1OPJA

Structural basis for the auto-inhibition of c-abl tyrosine kinase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
287
structure length
287
Chain Sequence
AMDPSSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Structural basis for the autoinhibition of c-Abl tyrosine kinase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 88
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1opjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1opjA01
3HX4A 2HY0A 2ITZA 4JDIA 3CY2A 4IM3A 3OY3A 1Q41A 3BBWA 4Y46A 4AE6A 4BKJA 3C4XA 4KWPA 4J97A 4BCGA 1WBNA 2VU3A 3ZLWA 3UBDA 3EQGA 4C3RA 4GG5A 2ITYA 4EK3A 2EXCX 3MPAA 3T3UA 4FNYA 3EIDA 3POOA 4IJPA 5B7VA 2Y6MA 5EM5A 3GQIA 4HJOA 2V22A 2BFXA 3VUIA 4XCUA 2PVRA 2PVKA 2WMTA 5LQFA 4QMVA 2XNMA 4MNEB 4Y72A 5IH4A 3ELJA 4P5ZA 3BYSA 2R2PA 5CEKA 2HW6A 2XIXA 4AU8A 3KF7A 3OXIA 4OAVB 4ZZMA 4EWHA 1ZMWA 3AT2A 3H9OA 5AP4A 3MSSA 4CLJA 2R3NA 3ORXA 3AC4A 4FV1A 3VBTA 3VIDA 4C4JA 4EHZA 2BIKB 4RT7A 3NCZA 3WF9A 1YWRA 2PHKA 5L3AA 3SW7A 3SW4A 2UZLA 4YJTA 5H9BA 3ZMMA 1YQJA 5A54A 2JKOA 3DAJA 5FEQA 2J9MA 2UW7A 2GHMA 4O0WA 3W33A 5I9WA 3SQQA 4I3ZA 1O6KA 1KV1A 5DOSA 4C4GA 3VW6A 3QKKA 3CQUA 5KX8A 5C8KA 1OITA 5EK7A 5AR7A 3BU3A 4EK4A 2NP8A 3TZMA 4U0IA 5HHWA 4C58A 2F9GA 3QF9A 3SXSA 4I5MA 4BCFA 2X9EA 5C4KA 3QX4A 4WT6A 4FEUA 1JPAA 4JG7A 2BZIB 2I0HA 5DWRA 3E8CA 5IDNA 4N70A 4TZRA 5AMNA 2ITWA 5FEDA 4FZAB 4FTIA 3UG2A 4CT1A 1S9JA 3QCXA 2W5HA 5HU3A 4BCNA 4D9UA 5LVNA 1H01A 2PZYA 4PTCA 5H8BA 3FLNC 1TKIA 4H1MA 2WMUA 2H6DA 1VJYA 3E93A 4HCVA 4LV5A 5DGZA 5IMEA 3DXPA 4H1JA 2JIUA 3V5LA 4UB7A 5CNNA 3R7VA 4L44A 5AAFA 4MX9A 2OO8X 4J98A 3UDBA 3CS9A 2OXDA 3R9OA 1XH7A 1JLUE 4CTCA 1PKGA 4XOZA 1OIUA 5E8YA 4XG7A 3BU6A 3FZRA 4E3CA 2GNLA 4FL1A 5IU2A 4L53A 2G2IA 3TT0A 4BCQA 3ZTXA 3Q32A 5CYIA 3Q9ZA 4KSPA 2O65A 1Y91A 5DR2A 2B55A 3MY5A 2C6MA 4BIBA 2B9FA 3B8QA 3BEAA 2A0CX 4O0SA 3FMEA 1NVRA 2PL0A 4PTEA 3HRFA 3ZRKA 4I6FA 1BL7A 3FMHA 4JDKA 3OHTA 4RIXB 2XK3A 3RCDA 3JY0A 3Q53A 3PIXA 4FMQA 4MHAA 1QPDA 4TWNA 2YWVA 1XH8A 4FZ6A 3RPOA 4O0RA 2PU8A 4USEA 3LMGA 4AW2A 3W8LA 4NL0A 5K0XA 3M2WA 5AV1A 1JKSA 3NMUF 1Q8YA 3R00A 4J71A 3A60A 2PUNA 4YBJA 3UQGA 2QI8A 5IDPA 2I0YA 5M4FA 3QZHA 3GENA 5LMKA 2VO7A 2ZDTA 4JR7A 3UYSA 3NVKI 2BRBA 3QD0A 5DMZA 5LCKA 4OTDA 1NVQA 3L8PA 5E7RA 1W83A 4TWOA 4YTCA 4A9YA 4ZY5A 3GI3A 2ONLC 3CQEA 5AUVA 3V5TA 3DV3A 3QTZA 3UQFA 2OF2A 5M08A 4O21A 4BC6A 5HBEA 2QD9A 4AW5A 4FYNA 4RVMA 3CTHA 3HV4A 4XBRA 1BMKA 4ZSAA 3LFAA 2B7AA 5KMMA 4F7JA 3R0TA 4RX7A 2W1GA 3QD2B 4BGQA 3OEZA 4DFYA 3RAWA 4R1VA 4MTAA 2XH5A 4MD7E 3LXPA 2W05A 2GSFA 2WO6A 2F4JA 3QD4A 3JR1A 4FTLA 4JL9A 2Z7RA 5J9LA 4QYEA 4GT3A 3FI4A 2ZV2A 2CHLA 3M42A 3TV6A 3G0FA 5FXSA 3UIMA 4DFLA 4KIQA 4M3QA 1V0BA 2DS1A 3CTQA 3ATSA 5AP7A 2E9PA 4AWIA 4IXPA 4FNWA 5CAUA 3HMPA 3LXKA 2WTJA 5KHWA 3F82A 3R30A 3NNWA 4CZUA 3MH3A 3FDNA 4QMLA 3DBEA 3TCPA 3V5PA 2XZSA 5F1ZA 3IDCA 4N6ZA 3K3IA 4BDBA 3F2RA 4JG6A 2X8IA 3U55A 2J5FA 3LIJA 4GIIA 3RPRA 4CMUA 2F2CB 4CYIA 3KRJA 3MW1A 1H28A 3PVWA 3R1NA 4U80A 5B2MA 4BHZA 3FYJX 3OBGA 3PUPA 3UOLA 2VWZA 2YITA 4ALVA 4FYOA 4K9YA 2X8EA 4YHFA 3TJCA 2CGVA 4HGLA 1BI8A 4G3GA 4Q9ZA 4FSNA 3LW0A 3RWPA 4BTJA 2Z60A 2R3HA 3QCYA 5IUIA 1FINA 2Z02A 4ASEA 4A06A 5DNRA 3MH1A 4FTUA 4BCMA 4F6UA 3Q3BA 1V0PA 3DY7A 4FKGA 5KMNA 3D5VA 4X3FA 3BGQA 2XJ0A 3ZC6A 3MN3A 2Y9QA 3SLSA 3HRCA 3ETAA 3IPHA 4ZLOA 5LVOA 3TNPC 5GZ8A 1PRYA 1PHKA 3DKCA 1V1KA 2RIOA 4FT3A 3F9NA 1JKTA 2ITTA 4IZAA 3G51A 2Z8CA 5KBRA 3EB0A 4OBPA 2I1MA 3O7LB 3NNVA 3QQLA 3VS6A 1H0VA 1R1WA 2GNHA 3QWJA 4JDHA 1H1WA 3EJ1A 4FR4A 5FP6A 4O7NA 3A7FA 5AR5A 1U4DA 3FSKA 5M56A 3OROA 4FSYA 4C61A 3POZA 2WHBA 2QO7A 3IW6A 3D4QA 3EFLA 4QMOA 2B1PA 2JIVA 3DS6A 3KU2A 3QHWA 3QZFA 4H58A 1WCCA 2YHVA 4IB5A 5DT4A 3QTRA 4FNZA 3OOMA 4MWIA 4CG9A 2EWAA 5DA3A 2B52A 5A6NA 4FT7A 2E9OA 2G2FA 3GT8A 3M11A 2YIQA 2VTAA 4PP9A 1GJOA 1ZYDA 2GU8A 4EZ7A 4AUAA 3BWFA 2CNUA 1GAGA 4D4VA 2YM5A 4W9WA 1L8TA 3LJ0A 3SA0A 4F6WA 2R4BA 1P2AA 3OUNB 4YZCA 3QAME 2UZTA 4QPMA 3EQDA 3OUKA 2X81A 3OMVA 4FICA 3KMMA 1OL2A 3FYKX 3ITZA 4CV8A 3TTIA 4XP0A 5CXHA 4KIOA 2VZ6A 4U41A 2WD1A 3MY1A 5J7HA 3QRJA 4FG9A 3C5IA 4CKJA 4OTRA 4LM5A 3R1SA 2BFYA 4YHTA 5H3QA 3OWPA 4ACDA 2XKFA 3PSBA 2OGVA 5LARA 5LVPA 4P2KA 2VWBA 4TPTA 2WNTA 2YCRA 1ZZ2A 4DH1A 3EN6A 1FQ1B 3HECA 3JVSA 2PK9A 4MXYA 5EKOA 5HE0A 4UX9A 2PSQA 5DYJA 1R78A 4BWXA 2JFMA 5EM6A 2XVDA 3IQ7A 3REPA 3R71A 5IA0A 5GZAA 2YISA 5FDXA 2GFCA 1LR4A 1Z5MA 5C9CA 4Y5QA 4ZTSA 5HBHA 4C4HA 2FB8A 4CD0A 3E8EA 4RA5A 4QPSA 2ERKA 3B2WA 4MNFA 1PXPA 3DT1A 4FODA 4V0GB 4Z3VA 4EHEA 3MIAA 1CKPA 2OXXA 3DAEA 2BR1A 3Q6WA 4JIAA 4RX8A 4PDYA 1RDQE 4NU1A 4RX5A 2ITNA 4Z7GA 5EYCA 5IEXA 4MXOA 2YCSA 1GZOA 3NSZA 5A46A 3VUMA 3NYXA 4B8MA 2JKMA 1REKA 4UEUA 2R3OA 5LMKC 5TE0A 3LCKA 1SYKA 3UJGA 2HWOA 1WMKA 4QMUA 4U45A 4EH3A 2JITA 3RVGA 3OW3A 1OPKA 2OLCA 4HCTA 3PXQA 4ACCA 5IMXA 4O0UA 3DZOA 4IAIA 1YKRA 4AG8A 2QHMA 3R8VA 2NRYA 3FL4A 1YXXA 2XNGA 2H34A 4QTCA 1FOTA 5CZIA 2OFVA 2XK7A 1STCE 1B6CB 3DB8A 5BVFA 3QWKA 4JBOA 4C3FA 2BAKA 2YM6A 3PVBA 3FJQE 4WD5A 4Q9SA 3PLSA 5EI8A 3BV2A 3LFDA 4ERKA 4WHZA 3ZO1A 4O84A 5DR9A 1PMEA 3SHEA 3LFQA 4AXAA 4NCTA 4EI4A 2XM8A 4M0ZA 5BYZA 3E63A 3VS4A 4IAZA 3P78A 1NA7A 1Q4LA 4ASZA 4PNIA 3I5ZA 5F9EA 2OW3A 4FK3A 4A4OA 3MVJA 2YA9A 4DTAA 2WEVA 5FG8A 3ODZX 5EHYA 3ZDUA 5IQBA 5F94A 4YC8A 4BCOA 4ANSA 4IVBA 4R7IA 2H9VA 1IEPA 4CFWA 2VWYA 2X2LA 1OIRA 3LXLA 3II5A 4AZWA 2ETRA 3TKUA 4PMSA 5GINE 2WPAA 3ALOA 5DRDA 3HAVA 2BHHA 4RVLA 2ZMDA 1ZMUA 3MY0A 5K3YA 4YSJA 1QPCA 2C6LA 3DKFA 4FL2A 4QYHA 4EOIA 5HESA 3VJOA 3UIBA 2YIRA 5J1WA 1R0PA 4FTQA 3I7BA 4IM0A 4V01A 4WNPA 5T68A 2Y7JA 2XRWA 5E8TA 2X2MA 4ARKA 4JLCA 4BBEA 3ACKA 4I93A 3D2KA 3FKLA 1ND4A 1WBOA 3MTLA 2PMIA 2NO3A 3G6HA 4FIEA 5TT7A 3KMUA 4DCAA 3PXFA 5GNKA 2YN8A 3QU0A 3QTIA 3UNZA 3G33A 2Q83A 3C4CA 2UVYA 2V5QA 4DEBA 3SAYA 4EJNA 4S31A 3ID6C 4X3FC 4OTHA 4LFIA 4TWCA 3RPSA 3VF9A 3A8WA 3BKBA 4YC6A 2C3KA 3E5AA 2QR8A 4AQCA 3PG1A 1OIYA 4FIHA 2IVUA 1OL7A 2OI4X 2P55A 5DEYA 4E7WA 2YZAA 4NTTA 1ZRZA 4APPA 2Z7SA 1H07A 4LYNA 1PXOA 4P5QA 3RM7A 1KE9A 1EH4A 2FGIA 4KBAA 3O7LD 4O82A 3GC0A 2BRNA 3R7EA 5ACKA 5CU0A 5J9ZA 4AX8A 3Q2JA 4X6RA 2VV9A 2QKRA 5D9HA 1YDTE 2R3QA 3TEIA 3PY3A 4BBFA 5L6WL 3V6RA 4RFZA 3KL8A 4O0VA 5JFXA 2VTRA 1XHAA 1ZLTA 3KRWA 4GVAA 5IQIA 4QMZA 4BCPA 4E6DA 3ZUUA 2WQMA 2BKZA 4F1TA 4XP3A 4ZS4A 4AN3A 1UU9A 2HCKA 3LFCA 3AGLA 4QMXA 4FV5A 3OCBA 4KKHA 5AP0A 3ZXZA 4CGAA 3MB6A 3Q9XA 4XG3A 5DR6A 2A19B 4ACMA 2BDJA 3WYYA 5D41A 2XK4A 2E9NA 2W5AA 1NXKA 2VTSA 2X4FA 3NUNA 3R7UA 3ZUTA 5CF6A 4ZTMA 5AUTA 2UZWE 3TUBA 3E64A 4YJSA 4JX3A 3HL7A 3MPMA 4TYIA 1A48A 3H3CA 3O8PA 5HVYA 4WSQA 4QMMA 2ZV9A 4KRDA 4N57A 2PULA 4RRVA 1WBPA 5C4LA 2QURA 3QUDA 5CVGA 2WAJA 2W96B 4E4MA 4S30A 2BVAA 5TO8A 2ZDUA 1R39A 4MNEA 3UO4A 5HNGA 3F88A 4GL9A 1FVTA 1IA8A 2F57A 3D15A 4CRSA 4CSVA 2GS2A 5AIRA 3PA4A 5AR2A 3IGGA 2OJJA 5H2UA 3C4FA 3RZFA 3GU7A 3IW4A 4AA5A 3VS0A 2X9FA 5AUXA 5BYYA 4GK4A 3UMWA 3VWAA 1F0QA 2KULA 2WTIA 3FQSA 3VQUA 5AIKA 3W16A 5AR3A 3ZRMA 4O7LA 4JAJA 4DH5A 3W2SA 3SRVA 2LAVA 2FA2A 3ORTA 3AC5A 3MDYA 4S32A 4UZHA 3Q04A 3ZONA 5CAOA 1LEWA 3GOPA 3VULA 3EN5A 5FXQA 2A1AB 1ZZLA 1XH9A 2W9FB 4DHFA 3LZBA 4FVPA 2GS6A 4BDFA 4FSMA 2W17A 3LQ3A 2YIWA 2OH0E 3FHRA 1H24A 3VNTA 4FKVA 4OT5A 5DT0A 3TG1A 4I20A 4O0XA 4BVUA 5HG5A 3GXLA 3SG8A 5LMBA 3VBVA 1W8CA 4GVJA 5BVEA 1QCFA 5L4QA 5JMSA 4FX3A 3QRKA 4KRCA 3D14A 4OTFA 2R3KA 4CQEA 4DINA 5IQGA 3FZTA 3GC9A 4I23A 1BUHA 4I5HA 3WZKA 1WZYA 5JGBA 2X7OA 3AOXA 4UWBA 4DT9A 1W82A 3CR0A 4OGRA 4FKIA 3LLAA 4BFMA 2RG5A 4GS6A 4A9RA 5BMSA 4I5CA 3RAHA 2XNBA 3NYNA 4B99A 3OTVA 1PYEA 4L8MA 4ZJVA 3A4OX 4IANA 4YPDA 4F63A 4OTQA 4YLLA 2ZMCA 4DYMA 1P14A 4C4IA 4EOOA 5AADA 2PMOX 2F7XE 2C0IA 5IQDA 2QOFA 3BLHA 4HVSA 3LFEA 4FTMA 3JY9A 4F9WA 4BCIA 5A4TA 1IR3A 5D10A 2QOIA 3D83A 4JRNA 4GU9A 4DG0E 4K8AA 4R78A 2GQSA 4CYJA 5E8XA 3ZXTA 5HBJA 4O91A 4C35A 5HCXA 1BLXA 1UVRA 2UZDA 2R3PA 4I0TA 4F7NA 3F7ZA 5D1JA 4RIXA 3H9FA 4DEIA 2KTYA 4RIYA 3CE3A 3C0HA 3O8TA 1M7NA 2O2UA 4U9AA 3UPXA 3BGPA 4E5BA 1TVOA 3A99A 4GUBA 3FL5A 3N51A 3S00A 2G2HA 2YCQA 3U54A 4BDIA 1YI3A 5T3QA 3ATTA 3LE6A 3BCEA 4DGLC 3CD8A 4ZMEA 3TACA 3E8NA 4AACA 3QRUA 4FC0A 4MD9E 5A4CA 5DH3A 2W1HA 4UBAA 4HCUA 1FMKA 4QQCA 4LRJA 2RFNA 4IZ5A 4YZNA 3LFBA 4XJ0A 3U4WA 3KQ7A 5AUWA 1WBWA 3FZOA 2CLXA 3C7QA 4PPBA 4WRSA 2VRXA 3F3WA 3MS9A 4GIHA 4Q5EA 4D5KA 1WVXA 4FEXA 3GCVA 3GU8A 4O27B 4W9XA 4EK8A 4QYFA 5J5TA 3DKOA 4I41A 2F49A 2XK8A 4DAWA 3VAPA 3AXWA 5FTGA 2YDKA 1CSNA 1YXVA 4BDJA 1KE8A 4QQJA 4R5SA 5AV4A 5CAQA 4ITIA 4IEBA 5DEWA 4G3DA 4GW8A 4TYJA 1E9HA 4F0GA 3BHUA 3BELA 4EUUA 3O51A 3HP5A 5IPJA 3P5KA 3ZUVA 3HV7A 4ACHA 2W7XA 1DM2A 5CI6A 1XO2B 2VAGA 4GSBA 5ANKA 5JZNA 4ZK5A 2V55A 1U59A 3NIEA 1U5RA 3S3IA 4RWLA 4WIHA 1SNUA 3MJ2A 4DFXE 2O63A 4F0IA 4O6LA 4K6ZA 5ACBC 4GK3A 4AGUA 3R2BA 4G6LA 2C69A 3NGAA 3GB2A 4EOQA 2C5XA 5KKRB 5IF1A 3PPZA 3KXMA 5AV2A 3VS5A 4AP7A 4EQUA 3VUKA 5IA1A 1NVSA 3FPQA 4CVAA 3EN9A 3AG9A 3HP2A 5CF8A 4O0YA 4AW1A 3I0OA 3ORMA 3HV3A 2QR7A 3GVUA 5EDPA 2X4ZA 1R0EA 2OIDA 4BI2A 1H1QA 4XV1A 2RG6A 3AMYA 3I1AA 4DBNA 2YM8A 2YDJA 3QQHA 4BF2A 2PYWA 3ORZA 4MAOA 5EW8A 5DRBA 2OK1A 2GQRA 5LXMA 3UP2A 3NZ0A 2VTNA 3SX9A 5JGAA 4X2KA 3PZEA 4GMYA 4RJ5A 3Q2MA 3C13A 3HMMA 3UVRA 4U43A 3T9TA 4BGGA 2R3RA 5HTIA 3DBDA 4MD8E 5FM2A 5FD2A 3DBCA 1ATPE 2I40A 4PMMA 2ETMA 4GUEA 4LGDA 4EH9A 4GEOA 3CEKA 3IONA 1H1PA 4BZNA 4PMPA 1IAHA 3CBLA 4WO5A 4BRXA 4C8BA 4F4PA 4X3JA 2ITOA 1NY3A 4RLLA 2J2IB 3QTWA 4IWQA 3V04A 3LHJA 3G5DA 4EZ3A 3L9NA 4D4RA 4A9SA 4PP7A 5HO7A 2Y4IB 3R9DA 3DJ6A 3B8RA 3NUPA 4DEGA 4TT7A 3OZ6A 3FV8A 1XKKA 3E88A 4D1ZA 5JRSA 3SOCA 3FMLA 5D7AA 3S1HA 3D5WA 4U7ZA 5HVJA 4MF1A 3O17A 2IZUA 5E8ZA 2BALA 2BTRA 4PL5A 5HO6A 2OICA 3MH0A 1H8FA 5ETIA 5C26A 4RX9A 4IHPA 4F1MA 3OD6X 3QC9A 3SRVB 2CN5A 3OF0A 2XJ2A 4J52A 4DFUA 3FI3A 4USDA 4E5AX 3SD0A 1ZAOA 3Q9YA 1ZYJA 4QTDA 2R7IA 4MBIA 4X21A 4IVCA 5CSWA 2XEZA 1I44A 2E9VA 2FO0A 2JEDA 3GUBA 2C3JA 4ASDA 3ANQA 5ANIA 2ACXA 4EEVA 3I79A 3QTXA 2A4LA 4ZXTA 4WNKA 1JSUA 3MJ1A 2W9ZB 2YACA 3LM5A 5JK3A 5HVKA 3WF8A 2O3PA 5J79A 1J1BA 2REIA 3RHKA 3S95A 5AA9A 5BUJA 5GIPE 2IG7A 2XJ1A 2HZ4A 3RNIA 4ENXA 1F3MC 3BHHA 2WELA 3QALE 4GT5A 2DUVA 3ZOSA 4NFMA 4QP2A 2EXMA 2R3JA 5HGIA 4G5JA 4ZY4A 3O96A 3SC1A 4PMTA 2F7EE 1VYZA 2B4SB 4AOTA 4H39A 4YR8A 5EQYA 4RVTA 2IVVA 3NYVA 4ZTQA 2WMSA 4G5PA 5HQ0A 3PA5A 1GIHA 4FTJA 1PXNA 2ITPA 3TZ8A 2V7AA 4QP6A 2ZVAA 2CLQA 3QYWA 2J90A 4IAFA 5CS6A 2YLEA 1O6LA 2ZJWA 3ZM9A 4V0GA 3MA6A 2ZB0A 3NDMA 2ETKA 2PVMA 3AT4A 4XMOA 1JWHA 3V51A 4GG7A 5KMOA 1OVEA 3P0MA 1YWNA 1REJA 1QPEA 4RC2A 4ANQA 3QTSA 4IX6A 2BPMA 3DK7A 1KE7A 3KC3A 5E1EA 4Z9LA 1J7LA 2CKOA 4QP9A 1YI6A 2C30A 4RIYB 4UXLA 4F09A 4Y5HA 4YJVA 1U54B 1OM1A 1DI9A 2AC3A 4J96A 3FHIA 3TJDA 4F9CA 3TKIA 4QMQA 3DBQA 4DGGA 5CVHA 4AFJA 3ORPA 2VO6A 4FVQA 5A3XA 4S34A 1H0WA 4BCHA 5A4QA 4YHJA 5AFVA 4FKQA 5BUEA 3NUYA 4TN6A 4BDKA 3FLYA 1QL6A 2X7FA 2Y8OA 3ORLA 5JN2A 3R2YA 4OTWA 3QQFA 4MBJA 5HEZA 1Y8YA 4CLIA 2OJ9A 2UUEA 5GJFA 4YZBA 1Q99A 1OECA 2EXEA 3NUSA 3CXWA 4FK6A 4WUAA 3FY0A 1B39A 3L8VA 3MV5A 2QOKA 4XRJA 5DT3A 5EG3A 3O8UA 3D7TA 3R8ZA 3V3VA 4EOPA 1G8AA 4E4LA 4GH2A 4IWDA 4YTIA 4GKHA 4QTAA 3A7HA 4RSSA 3CY3A 4O7YA 3PJ2A 4QO9A 5IA4A 3NUAA 3OT8A 4RWIA 4NKSA 3UOKA 2X0GA 1UNHA 4CFMA 3HYHA 5AP5A 1FGIA 2UZEA 5CVFA 5B2KA 4OR5A 3W32A 4DGOA 1OKZA 2YCFA 2IZSA 1PJKA 3F69A 2JGZA 1OKYA 4IVDA 4KUJA 2BAQA 1XQZA 4ZSJA 4QP3A 3ZO4A 2OBJA 2W0JA 3O23A 5HTCA 4KNBA 1TQPA 1W98A 2X39A 3FKNA 3RCJA 4EOSA 3KXGA 2BAJA 3CSVA 1UV5A 1OKWA 5AR8A 3PRFA 2XBJA 4IZYA 4YJOA 4PV0A 2XCKA 4GJ2A 2QONA 4LUEA 2YLFA 4FSQA 3T3VA 3HEGA 2C5VA 4L01A 4R3RA 3NEWA 3COIA 4EK6A 5AAEA 1KWPA 2O64A 3DTWA 4E5WA 3DKGA 3G9LX 3KREA 4K1BA 3KULA 4FNXA 1MUOA 2XYUA 3NVMB 2CN8A 3NRMA 3C50A 3MPTA 3BYMA 2WEIA 5ETCA 3QTQA 5FTOA 5LWMA 4CEGA 3NYOA 1YHWA 1JKKA 4IVAA 2C4GA 4RIOA 5HI2A 1H08A 2IW6A 2R3IA 4UXQA 5CEQA 2PVYA 4L6QA 2XKCA 3CC6A 4F70A 5IEYA 5JFSA 1OUKA 5ANGA 3WBLA 3BX5A 2WTCA 4L46A 3R8LA 3GCPA 3LCSA 4G9CA 3W1FA 5BUIA 4QTBA 5ANOA 3UGCA 4ZLZA 2QQ7A 3ULZA 5E8VA 3KK9A 2QOLA 2QOBA 3DDQA 5HORA 3AGMA 4YLJA 3W2CA 2CGUA 2YERA 1K9AA 2QU6A 5EFQA 3DDPA 2VTHA 4MBLA 3TZ7A 5E92A 4KA3A 3E3BX 3PVGA 1ZYSA 2XS0A 5DLSA 1OMWA 5K9IA 1J7UA 3EYGA 3GU5A 5FBOA 4C4EA 5M51A 4FSWA 4B9DA 4PL3A 4F7LA 3KA0A 5TKDA 5IEVA 4HYHA 3V5WA 4CFXA 1PKDA 3GC7A 1Y57A 2XB7A 4M67A 4O96A 3HDMA 4FV2A 1Q61A 1MRVA 5CU2A 4YLKA 5CSXA 4QYGA 4CFUA 5M57A 3PYYA 4FEWA 3QRIA 3LCTA 5HOAA 4L52A 4BICA 5FM3A 2GNIA 2RSVA 4MXXA 2C5OA 3CLYA 2X2KA 2HXLA 4QTEA 2W1CA 5F20A 4BYIA 2WTVA 4FKWA 4JQ7A 4I1ZA 4GCJA 4JR3A 4BBMA 3Q4ZA 4G9RA 3F3ZA 2X7GA 4UMPA 2WZJA 4WKQA 3O2MA 3F61A 2PY3A 3PPKA 3Q5ZA 3W10A 4C59A 5A4LA 2C6IA 4W4VA 3QGWA 1KOBA 3DJ7A 4E4NA 4F64A 1R3CA 5L2QA 1OL1A 3FI2A 4E20A 4O0TA 2PE0A 3ROCA 3GFEA 4RQVA 4R5YA 3RKBA 4C36A 3DXQA 5HIEA 4JIKA 3OWKA 3RALA 4F1OA 4JQEA 1KOAA 2WMXA 5DBXA 4FV0A 2HOGA 2C1AA 1M2PA 5AUYA 3HUBA 4FEVA 5IQAA 2HZIA 4HOKA 2UZNA 4LV8A 5DHJA 4PNKA 4KS7A 4O81A 2OKRA 2VWXA 4U3YA 4WNMA 4C0TA 4AA4A 4O7SA 4IC8A 3U87A 4D55A 4F0FA 3BE9A 3P9JA 5HNBA 3KK8A 5CX9A 2XK6A 2UW0A 3ZCLA 5AP3A 3ZU7A 2HIWA 2QODA 3NWWA 3MFTA 4QQTA 2J5EA 1VEBA 1HCKA 1OPLA 1UNLA 4YP8A 5FTQA 3CQWA 1OB3A 4XUFA 4R1YA 3R8PA 4EH2A 1JVPP 1MQ4A 1WVYA 4W4XA 4EJ7A 2R7BA 3PFQA 5CANA 2J51A 5C1QB 3SVVA 2OSCA 1B38A 1OBGA 1H26A 4XYFA 3VUTA 3TM0A 4H3BA 4JDJA 4UV0A 2ZAZA 5CWZA 4H05A 4MXAA 3S2PA 4I6QA 1Y8GA 3HV6A 5FP5A 3T9IA 2C5YA 4FI1A 4MQ1A 3BQCA 4CXAA 3IW7A 3OC1A 3QCSA 1T46A 4BTFA 5IQEA 3A7GA 4D1SA 1SVHA 4TY1A 4CFVA 3VF8A 5I9VA 4RJ7A 2J4ZA 5EQPA 3G0EA 3CCNA 3BYVA 1ZARA 3F3UA 1JOWB 4Z55A 1PXIA 4YNOA 5BNJA 1UKIA 2QO2A 5CF4A 5JKGA 4KS8A 4ITHA 3E7OA 3KKVA 3FLWA 3QUPA 4D0WA 5CSHA 1JBPE 4PUZA 5GJDA 2CMWA 4AN9A 5K5XA 2YABA 1CKJA 1KSWA 4MYGA 4YJRA 3HKOA 4F9YA 3FZ1A 3OEFX 2R0IA 4YZ9A 3D7TB 3VBQA 1TQMA 4D2RA 3IG7A 4IB3A 4JBQA 1E1VA 5FUTA 4TXCA 5JRQA 3G9NA 4S2ZA 4QMWA 4KBCA 3UP7A 4BY9E 5FXRA 2OIBA 3QA8A 3RTPA 3JYAA 4FVRA 3PP1A 4WNOA 1DS5A 3PJ3A 4ZLYA 4ZTNA 4HZSA 5JT2A 2XF0A 4IBMA 4UZDA 3M1SA 4HGSA 4M13A 5BVWA 2W1EA 3MTFA 5CASA 4AE9A 3L9MA 4O7TA 5CAPA 4QP8A 2XNOA 4X2JA 4DLIA 4C33A 2IZTA 2PVLA 4L45A 4EH7A 4NYEA 1RQQA 3RNYA 3UTOA 3OBJA 3MWUA 4YC3A 2HELA 5LCJA 2IZRA 2Y6OA 4IDVA 3BWJA 5I3RA 3WF5A 3DLZA 4YSMA 5EHLA 3Q4TA 3EHAA 3DB6A 2WB8A 3IECA 4JT3A 3KULB 2B9JA 4FKJA 5CTPA 3FXZA 5JSMA 1YXTA 1DI8A 5CU6A 5E1SA 3R02A 3KMWA 1OL6A 1A06A 3UMXA 1JSTA 3C4EA 1XBCA 2UZOA 2BHEA 2YM4A 3HV5A 3K2LA 3F5PA 3QGYA 4YGAA 3W2RA 4ANNA 4QMNA 3JS2A 4C62A 3EFJA 3EQRA 4WRGA 1SVGA 3QHRA 4EOMA 1ZXEA 2ZV7A 2Y0AA 4RFYA 5HD4A 2FYSA 4R6VA 1NT2A 4FKTA 4TRLA 5A14A 1PMNA 2C6TA 4NIFB 3EQHA 1FVVA 2GTMA 4UN0C 4NK9A 2PMLX 3C5UA 2WMQA 2VTLA 4JAIA 4DITA 3LMHA 2JDSA 4WA9A 3OXTA 4MEDA 4I0SA 5E90A 4HZRA 1SVEA 3VUGA 2WMAA 4IZ7A 2W1FA 4YTHA 2YFXA 4RPVA 3BLQA 1G3NA 3V8TA 3IO7A 2VUWA 3EWHA 3I4BA 4IW0A 3A62A 4K2RA 2R0UA 3UC3A 4YO4A 3C51A 3AC1A 3BHTA 4Y83A 5JFVA 3DA6A 3LQ8A 5HE1A 1S9IA 2QG5A 3A7IA 4O1OA 5ITAA 5KHXA 1O6YA 4ANMA 3FLQA 4AZTA 3BRBA 4B7TA 4ID7A 2GPHA 3QZGA 3UIXA 4IB0A 3RWQA 4DEEA 1P4FA 1FPUA 1U46A 4FIIA 4ANBA 1PW2A 3PJCA 5CEIA 4LRMA 3C0IA 2XUUA 4EHGA 5KO1A 4D28A 3ET7A 3R1YA 4YJQA 3HA8A 2QCSA 4KAOA 4KABA 4U3ZA 2R64A 3VO3A 2J0JA 5TR6A 2NRUA 2X6EA 3WZJA 2VTPA 2PUUA 4NM5A 2FSTX 3EKNA 5C27A 3WYXA 4E1ZA 3MESA 3FSFA 3DFCB 3A4PA 4XG8A 3RJCA 4Y8DA 2PE1A 3AC3A 4JQ8A 2Z2WA 2O0UA 3NIZA 4BKZA 4BDGA 5I9ZA 4E8AA 2YZLA 5E91A 4FKPA 5AM7A 4O22A 2PMNX 4YU2A 5BVOA 3R7GA 4RJ6A 2WOTA 3FZSA 1NW1A 3OOGA 1MQBA 3ANRA 2EVAA 3EQPA 4CTBA 4G6NA 5EHOA 5LJJA 2B0QA 4E93A 3RPYA 2VWVA 2PTKA 3O50A 3R1QA 3F2AA 4QMPA 4UWCA 3OG7A 5HX6A 5L6OA 3BYUA 4FKSA 5ICPA 3KXZA 5DFPA 2ITUA 2YM3A 2VX0A 3UOJA 3QUEA 4XS2A 1HOWA 2P33A 4DT8A 2OZOA 4WG5A 4BIEA 2R3LA 4IC7A 4FSUA 3MH2A 4PWNA 4U44A 5CF5A 3L9PA 3OWJA 3ZEWA 1IAJA 5EOBA 4BDCA 4FTCA 3LXNA 4OBOA 3ZRLA 4PRJA 3KXXA 4WUNA 4IB1A 4DGNA 2XRUA 2RF9A 2RKUA 2WIPA 4IADA 2EUFB 3IDBA 4BGHA 4EK5A 3F7WA 3R7OA 4A07A 4O2ZA 1Q8WA 3FLSA 3QD3A 4D2PA 4BI1A 2GNFA 4KSQA 3HMNA 4FTRA 1CTPE 3CKWA 2IW9A 1ZWSA 4EL9A 4R7HA 4FUYA 4LOPA 3VHKA 3H0YA 3VBXA 1M2RA 1QPJA 2C1BA 3R9RA 3EQFA 4DFZE 3EQIA 5HD7A 2WIHA 4QT1A 2OWBA 4QNAA 2GNJA 3OWLA 4RJ3A 4XHKB 4AOJA 2HENA 1F5QA 4DF3A 3QFVA 3RZBA 4ZJIA 3V8WA 3EFWA 3ZZWA 2QC6A 5FDPA 3D5XA 4RLKA 4YJUA 1XBAA 4ORKA 1Y6BA 1ZYLA 2QLQA 4NCTC 3F3TA 4YBKA 3WZEA 2W4JA 5JEBA 3QXOA 4U6RA 4TNDA 4DN5A 2XCHA 1AGWA 1PF8A 3UOHA 3UE4A 3ORKA 4CZTA 4UY9A 3FC1X 3QBNA 4FKUA 4HW7A 3KRRA 5LWNA 2IWIA 3AMAA 3ALNA 4RA4A 3R22A 4K33A 4ZEGA 5AV3A 5G6VA 5HLNA 3OS3A 3HDNA 2CKPA 3AD5A 2R3GA 4IAAA 4RGJA 1U54A 5FWKK 3UZPA 3GU4A 3FQHA 1H25A 4AFEA 5BVKA 2WU7A 2XEYA 3I6WA 4C4FA 2QOQA 2CSNA 4F6SA 4NW5A 2WQBA 4NH1A 2OU7A 3RM6A 2P4IA 2C6EA 4TW9A 3DCVA 3ZLSA 2VTMA 3FY2A 4JOAA 3GC8A 4EKKA 4ZJJA 2VO3A 1CKIA 5BQ0A 2CNVA 4NUSA 1SM2A 3NNXA 4AAAA 3EL8A 2PZIA 3KB7A 4L42A 4LRKA 5EM7A 5F95A 1VZOA 5H8EA 2VGPA 5IQCA 4NW6A 3RK7A 3MGYA 2FSOX 5HKMA 4LL5A 4EOLA 4OTPA 4RZVA 3PIZA 3TUDA 4R8QA 3F2NA 2VO0A 1YOLA 4ZSLA 2YEXA 4NT4A 2DWBA 5CEOA 2WOUA 1UNGA 1LPUA 2P0CA 3DJ5A 3KRLA 1PMUA 2X8DA 1GOLA 3R9NA 2I7QA 1FMOE 3PJ1A 3EQBA 2XIYA 4LG4A 3Q5IA 2VTTA 1K3AA 2OJGA 1P4OA 1WVWA 2BZHB 3PE1A 3COHA 4GYGA 4LQMA 4TNBA 4NTSA 4XV3A 3PPJA 5KKRC 3D9VA 2HAKA 5M07A 3TV7A 5CI7A 1URCA 3LFNA 2B9HA 5DI1A 2VX3A 1URWA 3JUHA 5E8SA 5LVMA 1YWVA 1XR1A 2IN6A 3NLBA 3N4VA 5AEPA 4EWQA 3ACJA 3GP0A 2ZV8A 4YUQA 5L2SA 2J7TA 3BBTB 4RIWB 2I6LA 4HNIA 3D0EA 2XIKA 4ALUA 3ZC5A 4M7IA 4L7SA 4CZYB 5DVRA 3GOKA 3RK5A 4TYEA 3PLAE 3GBZA 3D5UA 4IAYA 3U4UA 3P79A 4AZEA 3UZRA 4DLJA 3H30A 2WMBA 3QTUA 3PSDA 3BPRA 3R7YA 1YDSE 2VD5A 4QP4A 3BEGA 3GCSA 4U42A 5DIAA 3SV0A 3N4UA 2XIZA 1YDRE 2JKKA 3HZTA 4AZSA 4NFNA 3R73A 1OIQA 5IUGA 5IQHA 2VN9A 3WOWA 4TYGA 2IW8A 3DPKA 2YDIA 3F6XA 5J1VA 2RFDA 4XLIA 5AM6A 3V8SA 4OW8A 3KN6A 2W99B 3E7VA 4MVFA 3DK6A 4I94A 5JQ5A 4J8MA 1M14A 5HICA 5KMKA 4FEQA 3LCOA 2AC5A 4E6QA 2W4OA 1OI9A 2WTKB 2Y4IC 5ETAA 1XJDA 3I60A 3LLTA 1E1XA 4CCBA 5M4UA 3R83A 4JS8A 4RFMA 1A9UA 3DNDA 4AZFA 2B9IA 4UMQA 5GIOE 4A4LA 5IA3A 1BL6A 3N4TA 2JAMA 3EFKA 1SNXA 3U9CA 5EKNA 1T45A 3VHEA 1APME 3KF4A 4U79A 3ZM4A 2GTNA 4ZSEA 4FA2A 4GU6A 1XH4A 3I6UA 4KIPA 3U51A 4BWKA 2UW9A 5CAVA 2J0LA 4JVGA 2BRHA 4FG8A 3KGAA 3OW4A 1OZ1A 4R3PA 4X6QC 5IA2A 3DBFA 2XNEA 3IOKA 3P7AA 4M69B 5TF9A 3RINA 3WZDA 5EDQA 2R3FA 3KN5A 3SOAA 2AUHA 4IE9A 2ITXA 5EH0A 4E26A 4LMNA 1CMKE 3TXOA 3ZDIA 5L2TA 3UIUA 4ANLA 3MBLA 4B4LA 4R7BA 3ENHA 4CKIA 3TTJA 3UG1A 3BLRA 4FIFA 3DAKA 3LKMA 3LMIA 4FE2A 3TV4A 3QCQA 3W2QA 4XBUA 4ENYA 3OFMA 4XG6A 4O7VA 1J7IA 2X1NA 2XKEA 2ZOQA 2IJMA 3OCTA 4D4SA 4DCEA 2UW8A 4NWMA 4C38A 5KNJA 1TQIA 2OF4A 2YM7A 4ZTLA 5LMAA 1XH5A 5IA5A 2XA4A 4BDAA 4XG4A 4ZS0A 3F5UA 1GY3A 4EORA 1J91A 1Q24A 4ZTRA 3R7IA 4BZOA 2CKQA 5KMJA 4HVDA 3C0GA 1CM8A 3PVUA 2J0IA 2O8YA 5CEMA 4E4XA 3BI6A 4OT6A 4V05A 4TWPA 4TKSA 4L9IA 2E2BA 4NM7A 2JAVA 4IWOA 4BDHA 3TKHA 4FV8A 2B54A 1Q3DA 5AX9A 2JKQA 3L9LA 3GFWA 4IFCA 5K0KA 2BZJA 1G5SA 4FKLA 2YAAA 4NZWB 4II5A 1PY5A 3R9HA 4R77A 1I09A 3F5GA 1OL5A 4AOIA 3PJ8A 1PYXA 3L8SA 2OJIA 4ALWA 2UV2A 3MVLA 5B0XA 4EH8A 4WBOA 5J95A 1P5EA 3OCGA 2BIYA 3GQLA 3QLFA 2JC6A 3EKKA 4FIGA 4JI9A 4D58A 1UKHA 4AF3A 2OIQA 1OPJA 3MYGA 4IX4A 2G1TA 2W1ZA 3VS2A 4DGMA 4NKAA 1Y6AA 3R21A 2BUJA 3ENMA 4D2VA 4DEHA 4FIJA 3P7BA 4YJPA 5ANEA 3QKLA 4ITJA 4M0YA 5JQ8A 3UYTA 4CQGA 5CT0A 3PSCA 5ETFA 3F5XA 3G2FA 3AQVA 5D11A 1YXUA 3LVPA 3FKOA 4Y95A 3EN7A 5I9YA 4FTOA 2YJSA 3NW5A 4PPCA 4XV2A 4CMTA 2FUMA 4MXCA 4PDOA 3IK3A 4AW0A 5EYKA 3CGFA 3R8MA 1KE5A 3VS1A 3KRXA 4I0RA 4IM2A 3CD3A 3AC8A 3JVRA 2Q0BA 2HXQA 2R3MA 3DGKA 2GMXA 4AGCA 4ZZOA 1O9UA 2C3LA 2JFLA 4DTBA 1YOMA 3Q96A 3V6SA 4FTTA 3U6HA 1Q8ZA 2PVHA 2OZAB 1GIIA 4YZDA 5KE0A 3PXKA 4HYUA 4XP2A 3U9NA 2PE2A 3PE2A 2V62A 3NNUA 1J1CA 2RGPA 4AGDA 3DU8A 2IPXA 4OTIA 3NAXA 1KE6A 3O0GA 4QRCA 1MP8A 2VTIA 2HZ0A 3G6GA 5M53A 3BU5A 3ZBFA 1SMHA 5CQUA 2X6DA 4EH5A 3P1AA 5I4NA 5M55A 4HVGA 3AC2A 4I22A 3VBWA 4DA5A 4EC8A 4DH3A 4BIDA 2C6DA 5HG7A 2VGOA 4FZ7A 4D0XA 5HG9A 4EZ5A 2Y4PA 4NSTA 5EOLA 1SZMA 2AYPA 4L3JA 5EYMA 2HK5A 3U8WA 1WBSA 3ZH8A 3P7CA 4G16A 1WBVA 4UMTA 4CCUA 4X2NA 2C0OA 4CKRA 2XNNA 4GJ3A 5K4IA 4N4SA 4DTKA 5E8WA 1MRYA 4FV4A 4QOXA 3V01A 1Q5KA 4MF0A 3BYOA 4PQNA 3TNWA 4BTKA 2VWUA 2RL5A 1LEZA 2WGJA 1PXKA 3QLGA 4QMSA 5I0BA 3FMJA 3FLZA 4D5HA 2XNPA 3AD4A 4CT2A 4F65A 1YVJA 3MIYA 2Z7LA 3Q4UA 3C9WA 4ANOA 5L8KA 4FKOA 1YOJA 3LQ5A 3FQEA 4DH8A 3THBA 4G17A 3BIZA 5BX0A 3HRBA 3QKMA 3PDTA 3QL8A 4EUTA 3FPMA 1G8SA 2ESMA 1OGUA 1IASA 1UWHA 2XK9A 2ZM3A 3OT3A 3CIKA 5KUPA 1Q62A 3KXNA 4G6OA 3ROYA 3GNIB 2CKEA 4N6YA 4J7BA 1IA9A 3WF7A 2C5NA 4FTAA 3WI6A 4PTGA 3COKA 4U81A 3MA3A 3K5VA 5ANJA 4XNEA 4Z16A 4O1PA 3UODA 1ZOHA 3CPCA 4WG3A 2H8HA 4LOOA 2WKMA 2DYLA 4NIFA 3AD6A 5FLFA 5HO8A 3NAYA 3EMGA 3R04A 4FUXA 4MKCA 5HNIX 3D94A 2ZB1A 4RWKA 5KMLA 3FXWA 3HVCA 4UMUA 3DOGA 4XG2A 5LVLA 3TDWA 4LI5A 3SDJA 2C3IB 4O7WA 2FVDA 5J8IA 4DG2E 5AAGA 4BWPA 4ZZNA 3U6JA 4XRLA 2W06A 2Z7QA 4ZOGA 4LGHA 3OVVA 4NM3A 4ERWA 2UW5A 4XEYA 4MXZA 1GZKA 3EH9A 4X0MA 2CGXA 1WFCA 3LPBA 2UVXA 3IGOA 3E3PA 3P23A 4L3PA 2WMWA 4FZFB 4IJ9A 4E6CA 4DEAA 3I7CA 3MFRA 4KBKA 4P7EA 3FZPA 4FT0A 2JBOA 4IX5A 3RAIA 3DLSA 3ZYAA 4ZIMA 4LL0A 4E6AA 5CSPA 4M12A 2RFEA 1ZY4A 3QRTA 3VUHA 3ZSIA 3FMDA 2QVSE 4EC9A 3PWYA 4NM0A 1OKVA 3MFSA 3MVMA 4L43A 2O5KA 4L68A 1H4LA 2GCDA 3GCUA 4KINA 5HCYA 4XX9A 3K54A 4NJ3A 5AP1A 3UNJA 2HY81 4DH7A 3CP9A 3ZEPA 1Q8TA 3JXWA 5AA8A 3ULIA 2F2UA 5JZJA 3FMNA 4XLVA 2BMCA 2G01A 3GGFA 5AP2A 4XH6A 4B6LA 1DAWA 3HNGA 3PTGA 5B2LA 1H1SA 2WQEA 4FZDB 4QYYA 3NW7A 4W8EA 2WFYA 5E4HA 2XMYA 5CT7A 4AN2A 4PL4A 3WE8A 2BRGA 4AT3A 4EH4A 3MVHA 4F08A 3R8UA 4M97A 3RK9A 4OLIA 3OXZA 3BQRA 3D2IA 3MI9A 3CPBA 3IW8A 3KY2A 4IDTA 4U8ZA 4OAUC 1LUFA 3HAMA 3ZFXA 3DXNA 3S0OA 3IDPA 5BVNA 4M14A 2QLUA 3PXRA 4FV9A 4QP1A 2UW4A 3LFSA 4RC4A 3HLLA 5A9UA 5L8LA 5J9YA 4Q2AA 4RJ4A 4BYJA 2IVTA 4YNEA 4IAKA 4RQKA 4EQMA 3SG9A 4BCKA 5IH6A 3LOKA 5KMIA 3EZVA 4U5JA 2YIXA 4FOBA 3FUPA 3MB7A 4X2GA 4YPSA 5HTBA 4XV9A 4FT9A 1FVRA 2QKWB 3PXZA 4W4WA 2IVSA 2QG7A 2WU6A 3RAKA 3VRYA 2JD5A 4RWJA 4IFGA 4YO6A 5AJQA 5CALA 1GZNA 3E62A 4PDSA 3FE3A 4PX6A 3G15A 4HGEA 4GK2A 5AV0A 1JAMA 1UU3A 5HLWA 2VNYA 5IH5A 1W0XC 3I81A 4P90A 4CFNA 3EZRA 4NEUA 3P4KA 4GYIA 3TN8A 5J7BA 2C68A 2GHGA 4C37A 3BV3A 5BYLA 2DQ7X 3Q52A 5JFWA 2QNJA 2ERZE 3GCQA 4Q5HA 4M84A 4YJNA 5GZ9A 5E8UA 5IUHA 3CTJA 3IOPA 3G90X 4HYIA 1AQ1A 2IO6A 4QP7A 1QMZA 4FT5A 3GEQA 2SRCA 4XOYA 4GFMA 3VRZA 4ZY6A 2EB3A 4O2PA 3I0QA 2CJMA 3NUUA 5AUZA 4F9AA 4EKLA 4L3LA 2GNGA 3PIYA 3FMMA 2JDTA 2XP2A 4WOVA 1BX6A 5H8GA 5AUUA 4O83A 3QXPA 3VBYA 1K2PA 4LMUA 5BMMA 1L3RE 4I21A 4O7RA 2XYNA 4J99A 3FWQA 4IX3A 4BZDA 4JBVA 4L67A 4ZTHA 4A4XA 1ERKA 1W84A 3SXFA 4HVIA 5L2IA 1YXSA 5DE2A 5E9EA 3Q9WA 5HLPA 3RP9A 3I5NA 4FG7A 2YAKA 4EOKA 4G3FA 5HZNA 2P2IA 2P3GX 4KIKA 3E92A 3PY0A 4OBQA 2F7ZE 3W2PA 4BL1A 1M7QA 4GFGA 4JX7A 5IISA 3OY1A 2JIIA 2BCJA 4K18A 4FF8A 3P86A 5J87A 4TYHA 4AT5A 5M4CA 1YHSA 4M8TA 5CXZA 3BZ3A 3VW8A 3UO5A 1Q97A 3NPCA 3VVHA 2ZYBA 4M15A 2J50A 3CJGA 3F3VA 4G31A 4QMTA 4R3CA 3ZO2A 2BDFA 1GZ8A 2JDOA 2OJFE 3IW5A 4QMYA 3WE4A 5CEPA 2WQNA 3C4ZA 4FTKA 5CU3A 5I9XA 4HGTA 4IWPA 3A2CA 4YZMA 4I4FA 3Q4CA 1H1RA 2A27A 2QOHA 1JSVA 3DZQA 3PWDA 4MCVA 5D12A 3QYZA 4D4YA 3QZIA 3A8XA 4O7ZA 2FH9A 5CNOA 2I0EA 5CY3A 4AA0A 3ZSGA 4Z7HA 3KVXA 1JNKA 3ZSHA 3TDVA 1WBTA 1M2QA 3OTUA 4FV3A 2VNWA 3IS5A 1Q3WA 4FTNA 2OG8A 3ZFMA 4I4EA 4BKYA 1IG1A 2PWLA 4Y73A 5GJGA 4UALA 5EW3A 2OH4A 5HX8A 3UO6A 3DFAA 1PXLA 2I0VA 3QA0A 3CGOA 3TUCA 2YIYA 4JBPA 3EQCA 4DEDA 2R9SA 5A4EA 3TNQB 3ZBXA 3PY1A 3FAAA 5FBNC 5AP6A 5CQWA 4GRBA 1Z57A 4G3CA 4QD6A 2G9XA 5KZ0A 4RIWA 4EOJA 2JBPA 5CU4A 4FBXA 1VR2A 1WAKA 3ERKA 1UU7A 3QQGA 3LFFA 1IRKA 3RGFA 4Y85A 1DAYA 4B8LA 2LGCA 2GDOA 3CJFA 1HCLA 4GFOA 3PZHA 3R28A 4F99A 2BKKA 2FSMX 3TNIA 4QQ5A 1JKLA 2R5TA 2WMVA 4CV9A 4MK0A 3OCSA 5C8NA 5EDRA 2VWIA 1W7HA 4JXFA 3FMKA 4I24A 3VQHA 3OP5A 4F7SA 4RG0A 2ITQA 2HWPA 2JDRA 4WSYA 2EU9A 4CRLA 3AT3A 4RZWA 4X3FB 5FGKA 2UZBA 3W55A 3K5UA 3LAUA 5HIDA 5HCZA 5L6PA 5EI6A 3RHXA 5FEEA 4RC3A 4M68A 2V7OA 4CFFA 5IQFA 2BTSA 2C6KA 4C02A 3E87A 3ODYX 3N9XA 2P2HA 3W18A 5AR4A 5CENA 4IQ6A 5I9UA 1OBDA 3SGCA 5FRIA 4PF4A 3RBWA 3QQKA 4M66A 4QPAA 2W1DA 3TNHA 4NJDA 4FV7A 1UWJA 1J3HA 1BI7A 3A61A 3DQXA 4DFNA 4A7CA 2OFUA 4GKIA 4KB8A 4RBLA 5EW9A 4AS0A 2CDZA 3EOCA 4GT4A 4MQ2A 2UZUE 5DN3A 3SKCA 1YRPA 3ORNA 4M69A 3LJ2A 2XKDA 4EONA 4AGWA 3QQUA 2FSLX 2XM9A 1FGKA 3HMOA 5HE3A 1X8BA 2V0DA 3EYHA 2PUIA 5EQEA 3VC4A 3ZS5A 4FSRA 2VWWA 4LOQA 4FV6A 3WARA 2C0TA 2PZRA 1YW2A 5F4NA 2C47A 3NS9A 4ONAA 4C3PA 4B0GA 3UVPA 4HPTE 1YI4A 2CGWA 3ZHPC 2G15A 4MH7A 1MRUA 3HA6A 3DQWA 2UW3A 2Q0NA 4K0YA 4BN1A 4X7QA 4CG8A 3HMIA 1Q8UA 3RPVA 3KCFA 4BCJA 5EI2A 4RJ8A 3H9RA 1BYGA 2PVNA 3QQJA 3ZFYA 3FBVA 4IMYA 2J6MA 2WQOA 3H4JA 4JNWA 5BPYA 4DBXA 4UWYA 1GIJA 3KCKA 4L7FA 3UQCA 3R6XA 3TI1A 5C01A 3FEGA 3L1SA 1ZOGA 2JLDA 2GQGA 1PXMA 3WIGA 4J1RA 4D9TA 3BE2A 5I5ZA 5JGDA 1ZY5A 4H36A 2UZVA 4G3EA 4DFBA 2CCHA 3VJNA 2J0KA 5EM8A 4D2TA 2XBAA 5IKWA 1PXJA 1RJBA 3VS3A 2NPQA 3HUCA 4XG9A 5CLPA 4EH6A 4EQCA 1UU8A 3SXRA 1V0OA 2QOOA 2C6OA 2W5BA 5G1XA 5M44A 2QOCA 3DK3A 3MFUA 4C2WA 5KBQA 3FI8A 4FGBA 5HU9A 3H0ZA 3LM0A 3FXXA 3LCDA 4KKGA 5LOHA 2UVZA 3DTCA 3V5QA 3NW6A 3PP0A 3KXHA 3BGZA 3NCGA 4G1WA 5CSVA 4J95A 5IZFA 3O71A 4J8NA 2E9UA 1OUYA 4HYSA 4CMOA 4E73A 2UW6A 5AWMA 2ZM4A 4J53A 4D1XA 1VYWA 3V5JA 3WIKA 4HVHA 4IACA 1KUTA 2BRMA 2QO9A 1ZOEA 4PPAA 4EYMA 3BHVA 3PXYA 3L8XA 2VX1A 4WBBB 4BDDA 4ZMFA 2BZKB 3PG3A 3IKAA 4KIKB 2PVJA 2GS7A 4RMZA 5C8MA 3RMFA 4I92A 5TOZA 3CKXA 3EL7A 4O6EA 2OXYA 4X2FA 3ZLXA 2PPQA 4A9UA 2PZPA 3GU6A 2OZAA 4JG8A 3WF6A 4K11A 4C2VA 4FSTA 4V04A 3TIZA 4TYHB 1H00A 5M09A 4G2FA 4PY1A 1AD5A 3UC4A 1LP4A 4HNFA 5K4JA 3ZO3A 3A7JA 1RE8A 4ZP5A 2WXVA 3VUDA 1M17A 1ZMVA 1YHVA 4TL0A 3PA3A 1Z9XA 2GFSA 2CCIA 4BR3A 1RW8A 4N0SA 3TZ9A 1XH6A 5A6OA 3NUXA 5HE2A 4FL3A 3KFAA 4FKRA 3E8DA 2CPKE 4ACGA 1JQHA 5C03A 5T6KA 2QU5A 4H3QA 5HIBA 3WILA 4BI0A 4LGGA 4USFA 3ZZEA 4UYAA 2XIRA 4BTMA 4EYJA 2HYYA 4LUDA 3BHYA 4D2SA 3UPZA 5JH6A 1FBNA 3ORIA 4P4CA 4I5PA 4I6HA 4BDEA 4UMRA 3UZTA 5AX3A 3VS7A 3QC4A 3C1XA 4QNYA 2ITVA 4K77A 1XBBA 4JRVA 1H27A 4FSZA 5GHVA 3TL8A 4FGRA 3KVWA 4G34A 4WG4A 4O38A 5K5NA 2VTJA 2BILB 4AZVA 3C4WA 2QHNA 3H10A 2WMRA 4OUCA 1UA2A 5L8JA 2PZ5A 2HZNA 4I6BA 4D2WA 4RVKA 3Q60A 4U97A 4W8DA 3W2OA 3WZUA 2A2AA 4ZAUA 2W4KA 3LJ1A 3NR9A 4HPUE 5HG8A 4EHVA 2B53A 4GV1A 5CZHA 4YURA 2BDWA 2EB2A 4MWHA 3Q6UA 4C57A 3JPVA 2H96A 2ONLA 3KEXA 3ZLYA 5KZIA 3RI1A 1M52A 4OTGA 3B2TA 3QX2A 4FOCA 4W4YA 4C7TA 4DC2A 3F66A 4YTFA 5IG1A 3T8OA 4S33A 4YMJA 2GHLA 3COMA 4C34A 2WTKC 4UYNA 2WTWA 4KD1A 1PMVA 5J5SA 1KV2A 3S4QA 2NNWB 2YJRA 4IH8A 3UNKA 3AMBA 4U40A 3HGKA 2RFSA 5KCVA 4DE4A 4CNHA 1ZYCA 2VTOA 4EBWA 2HW7A 5M4IA 3K3JA 4H3PA 5DPVA 4AT4A 2JDVA 3D7ZA 4ZSGA 1XWSA 4DG3E 4IIRA 4KKEA 3R63A 3TWJA 3VN9A 4ASXA 4EBVA 2YWPA 4F9BA 3R01A 4A9TA 1BKXA 2WTDA 5FQDC 4JJRA 1CDKA 4L00A 3UVQA 2PUPA 3NX8A 1U5QA 2W1IA 3EN4A 5D7VA 3U6IA 5DG5A 3PRIA 1GNGA 3TIYA 2BROA 3FC2A 4O86A 2PVFA 3P08A 5EYDA 5L2WA 3DNEA 4BB4A 4PDPA 5I3OA 4APCA 4BHNA 2CNQA 4TTHB 5BVDA 2J0MB 5M06A 3W8QA 5ANDA 2VTQA 2ZM1A
chains in the Genus database with same CATH superfamily
3HX4A 2HY0A 2ITZA 4JDIA 3CY2A 4IM3A 3OY3A 1VLRA 1Q41A 3BBWA 4Y46A 4AE6A 4BKJA 3C4XA 4KWPA 4J97A 4BCGA 1WBNA 2VU3A 3ZLWA 3UBDA 3EQGA 4C3RA 4GG5A 2ITYA 4EK3A 2EXCX 3MPAA 3T3UA 4FNYA 3EIDA 3POOA 4IJPA 5B7VA 2Y6MA 5EM5A 3GQIA 4HJOA 2V22A 2BFXA 3VUIA 4XCUA 2PVRA 2PVKA 2WMTA 5LQFA 4QMVA 2XNMA 4MNEB 4Y72A 2X0PA 3ELJA 4P5ZA 5IH4A 3BYSA 2R2PA 5CEKA 2HW6A 2XIXA 4AU8A 3KF7A 3OXIA 4OAVB 4ZZMA 4EWHA 1ZMWA 3AT2A 3H9OA 5AP4A 3MSSA 4CLJA 2R3NA 3ORXA 3AC4A 4FV1A 3VBTA 3VIDA 4C4JA 4EHZA 2BIKB 4RT7A 3NCZA 3WF9A 1YWRA 2PHKA 5L3AA 3SW7A 3SW4A 2UZLA 4YJTA 5H9BA 3ZMMA 1YQJA 5A54A 2JKOA 3DAJA 5FEQA 2J9MA 2UW7A 2GHMA 4O0WA 3W33A 5I9WA 3SQQA 4I3ZA 1O6KA 1KV1A 5DOSA 4C4GA 3VW6A 3QKKA 3CQUA 5KX8A 5C8KA 1OITA 5EK7A 5AR7A 3BU3A 4EK4A 2NP8A 3TZMA 4U0IA 5HHWA 4C58A 2F9GA 3QF9A 3SXSA 4I5MA 4BCFA 2X9EA 5C4KA 3QX4A 4WT6A 3VONA 4FEUA 1JPAA 4JG7A 2BZIB 2I0HA 3W0RA 5DWRA 3E8CA 5IDNA 4N70A 4TZRA 5AMNA 2ITWA 5FEDA 4FZAB 4FTIA 3UG2A 4CT1A 1S9JA 3QCXA 2W5HA 5HU3A 4BCNA 4D9UA 5LVNA 1H01A 2PZYA 4PTCA 5H8BA 3FLNC 1TKIA 4H1MA 2WMUA 2H6DA 1VJYA 3E93A 4HCVA 4LV5A 5DGZA 5IMEA 3DXPA 4H1JA 2JIUA 3V5LA 4UB7A 5CNNA 3R7VA 4L44A 5AAFA 4MX9A 2OO8X 4J98A 3UDBA 3CS9A 2OXDA 3R9OA 1XH7A 1JLUE 4CTCA 1PKGA 4XOZA 1OIUA 5E8YA 4XG7A 3BU6A 3FZRA 4E3CA 2GNLA 4FL1A 4O4BB 5IU2A 4L53A 2G2IA 3TT0A 4BCQA 3ZTXA 3Q32A 5CYIA 3Q9ZA 4KSPA 2O65A 1Y91A 5DR2A 2B55A 3MY5A 2C6MA 4BIBA 2B9FA 3B8QA 3BEAA 2A0CX 4O0SA 3FMEA 1NVRA 2PL0A 4PTEA 3HRFA 3ZRKA 4I6FA 1BL7A 3FMHA 4JDKA 3OHTA 4RIXB 2XK3A 3RCDA 3JY0A 3Q53A 3PIXA 4FMQA 4MHAA 1QPDA 4TWNA 2YWVA 1XH8A 4FZ6A 3RPOA 4O0RA 2PU8A 4I6LA 4USEA 3LMGA 4AW2A 3W8LA 4NL0A 5K0XA 3M2WA 5AV1A 1JKSA 3NMUF 1Q8YA 3R00A 4J71A 3A60A 2PUNA 4YBJA 3UQGA 2QI8A 5IDPA 2I0YA 5M4FA 3QZHA 3GENA 5LMKA 2VO7A 2ZDTA 4JR7A 3UYSA 3NVKI 2BRBA 3QD0A 5DMZA 5LCKA 4OTDA 1NVQA 3L8PA 5E7RA 1W83A 4TWOA 4YTCA 4A9YA 4ZY5A 3GI3A 2ONLC 3CQEA 5AUVA 3V5TA 3DV3A 3QTZA 3UQFA 2OF2A 5M08A 4O21A 4BC6A 5HBEA 2QD9A 4AW5A 4FYNA 4RVMA 3CTHA 3HV4A 4XBRA 1BMKA 4ZSAA 3LFAA 2B7AA 5KMMA 4F7JA 3R0TA 4RX7A 2W1GA 3QD2B 4BGQA 3OEZA 4DFYA 3RAWA 4R1VA 4MTAA 2XH5A 4MD7E 3LXPA 2W05A 2GSFA 2WO6A 2F4JA 3QD4A 3JR1A 4FTLA 4JL9A 2Z7RA 5J9LA 4QYEA 4GT3A 3FI4A 2ZV2A 2CHLA 3M42A 3TV6A 3G0FA 5FXSA 3UIMA 4DFLA 4KIQA 4M3QA 1V0BA 2DS1A 3CTQA 3ATSA 5AP7A 2E9PA 4AWIA 4IXPA 4FNWA 5CAUA 3HMPA 3LXKA 2WTJA 5KHWA 3F82A 3R30A 3NNWA 4CZUA 3MH3A 3FDNA 4QDVA 4QMLA 3DBEA 3TCPA 3V5PA 2XZSA 5F1ZA 3IDCA 4N6ZA 3K3IA 4BDBA 3F2RA 4JG6A 2X8IA 3U55A 2J5FA 3LIJA 4GIIA 3RPRA 4CMUA 2F2CB 4CYIA 3KRJA 3MW1A 1H28A 3PVWA 3R1NA 4U80A 5B2MA 4BHZA 3FYJX 3OBGA 3PUPA 3UOLA 2VWZA 2YITA 4ALVA 4FYOA 4K9YA 2X8EA 4YHFA 3TJCA 2CGVA 4HGLA 1BI8A 4G3GA 4Q9ZA 4FSNA 3LW0A 3RWPA 4BTJA 2Z60A 2R3HA 3QCYA 5IUIA 1FINA 2Z02A 4ASEA 4A06A 5DNRA 3MH1A 4FTUA 4BCMA 4F6UA 3Q3BA 1V0PA 3DY7A 4FKGA 5KMNA 3D5VA 4X3FA 3BGQA 2XJ0A 3ZC6A 3MN3A 2Y9QA 3SLSA 3HRCA 3ETAA 3IPHA 4ZLOA 5LVOA 3TNPC 5GZ8A 1PRYA 1PHKA 3DKCA 1V1KA 2RIOA 4FT3A 4MUQA 3F9NA 1JKTA 2ITTA 4IZAA 3G51A 2Z8CA 5KBRA 3EB0A 4OBPA 2I1MA 3O7LB 3NNVA 3QQLA 3VS6A 1H0VA 4AAYA 1R1WA 2GNHA 3QWJA 4JDHA 1H1WA 3EJ1A 4FR4A 5FP6A 4O7NA 3A7FA 5AR5A 1U4DA 3FSKA 5M56A 3OROA 4FSYA 4C61A 2XAMA 3POZA 2WHBA 2QO7A 3IW6A 3D4QA 3EFLA 4QMOA 2B1PA 2JIVA 3DS6A 3KU2A 3QHWA 3QZFA 4H58A 1WCCA 2YHVA 4IB5A 5DT4A 3QTRA 4FNZA 3OOMA 4MWIA 4CG9A 2EWAA 5DA3A 2B52A 5A6NA 4FT7A 2E9OA 2G2FA 3GT8A 3M11A 2YIQA 2VTAA 4PP9A 1GJOA 1ZYDA 2GU8A 4EZ7A 4AUAA 3BWFA 2CNUA 1GAGA 4D4VA 2YM5A 4W9WA 1L8TA 3LJ0A 3SA0A 4F6WA 2R4BA 1P2AA 3OUNB 4YZCA 3QAME 2UZTA 4QPMA 3EQDA 3OUKA 2X81A 3OMVA 4FICA 3KMMA 1OL2A 3FYKX 3ITZA 4CV8A 3TTIA 4XP0A 5CXHA 4KIOA 2VZ6A 4U41A 2WD1A 3MY1A 5J7HA 3QRJA 4FG9A 3C5IA 4CKJA 4OTRA 4LM5A 3R1SA 2BFYA 4YHTA 5H3QA 3OWPA 4ACDA 2XKFA 3PSBA 2OGVA 5LARA 5LVPA 4P2KA 2VWBA 4TPTA 2WNTA 2YCRA 1ZZ2A 4DH1A 3EN6A 1FQ1B 3HECA 3JVSA 2PK9A 4MXYA 5EKOA 5HE0A 4UX9A 2PSQA 5DYJA 1R78A 4BWXA 2JFMA 5EM6A 2XVDA 3IQ7A 3REPA 3R71A 5IA0A 3W0SA 5GZAA 2YISA 5FDXA 4DDGA 2GFCA 1LR4A 1Z5MA 2NYAA 5C9CA 4Y5QA 4ZTSA 5HBHA 4C4HA 2FB8A 4CD0A 3E8EA 4RA5A 4QPSA 2ERKA 3B2WA 4MNFA 1PXPA 3DT1A 4FODA 4V0GB 4Z3VA 4EHEA 3MIAA 1CKPA 2OXXA 3DAEA 2BR1A 3Q6WA 4JIAA 4RX8A 4PDYA 1RDQE 4NU1A 4RX5A 2ITNA 4Z7GA 5EYCA 5IEXA 4MXOA 2YCSA 1GZOA 3NSZA 5A46A 3VUMA 3NYXA 4B8MA 2JKMA 1REKA 4UEUA 2R3OA 5LMKC 5TE0A 3LCKA 1SYKA 3UJGA 2HWOA 1WMKA 4QMUA 4U45A 4EH3A 2JITA 3RVGA 3OW3A 1OPKA 2OLCA 4HCTA 3PXQA 4ACCA 5IMXA 4O0UA 3DZOA 4IAIA 1YKRA 4AG8A 2QHMA 3R8VA 2NRYA 3FL4A 1YXXA 2XNGA 2H34A 4QTCA 1FOTA 5CZIA 2OFVA 2XK7A 1STCE 1B6CB 3DB8A 5BVFA 3QWKA 4JBOA 4C3FA 2BAKA 2YM6A 3PVBA 3FJQE 4WD5A 4Q9SA 3PLSA 5EI8A 3BV2A 3LFDA 4ERKA 4WHZA 3ZO1A 4O84A 5DR9A 1PMEA 3SHEA 3LFQA 4AXAA 4NCTA 4EI4A 2XM8A 4M0ZA 5BYZA 3E63A 3VS4A 4IAZA 3P78A 1NA7A 1Q4LA 4ASZA 4PNIA 3I5ZA 5F9EA 2OW3A 4FK3A 4A4OA 3MVJA 2YA9A 4DTAA 2WEVA 5FG8A 3ODZX 5EHYA 3ZDUA 5IQBA 5F94A 4YC8A 4BCOA 4ANSA 4IVBA 4R7IA 2H9VA 1IEPA 4CFWA 2VWYA 2X2LA 1OIRA 3LXLA 3II5A 4AZWA 2ETRA 3TKUA 4PMSA 5GINE 2WPAA 3ALOA 5DRDA 3HAVA 2BHHA 4O4CA 2ZMDA 1ZMUA 3MY0A 4RVLA 5K3YA 4YSJA 1QPCA 2C6LA 3DKFA 4FL2A 4QYHA 4JMQA 4EOIA 5HESA 3VJOA 3UIBA 4BJJB 2YIRA 5J1WA 1R0PA 4DHJA 4FTQA 3I7BA 4IM0A 4V01A 4WNPA 5T68A 2Y7JA 2XRWA 5E8TA 2X2MA 4ARKA 4JLCA 4BBEA 3ACKA 4I93A 3D2KA 3FKLA 1ND4A 1WBOA 3MTLA 2PMIA 2NO3A 3G6HA 4FIEA 5TT7A 3KMUA 4DCAA 3PXFA 5GNKA 2YN8A 3QU0A 3QTIA 3UNZA 3G33A 2Q83A 3C4CA 2UVYA 2V5QA 4DEBA 3SAYA 4EJNA 4S31A 3ID6C 4X3FC 4OTHA 4LFIA 4TWCA 3RPSA 3VF9A 3A8WA 3BKBA 4YC6A 2C3KA 3E5AA 2QR8A 4AQCA 3PG1A 1OIYA 4FIHA 2IVUA 1OL7A 2OI4X 2P55A 5DEYA 4E7WA 2YZAA 4NTTA 1ZRZA 4APPA 2Z7SA 1H07A 4LYNA 1PXOA 4P5QA 3RM7A 1KE9A 1EH4A 2FGIA 4KBAA 3O7LD 4O82A 3GC0A 2BRNA 3R7EA 5ACKA 5CU0A 5J9ZA 4AX8A 3Q2JA 4X6RA 2VV9A 2QKRA 5D9HA 1YDTE 2R3QA 3TEIA 3PY3A 4BBFA 5L6WL 3V6RA 4RFZA 3KL8A 4O0VA 5JFXA 2VTRA 1XHAA 1ZLTA 3KRWA 4GVAA 5IQIA 4QMZA 4BCPA 4E6DA 3ZUUA 2WQMA 2BKZA 4F1TA 4XP3A 4ZS4A 4AN3A 1UU9A 2HCKA 3LFCA 3AGLA 4QMXA 4FV5A 3OCBA 4KKHA 5AP0A 3ZXZA 4CGAA 3MB6A 3Q9XA 4XG3A 5DR6A 2A19B 4ACMA 2BDJA 3WYYA 5D41A 2XK4A 2E9NA 2W5AA 1NXKA 2VTSA 2X4FA 3NUNA 3R7UA 3ZUTA 5CF6A 4ZTMA 5AUTA 2UZWE 3TUBA 3E64A 4YJSA 4JX3A 3HL7A 3MPMA 4TYIA 1A48A 3H3CA 3O8PA 5HVYA 4WSQA 3W0NA 4QMMA 2ZV9A 4KRDA 4N57A 2PULA 4RRVA 1WBPA 5C4LA 2QURA 3QUDA 5CVGA 2WAJA 2W96B 4E4MA 4S30A 2BVAA 5TO8A 2ZDUA 1R39A 4MNEA 3UO4A 5HNGA 3F88A 4GL9A 1FVTA 1IA8A 2F57A 3D15A 4CRSA 4CSVA 2GS2A 5AIRA 3PA4A 5AR2A 3IGGA 2OJJA 5H2UA 3C4FA 3RZFA 3GU7A 3IW4A 4AA5A 3VS0A 2X9FA 5AUXA 5BYYA 4GK4A 3UMWA 3VWAA 1F0QA 2KULA 2WTIA 3FQSA 3VQUA 5AIKA 3W16A 5AR3A 3ZRMA 4O7LA 4JAJA 4DH5A 3W2SA 3SRVA 2LAVA 2FA2A 3ORTA 3AC5A 3MDYA 4S32A 4UZHA 3Q04A 3ZONA 5CAOA 1LEWA 3GOPA 3VULA 3EN5A 5FXQA 2A1AB 1ZZLA 1XH9A 2W9FB 4DHFA 3LZBA 4FVPA 2GS6A 4BDFA 4FSMA 2W17A 3LQ3A 3NFFB 2YIWA 2OH0E 3FHRA 1H24A 3VNTA 4FKVA 4OT5A 5DT0A 3TG1A 4I20A 4O0XA 4BVUA 5HG5A 3GXLA 3SG8A 5LMBA 3NFGB 3VBVA 1W8CA 4GVJA 5BVEA 1QCFA 5L4QA 5JMSA 4FX3A 3QRKA 4KRCA 3D14A 4OTFA 2R3KA 4CQEA 4DINA 5IQGA 3FZTA 3GC9A 4I23A 1BUHA 4I5HA 3WZKA 1WZYA 5JGBA 2X7OA 3AOXA 4UWBA 4DT9A 1W82A 3CR0A 4OGRA 4FKIA 3LLAA 4BFMA 2RG5A 4GS6A 4A9RA 5BMSA 4I5CA 3RAHA 2XNBA 3NYNA 4B99A 3OTVA 1PYEA 4L8MA 4ZJVA 3A4OX 4IANA 4YPDA 4F63A 4OTQA 4YLLA 2ZMCA 4DYMA 1P14A 4C4IA 4EOOA 5AADA 2PMOX 2F7XE 2C0IA 5IQDA 2QOFA 3BLHA 4HVSA 3LFEA 4FTMA 3JY9A 4F9WA 4BCIA 5A4TA 1IR3A 5D10A 2QOIA 3D83A 4JRNA 4GU9A 4DG0E 4K8AA 4R78A 2GQSA 4CYJA 5E8XA 3ZXTA 5HBJA 4O91A 4C35A 5HCXA 1BLXA 1UVRA 2UZDA 2R3PA 4I0TA 4F7NA 3F7ZA 5D1JA 4RIXA 3H9FA 4AXCA 4DEIA 2KTYA 4RIYA 3CE3A 3C0HA 3O8TA 1M7NA 2O2UA 4U9AA 3UPXA 3BGPA 4E5BA 1TVOA 3A99A 4GUBA 2A98A 3FL5A 3N51A 3S00A 2G2HA 2YCQA 3U54A 4BDIA 1ST0A 1YI3A 5T3QA 3ATTA 3LE6A 3BCEA 4DGLC 3CD8A 4ZMEA 3TACA 3E8NA 4AACA 3QRUA 4FC0A 4MD9E 5A4CA 5DH3A 2W1HA 4UBAA 4HCUA 1FMKA 4QQCA 4LRJA 2RFNA 4IZ5A 4YZNA 3LFBA 4XJ0A 3U4WA 3KQ7A 5AUWA 1WBWA 3FZOA 2CLXA 3C7QA 4PPBA 4WRSA 2VRXA 3F3WA 3MS9A 4GIHA 4Q5EA 4D5KA 1WVXA 4FEXA 3GCVA 3GU8A 4O27B 4W9XA 4EK8A 4QYFA 5J5TA 3DKOA 4I41A 2F49A 2XK8A 4DAWA 3VAPA 3AXWA 5FTGA 2YDKA 1CSNA 1YXVA 4BDJA 1KE8A 4QQJA 4R5SA 5AV4A 5CAQA 4ITIA 4IEBA 5DEWA 4G3DA 4GW8A 4TYJA 1E9HA 4F0GA 3BHUA 3BELA 4EUUA 3O51A 3HP5A 5IPJA 3P5KA 3ZUVA 3HV7A 4ACHA 2W7XA 1DM2A 5CI6A 1XO2B 2IF8A 2VAGA 4GSBA 5ANKA 5JZNA 2V55A 1U59A 3NIEA 1U5RA 4ZK5A 4RWLA 3S3IA 4WIHA 1SNUA 3MJ2A 4DFXE 2O63A 4F0IA 4O6LA 4K6ZA 5ACBC 4GK3A 4AGUA 3R2BA 4G6LA 3UDZA 2C69A 3NGAA 3GB2A 4EOQA 2C5XA 5KKRB 5IF1A 3PPZA 3KXMA 5AV2A 3VS5A 4AP7A 4EQUA 3VUKA 5IA1A 1NVSA 3FPQA 4CVAA 3EN9A 3AG9A 3HP2A 5CF8A 4O0YA 4AW1A 3I0OA 3ORMA 3HV3A 2QR7A 3GVUA 5EDPA 2X4ZA 1R0EA 2OIDA 4BI2A 1H1QA 4XV1A 2RG6A 3AMYA 3I1AA 4DBNA 2YM8A 2YDJA 3QQHA 4BF2A 2PYWA 3ORZA 4MAOA 5EW8A 5DRBA 2OK1A 2GQRA 5LXMA 3UP2A 3NZ0A 2VTNA 3SX9A 5JGAA 4X2KA 3PZEA 4GMYA 4RJ5A 3Q2MA 3C13A 3HMMA 3UVRA 4U43A 3T9TA 4BGGA 2R3RA 5HTIA 3DBDA 4MD8E 5FM2A 5FD2A 3DBCA 1ATPE 2I40A 4PMMA 2ETMA 4GUEA 4LGDA 4EH9A 4GEOA 3CEKA 3IONA 1H1PA 4BZNA 4PMPA 1IAHA 3CBLA 4WO5A 4BRXA 4C8BA 4F4PA 4X3JA 2ITOA 1NY3A 4RLLA 2J2IB 3QTWA 4IWQA 3V04A 3LHJA 3G5DA 4EZ3A 3L9NA 4D4RA 4A9SA 4PP7A 5HO7A 2Y4IB 3R9DA 3DJ6A 3B8RA 3NUPA 4DEGA 4TT7A 3OZ6A 3FV8A 1XKKA 3E88A 4D1ZA 5JRSA 3SOCA 3FMLA 5D7AA 3S1HA 3D5WA 4U7ZA 5HVJA 4MF1A 3O17A 2IZUA 5E8ZA 2BALA 2BTRA 4PL5A 5HO6A 2OICA 3MH0A 1H8FA 5ETIA 5C26A 4RX9A 4IHPA 4F1MA 3OD6X 3QC9A 3SRVB 2CN5A 3OF0A 2XJ2A 4J52A 4DFUA 3FI3A 4USDA 4E5AX 3SD0A 1ZAOA 3Q9YA 1ZYJA 4QTDA 2R7IA 4MBIA 4X21A 4IVCA 5CSWA 2XEZA 1I44A 2E9VA 2FO0A 2JEDA 3GUBA 2C3JA 4ASDA 3ANQA 5ANIA 2ACXA 4EEVA 3I79A 3QTXA 2A4LA 4ZXTA 4WNKA 1JSUA 3MJ1A 2W9ZB 2YACA 3LM5A 4O4DA 5JK3A 5HVKA 3WF8A 2O3PA 5J79A 1J1BA 2REIA 3RHKA 3S95A 5AA9A 5BUJA 5GIPE 2IG7A 2XJ1A 2HZ4A 3RNIA 4ENXA 1F3MC 3BHHA 2WELA 3QALE 4GT5A 2DUVA 3ZOSA 4NFMA 4QP2A 2EXMA 2R3JA 5HGIA 4G5JA 4ZY4A 3O96A 3SC1A 4PMTA 2F7EE 1VYZA 2B4SB 4AOTA 4H39A 4YR8A 5EQYA 4RVTA 2IVVA 3NYVA 4ZTQA 2WMSA 4G5PA 5HQ0A 3PA5A 1GIHA 4FTJA 2AEGA 3ML1A 3PFYA 1PXNA 2ITPA 3TZ8A 2V7AA 4QP6A 2ZVAA 2CLQA 3QYWA 2J90A 4IAFA 5CS6A 2YLEA 1O6LA 2ZJWA 3ZM9A 4V0GA 3MA6A 2ZB0A 4AQKA 3NDMA 2ETKA 2PVMA 3AT4A 4XMOA 1JWHA 3V51A 4GG7A 5KMOA 1OVEA 3P0MA 1YWNA 1REJA 1QPEA 4RC2A 4ANQA 3QTSA 4IX6A 2BPMA 3DK7A 1KE7A 3KC3A 5E1EA 4Z9LA 1J7LA 2CKOA 4QP9A 1YI6A 2C30A 4RIYB 4UXLA 4F09A 4Y5HA 4YJVA 1U54B 1OM1A 1DI9A 2AC3A 4J96A 3FHIA 3TJDA 4F9CA 3TKIA 4QMQA 3DBQA 4DGGA 5CVHA 4AFJA 3ORPA 2VO6A 4FVQA 5A3XA 1ST4A 4S34A 1H0WA 4BCHA 5A4QA 4YHJA 5AFVA 4FKQA 5BUEA 3NUYA 4TN6A 4BDKA 3FLYA 1QL6A 2X7FA 2Y8OA 3ORLA 5JN2A 3R2YA 4OTWA 3QQFA 4MBJA 5HEZA 1Y8YA 4CLIA 2OJ9A 2UUEA 5GJFA 4YZBA 1Q99A 1OECA 2EXEA 3NUSA 3CXWA 4FK6A 4WUAA 3FY0A 1B39A 3L8VA 3MV5A 2QOKA 4XRJA 5DT3A 5EG3A 3O8UA 3D7TA 3R8ZA 3V3VA 4EOPA 1G8AA 4E4LA 4GH2A 4IWDA 4YTIA 4GKHA 4F78A 4QTAA 3A7HA 4RSSA 3CY3A 4O7YA 3PJ2A 4QO9A 5IA4A 3NUAA 3OT8A 4RWIA 4NKSA 3UOKA 2X0GA 1UNHA 4CFMA 3HYHA 5AP5A 1FGIA 2UZEA 5CVFA 5B2KA 4OR5A 3W32A 4DGOA 1OKZA 2YCFA 2IZSA 1PJKA 3F69A 2JGZA 1OKYA 4IVDA 4KUJA 2BAQA 1XQZA 4ZSJA 4QP3A 3ZO4A 2OBJA 2W0JA 3O23A 5HTCA 4KNBA 1TQPA 1W98A 2X39A 3FKNA 3RCJA 4EOSA 3KXGA 2BAJA 3CSVA 1UV5A 4BJJA 1OKWA 5AR8A 3PRFA 2XBJA 4IZYA 4YJOA 4PV0A 2XCKA 4GJ2A 2QONA 4LUEA 2YLFA 4FSQA 3T3VA 1W2CA 3HEGA 2C5VA 4L01A 4R3RA 3NEWA 3COIA 4EK6A 5AAEA 1KWPA 2O64A 3DTWA 4E5WA 3DKGA 3G9LX 3KREA 4K1BA 3KULA 4FNXA 1MUOA 2XYUA 3NVMB 2CN8A 3NRMA 3C50A 3MPTA 3BYMA 2WEIA 5ETCA 3QTQA 5FTOA 5LWMA 4CEGA 3NYOA 1YHWA 1JKKA 4IVAA 2C4GA 4RIOA 5HI2A 1H08A 2IW6A 2R3IA 4UXQA 5CEQA 2PVYA 4L6QA 2XKCA 3CC6A 4F70A 5IEYA 5JFSA 1OUKA 5ANGA 3WBLA 3BX5A 2WTCA 4L46A 3R8LA 3GCPA 3LCSA 4G9CA 3W1FA 5BUIA 4QTBA 5ANOA 3UGCA 4ZLZA 2QQ7A 3ULZA 5E8VA 3KK9A 2QOLA 2QOBA 3DDQA 5HORA 3AGMA 4YLJA 3W2CA 2CGUA 2YERA 1K9AA 2QU6A 3PUFC 5EFQA 3DDPA 2VTHA 4MBLA 3TZ7A 5E92A 4KA3A 3E3BX 3PVGA 1ZYSA 2XS0A 5DLSA 1OMWA 5K9IA 1J7UA 3EYGA 3GU5A 5FBOA 4C4EA 5M51A 4FSWA 4B9DA 4PL3A 4F7LA 3KA0A 5TKDA 5IEVA 4HYHA 3V5WA 4CFXA 3W0MA 1PKDA 3GC7A 1Y57A 2XB7A 4M67A 4O96A 3HDMA 4FV2A 1Q61A 1MRVA 5CU2A 4FRFA 4YLKA 4QYGA 5CSXA 4CFUA 3PYYA 5M57A 4FEWA 3QRIA 3LCTA 5HOAA 4L52A 4BICA 5FM3A 4FJVA 2GNIA 2RSVA 4MXXA 2C5OA 3CLYA 2X2KA 2HXLA 4QTEA 2W1CA 5F20A 4BYIA 2WTVA 4FKWA 4JQ7A 4I1ZA 4GCJA 4JR3A 4BBMA 3Q4ZA 4G9RA 3F3ZA 2X7GA 4UMPA 2WZJA 4WKQA 3O2MA 3F61A 2PY3A 3PPKA 3Q5ZA 3W10A 4C59A 5A4LA 2C6IA 4W4VA 3QGWA 1KOBA 3DJ7A 4E4NA 4F64A 1R3CA 5L2QA 1OL1A 3FI2A 4E20A 4O0TA 2PE0A 3ROCA 3GFEA 4RQVA 4R5YA 3RKBA 4C36A 3DXQA 5HIEA 4JIKA 3OWKA 3RALA 4F1OA 4JQEA 1KOAA 2WMXA 5DBXA 4FV0A 2HOGA 2C1AA 1M2PA 5AUYA 3HUBA 4FEVA 5IQAA 2HZIA 4HOKA 2UZNA 4LV8A 5DHJA 4PNKA 4KS7A 3KIOC 2OKRA 2VWXA 4O81A 4U3YA 4WNMA 4C0TA 4AA4A 4O7SA 4IC8A 3U87A 4D55A 4F0FA 3BE9A 3P9JA 5HNBA 3KK8A 5CX9A 2XK6A 2UW0A 3ZCLA 5AP3A 3ZU7A 2HIWA 3AKJA 2QODA 3NWWA 3MFTA 4QQTA 2J5EA 3TMOA 1VEBA 1HCKA 1OPLA 1UNLA 4YP8A 5FTQA 3CQWA 1OB3A 4XUFA 4R1YA 3R8PA 4EH2A 1JVPP 1MQ4A 1WVYA 4W4XA 4EJ7A 2R7BA 3PFQA 5CANA 2J51A 5C1QB 3SVVA 2OSCA 1B38A 1OBGA 1H26A 4XYFA 3VUTA 3TM0A 4H3BA 4JDJA 4UV0A 2ZAZA 5CWZA 4H05A 4MXAA 3S2PA 4I6QA 1Y8GA 3HV6A 5FP5A 3T9IA 2C5YA 4FI1A 4MQ1A 3BQCA 4CXAA 3IW7A 3OC1A 3QCSA 1T46A 4BTFA 5IQEA 3A7GA 4D1SA 1SVHA 4TY1A 4CFVA 3VF8A 5I9VA 4RJ7A 2J4ZA 5EQPA 3G0EA 3CCNA 3BYVA 1ZARA 3F3UA 1JOWB 4Z55A 2XALA 1PXIA 4YNOA 5BNJA 1UKIA 2QO2A 5CF4A 5JKGA 4KS8A 4ITHA 3E7OA 3KKVA 3FLWA 3QUPA 4D0WA 5CSHA 1JBPE 4PUZA 5GJDA 2CMWA 4AN9A 5K5XA 2YABA 1CKJA 1KSWA 4MYGA 4YJRA 3HKOA 4F9YA 3FZ1A 3OEFX 2R0IA 4YZ9A 3D7TB 3VBQA 1TQMA 1W2DA 4D2RA 3IG7A 4IB3A 4JBQA 1E1VA 5FUTA 4TXCA 5JRQA 3G9NA 4S2ZA 4QMWA 4KBCA 3UP7A 4BY9E 3AKKA 5FXRA 2OIBA 3QA8A 3RTPA 3JYAA 4FVRA 3PP1A 4WNOA 1DS5A 3PJ3A 4ZLYA 4ZTNA 4HZSA 5JT2A 2XF0A 4IBMA