1OPJA

Structural basis for the auto-inhibition of c-abl tyrosine kinase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
287
structure length
287
Chain Sequence
AMDPSSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Structural basis for the autoinhibition of c-Abl tyrosine kinase
pubmed doi rcsb
source organism Mus musculus
total genus 88
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1opjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1opjA01
1Q3WA 2XKDA 4ZAUA 4ZSAA 1Y6AA 2YM4A 3K3JA 3LLTA 5JRSA 2F4JA 3E3PA 4IWPA 4MCVA 4ASXA 4IWQA 3D4QA 4V0GA 5C27A 3F3ZA 2NPQA 3OW4A 4W4XA 3RAKA 5EYDA 4F65A 5K5NA 4FUYA 4RC3A 4J71A 3O8UA 3WZUA 4HOKA 4R3PA 5LMKA 4IVAA 1M7NA 3C51A 3CGFA 4RWKA 5CI6A 2FYSA 2A0CX 2QC6A 4AWIA 4M3QA 5HCXA 5FTGA 2ZV9A 3D2IA 3DQWA 2XF0A 4TWOA 4FR4A 3U55A 1OB3A 5HLNA 1KOAA 3PLAE 5HE3A 4PNIA 4AW5A 4YLLA 1J7UA 1Q41A 2GSFA 2W1ZA 5IG1A 4NFNA 2PE1A 3I79A 2IVSA 1GIIA 3LAUA 3QD4A 4CYIA 4RGJA 1BL7A 5LWMA 3E7OA 2ETRA 5AP0A 4DTAA 4QTAA 4BI0A 4O84A 3ZHPC 4RJ4A 3QD3A 4FNWA 1URCA 4XHKB 4XMOA 4FV9A 5JGDA 3HLLA 2XNMA 3R9HA 1R39A 4UB7A 2B53A 5GJGA 4L46A 3MIAA 2BILB 3NIZA 1M14A 3LQ3A 3PPZA 5L3AA 4FSNA 1XH4A 1ZYJA 3MPMA 5IDPA 3DLZA 2R3NA 4EH4A 4F6SA 1PXLA 4XG3A 1YXTA 3QL8A 3KQ7A 4YHJA 5C4LA 4NKSA 2XNOA 4YHFA 4IJPA 3UZRA 3LHJA 4LFIA 2V22A 3DBDA 2QI8A 1YHVA 4I5MA 4IVCA 1GZNA 3ODZX 3BYMA 4XS2A 2X7GA 1OL7A 5EKOA 3PDTA 2CGWA 3DS6A 4JBVA 3C9WA 2R9SA 2J4ZA 4BICA 2CNUA 1UV5A 1CMKE 3Q4UA 4C34A 3VS4A 1ZXEA 4TWPA 2J7TA 1OPKA 2IO6A 3A4PA 3T8OA 1YXXA 4O21A 4UXQA 3ZLYA 4FSWA 2CLQA 5CNNA 2YJRA 4TYGA 1URWA 4EL9A 4NT4A 3BEAA 4EI4A 4RJ7A 3VAPA 3A7IA 4RA4A 4E8AA 1OGUA 3S1HA 1J7LA 3KB7A 4DEDA 2YCRA 3TIZA 1UU3A 4FSTA 2HOGA 4CEGA 4MNEB 4O82A 2JAMA 4DH3A 3A2CA 3A7GA 3R8ZA 2JGZA 3Q52A 2GDOA 3MH0A 2XZSA 4ITHA 5AUWA 3G0EA 3KU2A 5H2UA 5IDNA 1FOTA 3KGAA 4IWOA 1JQHA 1FMOE 4G9RA 5AP4A 5KZ0A 4BHNA 5K4JA 2GCDA 4RBLA 3TZ8A 4CG9A 4O6LA 3UVQA 5A46A 5A6NA 1ZWSA 3F66A 4WG3A 5CEPA 4L3LA 4PMSA 5IH4A 5ANDA 4DT8A 3TM0A 3FJQE 5J1WA 3TNIA 3SD0A 4AZTA 1IR3A 4LL5A 3L9PA 3DPKA 4WBBB 4FKWA 3ZXTA 2YDKA 3DK6A 2X2LA 3NDMA 3PRIA 5KZIA 4FTAA 3ORTA 5IUGA 4DA5A 2GFCA 2WTCA 2XRUA 3NLBA 4FOBA 3RZBA 3VUTA 3H3CA 4EYMA 4ZLYA 3K54A 3ALOA 3LVPA 1OL2A 5BUEA 2R3RA 3AGLA 2F2UA 3BHHA 3LLAA 1XKKA 2Q0NA 4I6QA 4ZJVA 3C13A 2YDIA 3QD0A 2GS6A 1YWNA 3LFDA 3O96A 2QO9A 4DFZE 3E5AA 1MQBA 1TVOA 2XK6A 3GC9A 3DAEA 3FEGA 1YOMA 2I0HA 3L8PA 4GMYA 3F2AA 3VS3A 3VS2A 3GU5A 4QMVA 4AZFA 4M67A 2R3KA 2BR1A 4J8NA 3V8WA 4KS7A 4NJDA 1WBWA 5KMNA 4F1MA 3F6XA 3P7AA 4WSQA 3A7HA 2X1NA 2FO0A 5BVEA 1JSTA 1JKSA 4B8MA 2F2CB 2UZTA 4AZWA 4I6HA 3R8PA 1CKIA 1A9UA 2E2BA 3HV7A 1MRVA 4QMSA 3R1NA 3PPKA 4CZYB 3ZUTA 4LGDA 3F3WA 3L8XA 4EJNA 3HV3A 3RCJA 3ATSA 5J95A 4C02A 3RHXA 3MFTA 3NZ0A 4CKRA 4MWIA 4QO9A 1U54A 3IOPA 1DI9A 3OEZA 3LFFA 3CEKA 1RJBA 2QOOA 5M51A 2XJ0A 5IA2A 3IO7A 4BCOA 2GQSA 3EN5A 5D10A 2OZAB 4UMTA 4EK3A 3KULB 2HXQA 3FC1X 1OKWA 3HA8A 3HV6A 4L6QA 4K77A 3BIZA 2H6DA 2ITYA 3FE3A 1O9UA 4MH7A 3MN3A 4UWCA 1WBOA 4OAVB 4MF1A 4K33A 4R5YA 5KMJA 1YQJA 2ESMA 3HMOA 5FLFA 3GU4A 1ZYDA 3OP5A 4CFNA 4X6QC 3F5UA 2JKQA 3O2MA 3HVCA 4FTKA 4DN5A 5KHWA 1STCE 2ITNA 2VWIA 5IEVA 3F2RA 2VTQA 2WHBA 4I5CA 4TXCA 3ZC5A 3GFEA 4ANLA 2YERA 5HG7A 4FTUA 5IEYA 4HCVA 3P1AA 2HZNA 2VX0A 3V5QA 3IW6A 4UMRA 5I9YA 1J91A 3MPAA 1FINA 3SG9A 5BMSA 4KBKA 4AGWA 4BBEA 3VQHA 3ORKA 3SX9A 3RGFA 3HAVA 3VJNA 5FGKA 4E4XA 3RWPA 4CLIA 2CGVA 4ACCA 2WGJA 1NT2A 2GNHA 3OOGA 5EW9A 4DG2E 1TQPA 3F7WA 4YHTA 3ULZA 1WAKA 1FBNA 4YGAA 1ZY4A 4C57A 3TNHA 3ANRA 4AACA 2XIYA 1H0WA 2E9OA 3C7QA 4DFNA 5DEYA 2ETMA 3ZRKA 1JWHA 1RDQE 2C5VA 2J9MA 4AZVA 2YM6A 4KIQA 4CRLA 3W8QA 1IG1A 5AADA 5M09A 3GCUA 3DBEA 4ONAA 3A7FA 3AC4A 2XNPA 1YW2A 4GRBA 5FEQA 3UVPA 2Z8CA 4DTBA 2HYYA 2XK7A 3WBLA 4F7SA 4MWHA 3DBQA 2Y8OA 2BKZA 3DNDA 3L8SA 3SAYA 4EHEA 3NW7A 1NXKA 4TT7A 3HGKA 4QNYA 5E1EA 4BDCA 3AMYA 4PDSA 2IZTA 4CFFA 3PXQA 4QMMA 4IM0A 4QOXA 2GS2A 4HVDA 4CRSA 4E73A 1Q61A 2R3IA 3V5LA 2V55A 5KE0A 4EZ5A 3KN5A 3V04A 4JOAA 4XX9A 1OL6A 2FSTX 3ROYA 2XK3A 5EHLA 5EW3A 2JIUA 2OKRA 4BYIA 3AQVA 3NSZA 4IXPA 4L68A 4NW6A 3PWDA 4YSJA 5J79A 3COMA 1BMKA 4A4XA 4W9WA 4XEYA 2R3PA 4CT2A 3MPTA 3QRUA 2QD9A 3PFQA 4CVAA 3A99A 3G9NA 3QUDA 3O71A 1L3RE 3EQHA 3KXNA 3RM7A 3QALE 5E1SA 5HLWA 4O22A 3QRTA 2ZV2A 2X2KA 5H8GA 1SYKA 3QCQA 3OC1A 4QYGA 2WOUA 5L4QA 5GIPE 4FG9A 5DR2A 5T6KA 3Q96A 4FVQA 3EQFA 1ZZLA 5M4IA 2GHGA 3L9NA 1PXNA 3C4FA 4C8BA 3BE2A 4CTBA 5K9IA 4NM7A 2WTDA 4S31A 1KE7A 1O6LA 3MVHA 1PMVA 4FV7A 3BKBA 3EZVA 3SRVA 1O6YA 1OUKA 3I6WA 1XH7A 2O0UA 4U5JA 3CP9A 5A3XA 2F9GA 5IA3A 4Z9LA 4BRXA 3TDVA 3E7VA 4F4PA 3PIZA 1B38A 1XWSA 3WILA 4GK3A 4EOLA 3IW4A 1ZOGA 2XNNA 2OBJA 3MH1A 3RK5A 2UW8A 4QP1A 4YZNA 3WF5A 3UPXA 4APCA 5CX9A 2Z60A 3HNGA 5AUTA 1ZMUA 1XH9A 1YXVA 3BQCA 3ELJA 1Q3DA 4GV1A 3V01A 4GT5A 1E1VA 1K9AA 2J51A 3F88A 3RPSA 5IQGA 3OTVA 4EEVA 2C6DA 1DI8A 2YA9A 5KMKA 3OD6X 5AIRA 4BCFA 4BHZA 3IONA 3P79A 2O2UA 4QTBA 3KRJA 3DJ7A 3O7LB 3K5VA 4FUXA 4C4HA 4C35A 4ZSJA 5CXZA 3WIKA 4WD5A 4OR5A 1NVSA 3KKVA 4ZY5A 4C7TA 3BLRA 3AXWA 3L9MA 2R4BA 2Z02A 3GUBA 5BVNA 3AOXA 2BTRA 3UOJA 3KREA 2OIDA 2O3PA 5HU9A 2RG5A 2WU6A 5B2LA 3IK3A 4CTCA 1T46A 2AC5A 2F7ZE 4U6RA 2CKOA 3ZBXA 4ORKA 3R22A 4U80A 5I3RA 2VTHA 3R30A 4FSRA 5TO8A 2HAKA 4GVJA 4FKQA 3BGZA 4LOQA 4KA3A 2O63A 2W1HA 3Q4ZA 1H28A 1H27A 4H1MA 5ETCA 3DXNA 5AV1A 4D2VA 5IA1A 4O7VA 4TPTA 5EI2A 3MFSA 3EN4A 5E9EA 3WZEA 3MWUA 4C2WA 3MY1A 3ZO2A 3H4JA 5J9YA 4IBMA 1O6KA 3LFNA 4G5PA 5CU3A 4L00A 3P5KA 4BCJA 5HIDA 5LCJA 4R77A 2C6LA 4IMYA 4JG7A 4QTCA 4RFMA 5CSHA 3RTPA 4B4LA 5HD4A 3ORNA 2W4KA 5HVKA 3OBGA 5FD2A 5LVMA 4HPUE 3VW8A 4XLIA 2PVMA 2VO7A 3UC4A 4WRGA 5HO6A 4KAOA 4BDEA 2XIZA 1FVTA 3I4BA 1ZYSA 3NCGA 5I3OA 2JFLA 3LFBA 5EI6A 3BHYA 4GT4A 3NUUA 4P2KA 3R7IA 3CGOA 4BDAA 4FSZA 4E4NA 3DZQA 3AT4A 2RFEA 3WYXA 4WIHA 2YZAA 5LJJA 2PMIA 3OG7A 5E8UA 4G3CA 2WQEA 3EIDA 3MBLA 2HWPA 4USFA 4K6ZA 5ANIA 1Q62A 5FDXA 4MYGA 3RCDA 4DF3A 1Q8YA 4IAIA 3CSVA 4D5HA 4LRMA 5FXRA 2X9FA 5HESA 1Q97A 2XK8A 4K9YA 5ETFA 4CD0A 4KS8A 2CMWA 2YWPA 4S34A 3UIBA 4AF3A 1Z5MA 2X0GA 1UNGA 4TN6A 4QMYA 2C4GA 3TUCA 3KRLA 4RWIA 4GT3A 3NPCA 4B7TA 1R1WA 5L2QA 4JDKA 3UO5A 3MB7A 2R3GA 3QCSA 4CXAA 2XYNA 2JDSA 3TXOA 4D2RA 4D1XA 2HK5A 2VTLA 4AXAA 2YCSA 4BDHA 4QPMA 4C36A 5LMAA 3P78A 3NYXA 5AR5A 5LMBA 4EHVA 3DQXA 3PE2A 4YLJA 4C3FA 1UNHA 5DOSA 4D5KA 4EOPA 3EOCA 4DG3E 3C4CA 5ANOA 1Q24A 3R73A 4RVTA 5FWKK 2QODA 5AR4A 3EQDA 1OZ1A 3UMXA 2WMSA 5GHVA 3QWJA 2Y0AA 3IECA 1P14A 4L52A 1OL5A 5L2IA 1YOLA 3FI8A 2VRXA 1P4FA 2PVJA 3EFJA 4AS0A 4UX9A 2J0JA 2ITVA 4WUAA 5L2WA 3SRVB 2OIQA 5AUZA 2Y7JA 2UZUE 4XP3A 4BCPA 2VU3A 2ZAZA 5CQWA 4P90A 3TN8A 3OUNB 4L7FA 3SLSA 4WSYA 5AUVA 5CI7A 5TF9A 1XR1A 3ORIA 2IVTA 4QD6A 5I5ZA 2PZIA 1GIJA 3LCSA 4FL3A 4F9CA 2JIIA 5K0KA 1S9IA 4C38A 3CJGA 2C47A 4HNFA 2QCSA 2WQBA 2EXMA 3QC4A 4IQ6A 4LV8A 3W33A 4H3QA 3NNWA 3HECA 3LQ8A 2RIOA 2VD5A 4FKIA 4F9BA 3UVRA 3H9RA 3QA8A 3KK9A 2OIBA 4UMQA 4GFMA 5HIEA 3R7OA 2GQGA 5KBQA 3FHRA 5EKNA 4ID7A 4JBPA 3RK9A 1FVVA 5HO8A 1ZAOA 4QMPA 5CU0A 5HTCA 4DLIA 1W8CA 5JFSA 2OF4A 2NP8A 3IW7A 4O38A 4ZTLA 4XOZA 2VTAA 4AZSA 2QO7A 4F7LA 4J52A 4AT5A 4I4FA 1TKIA 5CQUA 3V51A 4FMQA 4F6WA 4BIEA 2WOTA 1F3MC 1OPLA 3UO4A 5JFXA 2W9ZB 3D15A 3OT3A 3AC1A 2W5BA 1GZ8A 3GBZA 3QGWA 3SXFA 4EOIA 2AUHA 4XP2A 1SZMA 2PVNA 3HV4A 2DS1A 5AV0A 3S0OA 4F08A 4UZHA 4WBOA 3GOKA 2XK4A 4PPCA 4E1ZA 2XCKA 5JFWA 5EYKA 4K0YA 5HO7A 5CTPA 3COIA 4RQKA 4AQCA 4IJ9A 2OH0E 3BHUA 3EQBA 3H0ZA 3IDBA 2XNEA 3QXPA 1H24A 2YM7A 1DAYA 4GYIA 3MA3A 2AC3A 4PTGA 1BX6A 1GJOA 2YIXA 4Y72A 5CU4A 4C4EA 5IZFA 4F7NA 4BIBA 5DFPA 3FBVA 4D4VA 4R7BA 2YISA 2BZHB 2Z7QA 2UZBA 3VULA 2PL0A 3TT0A 2E9VA 4PL4A 4S2ZA 5C8KA 3P23A 3CS9A 5JMSA 3DDPA 2ZV7A 1RE8A 2BZIB 2Q0BA 2W4JA 3HYHA 3R7YA 3ZLSA 3ZMMA 4A06A 1YDTE 2HW7A 2BDJA 4AG8A 4D1SA 3Q2JA 5KCVA 4E93A 1M2QA 2DYLA 4EOMA 3CE3A 3SVVA 4F70A 5JQ8A 5CAVA 3G90X 1YHSA 4L43A 2C6MA 2OICA 1UKIA 2WTKC 2B9IA 1G5SA 4NFMA 2GNLA 3EFLA 5DEWA 4M69A 4YC8A 4PNKA 2PPQA 4X21A 3UZTA 3FKLA 3UO6A 5AM7A 1LUFA 4MXYA 4YLKA 3Q5ZA 5DI1A 3O17A 2X6EA 4O0UA 3S2PA 4JVGA 3R71A 5IA0A 3QGYA 4RJ3A 4YBJA 3PXYA 4H05A 3UQGA 4H58A 1BLXA 3GGFA 5HNGA 3THBA 3R8VA 3V8TA 5HG5A 2Z7SA 4XJ0A 2I0EA 2LAVA 5D9HA 4FV5A 5H8EA 4JR3A 2OFUA 2VWUA 3G0FA 3NNVA 4UEUA 3RBWA 5BVFA 2IWIA 3NR9A 1DS5A 4HZRA 5G6VA 4R5SA 4C61A 5TKDA 2G9XA 5HVJA 4BY9E 3RNIA 2I1MA 3LMGA 4ZTHA 4E4LA 1YRPA 4JRNA 1REJA 3C4EA 3EKNA 4PMTA 3C4ZA 3HDNA 4ZSEA 3F3VA 5KNJA 3G15A 2JDRA 1OITA 4O0XA 4S33A 4LI5A 4G3DA 2XBAA 3E8DA 5IKWA 4DGNA 2O64A 4USEA 1H4LA 2XKFA 2VTSA 4FV4A 3MVJA 4YO6A 2YIRA 1PHKA 3UPZA 1F0QA 3ACKA 3FY0A 4O0RA 2QQ7A 2VWYA 4RX7A 4XRJA 4EONA 3ORPA 2P0CA 2R0IA 4H3BA 2YLFA 5L8LA 4M12A 4FSQA 5BMMA 5KO1A 2PVLA 1WZYA 4WNKA 5A4QA 2R3OA 4FF8A 3W2OA 5HBJA 3CY2A 3DOGA 3UNKA 3C1XA 3FUPA 4LGHA 4E6QA 3O8TA 3ZONA 3RM6A 4B6LA 3TG1A 2X4ZA 4GU9A 4O2PA 4XV3A 3PY1A 3ZLXA 3FYJX 3R83A 3QLGA 1FGIA 3TZ7A 3FMNA 5F1ZA 4DE4A 4TRLA 3JVSA 1DAWA 4OTFA 1LPUA 5HTBA 4PPBA 5HD7A 2PVFA 4M15A 3V5TA 3ZC6A 4RVMA 4E20A 2WMXA 4J1RA 5D7VA 4F9WA 3Q60A 2DWBA 4G2FA 5LVPA 2XIRA 3U87A 5BYYA 3I0QA 3ZRLA 4D4SA 3DT1A 4K18A 5M44A 3GCSA 4MBIA 4PMMA 4AA0A 2R0UA 1MRUA 4OW8A 2YIQA 3BBWA 4F0FA 4MVFA 3TNQB 4KWPA 3FXWA 3Q9YA 2YEXA 3SW4A 5IF1A 3AMBA 2BRNA 1U5QA 5GJFA 3PP1A 4I20A 4YJVA 4BF2A 2WTWA 3K5UA 4Q9SA 4QYYA 4KRDA 4U8ZA 2VTJA 4YUQA 2QOCA 2UW0A 2BCJA 2X39A 2PWLA 4G31A 4ZZMA 4RVLA 3ZCLA 4DH8A 3DY7A 3HMMA 4RT7A 3CTQA 2P3GX 3O0GA 4BWXA 4L45A 2OZAA 1SMHA 2WIPA 3TKUA 3KULA 3QTZA 4GFGA 3LJ1A 4FTOA 1G3NA 1BI7A 3A8WA 3DDQA 4HYUA 4OTQA 4P4CA 2OJGA 3NMUF 2QG5A 3CTJA 4NM0A 2ZDUA 2WPAA 3FSKA 3UP2A 3MFUA 2GHMA 1AGWA 4EH8A 1KE9A 1V0BA 3I0OA 3QX2A 3QXOA 4FTTA 3W8LA 3MYGA 3MW1A 4FTIA 3SV0A 1VYZA 3ENMA 3GU8A 1FPUA 2BTSA 1XHAA 3EJ1A 4YC3A 5JZJA 2ZMCA 5M57A 2FUMA 2UZWE 4OTPA 3F3TA 3O7LD 4TYHB 3OY3A 4J96A 1R3CA 5CAPA 2ZJWA 4XUFA 3UC3A 4J95A 4HVGA 2H9VA 3MVLA 5EYCA 3T3UA 2WO6A 4A9SA 3I7CA 3MJ2A 4PV0A 2C69A 2EUFB 2XVDA 5CY3A 4CLJA 1I44A 1ZMWA 2BALA 3OT8A 5LWNA 3UIXA 2X8DA 4IAZA 2P4IA 3D7TB 3RJCA 5TR6A 4UWBA 2C1BA 3ZEPA 3T9TA 3F69A 4O7SA 2VV9A 5AUXA 3MA6A 4M69B 4N4SA 4BCIA 3Q5IA 2C5NA 5ICPA 3MTFA 4RLLA 4FV3A 5H9BA 1K3AA 3UBDA 1IAJA 4QP4A 3PZEA 1UA2A 5J9LA 2YM3A 2W7XA 3R00A 4QP7A 3EQRA 5FRIA 1ATPE 3K2LA 3LCOA 3PPJA 4EYJA 4U40A 3D0EA 5ETAA 4O7TA 2GMXA 2WQMA 4MD8E 5AAEA 1QPJA 3HP2A 2OJIA 2JD5A 1H1RA 4YPDA 5L2SA 4U81A 4JS8A 4EH9A 5JH6A 2JEDA 2VTMA 2YCQA 4AUAA 5AEPA 3L8VA 4BWKA 4IB5A 1PMNA 3S00A 3W10A 5CAQA 4HGTA 1XH8A 3LM5A 4ZTMA 3OMVA 5AUUA 4RSSA 4NTTA 4QMNA 5C8MA 3DCVA 1PYEA 3TJCA 2E9PA 4BDDA 5TT7A 4OTRA 2F7XE 4X6RA 3Q6WA 4LUEA 3E62A 5HG8A 3R8LA 3WZKA 1YDSE 4MX9A 3UQFA 5AM6A 1H00A 4KIKB 4BCGA 2BMCA 2UZNA 4O0VA 5EHYA 1E1XA 3Q3BA 4J7BA 5E91A 3P7CA 3NNXA 4IX6A 2WELA 3NX8A 1FQ1B 2XK9A 3LXLA 4FTLA 5C9CA 4YTFA 4FEVA 1UWHA 4FKSA 4BDKA 5F4NA 2VGOA 4F6UA 3DZOA 1U59A 4ZTSA 1JLUE 4II5A 4FT9A 4LOPA 5AA8A 2CCHA 3EYGA 3QQLA 3R7GA 3CBLA 4OTDA 3SKCA 4CT1A 4DH7A 5AAGA 4W8DA 5K0XA 2BAQA 4BDBA 4BVUA 5E8ZA 5DLSA 4C62A 4APPA 3R1QA 2C6IA 5AV4A 3WF8A 2B0QA 5JGAA 3DBFA 3EH9A 4U3YA 3O50A 4R7IA 4OT5A 2W99B 4U79A 2XS0A 2JC6A 3TNPC 2PE2A 3BELA 4DFYA 4ITJA 3F61A 4F1OA 4JG8A 4LMNA 4RFZA 3DK3A 1OKVA 2EXEA 2YM8A 4EKKA 3I81A 4ALUA 3FV8A 3R01A 4BCHA 4EH2A 1Q8WA 4L01A 2RKUA 2WAJA 5F95A 2P2IA 2F49A 3HKOA 3KXHA 4O6EA 3F5XA 1YXUA 2WTKB 1CM8A 4WO5A 3VRYA 4TYEA 4F9YA 2OK1A 1WBTA 4X0MA 5C01A 3H30A 3KVXA 3LIJA 3FXZA 3DAKA 1H1SA 5KMMA 3TV6A 2R3JA 4X2KA 4U97A 4ZJJA 4JX3A 4ANQA 2PUNA 5HICA 4BGGA 3UE4A 4DLJA 3DBCA 4NCTC 4J98A 3Q9ZA 3U6JA 5CF4A 4X2GA 3PA5A 3FPQA 5M56A 4ACHA 4M66A 3TWJA 5L8JA 4UV0A 4O81A 2GTNA 4EWQA 3NCZA 4JR7A 4UALA 4BBFA 4C59A 4F0GA 4EH6A 3TV4A 3UYSA 2PZ5A 5EM8A 2UZEA 5FDPA 2OW3A 1W98A 4Z7HA 2OG8A 2OJFE 2GHLA 4FSMA 5E8VA 3DK7A 5GNKA 1OBDA 4M68A 5EQPA 4NJ3A 4FTQA 2QOHA 5CWZA 2XIKA 1VR2A 3GCPA 2C1AA 2QKWB 2GNFA 1JKKA 5M07A 3FQHA 1YWVA 3RNYA 1ZYLA 4RIWB 4UMUA 3M11A 4QYEA 4IAYA 4RX9A 3PTGA 4CQGA 1JKLA 1WFCA 3U9NA 3N9XA 1ZARA 4TYJA 4RZWA 4YTHA 4FG8A 2BFYA 3W55A 3LMIA 1J7IA 2PE0A 1OIQA 2QNJA 3ORXA 4YNOA 2ZV8A 5CALA 4FL1A 4EHZA 1OIYA 3FZ1A 4ANNA 3R8MA 3PG1A 5L6WL 3DNEA 3EFWA 2HELA 1P5EA 3DTCA 3QD2B 5D7AA 5JZNA 3Q6UA 3ZZEA 3I1AA 2A2AA 1J3HA 3D94A 1SVHA 5M08A 3QYZA 4ZEGA 2PSQA 4NM5A 4ASDA 5CU2A 2P55A 2W0JA 5DH3A 5FG8A 1PXMA 1PW2A 4IVBA 4ZOGA 4O7ZA 4B8LA 4GW8A 1OI9A 1ND4A 4O0SA 3R1YA 2O8YA 4IX4A 2XB7A 4I0SA 4HW7A 5DNRA 3S95A 2QR8A 3BGQA 3JXWA 2VZ6A 2ZDTA 4ACDA 1OBGA 4FZFB 3KC3A 3TI1A 1M17A 4KSQA 4I23A 4CKJA 3BHTA 1KWPA 2C6TA 4LOOA 3S3IA 3PIXA 3VHKA 5CNOA 2XJ1A 3M1SA 5I4NA 2PMNX 2W1IA 4I5PA 1LP4A 4K1BA 3QTQA 5FUTA 2CNVA 2WKMA 3NYOA 3OF0A 4NCTA 2PULA 2A27A 1GZKA 2VX1A 4IX5A 4A7CA 5M06A 3HUCA 2ONLC 3NAXA 3QCYA 4QMLA 4E3CA 5BUIA 2VWWA 2QG7A 4FTRA 3N4UA 4UMPA 3GT8A 1VYWA 2OLCA 3RZFA 3PVBA 4GG5A 1PJKA 3ZSGA 3ZOSA 1H25A 3BYUA 4B0GA 2CNQA 5BNJA 3DTWA 4ZY6A 2HIWA 3QQFA 5DT3A 4TZRA 5CSWA 2W4OA 4QP6A 4JXFA 4D1ZA 4DG0E 4FNYA 2E9NA 5FQDC 2DQ7X 5J87A 5I9XA 2SRCA 3SXSA 1Y6BA 2PMLX 5DMZA 4QMWA 3CPCA 4BBMA 2G2FA 3DB8A 4U0IA 5AUYA 5CASA 1AD5A 3FHIA 1JNKA 2WMWA 3Q4CA 3W18A 2YIWA 2A19B 4O7LA 3ZUUA 5CSXA 4DGLC 4NUSA 3U4UA 2XIXA 4MNFA 4AX8A 3GFWA 3E93A 5EDPA 5BYZA 2CCIA 4FKUA 4F0IA 3R04A 3ID6C 1RQQA 4D55A 2ITQA 3FLYA 3I5NA 3ZBFA 4JBOA 4JBQA 3PJ8A 4AE6A 1OMWA 4PY1A 2UVYA 5CF8A 3DKOA 4EKLA 3CKWA 3F5GA 2IG7A 2H8HA 3PVWA 4DH1A 4E4MA 5J7HA 2NO3A 2ITPA 3WZDA 3TUBA 4YC6A 3EN9A 4W8EA 3R7EA 2UZVA 2C3LA 4Y8DA 4WNMA 3GCVA 2WIHA 1P4OA 3VF9A 3MH3A 5IEXA 2WMBA 3LXPA 2XM8A 3HUBA 2A4LA 4D4YA 3VO3A 5C1QB 4V04A 5CEMA 3FL4A 3C5UA 4FV6A 2B54A 4IW0A 5EQYA 5HI2A 5IUHA 2VUWA 2QOKA 4IZYA 5EDRA 1OL1A 3ORMA 4X2JA 4QTDA 2WMRA 5HCZA 4QNAA 4QMTA 3ZEWA 3EQCA 3H10A 3FXXA 3QUEA 5TE0A 4EOJA 3R8UA 2C5OA 4YZMA 4NYEA 3MFRA 4RWJA 3CD8A 5K5XA 3HRFA 2UW4A 4FNZA 4NM3A 4OBOA 4YZBA 3UNJA 4QMOA 2X7OA 5DBXA 2NRYA 1FGKA 2HY0A 4TWNA 3ZZWA 4M84A 3VUHA 4FK3A 5AX3A 5AWMA 4ZS4A 1WBNA 2WMAA 3NIEA 3HA6A 4NZWB 3S4QA 2UUEA 3W2PA 4LMUA 2W1CA 3HEGA 3QTIA 1GAGA 3HRBA 3VUKA 4P7EA 3OTUA 1SVEA 3LW0A 4JQ8A 5EDQA 2JITA 4X7QA 5HU3A 4DCEA 4RC2A 3TJDA 3VS7A 4O7NA 4CFMA 1WMKA 4EUUA 4R1YA 3VUMA 1WBSA 2B9FA 4FYOA 2XNBA 3VBWA 3VNTA 3AC5A 4ALVA 4FEQA 4AOJA 4MXCA 2QU5A 4J99A 4A9RA 3QTSA 4XV9A 1ERKA 3FMKA 4ENYA 4IANA 4R78A 4RIYA 3NGAA 4FSYA 2WTJA 3KEXA 2YAKA 4G5JA 4MBLA 4O1PA 4PDYA 3F5PA 4PF4A 3HAMA 4DGOA 3Q9WA 5JK3A 4MD9E 2ZB0A 3KVWA 3P9JA 5EH0A 1M2RA 4EWHA 2QURA 4G3FA 4FE2A 5CXHA 3OXTA 4MXOA 4UN0C 2F7EE 2R3QA 4NTSA 4I21A 3G2FA 3QCXA 4U41A 3E8CA 3C0GA 3DA6A 4ACGA 2F57A 1Q5KA 2XEZA 4QPSA 5GJDA 5HCYA 4E6CA 4FKOA 5DGZA 4EZ3A 5IQEA 4EC8A 4XV1A 3HMPA 3BPRA 2YM5A 3QC9A 3OZ6A 3V5WA 4GFOA 3QWKA 3ULIA 4QQCA 2W1DA 5EYMA 5ANJA 4EQMA 3W2QA 4EH3A 2W06A 3R2BA 3AD6A 5HKMA 4HZSA 1CKJA 4I92A 4U44A 4WG4A 2R64A 2JBOA 1H08A 2W1EA 5HTIA 2RFSA 2RG6A 3IG7A 4Y83A 5D1JA 4XBUA 1WCCA 3QQHA 3UMWA 4ACMA 2C68A 3TACA 5CSPA 4GK2A 2W17A 5KX8A 2OXYA 4DGMA 4MTAA 5GIOE 4ZXTA 4NL0A 4V05A 5EOLA 1Y91A 3EQGA 4XBRA 5HQ0A 3CIKA 3QU0A 4FEXA 1GIHA 3UODA 4NKAA 4AT4A 3NUSA 3CY3A 3GC8A 3JR1A 2QO2A 1LR4A 4E5AX 4Y5QA 5GZ9A 3NVKI 4QP3A 2J0LA 3D5XA 4YZCA 4DFLA 2PZYA 2YHVA 3VQUA 3DAJA 2ZVAA 3A8XA 5T68A 2W5HA 5IQAA 4QPAA 4I6BA 4QP9A 3Q04A 4OGRA 4DFUA 4QP8A 4NIFB 3DGKA 3TKIA 3EWHA 3CR0A 4EZ7A 3VVHA 2CHLA 3EQPA 5J5SA 1KOBA 4S30A 1JSVA 1XBBA 1YXSA 3CPBA 3VF8A 2C6OA 2ITUA 2QLUA 4H39A 4EBVA 5HORA 3FKOA 3LPBA 5HBHA 3FMEA 4MXZA 3V8SA 5IH6A 2CKPA 2V5QA 5CAOA 5BVDA 4CCBA 3FZPA 4HYSA 4AW0A 3K3IA 5ANEA 2J6MA 2ITZA 2BRHA 1KE8A 3HRCA 4JDIA 3UG2A 4RWLA 1BKXA 3EB0A 4RIOA 5CANA 5D41A 5LXMA 2CKQA 3QHRA 4FIFA 3QRIA 2Y9QA 3LXKA 4BWPA 2VO0A 5M4UA 5EM6A 5HE1A 4C3PA 3QTXA 3OWPA 4LM5A 4PTEA 5HG9A 1OKZA 1W0XC 1UWJA 1K2PA 4QMZA 4TWCA 4ZTQA 3W2CA 5BVOA 4CV8A 4KBAA 4B9DA 3MDYA 4E26A 4WT6A 4GCJA 3EHAA 4HJOA 4LL0A 4OUCA 1U4DA 4EJ7A 1APME 2AYPA 3OCTA 1ZYCA 3R63A 2QKRA 1GOLA 3BLHA 4E5WA 4EQCA 2EU9A 1WVYA 3NS9A 4IDTA 1NY3A 3DKFA 2JDVA 2RF9A 3GENA 4C2VA 4Z3VA 3EL7A 3KMWA 3NAYA 2PHKA 3QQJA 3QZGA 4Y95A 3ZUVA 5D12A 3DXQA 4X3FC 3WF7A 3BU6A 3D9VA 1HCLA 1PXJA 2WZJA 4G6LA 5FM2A 5FTOA 3PLSA 2PK9A 1XH6A 5J8IA 3EN7A 3PSDA 3PZHA 3I60A 3KN6A 4L8MA 3VIDA 5LOHA 3OHTA 5HOAA 4F64A 4RQVA 4BGHA 5KMOA 3EKKA 2YDJA 4RLKA 2PUUA 4JQ7A 4BTMA 3MSSA 4R6VA 2OU7A 2PY3A 1XBAA 3RK7A 3Q32A 5AX9A 2PMOX 3LFCA 2ZOQA 1H0VA 3KXGA 3MB6A 1GZOA 4RIYB 4L53A 4ZLOA 3VN9A 4L67A 5FP6A 2BDWA 2XNGA 3R21A 3BEGA 4M97A 3FMDA 4U7ZA 3F82A 3PP0A 3U8WA 3R9NA 3PXFA 2VWBA 2I0YA 4FI1A 4BZNA 2VNYA 4TYHA 1KSWA 4TYIA 5EQEA 1PXKA 3SG8A 5IMXA 2V7AA 2C5YA 4IHPA 4CFWA 5DR9A 4F63A 3IPHA 4YO4A 4PL3A 3JPVA 4O0YA 5BVKA 2C3IB 1MP8A 3CCNA 4D2TA 4MK0A 3D5WA 4HYIA 4IZ7A 1XBCA 1WBVA 4TW9A 5DVRA 3AT3A 4GH2A 1QMZA 3LFQA 3D7TA 2ITOA 3UG1A 4I0RA 3MVMA 4A9UA 2EB3A 2WU7A 3LJ0A 4GSBA 5KUPA 5AFVA 2A1AB 4C4IA 2HZ0A 4E6AA 2VO3A 3UDBA 2X6DA 4M8TA 3FMJA 3QQUA 2J5EA 4JIAA 3VBVA 2QOLA 2VN9A 5KHXA 1IA8A 4DAWA 4LUDA 4MKCA 2WMTA 5AV3A 2PZPA 4CZTA 5ITAA 3C0HA 1NVQA 4K11A 4MHAA 3UOKA 4AFJA 4AOTA 5IQCA 3AC2A 2QLQA 1JBPE 2J90A 3T3VA 3FAAA 3SOAA 4AT3A 2X7FA 3NUYA 4GG7A 4EUTA 3H9OA 2YZLA 3DFAA 2JDOA 2XCHA 1MUOA 3OOMA 4FKPA 4LRJA 4XG4A 3MTLA 3KXMA 5CF5A 2BFXA 4QYFA 1QCFA 3KF7A 4I22A 5AJQA 3ROCA 4D28A 4N57A 4NSTA 5LVLA 3CQUA 2PVRA 4I1ZA 5DWRA 4C3RA 2CN8A 2FB8A 2YLEA 5BPYA 5IPJA 4IX3A 4WG5A 3IKAA 1OECA 5HX6A 4UYNA 4ANSA 4BGQA 1ZOEA 4KIKA 3OXIA 4TNBA 4I93A 3LZBA 3KL8A 5I0BA 1JAMA 5GINE 5C03A 4BI2A 1Q8UA 4IZAA 3FMHA 3QTRA 3L1SA 4YJSA 4FGRA 3RAIA 4EBWA 3OUKA 1U5RA 3WE8A 2FSOX 5L8KA 2WFYA 5EOBA 2J0KA 5HE2A 2BHHA 4FTJA 2QONA 3QHWA 3BWFA 4HVHA 5GZAA 3VUDA 2GNIA 3UZPA 5DIAA 3TV7A 5E4HA 5G1XA 3NVMB 4IM3A 1CTPE 3RVGA 1SM2A 3V3VA 2B1PA 5LCKA 4DFBA 3FL5A 4RJ8A 2XEYA 4S32A 1OIRA 2BRMA 4FKLA 3POZA 4FZDB 2ITWA 4KB8A 5I9UA 3MJ1A 2XRWA 3OWLA 4FIEA 4Q5EA 1YI6A 5H8BA 5HNIX 4KABA 3NW6A 3RKBA 3PVGA 2C6EA 5E92A 4G3GA 2NRUA 3ORZA 3QF9A 4YJUA 2ZB1A 3ZU7A 3WE4A 2B9HA 1P2AA 2OGVA 3BX5A 4XG6A 5AAFA 4EH5A 1SNXA 4IAKA 2CJMA 3FLZA 4CQEA 4IAAA 3COHA 1NA7A 3N4TA 1BYGA 4ITIA 3FZTA 4IWDA 4L3JA 5EK7A 2VTOA 4C0TA 1X8BA 3H9FA 4QMXA 1QPDA 4O96A 1WVXA 3ZH8A 4XG9A 4I5HA 2X2MA 4GU6A 1XQZA 2FSLX 5HHWA 1EH4A 2HCKA 4J53A 2C3JA 2E9UA 5EM7A 3GB2A 3FC2A 5DYJA 1UVRA 2OXDA 4IC7A 5DA3A 5AMNA 4OTWA 5LVOA 4XCUA 4A4OA 4BTKA 4FV0A 4XH6A 4W4WA 4AFEA 4C37A 5HEZA 3B2TA 3BI6A 3GOPA 3GXLA 1PXPA 3A7JA 3TZMA 3I7BA 4GKHA 5E8WA 1WBPA 4HGSA 4PX6A 3TNWA 5I9ZA 1W84A 4GYGA 4TL0A 3F3UA 2I0VA 3RWQA 3N4VA 4BKJA 3R9RA 1H8FA 5AP7A 3WOWA 3BBTB 3QKMA 4CZUA 4FV1A 5JKGA 3LKMA 1BUHA 4FKJA 4OBQA 5IISA 2HXLA 3R1SA 4IACA 3RAHA 2P2HA 1TQMA 3NUNA 1KV2A 4C4JA 4BDGA 4RIWA 4M14A 1SVGA 4GUEA 4YNEA 4RG0A 3WARA 1Y8YA 2OZOA 3P08A 4GL9A 4A9TA 1IEPA 4FK6A 4F1TA 2WTVA 3GP0A 3C5IA 4PP7A 2VWXA 5J7BA 5HIBA 1IA9A 5A14A 3PWYA 3UNZA 5L6PA 1QPEA 3Q4TA 3DB6A 4IB1A 2WMUA 4DH5A 4D0XA 1PMUA 3W2RA 4AN2A 4LRKA 3KA0A 4M7IA 2WEIA 5J9ZA 1MQ4A 4ZLZA 2BPMA 2ERKA 4JJRA 4HGLA 4YJOA 3IOKA 4JRVA 4ZZOA 5IQIA 3HP5A 4IAFA 5A4CA 2JAVA 5JSMA 5L2TA 3I5ZA 3IQ7A 3PY3A 4ZS0A 5HX8A 1OVEA 4RC4A 4WOVA 4FIHA 5ANGA 4AA4A 3P0MA 4ZY4A 1PKDA 5EW8A 5DPVA 4IB0A 4FEWA 2V0DA 2YN8A 3MH2A 4NW5A 3VS5A 2WB8A 3C50A 3QA0A 2BAKA 4AOIA 3QQGA 4U9AA 3KY2A 4J97A 3SW7A 2CKEA 3R9OA 2HW6A 3IDPA 3IW8A 4LV5A 2VTRA 5HVYA 5E7RA 1I09A 4ASEA 2UVXA 1VZOA 3JUHA 2WNTA 2RGPA 4FT0A 4X3FB 3FI4A 5DT0A 3OFMA 3GNIB 4C33A 3MY0A 3NYNA 4FYNA 4D9UA 3R28A 4Y73A 5CVGA 3F9NA 4RVKA 4YR8A 4PWNA 4KSPA 3QLFA 4D2SA 4GKIA 4Q5HA 1H1PA 3GQLA 3VBQA 4ASZA 3PG3A 1UU9A 4IB3A 4CG8A 2G2HA 3FYKX 4D9TA 4C4GA 4OTGA 4X2FA 2UZOA 3R7UA 3G6GA 3VRZA 2XYUA 2JBPA 1FVRA 5JT2A 4AN9A 2RSVA 2XUUA 4EH7A 2EXCX 2W1FA 3PXKA 4FZ6A 1G8SA 2Y6OA 2C0TA 2ZM4A 4RIXB 4EOSA 1YDRE 5HBEA 2X8EA 5KMLA 5LVNA 5IA5A 2JDTA 1V0OA 2YITA 4CCUA 4I41A 3PXRA 2EVAA 2I40A 3EMGA 4MBJA 2GQRA 4O83A 5AR3A 3OBJA 5CENA 1JPAA 1YOJA 3FMMA 4NK9A 3UQCA 3DKGA 2Q83A 5CS6A 4O86A 3D5UA 3O8PA 4O91A 3OXZA 4IADA 2BRBA 5JN2A 3P4KA 3HZTA 3ACJA 4JAIA 4BCMA 5A4TA 4EC9A 2OXXA 4DBXA 3BRBA 4OT6A 5JQ5A 3UP7A 4CMUA 4PTCA 2WQNA 4FNXA 5I9VA 2BRGA 4WA9A 5ACBC 4R3RA 4AA5A 3Q53A 3SGCA 1TQIA 1OUYA 4BTJA 5M4FA 1IAHA 2QHMA 5JEBA 2B52A 5A6OA 3GU6A 3AD5A 3A61A 2FA2A 4YJRA 4RJ6A 5CT0A 4O7YA 4QYHA 4ZZNA 3QZIA 4ERKA 4JI9A 3QTWA 4ZP5A 3ZDUA 3JY0A 2QOQA 1YHWA 4JX7A 4KD1A 3MY5A 2WD1A 3ERKA 4MEDA 3ZTXA 4G9CA 3GCQA 4DYMA 4V0GB 2R7BA 3AGMA 5E90A 1ZRZA 2BAJA 4JNWA 3WYYA 2ERZE 2ETKA 3TDWA 3U6IA 3E64A 1WVWA 3BU5A 3FDNA 2GNJA 2VTIA 4DEBA 4R3CA 4L3PA 1ZLTA 2QU6A 3TKHA 2OI4X 1PYXA 4ZK5A 3TIYA 3ENHA 3I6UA 1AQ1A 3F7ZA 4JIKA 4QMUA 4N0SA 4CV9A 2JKKA 3ZO3A 4WUNA 5BUJA 4NEUA 2W5AA 4IE9A 3T9IA 5J1VA 2R3MA 2YABA 3OW3A 5FM3A 4LQMA 4FOCA 3ZO1A 3A60A 2FH9A 3DV3A 1HCKA 3PSCA 1REKA 5CVFA 2WMQA 4FTNA 3UIUA 3OS3A 1PXIA 4XG7A 1M2PA 4I94A 2WTIA 2VWVA 2WMVA 2OJ9A 5BVWA 4DEEA 3AC8A 3QQKA 4G1WA 4DFXE 3SXRA 4HVSA 3ATTA 4QP2A 5TOZA 3BYSA 2X4FA 4QMQA 4PPAA 5E8SA 3PJCA 2BIKB 3E88A 4ENXA 4WHZA 2Z7RA 4B99A 3II5A 5FXQA 4BR3A 4ZMFA 3PA4A 2X81A 3E8EA 5F20A 4FTCA 5CEIA 3HMIA 4HCTA 4KBCA 4N70A 3W2SA 3ZSHA 5HNBA 5IH5A 3QTUA 5HE0A 3SDJA 3O23A 3G9LX 4D0WA 2WQOA 3LFAA 5LARA 1JKTA 2JLDA 4ZTNA 4I0TA 2QR7A 3B8QA 4O2ZA 4YP8A 3VS1A 1XO2B 3ZYAA 1L8TA 4BB4A 4D58A 4G3EA 4FT3A 2V7OA 4ZSLA 4RX8A 2VWZA 3F2NA 3GQIA 3E3BX 3BQRA 4NWMA 1LEZA 2UW3A 4AU8A 3OVVA 3ORLA 1ZY5A 4CMTA 3AC3A 3FY2A 4DGGA 4BC6A 1PY5A 2W96B 3PUPA 3QZHA 2ZM3A 2FGIA 3V5PA 2RFNA 3W16A 1UU7A 3ZM4A 5M4CA 2IPXA 3PYYA 4KINA 4I3ZA 2G15A 2XMYA 3CTHA 4FV2A 2B55A 1J1BA 4KKHA 4L42A 4M0YA 3FKNA 3ZDIA 4FV8A 4XG2A 1QPCA 1KE6A 5CEQA 4AE9A 4CMOA 3PJ3A 2BROA 1CDKA 3N51A 3CD3A 5A54A 3G51A 3Q9XA 5L6OA 2PZRA 3BV3A 3QYWA 4E6DA 4BDFA 4FGBA 5FEDA 4JLCA 4W4VA 4FVPA 4KKGA 5DE2A 3UOLA 4HPTE 4BCKA 2V62A 2FVDA 3HMNA 3U6HA 1OPJA 3HX4A 4UWYA 3MIYA 2J5FA 2WEVA 1B39A 2C30A 3FLSA 3WF9A 3TTIA 5C26A 3OEFX 4CNHA 5C8NA 3BE9A 4FX3A 4Y46A 2PVYA 1H01A 2UVZA 3QKLA 2W9FB 3NRMA 1J1CA 3E8NA 3CXWA 3P86A 3O51A 1F5QA 1VEBA 4NIFA 4CFXA 1YI4A 2ITTA 4ZSGA 2XP2A 2BVAA 3FLQA 2H34A 4TKSA 3R7VA 3D14A 3IGGA 3NWWA 5A4EA 3ANQA 1PMEA 2IZUA 2GS7A 2CSNA 3PJ2A 1MRYA 5A9UA 4GJ2A 3ZFXA 5H3QA 1IASA 3ODYX 2VAGA 3PA3A 4OBPA 5AIKA 4MF0A 4ZTRA 3WI6A 4AAAA 2CLXA 3FSFA 2J2IB 5ACKA 3ZRMA 1OIUA 5KKRC 4XYFA 4ALWA 1SNUA 4BTFA 2G2IA 2XM9A 3ZFMA 5AP2A 3FLWA 3IS5A 1E9HA 4RFYA 2UW6A 3E63A 4GJ3A 2BZKB 4RA5A 2P33A 4Q2AA 3RMFA 3UIMA 1YWRA 2YCFA 3TUDA 3NUAA 3QBNA 5AP1A 3GU7A 2ITXA 3DJ5A 2O65A 4QT1A 4WNPA 4H1JA 3FPMA 4YMJA 3MGYA 4YJPA 4BKYA 3E92A 4DC2A 5CZIA 3VW6A 3EN6A 4FBXA 2R5TA 2JKMA 3SQQA 1UNLA 4RX5A 1YVJA 1W82A 2ZMDA 3Q2MA 4FIGA 4YSMA 3WF6A 3R6XA 4BIDA 1GY3A 4FTMA 2IJMA 1OM1A 3BLQA 3H0YA 4JQEA 5EFQA 3U9CA 3UYTA 2I6LA 3QX4A 4YJQA 1PXOA 4MQ2A 4XRLA 3RPRA 5D11A 3UOHA 3WIGA 5CAUA 4G6OA 2PYWA 4EHGA 1RW8A 3TL8A 2OH4A 2XJ2A 1H1WA 4MXAA 4CFUA 5E8TA 2OF2A 5HZNA 4CYJA 3LCDA 1JVPP 4KKEA 1U54B 4AGDA 5E8XA 3DJ6A 5JGBA 3QFVA 3M2WA 5JRQA 3VS0A 2Z2WA 4IZ5A 4C58A 4U42A 3SHEA 2BHEA 4XOYA 3DKCA 4HCUA 4YU2A 4F9AA 1W83A 5JFVA 4G17A 1Q8TA 4D2PA 3W32A 3LE6A 4A07A 3KRXA 3JS2A 2I7QA 3LMHA 2ONLA 3PXZA 4KIOA 3TEIA 3FZRA 4FKTA 2BIYA 4HNIA 2UV2A 2C0IA 1CKPA 3VS6A 4FL2A 4KNBA 2BUJA 5E8YA 4AW2A 3BZ3A 5C4KA 4R8QA 1Z9XA 5EG3A 4AN3A 2B7AA 2IVUA 2Y4IC 5LQFA 4R7HA 4EK8A 4QRCA 5AP6A 4E5BA 3GVUA 5I9WA 3FWQA 5KBRA 5AV2A 4YURA 4ARKA 3SA0A 5A4LA 2IW8A 2IW6A 4FC0A 4FSUA 3CQEA 2IZSA 1KV1A 2CGXA 4P5ZA 5CVHA 5FBNC 3SOCA 5F9EA 1ZZ2A 2HZIA 3G5DA 4MD7E 4PUZA 5CEOA 4UYAA 4O7RA 3B2WA 1ZMVA 1UU8A 2HY81 2VGPA 3C4XA 3VHEA 4UZDA 4YJNA 3MESA 4LG4A 4U43A 3EYHA 4IC8A 2VTTA 3PY0A 5IU2A 3OCSA 1R78A 2CN5A 3VBTA 4ANBA 1R0PA 2W1GA 1XH5A 3C4WA 3CC6A 3ETAA 5B7VA 2BDFA 5CYIA 1XJDA 2OFVA 3G6HA 2G01A 4RRVA 1UKHA 4RZVA 3BCEA 4IFCA 3BHVA 2QOFA 4BDJA 4AGCA 4W4YA 4XV2A 3IDCA 3QAME 2VO6A 4DINA 3U54A 2DUVA 4DT9A 3D7ZA 4WNOA 2GPHA 3CKXA 3ZS5A 1BI8A 4GIIA 3WZJA 3LJ2A 4RMZA 1YI3A 4FKVA 2H96A 2JKOA 3JY9A 3KRRA 4PQNA 3ZM9A 1H07A 5EM5A 5AP3A 4EQUA 4AZEA 3R0TA 4CSVA 4NU1A 4G16A 4ZMEA 4MAOA 1S9JA 3LFEA 4FT5A 4Z7GA 5IMEA 1VJYA 4D4RA 1Q99A 2G1TA 2UW5A 4BL1A 1H1QA 5CEKA 3M42A 2FSMX 4QTEA 4BI1A 5IA4A 5M55A 3LM0A 4IIRA 4BZOA 3OY1A 2PVHA 4O0TA 4PDPA 4DBNA 3KCKA 3KXZA 4N6YA 4R1VA 3V6SA 2J50A 3OCGA 2ZYBA 2EWAA 4FIIA 4FKRA 4X3JA 5KMIA 4YJTA 3D83A 3AT2A 3PIYA 5BX0A 5HGIA 5FXSA 1YKRA 4AW1A 4DEIA 3V5JA 5J5TA 4JG6A 4XG8A 4WKQA 2BKKA 3VJOA 3KK8A 1A06A 3EFKA 1Y8GA 4GK4A 5EHOA 3OROA 3TZ9A 2NNWB 4HVIA 2J0IA 4Q9ZA 3KMUA 1IRKA 5AP5A 4PRJA 2JIVA 2WXVA 2VNWA 3B8RA 3NEWA 5IQFA 4PP9A 4XLVA 4RJ5A 3RI1A 4U45A 3DXPA 2OO8X 3R9DA 3KRWA 4DEHA 4A9YA 1JOWB 1Q8ZA 2CGUA 2VTNA 4LYNA 4RPVA 4Y85A 4YBKA 5DT4A 2R3HA 2PU8A 4YTCA 4DCAA 3LCKA 4D2WA 3HV5A 3TCPA 4U3ZA 2EB2A 4FODA 2R3FA 4O1OA 2YAAA 3REPA 4XP0A 5GZ8A 4MXXA 5IQHA 4BYJA 4IM2A 5B2MA 5CZHA 3KFAA 2CDZA 4ERWA 3C0IA 3FI2A 4IEBA 4O0WA 3QKKA 4FVRA 3RPOA 2XH5A 3AG9A 2QHNA 4GEOA 4GIHA 2UW9A 5DN3A 3NYVA 2IVVA 5DRDA 3LXNA 3RHKA 3SC1A 2REIA 3ALNA 3BU3A 5HLPA 3QZFA 3RAWA 3TTJA 3UTOA 4MQ1A 4BDIA 5IQBA 4ZJIA 3NUPA 4H3PA 3NNUA 2W05A 3NW5A 4L9IA 3ZO4A 1G8AA 4A4LA 5T3QA 5M53A 3FLNC 4N6ZA 2C5XA 2GTMA 3A4OX 4FKGA 5DR6A 5ANKA 3RP9A 1GNGA 3U51A 2XKCA 3A62A 2R2PA 1Z57A 3P7BA 3POOA 2JFMA 4FG7A 4LGGA 4Z16A 4K8AA 2KTYA 3HDMA 3QRKA 2HZ4A 4YTIA 3GI3A 3LCTA 3FMLA 1Q4LA 4YZDA 4KUJA 3FZSA 4DEGA 2VTPA 3EL8A 4FICA 3ZSIA 2Z7LA 5F94A 2LGCA 1OKYA 2CPKE 4O7WA 2X8IA 2ZM1A 3V6RA 2UZDA 4AGUA 3FZOA 3ET7A 2C0OA 4GUBA 4QQJA 5IUIA 3G33A 1R0EA 3PRFA 3DLSA 3GEQA 4ANOA 4G6NA 3IW5A 4JT3A 3AMAA 4DTKA 5IQDA 4H36A 2QOBA 3QRJA 4QQ5A 3LOKA 4BN1A 3DU8A 3NUXA 3EQIA 4HYHA 3VBXA 3VUGA 2BZJA 1Y57A 3D2KA 2B4SB 2GFSA 3D5VA 4TNDA 4I24A 3BYOA 1LEWA 5CU6A 4ZIMA 4PL5A 4DEAA 4FA2A 5KKRB 3CLYA 5K3YA 2GU8A 4UY9A 4F7JA 4CGAA 3E87A 4FZAB 4WRSA 4EK4A 1V1KA 5AA9A 4E7WA 3PSBA 5CF6A 2VX3A 3KMMA 1BL6A 4YZ9A 4BZDA 4Z55A 5K4IA 2J0MB 2KULA 4ANMA 4O27B 1ZOHA 1PKGA 4IH8A 4OLIA 4EK5A 3ZXZA 5CT7A 1NVRA 4HGEA 3RPYA 2OWBA 3BYVA 4JDJA 4F09A 4EOOA 2XKEA 4YPSA 4BCQA 4M13A 3CJFA 2XBJA 5ETIA 4DHFA 4JDHA 4CKIA 3DFCB 4EOQA 5FP5A 5LMKC 1PRYA 1CSNA 3U4WA 3MS9A 3KF4A 3GC0A 4V01A 4BFMA 4G34A 4JAJA 1U46A 3COKA 4C4FA 4IDVA 4I6FA 4Y5HA 5DRBA 4BCNA 3HL7A 3JYAA 2PUIA 4X3FA 3KXXA 4OTIA 2ACXA 4JL9A 5AR2A 3RINA 3RPVA 3VC4A 5FTQA 3MV5A 2YFXA 3PVUA 4EORA 3UJGA 2QVSE 5B0XA 4IFGA 1V0PA 3IGOA 1HOWA 3MI9A 4FIJA 4P5QA 5AR8A 4XNEA 5B2KA 2Y4PA 3PJ1A 4MNEA 2PUPA 2HWOA 3FQEA 3FQSA 3CQWA 2C3KA 3FI3A 4W9XA 4AP7A 4IVDA 4J8MA 4I4EA 3JVRA 4OTHA 5DG5A 3RALA 2YIYA 4CFVA 1A48A 1DM2A 4FZ7A 5DHJA 4RIXA 1PF8A 2OSCA 3R02A 2PVKA 3OCBA 4M0ZA 4X2NA 1M52A 2R3LA 3VBYA 4PMPA 2Y4IB 5AR7A 1NW1A 4TY1A 3VWAA 4DITA 3W1FA 3BV2A 5CSVA 3ZFYA 4L44A 3R2YA 3BGPA 2RL5A 2RFDA 3ZLWA 1M7QA 3L9LA 2YJSA 4USDA 4EK6A 3QUPA 3VUIA 1B6CB 1H26A 3GC7A 3LQ5A 5EI8A 2QOIA 4OAUC 2Y6MA 4PDOA 5CLPA 4F99A 1KE5A 3BWJA 3OWJA 3ITZA 4NH1A 4K2RA 4GS6A 5FEEA 2IN6A 5BYLA 1T45A 4EOKA 4KRCA 4FEUA 2O5KA 2B9JA 2C6KA 2GNGA 2R7IA 1JSUA 4BKZA 4TTHB 2IW9A 4QQTA 2YWVA 4KIPA 4L7SA 5BQ0A 4UBAA 1KUTA 3AD4A 3KCFA 2X9EA 3OWKA 4FT7A 2OJJA 3EZRA 2UZLA 2YACA 3UGCA 4GVAA 1QL6A 2PTKA 5FBOA 1FMKA 2UW7A 2HENA 3PE1A 4UXLA 2IZRA 3LFSA 1W7HA 2XA4A
chains in the Genus database with same CATH superfamily
1Q3WA 2XKDA 4ZAUA 4ZSAA 1Y6AA 2YM4A 3K3JA 3LLTA 5JRSA 2F4JA 3E3PA 4IWPA 4MCVA 4ASXA 4IWQA 3D4QA 4V0GA 5C27A 3F3ZA 2NPQA 3OW4A 4W4XA 3RAKA 5EYDA 4F65A 5K5NA 4FUYA 4RC3A 4J71A 3O8UA 3WZUA 4HOKA 4R3PA 5LMKA 4IVAA 3AKKA 1M7NA 3C51A 3CGFA 4RWKA 5CI6A 2FYSA 2A0CX 2QC6A 4AWIA 4M3QA 5HCXA 5FTGA 2ZV9A 3D2IA 3DQWA 2XF0A 4TWOA 4FR4A 3U55A 1OB3A 5HLNA 1KOAA 3PLAE 5HE3A 4PNIA 4AW5A 4YLLA 1J7UA 1Q41A 2GSFA 2W1ZA 5IG1A 4NFNA 2PE1A 3I79A 2IVSA 1GIIA 3LAUA 3QD4A 4CYIA 4RGJA 1BL7A 5LWMA 3E7OA 2ETRA 5AP0A 4DTAA 4QTAA 4AXCA 4BI0A 4O84A 3ZHPC 4RJ4A 3QD3A 4FNWA 1URCA 4XHKB 4XMOA 4FV9A 5JGDA 3HLLA 2XNMA 3R9HA 1R39A 4UB7A 2B53A 5GJGA 4L46A 3MIAA 2BILB 3NIZA 1M14A 3LQ3A 3PPZA 5L3AA 4FSNA 1XH4A 1ZYJA 3MPMA 5IDPA 3DLZA 2R3NA 4EH4A 4F6SA 1PXLA 4XG3A 1YXTA 3QL8A 3KQ7A 4YHJA 5C4LA 4NKSA 2XNOA 4YHFA 4IJPA 3UZRA 3LHJA 4LFIA 2V22A 3DBDA 2QI8A 1YHVA 4I5MA 4IVCA 1GZNA 3ODZX 3BYMA 4XS2A 2X7GA 1OL7A 5EKOA 3PDTA 2CGWA 3DS6A 4JBVA 3C9WA 2R9SA 2J4ZA 4BICA 2CNUA 1UV5A 1CMKE 3Q4UA 4C34A 3VS4A 1ZXEA 4TWPA 2J7TA 1OPKA 2IO6A 3A4PA 3T8OA 1YXXA 4O21A 4UXQA 3ZLYA 4FSWA 2CLQA 5CNNA 2YJRA 4TYGA 1URWA 4EL9A 4NT4A 3BEAA 4EI4A 4RJ7A 3VAPA 3A7IA 4RA4A 4E8AA 1OGUA 3S1HA 1J7LA 3KB7A 4DEDA 3W0MA 2YCRA 3TIZA 1UU3A 4FSTA 2HOGA 4CEGA 4MNEB 4O82A 2JAMA 4DH3A 3A2CA 3A7GA 3R8ZA 2JGZA 3Q52A 2GDOA 3MH0A 2XZSA 4ITHA 5AUWA 3G0EA 3KU2A 5H2UA 5IDNA 1FOTA 3KGAA 4IWOA 1JQHA 1FMOE 4G9RA 5AP4A 5KZ0A 4BHNA 5K4JA 2GCDA 4RBLA 3TZ8A 4CG9A 4O6LA 3UVQA 5A46A 5A6NA 1ZWSA 3F66A 4WG3A 5CEPA 4L3LA 4PMSA 5IH4A 5ANDA 4DT8A 3TM0A 3FJQE 5J1WA 3BLAA 1G8JA 3TNIA 4DHIB 3SD0A 4AZTA 1IR3A 4LL5A 3L9PA 3DPKA 4WBBB 4FKWA 3ZXTA 2YDKA 3DK6A 2X2LA 3NDMA 3PRIA 5KZIA 4FTAA 3ORTA 5IUGA 4DA5A 2GFCA 2WTCA 2XRUA 3NLBA 4FOBA 3RZBA 3VUTA 3H3CA 4EYMA 4ZLYA 3K54A 3ALOA 3LVPA 1OL2A 5BUEA 2R3RA 3AGLA 2F2UA 3BHHA 3LLAA 1XKKA 2Q0NA 4I6QA 4ZJVA 3C13A 2YDIA 3QD0A 2GS6A 1YWNA 3LFDA 3O96A 2QO9A 4DFZE 3E5AA 1MQBA 1TVOA 2XK6A 3GC9A 3DAEA 3FEGA 1YOMA 2I0HA 3L8PA 4GMYA 3F2AA 3VS3A 3VS2A 3GU5A 4QMVA 4AZFA 4M67A 2R3KA 2BR1A 4J8NA 3V8WA 4KS7A 4NJDA 1WBWA 5KMNA 4F1MA 3F6XA 3P7AA 4WSQA 3A7HA 2X1NA 2FO0A 5BVEA 1JSTA 1JKSA 4B8MA 2F2CB 2UZTA 4AZWA 4I6HA 3R8PA 1CKIA 1A9UA 2E2BA 3HV7A 1MRVA 4QMSA 3R1NA 3PPKA 4CZYB 3ZUTA 4LGDA 3F3WA 3L8XA 4EJNA 3HV3A 3RCJA 3ATSA 5J95A 4C02A 3RHXA 3MFTA 3NZ0A 4CKRA 4MWIA 4QO9A 1U54A 3IOPA 1DI9A 3OEZA 3LFFA 3CEKA 1RJBA 2QOOA 5M51A 2XJ0A 5IA2A 3IO7A 4BCOA 2GQSA 3EN5A 5D10A 2OZAB 4UMTA 4EK3A 3KULB 2HXQA 3FC1X 1OKWA 3HA8A 3HV6A 4L6QA 4K77A 3BIZA 2H6DA 2ITYA 3FE3A 1O9UA 4MH7A 3MN3A 4UWCA 1WBOA 4OAVB 4MF1A 4K33A 4R5YA 5KMJA 1YQJA 2ESMA 3HMOA 5FLFA 3GU4A 1ZYDA 3OP5A 4CFNA 4X6QC 3F5UA 2JKQA 3O2MA 3HVCA 4FTKA 4DN5A 5KHWA 1STCE 1TZDA 2ITNA 2VWIA 5IEVA 3F2RA 2VTQA 2WHBA 4I5CA 4TXCA 3ZC5A 3GFEA 4ANLA 2YERA 5HG7A 4FTUA 5IEYA 4HCVA 3P1AA 2HZNA 2VX0A 3V5QA 3IW6A 4UMRA 5I9YA 1XMMA 1J91A 3MPAA 1FINA 3SG9A 5BMSA 4KBKA 4AGWA 4BBEA 3VQHA 3ORKA 3SX9A 3RGFA 3HAVA 3VJNA 5FGKA 3BL9A 4E4XA 3RWPA 4CLIA 2CGVA 4ACCA 2WGJA 1NT2A 4O4CA 2GNHA 3OOGA 5EW9A 2X0PA 4DG2E 1TQPA 3F7WA 4YHTA 3ULZA 1WAKA 1FBNA 4YGAA 1ZY4A 4C57A 3TNHA 3W0PA 3ANRA 4AACA 2XIYA 1H0WA 2E9OA 3C7QA 4DFNA 5DEYA 2ETMA 3ZRKA 1JWHA 1RDQE 2C5VA 2J9MA 4AZVA 2YM6A 4KIQA 4CRLA 3W8QA 1IG1A 5AADA 5M09A 1W2FA 3GCUA 3DBEA 4ONAA 3A7FA 3AC4A 2XNPA 1YW2A 4GRBA 5FEQA 3UVPA 2Z8CA 4DTBA 2HYYA 2XK7A 3WBLA 4F7SA 4MWHA 3DBQA 2Y8OA 2BKZA 3DNDA 3L8SA 3SAYA 4EHEA 3NW7A 1NXKA 4TT7A 3HGKA 4QNYA 5E1EA 4BDCA 3AMYA 4PDSA 2IZTA 4CFFA 3PXQA 4QMMA 4IM0A 4QOXA 2GS2A 4HVDA 4CRSA 4E73A 1Q61A 2R3IA 3V5LA 2V55A 5KE0A 4EZ5A 3KN5A 3V04A 4JOAA 4XX9A 1OL6A 2FSTX 3ROYA 2XK3A 5EHLA 5EW3A 2JIUA 2OKRA 4BYIA 3AQVA 3NSZA 4IXPA 4L68A 4NW6A 3PWDA 4YSJA 5J79A 3COMA 1BMKA 4A4XA 4W9WA 4XEYA 2R3PA 4CT2A 3MPTA 3QRUA 2QD9A 3PFQA 4CVAA 3A99A 3G9NA 3QUDA 3O71A 1L3RE 3EQHA 3KXNA 3RM7A 3QALE 5E1SA 5HLWA 4O22A 3QRTA 2ZV2A 2X2KA 5H8GA 1SYKA 3QCQA 3OC1A 4QYGA 2WOUA 5L4QA 5GIPE 4FG9A 5DR2A 5T6KA 3Q96A 4FVQA 3EQFA 1ZZLA 5M4IA 2GHGA 3L9NA 1PXNA 3C4FA 4C8BA 3BE2A 4CTBA 5K9IA 4NM7A 2WTDA 4S31A 1KE7A 1O6LA 3MVHA 1PMVA 4FV7A 3BKBA 3EZVA 3SRVA 1O6YA 1OUKA 3I6WA 1XH7A 2O0UA 4U5JA 3CP9A 5A3XA 2F9GA 5IA3A 4Z9LA 4BRXA 3TDVA 3E7VA 4F4PA 3PIZA 1B38A 1XWSA 3WILA 4GK3A 4EOLA 3IW4A 1ZOGA 2XNNA 2OBJA 3MH1A 3RK5A 2UW8A 4QP1A 4YZNA 3WF5A 3UPXA 4APCA 5CX9A 2Z60A 3HNGA 5AUTA 1ZMUA 1ST4A 1XH9A 1YXVA 3BQCA 3ELJA 1Q3DA 4GV1A 3V01A 4GT5A 2AEGA 1E1VA 1K9AA 2J51A 3F88A 3RPSA 5IQGA 3OTVA 4EEVA 2C6DA 1DI8A 2YA9A 5KMKA 3OD6X 5AIRA 4BCFA 4BHZA 3IONA 3P79A 2O2UA 4QTBA 3KRJA 3DJ7A 3O7LB 3K5VA 4FUXA 4C4HA 4C35A 4ZSJA 5CXZA 3WIKA 4WD5A 4OR5A 1NVSA 3KKVA 4ZY5A 4C7TA 3BLRA 3AXWA 3L9MA 2R4BA 2Z02A 3GUBA 5BVNA 3AOXA 2BTRA 3UOJA 3KREA 2OIDA 2O3PA 5HU9A 2RG5A 2WU6A 5B2LA 3IK3A 4CTCA 1T46A 2AC5A 2F7ZE 4U6RA 2CKOA 3ZBXA 4ORKA 3R22A 4U80A 5I3RA 2VTHA 3R30A 4FSRA 5TO8A 2HAKA 4GVJA 4FKQA 3BGZA 4LOQA 4KA3A 2O63A 2W1HA 3Q4ZA 1H28A 1H27A 4H1MA 5ETCA 3DXNA 5AV1A 4D2VA 5IA1A 4O7VA 4TPTA 5EI2A 3MFSA 3EN4A 5E9EA 3WZEA 3MWUA 4C2WA 3MY1A 3ZO2A 3H4JA 5J9YA 4IBMA 1O6KA 3LFNA 4G5PA 5CU3A 4L00A 3P5KA 4BCJA 5HIDA 5LCJA 4R77A 2C6LA 4IMYA 4JG7A 4QTCA 4RFMA 5CSHA 3RTPA 4B4LA 5HD4A 3ORNA 2W4KA 5HVKA 3OBGA 5FD2A 5LVMA 4HPUE 3VW8A 4XLIA 2PVMA 2VO7A 3UC4A 4WRGA 5HO6A 4KAOA 4BDEA 2XIZA 1FVTA 3I4BA 1ZYSA 3NCGA 5I3OA 2JFLA 3LFBA 5EI6A 3BHYA 4GT4A 3NUUA 4P2KA 3R7IA 3CGOA 4BDAA 4FSZA 4E4NA 3DZQA 3AT4A 2RFEA 3WYXA 4WIHA 2YZAA 5LJJA 2PMIA 3OG7A 5E8UA 4G3CA 2WQEA 3EIDA 3MBLA 2HWPA 4USFA 4K6ZA 5ANIA 1Q62A 5FDXA 4MYGA 3RCDA 4DF3A 1Q8YA 4IAIA 3CSVA 5BV3A 4D5HA 1OGYA 4LRMA 5FXRA 2X9FA 5HESA 1Q97A 2XK8A 4K9YA 5ETFA 4CD0A 4KS8A 2CMWA 2YWPA 4S34A 3UIBA 4AF3A 1Z5MA 2X0GA 1UNGA 4TN6A 4QMYA 2C4GA 3TUCA 3KRLA 4RWIA 4GT3A 3NPCA 4B7TA 1R1WA 5L2QA 4JDKA 3UO5A 3MB7A 2R3GA 3QCSA 4CXAA 2XYNA 2JDSA 3TXOA 4D2RA 4D1XA 2HK5A 2VTLA 4AXAA 2YCSA 4BDHA 4QPMA 4C36A 5LMAA 3P78A 3NYXA 5AR5A 5LMBA 4EHVA 3DQXA 3PE2A 4YLJA 4C3FA 1UNHA 5DOSA 4D5KA 4EOPA 3EOCA 4DG3E 3C4CA 5ANOA 1Q24A 3R73A 4RVTA 5FWKK 2QODA 5AR4A 3EQDA 1OZ1A 3UMXA 3W0RA 2WMSA 5GHVA 3QWJA 2Y0AA 3IECA 1P14A 4L52A 1OL5A 5L2IA 1YOLA 3FI8A 2VRXA 1P4FA 2PVJA 3EFJA 4AS0A 4UX9A 2J0JA 2ITVA 4WUAA 5L2WA 3SRVB 2OIQA 5AUZA 2Y7JA 2UZUE 4XP3A 4BCPA 2VU3A 2ZAZA 5CQWA 4P90A 3TN8A 3OUNB 4L7FA 3SLSA 4WSYA 5AUVA 5CI7A 5TF9A 1XR1A 3ORIA 2IVTA 4QD6A 5I5ZA 2PZIA 1GIJA 3LCSA 4FL3A 4F9CA 2JIIA 5K0KA 1S9IA 4C38A 3CJGA 2C47A 4HNFA 2QCSA 2WQBA 2EXMA 3QC4A 4IQ6A 4LV8A 3W33A 4H3QA 3NNWA 3HECA 3LQ8A 2RIOA 2VD5A 4FKIA 4F9BA 3UVRA 3H9RA 3QA8A 3KK9A 2OIBA 4UMQA 4GFMA 5HIEA 3R7OA 3NFGB 2GQGA 5KBQA 3FHRA 5EKNA 4ID7A 4QDVA 4JBPA 3RK9A 1FVVA 5HO8A 1ZAOA 4QMPA 5CU0A 5HTCA 4DLIA 1W8CA 5JFSA 2OF4A 2NP8A 3IW7A 4O38A 4ZTLA 4XOZA 2VTAA 4AZSA 2QO7A 4F7LA 4J52A 4AT5A 4I4FA 1TKIA 5CQUA 3V51A 4FMQA 4F6WA 4BIEA 2WOTA 1F3MC 1OPLA 3UO4A 5JFXA 2W9ZB 3D15A 3OT3A 3AC1A 2W5BA 1GZ8A 3GBZA 3QGWA 3SXFA 4EOIA 2AUHA 4XP2A 1SZMA 2PVNA 3HV4A 2DS1A 5AV0A 3S0OA 4F08A 4UZHA 4WBOA 3GOKA 2XK4A 4PPCA 4E1ZA 2XCKA 5JFWA 5EYKA 4K0YA 5HO7A 5CTPA 3COIA 4RQKA 4AQCA 4IJ9A 2OH0E 3BHUA 3EQBA 3H0ZA 3IDBA 2XNEA 3QXPA 1H24A 2YM7A 1DAYA 4GYIA 3MA3A 2AC3A 4PTGA 1BX6A 1GJOA 2YIXA 4Y72A 5CU4A 4C4EA 5IZFA 4F7NA 4BIBA 5DFPA 3FBVA 4D4VA 4R7BA 2YISA 2BZHB 2Z7QA 2UZBA 3VULA 2PL0A 2XAMA 3TT0A 2E9VA 4PL4A 4S2ZA 5C8KA 3P23A 3CS9A 5JMSA 3DDPA 2ZV7A 1RE8A 2BZIB 2Q0BA 2W4JA 3HYHA 3R7YA 3ZLSA 3ZMMA 4A06A 1YDTE 2HW7A 2BDJA 4AG8A 4D1SA 3Q2JA 5KCVA 4E93A 1M2QA 2DYLA 4EOMA 3CE3A 3SVVA 4F70A 5JQ8A 5CAVA 3G90X 1YHSA 4L43A 2C6MA 2OICA 1UKIA 2WTKC 2B9IA 1G5SA 4NFMA 2GNLA 3EFLA 5DEWA 4M69A 4YC8A 4PNKA 2PPQA 4X21A 3UZTA 3FKLA 3UO6A 5AM7A 1LUFA 4MXYA 4YLKA 3Q5ZA 5DI1A 3O17A 2X6EA 4O0UA 3S2PA 4JVGA 3R71A 5IA0A 3QGYA 4RJ3A 4YBJA 3PXYA 4H05A 3UQGA 4H58A 1BLXA 2ZFYA 3GGFA 5HNGA 3THBA 3R8VA 3V8TA 5HG5A 2Z7SA 4XJ0A 2I0EA 2LAVA 5D9HA 4FV5A 5H8EA 4JR3A 2OFUA 2VWUA 3G0FA 3NNVA 4UEUA 3RBWA 5BVFA 2IWIA 3NR9A 1DS5A 4HZRA 5G6VA 4R5SA 4C61A 5TKDA 2G9XA 5HVJA 4BY9E 3RNIA 2I1MA 3BL7A 3LMGA 4ZTHA 4E4LA 1YRPA 4QEBA 4JRNA 1REJA 3C4EA 3EKNA 4PMTA 3C4ZA 3HDNA 4ZSEA 3F3VA 5KNJA 3G15A 2JDRA 1OITA 4O0XA 4S33A 4LI5A 4G3DA 2XBAA 3E8DA 5IKWA 4DGNA 2O64A 4USEA 1H4LA 2XKFA 2VTSA 4FV4A 3MVJA 4YO6A 2YIRA 1PHKA 3UPZA 4LDTA 1F0QA 3ACKA 3FY0A 4O0RA 2QQ7A 2VWYA 4RX7A 4XRJA 4EONA 3ORPA 2P0CA 2R0IA 4H3BA 2YLFA 5L8LA 4M12A 4FSQA 5BMMA 5KO1A 4AXEA 2PVLA 1WZYA 4WNKA 5A4QA 2R3OA 4FF8A 3W2OA 5HBJA 3CY2A 3DOGA 3UNKA 3C1XA 3FUPA 4LGHA 4E6QA 3O8TA 3ZONA 3RM6A 4B6LA 3TG1A 2X4ZA 4GU9A 4O2PA 4XV3A 3PY1A 3ZLXA 3FYJX 3R83A 3QLGA 1FGIA 3TZ7A 3FMNA 5F1ZA 4DE4A 4TRLA 3JVSA 1DAWA 4OTFA 1LPUA 5HTBA 4PPBA 5HD7A 2PVFA 4M15A 3V5TA 3ZC6A 4RVMA 4E20A 2WMXA 4J1RA 5D7VA 4F9WA 3Q60A 2DWBA 4G2FA 5LVPA 2XIRA 3U87A 5BYYA 3I0QA 3ZRLA 4D4SA 3DT1A 4K18A 5M44A 3GCSA 4MBIA 4PMMA 4AA0A 2R0UA 1MRUA 4OW8A 2YIQA 3BBWA 4F0FA 4MVFA 3TNQB 4KWPA 3FXWA 3Q9YA 2YEXA 3SW4A 5IF1A 3AMBA 2BRNA 1U5QA 5GJFA 3PP1A 4I20A 4YJVA 4BF2A 2WTWA 3K5UA 4Q9SA 4QYYA 4KRDA 4U8ZA 2VTJA 4YUQA 2QOCA 2UW0A 2BCJA 2X39A 2PWLA 4G31A 4ZZMA 4RVLA 3ZCLA 4DH8A 3DY7A 3HMMA 4RT7A 3CTQA 2P3GX 3O0GA 4BWXA 4L45A 2OZAA 1SMHA 2WIPA 3TKUA 3KULA 3QTZA 4GFGA 3LJ1A 4FTOA 1G3NA 1BI7A 3A8WA 3DDQA 4HYUA 4OTQA 4P4CA 2OJGA 3NMUF 2QG5A 3CTJA 4NM0A 1XMLA 2ZDUA 2WPAA 3FSKA 3UP2A 3MFUA 2GHMA 1AGWA 4EH8A 1KE9A 1V0BA 3I0OA 3QX2A 3QXOA 4FTTA 3W8LA 3MYGA 3MW1A 4FTIA 3SV0A 1VYZA 3ENMA 3GU8A 1FPUA 2BTSA 1XHAA 3EJ1A 4YC3A 5JZJA 2ZMCA 5M57A 2FUMA 2UZWE 4OTPA 3F3TA 3O7LD 4TYHB 4DDGA 3OY3A 4J96A 1R3CA 5CAPA 2ZJWA 4XUFA 3UC3A 4J95A 4HVGA 2H9VA 3MVLA 5EYCA 3T3UA 2WO6A 4A9SA 3I7CA 3MJ2A 4PV0A 2C69A 2EUFB 2XVDA 4AQKA 2XANA 5CY3A 4CLJA 1I44A 1ZMWA 2BALA 3OT8A 5LWNA 3UIXA 2X8DA 4IAZA 2P4IA 3D7TB 3RJCA 5TR6A 4UWBA 2C1BA 4O4DA 3T9TA 3F69A 3ZEPA 2XAOA 4O7SA 2VV9A 5AUXA 3MA6A 4M69B 4N4SA 4BCIA 3Q5IA 2C5NA 5ICPA 3W0QA 3MTFA 4RLLA 4FV3A 5H9BA 1K3AA 3UBDA 1IAJA 4QP4A 3PZEA 1UA2A 5J9LA 2YM3A 2W7XA 3R00A 4QP7A 3EQRA 5FRIA 1ATPE 3K2LA 3LCOA 3PPJA 4EYJA 4U40A 3D0EA 5ETAA 4O7TA 2GMXA 2WQMA 4MD8E 5AAEA 1QPJA 3HP2A 2OJIA 2JD5A 4DHZA 1H1RA 4YPDA 5L2SA 4U81A 4JS8A 4EH9A 5JH6A 2JEDA 2VTMA 2YCQA 4AUAA 5AEPA 3L8VA 4BWKA 4IB5A 1PMNA 3S00A 3W10A 5CAQA 4HGTA 1XH8A 3LM5A 4ZTMA 3OMVA 5AUUA 4RSSA 4NTTA 4QMNA 5C8MA 3DCVA 1PYEA 3TJCA 2E9PA 4BDDA 5TT7A 4OTRA 2F7XE 4X6RA 3Q6WA 4LUEA 3E62A 5HG8A 3R8LA 3WZKA 1YDSE 4MX9A 3UQFA 5AM6A 1H00A 4KIKB 4BCGA 2BMCA 2UZNA 4O0VA 5EHYA 1E1XA 1ST0A 3Q3BA 4J7BA 5E91A 3P7CA 3NNXA 4IX6A 2WELA 3NX8A 1FQ1B 2XK9A 3LXLA 4FTLA 5C9CA 4YTFA 4FEVA 1UWHA 4FKSA 4BDKA 5F4NA 2VGOA 4F6UA 3DZOA 1TFFA 1U59A 4ZTSA 1JLUE 4II5A 4FT9A 4LOPA 5AA8A 2CCHA 3EYGA 3QQLA 2A98A 3CBLA 3R7GA 4OTDA 3SKCA 4CT1A 4DH7A 4W8DA 5AAGA 5K0XA 2BAQA 4BDBA 4BVUA 5E8ZA 5DLSA 4C62A 4APPA 3R1QA 2C6IA 5AV4A 3WF8A 2B0QA 5JGAA 3DBFA 3EH9A 4U3YA 3O50A 4R7IA 4OT5A 2W99B 4U79A 2XS0A 2JC6A 3TNPC 2PE2A 3BELA 4DFYA 4ITJA 3F61A 4F1OA 4JG8A 4LMNA 4RFZA 3DK3A 1OKVA 2EXEA 2YM8A 4EKKA 3I81A 4ALUA 3FV8A 3R01A 4BCHA 4EH2A 1Q8WA 4L01A 2RKUA 2WAJA 5F95A 4O4BB 2P2IA 2F49A 3HKOA 3KXHA 4O6EA 1W2DA 1YXUA 2WTKB 1CM8A 3F5XA 4WO5A 3VRYA 4TYEA 4F9YA 2OK1A 1WBTA 4X0MA 5C01A 3H30A 3KVXA 3LIJA 3FXZA 3DAKA 1H1SA 5KMMA 3ML1A 3TV6A 2R3JA 4X2KA 4U97A 4ZJJA 4JX3A 4ANQA 2PUNA 5HICA 4BGGA 3UE4A 4DLJA 3DBCA 4NCTC 4J98A 3Q9ZA 3U6JA 5CF4A 4X2GA 3PA5A 3FPQA 5M56A 4ACHA 4M66A 3TWJA 5L8JA 4UV0A 4O81A 2GTNA 4EWQA 3NCZA 4JR7A 4UALA 4BBFA 4C59A 4F0GA 4EH6A 3TV4A 3UYSA 2PZ5A 5EM8A 2UZEA 5FDPA 2OW3A 1W98A 4Z7HA 2OG8A 2OJFE 2GHLA 4FSMA 5E8VA 3DK7A 5GNKA 1OBDA 4M68A 5EQPA 4NJ3A 4FTQA 2QOHA 5CWZA 2XIKA 1VR2A 3GCPA 2C1AA 2QKWB 2GNFA 1JKKA 5M07A 3FQHA 1YWVA 3RNYA 1ZYLA 4RIWB 4UMUA 3M11A 4QYEA 4IAYA 4RX9A 3PTGA 4CQGA 1JKLA 1WFCA 3U9NA 3N9XA 1ZARA 4TYJA 4RZWA 4YTHA 4FG8A 2BFYA 3W55A 3LMIA 1J7IA 2PE0A 1OIQA 2QNJA 3ORXA 4YNOA 2ZV8A 5CALA 4FL1A 4EHZA 1OIYA 3FZ1A 4ANNA 3R8MA 3PG1A 5L6WL 3DNEA 3EFWA 2HELA 1P5EA 3DTCA 3QD2B 5D7AA 5JZNA 3Q6UA 3ZZEA 3I1AA 2A2AA 1J3HA 3D94A 1SVHA 5M08A 3QYZA 4ZEGA 2PSQA 4NM5A 4ASDA 5CU2A 2P55A 2W0JA 5DH3A 5FG8A 1PXMA 1PW2A 4IVBA 4ZOGA 4O7ZA 4B8LA 4GW8A 1OI9A 1ND4A 4O0SA 3R1YA 2O8YA 4IX4A 2XB7A 4I0SA 4HW7A 5DNRA 3S95A 2QR8A 3BGQA 3JXWA 2VZ6A 2ZDTA 4ACDA 1OBGA 4FZFB 3KC3A 3TI1A 1M17A 4KSQA 4I23A 4CKJA 3BHTA 4AXFA 1KWPA 2C6TA 4LOOA 3S3IA 2IF8A 3PIXA 3VHKA 5CNOA 2XJ1A 3M1SA 5I4NA 2PMNX 2W1IA 4I5PA 1LP4A 4K1BA 3QTQA 5FUTA 2CNVA 2WKMA 3NYOA 3OF0A 4NCTA 2PULA 2A27A 1GZKA 2XARA 2VX1A 4IX5A 4A7CA 5M06A 3HUCA 2ONLC 3NAXA 3QCYA 4QMLA 4E3CA 5BUIA 2VWWA 2QG7A 4FTRA 3N4UA 4UMPA 3GT8A 1VYWA 2OLCA 3RZFA 3PVBA 4GG5A 1PJKA 3ZSGA 3ZOSA 1H25A 3BYUA 4B0GA 2CNQA 5BNJA 3DTWA 4ZY6A 2HIWA 3QQFA 5DT3A 4TZRA 5CSWA 2W4OA 4QP6A 4JXFA 4D1ZA 4DG0E 4FNYA 2E9NA 5FQDC 2DQ7X 5J87A 5I9XA 2SRCA 3SXSA 1Y6BA 2PMLX 5DMZA 4QMWA 3CPCA 4BBMA 2G2FA 3DB8A 4U0IA 5AUYA 5CASA 1AD5A 3FHIA 1JNKA 2WMWA 3Q4CA 3W18A 2YIWA 2A19B 4O7LA 3ZUUA 5CSXA 4DGLC 4NUSA 3U4UA 2XIXA 4MNFA 4AX8A 3GFWA 3E93A 5EDPA 5BYZA 2CCIA 4FKUA 4F0IA 3R04A 3ID6C 1RQQA 4D55A 2ITQA 3FLYA 3I5NA 3ZBFA 4JBOA 4JBQA 3PJ8A 4AE6A 1OMWA 4PY1A 2UVYA 5CF8A 3DKOA 4EKLA 3CKWA 3F5GA 2IG7A 2H8HA 3PVWA 4DH1A 4E4MA 5J7HA 2NO3A 2ITPA 3WZDA 3TUBA 4YC6A 3EN9A 4W8EA 3R7EA 2UZVA 2C3LA 4Y8DA 4WNMA 3GCVA 2WIHA 1P4OA 3VF9A 3MH3A 5IEXA 2WMBA 3LXPA 2XM8A 3HUBA 2A4LA 4D4YA 3VO3A 5C1QB 4V04A 5CEMA 3FL4A 3C5UA 4FV6A 2B54A 4IW0A 5EQYA 5HI2A 5IUHA 2VUWA 2QOKA 4IZYA 5EDRA 1OL1A 3ORMA 4X2JA 4QTDA 2WMRA 5HCZA 4QNAA 4QMTA 3ZEWA 3EQCA 3H10A 4QDEA 3FXXA 3QUEA 5TE0A 4EOJA 3R8UA 2C5OA 4YZMA 4NYEA 3MFRA 4RWJA 3CD8A 5K5XA 3HRFA 2UW4A 4FNZA 4NM3A 4OBOA 4YZBA 3UNJA 4QMOA 2X7OA 5DBXA 2NRYA 1FGKA 2HY0A 4TWNA 3ZZWA 4M84A 3VUHA 4FK3A 5AX3A 5AWMA 4ZS4A 1WBNA 2WMAA 3NIEA 3HA6A 4NZWB 3S4QA 2UUEA 3W2PA