VUIA 1MRYA 1RQQA 1V0OA 4FNYA 3R7EA 4AAAA 4BY9E 5IQCA 2BKZA 4FV8A 1J91A 4M68A 3W1FA 2F2UA 4JT3A 1DI8A 4BDIA 3OY1A 4ENXA 4GH2A 3GC8A 3I6WA 5B7VA 3ROYA 4C4JA 3HRCA 4G3EA 4CYIA 3V5TA 3CP9A 3KCFA 1B6CB 2EXEA 1LR4A 2YAKA 4NTSA 4ZTRA 4ZY4A 3HL7A 5BPYA 3ATSA 3EN7A 3MI9A 3ZLSA 2XEYA 3FZTA 1XKKA 4JQ7A 4J52A 1FOTA 3DBQA 5HE0A 4ITJA 4K6ZA 4M97A 1P5EA 3ZO3A 5EKNA 3HV4A 5FUTA 3QLGA 3NMUF 4QMOA 5FBNC 3P08A 4GT3A 4JG6A 3RMFA 3LXKA 2WMTA 4BCGA 3OCTA 4DG0E 2ETMA 4X0MA 4W4YA 5EI8A 5E9EA 4O38A 3LAUA 5DNRA 4BB4A 3R28A 3FEGA 3A2CA 3T3VA 1YOMA 4BDCA 1K2PA 5DHJA 4MF0A 3W18A 3D83A 1AQ1A 4ALVA 3TV7A 5D7VA 5HZNA 1P14A 4IHPA 3QA8A 3REPA 1H25A 3GOPA 5AM7A 4G9CA 2PHKA 3T9IA 5CSPA 4E1ZA 4E26A 5J7HA 3DBDA 1QMZA 2ERZE 3DZQA 3FLYA 5HBHA 5BUEA 5KKRC 4D58A 3OUKA 3Q3BA 5AUZA 3PY1A 3SD0A 2OJGA 3FC1X 1UNHA 2BFYA 2Z7RA 2YLEA 5DG5A 2WMRA 3QQGA 3D0EA 1H08A 2OIBA 3JPVA 1CM8A 1REKA 2C0OA 3LFBA 4IVAA 4BDDA 5IA3A 4F9YA 4UWYA 3BU6A 3MJ2A 4EWQA 4TTHB 4HNIA 3R1SA 2W17A 5JFWA 2HYYA 3ZLWA 4XCUA 4EK3A 4FZAB 4UWCA 2JKOA 4HYHA 4E5AX 4AOIA 4YR8A 3CBLA 5CVFA 4YZDA 3OS3A 3MW1A 4DG3E 4BBMA 3W2QA 2R7IA 3FL5A 3H10A 4FTCA 4LMNA 4JOAA 3TDWA 3UMXA 5CLPA 3IKAA 1E9HA 4J98A 4BCFA 4CV8A 2OWBA 5CASA 2BZHB 4XLIA 3LFNA 4L7FA 3PPZA 5J9YA 5EQYA 4GFGA 2OICA 4EC9A 4E20A 4QOXA 2WKMA 4R8QA 4WO5A 3RPOA 5K3YA 4IWPA 1REJA 3TNIA 3VUTA 2R3GA 3R9OA 4EJ7A 4HPUE 4QP8A 3BZ3A 3CTQA 3LFEA 3R1YA 4NUSA 3PTGA 5I0BA 3MFSA 3BYMA 3NDMA 1Y8YA 2W1HA 1XBAA 3BE2A 4TZRA 4XP2A 5IF1A 3KRWA 1V0BA 3CKXA 4G6OA 1IA9A 2CCIA 4FKTA 4YZCA 2WZJA 5B0XA 2OZAA 4UYNA 4KRDA 4GU9A 4KKHA 1GZKA 4FEWA 1ZOEA 3FPQA 3UE4A 5EI2A 4JR3A 5DYJA 3BPRA 2QO2A 3K5VA 3RM7A 3RWPA 4QMSA 4KIPA 4AGUA 4CLIA 5HG7A 3N4VA 4L00A 5A4EA 4XUFA 3QQFA 2PE0A 5I4NA 5IUHA 4YJSA 1YHWA 3VHKA 1VYZA 3PA3A 2WD1A 4OBQA 1WBSA 5EW8A 4C0TA 2VTHA 2IZSA 3OOMA 4F09A 5M06A 3L9LA 3EIDA 4H3PA 2Y7JA 3CLYA 2CHLA 1ZMVA 2C5YA 4CRSA 4LRMA 4AZWA 4B6LA 4CFWA 3UYSA 1P2AA 1YWVA 2PMIA 2QOFA 2VX3A 4G6LA 2OLCA 3H9FA 4TRLA 5ANOA 2JKKA 2YCQA 4YJPA 4MNEB 3RCDA 2XZSA 1LPUA 3UQGA 1S9JA 4WNPA 5AM6A 3W2CA 2DQ7X 2GDOA 3TV6A 4RIYB 4RJ7A 3QCYA 4CFUA 4FV5A 2OJIA 1BI8A 4HOKA 3PP1A 2Z2WA 2XK4A 3VBXA 4LGGA 3AC1A 3R2BA 4I6QA 3B8RA 4QP3A 4C34A 4MBIA 4F1MA 5FEEA 2JDTA 3MFTA 3OTVA 4UWBA 5JFXA 3FQHA 4BWXA 2GFSA 3FI4A 4FYNA 4KAOA 3VVHA 4AA5A 4O2ZA 4WSQA 5AEPA 2CGUA 5AV1A 4AT5A 2R3IA 4CMOA 3F7ZA 3RHKA 4O7RA 1SZMA 3LCSA 4FNWA 5CF5A 4U9AA 2XNOA 3W2RA 5E8YA 4EOIA 2YHVA 3PPJA 1XH6A 3IW8A 1TVOA 1FBNA 2YJSA 3E93A 4RIXB 2PZRA 1B39A 3PXYA 4QMMA 3TTIA 2QLUA 2R7BA 2XIYA 2J0LA 3DDPA 5AV0A 3WZUA 2F49A 4DH8A 5EQPA 3AMAA 4IACA 1OL2A 1YXVA 3O96A 3GCQA 3BE9A 4PX6A 4IB3A 4LOOA 3AT3A 3GVUA 4RLKA 4P4CA 4F1OA 1A9UA 5HG9A 1OPLA 4FSRA 2W1GA 4IEBA 1H8FA 4L3JA 5CAOA 4U3ZA 5HD4A 3RPYA 1Z57A 3ANQA 4FKOA 5HE3A 3DLSA 4ACGA 3CQWA 3LE6A 4AP7A 3R9RA 4W9XA 2WOUA 3UOLA 1A06A 1BL6A 2PZIA 3FI3A 4IE9A 1GOLA 2FSTX 4DBXA 4BTMA 3ODYX 4QTAA 3QF9A 2OJFE 3C0GA 4ONAA 3MESA 4C8BA 4F4PA 3DKCA 1ZZLA 3IECA 4E73A 3FQEA 1UU7A 2WMQA 4U80A 4D2WA 5J1WA 4LV5A 5A3XA 2CGWA 2IW9A 2CNUA 3EQHA 1J1BA 2W4JA 3PXZA 2ITQA 5AP0A 3DXNA 4M66A 2R0UA 3AGLA 2F7EE 5BVFA 2JIVA 3L8PA 3Q5ZA 3VBTA 4QTDA 4RRVA 2HY0A 4RJ4A 3I60A 4J99A 5J5SA 4EH4A 3DV3A 5FP6A 2OI4X 5LARA 2QOIA 3KXNA 3KRLA 5FRIA 4FX3A 5GIOE 3R7VA 5L8KA 2XRWA 3C5IA 5FTOA 3PLAE 5KKRB 4PV0A 3COHA 4ANQA 3WARA 3Q2MA 5HVKA 4A06A 4IAFA 4JL9A 4FTRA 5AIRA 5AP3A 1LEWA 3F2AA 3EYGA 3O8TA 2W5BA 4M3QA 2P33A 4PP7A 3AQVA 2CGXA 2GHMA 3QX4A 2WOTA 3LW0A 5C8MA 3DNEA 3ZYAA 4EH7A 5AUUA 3U6HA 2IN6A 5E1SA 2EB2A 3QU0A 4DEHA 5FG8A 3S1HA 2Y4PA 2X8DA 4M69B 4V0GB 5AWMA 4ZJVA 2RGPA 4LGDA 4L42A 1KOAA 4MYGA 3G15A 3P0MA 2BALA 5M55A 3HGKA 5CU4A 2C6TA 1JVPP 4TWOA 2YAAA 4U7ZA 4E8AA 4TNBA 1UV5A 2BRHA 4KNBA 2XP2A 4FKWA 5E8UA 4AACA 4F9BA 3P7AA 3CPBA 2JKMA 4XP0A 4JG8A 3ITZA 2QLQA 2XH5A 3TWJA 5LCKA 3UP7A 4BKYA 2C3JA 4IW0A 3CSVA 2C6LA 2XCHA 2W05A 1YXTA 2Q83A 2A19B 2IVUA 2QO7A 3OFMA 5BVKA 4BIDA 3PA5A 1M17A 4PUZA 1OKYA 4EKLA 3VRZA 1ZWSA 3KULB 3R6XA 4YJVA 5FXQA 3CIKA 4OTPA 4LUEA 2VRXA 2VTMA 5LWMA 3LFCA 4G5JA 4B8MA 4BDKA 4C4HA 3H30A 5BUIA 4AFEA 4MQ1A 1PXIA 4O22A 3BHYA 4YJQA 4O7NA 4BHNA 4KSPA 4HVSA 5E7RA 3UVPA 3MPAA 4JIAA 3RAKA 2X8EA 3DJ6A 4IM2A 3F2NA 5IUIA 2C3LA 3O7LB 2PTKA 5AR7A 1YHSA 2WFYA 3FKOA 4EOSA 3U4WA 2CLXA 3K54A 4XV3A 4H36A 1FGKA 1O6YA 3PPKA 3RK5A 3ZRKA 4AZSA 3FZOA 3ZSIA 4JXFA 4NSTA 4X3FC 3F2RA 3OXIA 5L2WA 4UYAA
chains in the Genus database with same CATH superfamily
2O64A 2QNJA 3GENA 1FQ1B 4X2JA 3AC8A 3R7YA 2UZVA 3RBWA 3RZBA 2GNGA 4IVDA 4CFMA 5CF8A 3FHRA 1V0PA 4FKPA 3AD4A 3R1QA 3V3VA 4XV1A 3S00A 4XV9A 5M4IA 3UO5A 2GTNA 3WF5A 3ATTA 3R8VA 3ZOSA 4EHZA 2B9JA 3L9MA 4AN9A 4O4BB 3W55A 4AGCA 3PVWA 4PNIA 3A4PA 4BCQA 5GJDA 1WMKA 2G1TA 2B9HA 2VTQA 1CKJA 4FV6A 4DEDA 5M44A 2YN8A 3G0FA 4S30A 5AV2A 3V5WA 4OTGA 3ZM4A 2EB3A 3CQEA 1PJKA 4TN6A 5ETAA 2ITUA 4IB1A 4XOYA 2CN8A 4UZHA 5EW3A 4O21A 3LMIA 3AC5A 3AT4A 4GS6A 3L8SA 1Q61A 4F78A 4GK4A 3O2MA 1JSVA 5CAQA 3E88A 3ZS5A 3R21A 1UU8A 4DG2E 4F70A 5HG8A 2HW7A 4CZYB 5KNJA 3IONA 3F7WA 2J0JA 3QD0A 1PMEA 1PKDA 3EJ1A 3EN6A 3SHEA 2C47A 1JBPE 2PYWA 3QUDA 2OXYA 3KF7A 2R64A 5KBRA 1W2DA 3NYVA 3MWUA 5BVEA 4O83A 2WMVA 4RQKA 2OJJA 2XUUA 4QTCA 4NJDA 3ORKA 4UXQA 2ZM3A 3KQ7A 3W33A 2AYPA 2RG5A 5BX0A 4EQCA 1UU9A 4EHGA 4E4XA 4M14A 3S2PA 3BYVA 4C61A 4I6LA 3TJCA 4CXAA 3BQCA 3DPKA 4CD0A 5CU3A 3FWQA 5ETFA 1OUYA 4FTAA 5AAFA 2UZBA 3OOGA 5A4CA 1GNGA 2UZOA 5AR4A 5HNBA 3E7OA 3HMMA 4TWPA 2R3HA 4B0GA 1BUHA 4OTDA 4JX3A 2C5OA 2ITPA 5HCZA 4AOTA 3VS0A 1OPJA 1FINA 1ZAOA 5FEDA 4I22A 3AMBA 3G0EA 2BZIB 4I21A 5JZJA 4ANNA 1W82A 2VD5A 3G6HA 3HRFA 4BZOA 4B4LA 3CEKA 1ZXEA 4RIWB 4RGJA 3QA0A 3WZKA 4D1ZA 3E3PA 2HAKA 3LLTA 5DR9A 4OT6A 5DBXA 2WQNA 4Q9SA 5CQWA 4BYJA 4I92A 3UYTA 3GBZA 2VO0A 4ZZMA 5E8XA 5BYLA 3MVLA 2W1CA 3QZHA 1H24A 4K77A 3QTUA 4AF3A 4N0SA 2BVAA 1PXLA 1NT2A 3GU4A 4LL5A 4DT8A 2CNVA 4R7HA 4BI0A 1EH4A 3ZFXA 4D4VA 2WGJA 5H2UA 4ORKA 5HO8A 3BEAA 3ENHA 1TZDA 3NCZA 2HOGA 3JR1A 3MY5A 1Y57A 3ELJA 3NUAA 2X9EA 1Q8WA 4DGNA 3VF8A 4Y5QA 4XS2A 4KABA 4YP8A 4CFFA 3BV2A 1XH4A 3ZDIA 3NUNA 1XH8A 4I0TA 5D9HA 3K3IA 1YWRA 2BDJA 4FRFA 5BNJA 1OI9A 3HUCA 5J87A 3GXLA 4QNYA 1JQHA 4FT7A 3E3BX 2H8HA 2HZ0A 3QTQA 3UGCA 3ZUUA 4V05A 2PULA 4KA3A 4U44A 5DIAA 3NVMB 4EQUA 2J6MA 4DH1A 3B2TA 4U0IA 5EHYA 1R1WA 4L43A 3ORIA 3OEFX 3UIUA 3VRYA 4UMPA 4H05A 5TT7A 5FEQA 3QQJA 4QYGA 2CSNA 1IASA 2FGIA 4E5BA 4XG3A 3IOKA 2XNGA 4QMXA 4ALUA 2UZDA 4IAAA 4DFBA 3MV5A 3FMJA 3VNTA 2EXCX 2W0JA 2OSCA 3CS9A 5DI1A 4YZMA 3GP0A 3SV0A 2JITA 4BZNA 1H4LA 2YWVA 4GVAA 3LMHA 3NCGA 4O7WA 2JBPA 3SW7A 3F3UA 4FT3A 1PXMA 2KULA 4FR4A 4QYFA 3F9NA 3G51A 4FTKA 1KV2A 3QTRA 4H39A 3FMDA 4IAKA 4EOQA 1KV1A 4RJ8A 1NVQA 1O6LA 4F9CA 5FM2A 4AZFA 2GMXA 1VZOA 3RJCA 1W98A 1KWPA 2ITYA 2VWWA 5JT2A 2WTKC 3MH1A 3WILA 2QONA 2JDRA 2BRMA 4RVMA 4L53A 4OR5A 3TIYA 3GU6A 4MWIA 4FKVA 1PYXA 3DJ7A 4PWNA 5HIBA 4ZJIA 3V5LA 4YTCA 3RALA 2R3FA 4ITHA 4YNOA 2QODA 2RL5A 4X3FB 3TJDA 5IQBA 1H01A 2VTLA 3UNKA 4W8EA 2C6KA 1U59A 2C0IA 2VTAA 5C27A 1M7QA 3Q52A 4TYJA 5HO6A 3ORLA 3S95A 4QDEA 1YVJA 1ZMWA 2BRBA 2F4JA 4WG4A 4Z7HA 4BWPA 4FSUA 3W32A 2BTRA 3BELA 3SLSA 3B8QA 1ZOHA 2BRNA 3EZVA 4Q5EA 5FXRA 3I0QA 1L8TA 5CSHA 4BKZA 2VUWA 1MRUA 3ANRA 4RFZA 5IA5A 1KE6A 3BGQA 3HZTA 2O0UA 2E9UA 2ITWA 5A4LA 2CCHA 3EKNA 5L3AA 4YJUA 1LUFA 2XJ2A 4HYSA 3SQQA 2W06A 2PVFA 1ZYJA 3F6XA 3HEGA 3IK3A 3DXPA 3UBDA 3BBTB 3V51A 4RA5A 4ANOA 4DN5A 4EOLA 1OZ1A 3U4UA 4RC4A 2XK9A 1SNUA 3KN6A 5EKOA 3FXZA 4Q9ZA 4ZTMA 4FUXA 2YLFA 4BL1A 1URCA 2O5KA 3MH0A 2UVYA 3KGAA 4R5SA 4HYUA 3R7IA 4GJ2A 2J51A 2V62A 2VWYA 3AG9A 5KBQA 5M53A 4BDGA 3KL8A 3FMEA 4MX9A 4TW9A 2A4LA 3COIA 3ULZA 5E8ZA 2B4SB 4ZY6A 3U9CA 1OM1A 3QCQA 4NCTA 3SRVB 4IAYA 3W0SA 3SX9A 4KIKB 4KKGA 3UOJA 5JGBA 1MQBA 1BMKA 3C51A 3PJ8A 4FEVA 5FGKA 2VWUA 3IW7A 2VWZA 4JIKA 3CJFA 3FI2A 3U87A 3IS5A 3OXTA 5CEMA 5E8TA 5HU9A 4CMTA 4L7SA 4PMSA 2HZ4A 2XKCA 3LM5A 4D2SA 3FAAA 3NUXA 3COKA 5K0KA 5HE1A 4BF2A 5BYZA 3VS3A 3P9JA 5L2IA 2XARA 2B1PA 2RFEA 5KX8A 3ZLYA 5BV3A 1UNGA 2VO6A 3NSZA 3NW6A 4C4IA 1QPDA 3D5UA 2JDVA 1HCLA 3OCGA 4AS0A 5CF6A 3MH2A 2VGOA 3HV6A 3GCSA 3EQIA 4OTQA 5A6NA 5C03A 4DEEA 5CNNA 4WD5A 1X8BA 3FDNA 2YM7A 2BDFA 2W96B 4AXEA 5A54A 4EZ5A 1OKVA 2OO8X 2JDOA 5E8WA 5CY3A 3TNWA 3UDSA 4O82A 4EH3A 3HVCA 3ZO1A 3EFJA 5GNKA 4O27B 4BC6A 4E4LA 2ZM4A 4C3PA 3OWJA 4CFNA 3PY0A 5HX8A 5IDNA 3TNQB 2OW3A 3ALNA 5LVLA 1G8AA 4D9UA 3P79A 4YTIA 1U54A 3BYUA 3R7OA 3ZONA 5DOSA 4WG5A 4FTTA 4MWHA 3NX8A 5I5ZA 4FT5A 2XKFA 3PSDA 2NPQA 3QZFA 4D1XA 4HZSA 2BKKA 3Q6WA 3ZBXA 4X6RA 2QOBA 3W0OA 1FGIA 5KMOA 3PFYA 1SVEA 2QR7A 2FO0A 2GNFA 4RVTA 3GEQA 1VR2A 1Q8YA 3QGWA 5HIDA 5KCVA 3EL8A 5C9CA 2P0CA 1XHAA 2PMNX 3F66A 4OW8A 4BFMA 5K9IA 5A6OA 3OP5A 1Q8ZA 3NNVA 4RSSA 4FV4A 4PDYA 4PTEA 2GQSA 3ZRMA 2BCJA 2VX1A 4U43A 2BMCA 1WVYA 4LYNA 4MBLA 1H1WA 5HLWA 2W1DA 4GIIA 4PF4A 2IZRA 4K8AA 4NWMA 4Z3VA 3QXOA 4FZ7A 2UZWE 2XK6A 3E7VA 4P2KA 4AT3A 1JKKA 5L2TA 2YWPA 2GTMA 3PIZA 4ALWA 4BCIA 5EM5A 3H3CA 4ZK5A 3V8WA 3WE4A 1CKIA 2WTWA 3LFSA 4WG3A 3UNZA 5J79A 4DFUA 3LQ3A 3UPXA 2CKPA 2OJ9A 3EL7A 3RHXA 2W7XA 3MIAA 2XNPA 4FIEA 2VNYA 3TV4A 2WQOA 3DCVA 3F5UA 3DQXA 3LZBA 4Q2AA 5DR2A 2E9VA 5IQAA 2LAVA 3H0YA 2I40A 4A9YA 3KVXA 3HV5A 4AG8A 3EN4A 1IRKA 1QCFA 4GL9A 5AIKA 3UOKA 5IEXA 3T9TA 4MUQA 4V04A 2WTJA 3HV3A 3QAME 3LXPA 2YABA 4DBNA 1MUOA 2GPHA 2UUEA 4PDPA 4QP2A 4NYEA 3MYGA 4U41A 1BL7A 4FVPA 3RAHA 3BWFA 5CYIA 3C1XA 4EOOA 4C58A 4WHZA 2QHNA 3OF0A 3BU3A 3K5UA 4AZEA 2CGVA 1H28A 1HOWA 4OTHA 4BZDA 3QUPA 3I79A 4O7SA 3MPMA 4JDJA 4IX3A 2WTKB 2X0GA 3FYJX 2C69A 4KIOA 4M12A 5DLSA 1YKRA 4EUUA 1PXJA 1JWHA 3KEXA 3NW7A 4IB5A 4O6LA 5T6KA 3CGFA 4O7ZA 3TI1A 2BTSA 2PL0A 4N6YA 2R3QA 4D1SA 4BIEA 4YJNA 5LCJA 1GY3A 5EYKA 1XBBA 4O0SA 4I20A 1RDQE 5HO7A 5D12A 3WI6A 4TT7A 3I0OA 1R78A 2W5HA 2OH0E 3TTJA 4R1YA 3D7ZA 5AUTA 1IAJA 2CKOA 5IA1A 3QL8A 3FZPA 4V0GA 4QPSA 1E1XA 4JMQA 3FKNA 1RJBA 2V22A 4GFOA 4ZLYA 4MXCA 4I3ZA 1QL6A 4IZ5A 4APCA 1IAHA 4DYMA 3ZHPC 2B55A 4PNKA 3FMHA 1H0WA 5JFVA 3QRJA 2ESMA 3R9HA 5M57A 3UQCA 1OL5A 3COMA 3PSBA 2BAQA 4GVJA 4OTFA 2WXVA 4CFXA 2WEIA 4C38A 2WU7A 3IGGA 3QALE 2XB7A 5LMKA 1JOWB 4USEA 4J96A 4JAJA 5C4LA 4F7NA 2QHMA 4HJOA 3DJ5A 2O2UA 3OW4A 4TYGA 4GSBA 2OKRA 3PIXA 4FKQA 4TPTA 5BVDA 2XANA 4GMYA 5CAUA 3DAEA 3UNJA 5AP7A 5CSVA 5DRBA 4C33A 4Z16A 4TYEA 5HNIX 3NNXA 5L6OA 4IAIA 4U45A 2X7OA 1ND4A 5CVHA 5IMXA 3ZUTA 4YU2A 2ZAZA 4OBOA 4WUNA 3ORXA 4BBFA 4DLJA 4M7IA 4FIIA 2PVMA 4BR3A 2X0QA 2J5FA 3FLQA 4TWCA 4B9DA 2GS7A 1GIJA 3FY2A 4C36A 2J0KA 4NM7A 1VLRA 5CI7A 3C13A 2JLDA 2R0IA 3Q4UA 3PZEA 2C5VA 5FM3A 4Y95A 3QQHA 4KBKA 1T46A 4DGMA 2G2FA 4RPVA 4ACCA 4AT4A 4DITA 3SDJA 2C68A 3R01A 2XK3A 1J7IA 4J97A 1IG1A 3D7TB 3TKHA 4D9TA 5JRQA 3HA6A 3VBYA 3IQ7A 4LOQA 4DTBA 3Q96A 1ZY4A 4BJJB 3E92A 4RG0A 3GU7A 4FKJA 4HNFA 4FKIA 3BWJA 1BKXA 1JKTA 2Y4IC 3G90X 1ZY5A 5GZAA 2OGVA 3BHTA 3F82A 3O8UA 4YC8A 3PVGA 4MK0A 5F20A 2O65A 2GU8A 1VYWA 5AP1A 4I4EA 4DDIA 2X6EA 1Q97A 3V8TA 1I44A 2XCKA 3M42A 5DWRA 5I9UA 5ANKA 3AT2A 5L6PA 3CY2A 3ZM9A 5KMNA 4CRLA 5DPVA 4F9AA 4D4SA 4PPBA 5D11A 4XG8A 3TUCA 3KXHA 4EL9A 5ACBC 4AXCA 4U40A 4KKEA 4UN0C 3PUFC 5EOBA 4IZAA 4GYIA 5HTIA 3QZIA 5JK3A 4G3CA 4ZTHA 3A8WA 5ANIA 3I1AA 3OW3A 3DKGA 4GK3A 2ZV8A 3VS1A 3I7CA 1U5RA 4F65A 1U5QA 5M56A 2R3OA 3L8VA 4GKHA 3DB8A 3V5JA 4FKSA 4K11A 3AXWA 4U42A 3GC0A 2Y8OA 3WZJA 3M2WA 4AE9A 5ITAA 1S9IA 1M2RA 4FIFA 4E3CA 3FMKA 4DT9A 3Q6UA 4ZTLA 4G3FA 4I6BA 1RW8A 1GZNA 2C0TA 4OUCA 1YOLA 4L3LA 1Y6AA 2VGPA 2O3PA 2XNBA 2G9XA 5AMNA 1W8CA 4YZ9A 2PUIA 2FSOX 4L6QA 4DAWA 4DEBA 4BI2A 4R3PA 4R5YA 1R3CA 4FTJA 4MVFA 2QKRA 4V01A 4F08A 4JRVA 4QP9A 3BRBA 2QOQA 4CKIA 2Z8CA 3ORPA 3QC4A 2VU3A 2P4IA 5IU2A 2YM5A 4U97A 5CT7A 1Q4LA 4UALA 2QC6A 3KA0A 4R1VA 4LG4A 3MY1A 4MD9E 4Y72A 5H9BA 4O0XA 5AJQA 1A48A 4NT4A 4NFMA 5CEIA 5ICPA 3F5PA 5J9LA 4YNEA 3Q60A 3QYWA 4BRXA 3GOKA 3OBJA 3MB6A 2BHEA 3NUPA 4RBLA 5L8JA 4BCPA 5AX3A 4L8MA 5EG3A 4FL1A 2WEVA 4QMYA 4XRJA 3JVSA 2W9ZB 3NLBA 2OU7A 4PL3A 5M51A 3FLNC 3HMIA 4ZZOA 2W1EA 1KOBA 4G5PA 4IH8A 4QD6A 4W8DA 1Q3WA 2WIPA 4NIFA 4RWJA 3VW8A 1KE8A 1UA2A 4G2FA 5IZFA 4J7BA 5AP6A 4IFGA 4YZBA 5B2MA 4NH1A 4S34A 2J5EA 3ORTA 4IJPA 4N70A 4XRLA 3VWAA 3ZSHA 2ZFYA 5A4QA 4O7YA 5IMEA 4ZSGA 4MAOA 4N6ZA 4W4VA 3TXOA 3MY0A 4YTHA 5IH5A 1H00A 4TYHB 2YDKA 2VX0A 1VEBA 3K3JA 3CKWA 4IIRA 3LXLA 4XP3A 2B0QA 3C4WA 4D0WA 2I7QA 1YI4A 1TQIA 2HZNA 3NUYA 4YJTA 3VHEA 1H1QA 1ZYDA 3F5GA 3F5XA 4EH2A 3EQGA 4LDTA 3QTWA 4GK2A 4PY1A 4RFMA 4C37A 3R2YA 5EDPA 3ACJA 3T3UA 4ERWA 3QQLA 4BDJA 4CVAA 3GI3A 5JEBA 5C1QB 4ZZNA 1Q5KA 3F88A 5CZHA 4PDOA 4X2FA 2IWIA 1NVSA 2VTOA 3RVGA 3BL7A 5J9ZA 4EH5A 5KHXA 4AZTA 2GHGA 4GG7A 1FPUA 3UZTA 4HYIA 1GZOA 3SOAA 1R0PA 3DK7A 3W8LA 3D5XA 3QFVA 3HDNA 4FIJA 4AW5A 3OWLA 4FSNA 4KRCA 4M8TA 2XYUA 2ZMDA 3RP9A 5J7BA 1PXKA 3FYKX 3QTZA 3R8UA 2QU6A 4ANSA 4ERKA 4FYOA 5CU6A 4JR7A 2R3PA 4WKQA 1XBCA 1DAWA 4YBJA 4I4FA 4X2NA 5CSWA 4RQVA 1DS5A 3W0NA 3PDTA 2VV9A 4DGLC 2V7OA 3LCTA 3VW6A 4QTBA 3QRIA 4I5MA 5GZ8A 3O0GA 3MGYA 4GRBA 4F9WA 3PA4A 1PW2A 3AC2A 4FSTA 2ITNA 4GT4A 4HVIA 3PWYA 4BVUA 1YWNA 1CMKE 2W4KA 5DN3A 5GJFA 3VS6A 3WYXA 4AFJA 3LJ2A 3IW5A 3BLQA 3LJ0A 3DFCB 3QTIA 2IPXA 5EYDA 4A7CA 5J1VA 3UTOA 3LPBA 3TL8A 5DE2A 2UZUE 2CLQA 2PE2A 4KBAA 4H1MA 4IWOA 5B2KA 3WBLA 4FK6A 1U4DA 4EI4A 5AV4A 3OHTA 5AP2A 2OK1A 3MSSA 3JYAA 3HP2A 3N9XA 2WQBA 4FSWA 4ASZA 1H0VA 5BMSA 3TZMA 4RMZA 4UMQA 4F64A 4NM0A 2RIOA 1JSTA 1ZARA 2WU6A 3ZC5A 2BILB 5JRSA 3R9DA 4A4LA 5IISA 2Z02A 3SG9A 2PVJA 4CKJA 3KXMA 3P78A 5HLPA 4W4XA 4ACHA 2F2CB 2QKWB 2EU9A 2QU5A 3BU5A 3OWKA 2OIDA 2UZTA 3S3IA 2UZEA 3ROCA 3AC3A 2JD5A 4CCBA 2AC5A 1YXSA 1OUKA 1UU3A 3MN3A 5TR6A 5DVRA 1YRPA 4CQGA 2UVZA 4AXFA 2SRCA 1QPJA 5DEWA 3MTLA 4CTBA 4U8ZA 4M0ZA 3ETAA 4LMUA 1RE8A 4PP9A 4EORA 4I24A 2WMSA 4RWLA 1XWSA 3OXZA 4FKUA 4J8NA 1YW2A 2I1MA 5I9YA 4J8MA 1H1PA 3KXGA 4JAIA 5HKMA 3VUHA 2F57A 2AC3A 1ZLTA 2HW6A 3IG7A 3C4FA 4DEIA 3DKOA 2IVTA 2VN9A 4WBOA 4NM5A 4CMUA 4I41A 1XH5A 3U8WA 3P1AA 2Z7LA 5T68A 4CT1A 5H8GA 1YOJA 3BHVA 3CY3A 4UZDA 4LGHA 4F7SA 3QCSA 3U54A 2XA4A 2XBAA 3DB6A 4ZMFA 4JDIA 4NZWB 2R9SA 3CJGA 3BLAA 3BHUA 3E8CA 5K5XA 3GCPA 5BQ0A 2P55A 3UZPA 5HI2A 2OFVA 2J9MA 4ZTQA 4B99A 3I5ZA 3IW6A 2FB8A 3PJCA 4GT5A 3R71A 2I0YA 3PIYA 4I6HA 4K33A 5HIEA 4BDHA 5J8IA 4E4NA 4GYGA 2F7ZE 2RFDA 5LVPA 3Q4CA 3JY0A 4EBVA 3I6UA 4UY9A 5H8EA 4IC7A 1IA8A 2JAMA 4IB0A 4F0GA 5LQFA 3KFAA 3DKFA 4WOVA 4AUAA 2WB8A 3BKBA 4DCEA 3SKCA 3I81A 2P3GX 5L8LA 2X6DA 3NZ0A 4FIHA 4ASEA 4USDA 4FA2A 3KN5A 2ZDUA 3K2LA 4A9SA 4YLKA 2G15A 4FZ6A 3RNIA 1WVXA 3KMUA 5IDPA 2RFSA 4EZ7A 3SW4A 4AE6A 4AWIA 4XH6A 4BCKA 1KSWA 4QQ5A 4YSMA 4G34A 3SXRA 1YXUA 5AAGA 4M15A 3KRRA 4YLLA 2JFLA 2ZM1A 1PY5A 3A7HA 1APME 3O50A 5FD2A 4M13A 4CZUA 4AZVA 4HVHA 5HHWA 3DU8A 3LQ5A 4DA5A 3GFEA 4BN1A 4I94A 4GFMA 2R5TA 5CENA 3PVBA 2X7GA 3BX5A 4LV8A 3SA0A 4ANLA 1FMOE 1KE7A 3VQUA 2YCSA 5JFSA 3OBGA 2A27A 3C4XA 4MKCA 3IDBA 1Z9XA 4ZTSA 1XH7A 4AQKA 4XG6A 2J90A 4WA9A 5HCXA 5BUJA 3HA8A 1PMVA 3LMGA 5CTPA 4A9UA 2OXDA 4Y8DA 4PRJA 3A8XA 4DH5A 4PTCA 1KE9A 3ORZA 3ML1A 3OG7A 3PSCA 3CPCA 1G3NA 4XEYA 3BL9A 3FI8A 4CKRA 1SVGA 4RA4A 5D41A 4O91A 1VJYA 2C30A 4LUDA 5ANDA 2CN5A 2X2KA 3VJNA 1HCKA 2B53A 1SYKA 2WMAA 2R4BA 4JBOA 1WBTA 2HCKA 3R73A 4FV0A 3LLAA 4HPTE 2PVLA 3EOCA 4EH8A 5I9XA 5KMIA 2YM6A 5LVMA 3TKUA 2HY81 3R7GA 5DT3A 4D28A 4H3BA 4YTFA 4MNFA 4QYEA 4MHAA 3IW4A 5DMZA 4MBJA 1M2PA 3R9NA 4O96A 3QTXA 2Y6MA 3NRMA 3Q32A 4RJ5A 5EHOA 3PVUA 3TN8A 4EYJA 4CYJA 3HECA 4QMUA 1JPAA 2QG7A 4IWDA 3R63A 1PHKA 3FV8A 2JGZA 4YO4A 4AOJA 1ST0A 3II5A 3U6JA 4KIQA 4NTTA 5EHLA 3OD6X 1UNLA 3WOWA 4H3QA 5BMMA 4C02A 4FTUA 4EQMA 2VWXA 3G33A 3HP5A 2B7AA 3E64A 4PL4A 1JNKA 2Y9QA 2ZVAA 3EN9A 1Y91A 4KBCA 2W1FA 4S31A 4BDBA 2P2HA 4EJNA 3P4KA 4DHFA 3KCKA 4IFCA 4DFNA 5L4QA 2UZNA 5H3QA 2PZPA 5CT0A 4YHFA 2XNNA 2E9NA 4GU6A 4M84A 2PVHA 4XBRA 3UOHA 2E9PA 5EYMA 1OGYA 3FY0A 3NAYA 2WTDA 3S0OA 2BUJA 2UW3A 4JX7A 2JIUA 4KWPA 2C3IB 3IGOA 5LVOA 5GJGA 2IW8A 3W2OA 3QX2A 2R3RA 3OT8A 2C1BA 5AFVA 1XJDA 4FV9A 4D5KA 5E8VA 3F3VA 3GT8A 2BR1A 3TEIA 5CXHA 4JVGA 3WIKA 4A07A 3WE8A 4MXYA 5ANEA 5KZIA 4D2VA 1W83A 2NYAA 4YGAA 4C4EA 4C3RA 4FBXA 4FMQA 4HGLA 2Y6OA 3ZH8A 4FUYA 2Z60A 3E62A 4O0UA 3VF9A 4I93A 3QXPA 3Q9WA 4CCUA 4FE2A 3ALOA 4K0YA 3FXWA 4EOMA 2WPAA 4DGOA 2QVSE 3A7GA 3LKMA 5D1JA 4RZVA 4X2GA 3V5QA 5AR2A 3VQHA 2IEWA 4Y5HA 1PRYA 4E6QA 2YJRA 3IOPA 1WAKA 4GW8A 3VBVA 3G9LX 3DZOA 1WVWA 4USFA 3F61A 3QTSA 4GUBA 3NFGB 4PPAA 3DY7A 4QP7A 4CQEA 4PMMA 5IQGA 4AA0A 1WFCA 4KSQA 4FTMA 4WBBB 3MBLA 1PXPA 5TKDA 2XJ1A 1DM2A 1GJOA 1WBVA 1Q99A 3FXXA 3G5DA 3LIJA 3WIGA 1OKWA 2YM4A 3W2PA 2PU8A 4BJJA 2OFUA 4APPA 4UBAA 2VTJA 1B38A 3O17A 3TIZA 4L52A 5DEYA 3NNWA 3HNGA 4EH6A 2VO7A 4QRCA 4BCHA 3EFLA 2ERKA 3FMNA 4YO6A 2VWBA 4IWQA 2XIKA 4RX7A 3R8ZA 3PZHA 2YIXA 4QMVA 4C57A 4EUTA 5KO1A 1M52A 1ATPE 4O0TA 3W8QA 2YDJA 4FTQA 5D7AA 3GNIB 4R6VA 3ZSGA 5AADA 3WZDA 4LRKA 4YBKA 2YFXA 3MA6A 4AX8A 3DT1A 3ID6C 4NKAA 1GZ8A 1W7HA 1YHVA 5EDRA 3LJ1A 5IA2A 5IQHA 4A9RA 4GIHA 3LFQA 2YACA 3UG1A 4F6SA 3KKVA 3TT0A 3UP2A 2HENA 3HX4A 3IPHA 4FSQA 4I6FA 1IEPA 4MNEA 2XK8A 3RNYA 5HNGA 4AXAA 2QOHA 3ZRLA 2BHHA 2R3LA 2VTNA 5M4FA 4RIYA 5C4KA 3CXWA 5DGZA 3TUDA 2BFXA 3ENMA 2GNIA 4XG2A 4C7TA 4HVGA 3H4JA 4NCTC 3SXFA 2YA9A 4FSMA 3MFRA 4F6WA 4G16A 2F7XE 3VS4A 5GINE 2VWIA 4R3RA 2Q0BA 3CTHA 4RIOA 4PMTA 4IAZA 2YIWA 5FDPA 4DH3A 4U6RA 3ZO4A 5C26A 5M08A 3EMGA 4EKKA 3AD5A 2V7AA 4OGRA 3LVPA 5AAEA 4QQJA 3LCDA 3I7BA 3TNHA 2H34A 1H1SA 4D4YA 2ETKA 5K4JA 4XJ0A 3AKJA 3F69A 3A7FA 2X0OA 2OG8A 2RG6A 3KXXA 4RIXA 2F9GA 1J7LA 4X6QC 2I6LA 3RGFA 4CTCA 3NAXA 3UO4A 5AA9A 4XG7A 3C50A 5CQUA 4QMPA 1T45A 1ZOGA 3QZGA 4MD8E 2X9FA 3PG1A 4FOBA 4UV0A 3DTCA 3RZFA 2X7FA 3PWDA 1OIRA 5JKGA 3RPVA 2A0CX 4L01A 4GCJA 4IM3A 5H8BA 3N51A 4ACDA 4HCTA 4KB8A 4TKSA 3M1SA 5FLFA 5IEVA 2VWVA 4ZTNA 2VTSA 4XV2A 3FKLA 4GV1A 4BDFA 3QLFA 3Q5IA 1W84A 3N4TA 5HG5A 5I3RA 3UO6A 4NW6A 1M14A 3V04A 4B7TA 5HQ0A 4O1OA 4AAYA 3C0IA 3NS9A 3HKOA 2GS6A 1ERKA 2QOCA 3RI1A 4CSVA 2YM8A 3O71A 4OTRA 3QRTA 3WF9A 5CALA 1Q62A 3QUEA 3UG2A 4EOJA 3LFAA 4FODA 4ZJJA 3EFKA 3V6RA 4FG8A 3UC3A 2W5AA 3C0HA 4E93A 2G2HA 4JBVA 3OY3A 3FSKA 2ACXA 3PUPA 2WTIA 4DCAA 4OAUC 1W2FA 4I0SA 4HVDA 5KMJA 1WBNA 2XKEA 3HMOA 4EOKA 2W1ZA 3VULA 4WSYA 4FV7A 2GCDA 2WQMA 5JZNA 3W16A 3OVVA 2FYSA 3D14A 4TYHA 3UC4A 4D2PA 4FV2A 4E7WA