1OPJA

Structural basis for the auto-inhibition of c-abl tyrosine kinase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
287
structure length
287
Chain Sequence
AMDPSSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the autoinhibition of c-Abl tyrosine kinase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
total genus 88
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1opjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1opjA01
3UG2A 3AMBA 5AIKA 4WHZA 3TIZA 3IW6A 3SA0A 2V55A 3SDJA 2VTQA 2C6LA 2OG8A 3HYHA 4QP3A 4QQJA 4DEBA 3R9RA 3BHVA 3DCVA 4BGGA 4D4RA 4O7ZA 5CAPA 4QMTA 1UWHA 4EBWA 1XR1A 2VO6A 1IA8A 3CQUA 3WBLA 2I40A 4RLKA 3OF0A 3SRVB 4HNIA 4LGHA 4YC8A 2HXLA 4YZNA 1U5QA 5L4QA 1K3AA 2BR1A 5HE2A 5KE0A 1YHWA 5AJQA 1WBPA 4DF3A 4IFCA 4IWPA 3PA3A 3H3CA 4O7LA 4BCMA 2OF4A 4J97A 1UVRA 1OKVA 3U87A 3EFLA 2BAQA 1QL6A 4E73A 3R21A 1GIIA 2VX0A 4MNEB 3FJQE 4IVBA 3R8ZA 4DFXE 1OPLA 4CMUA 1G8SA 4ACHA 1H24A 4IEBA 4YHJA 2XNMA 4IXPA 3ZUUA 4EOOA 2ITPA 2XYUA 3G0EA 3V8TA 5JMSA 2CMWA 3R04A 4F0GA 2XKCA 5IF1A 3HZTA 3IDBA 3BRBA 4WRSA 5C9CA 4AZWA 4TWCA 3EN5A 3E8DA 3OCBA 4ASZA 4C2WA 1MRVA 2CJMA 3TL8A 5J1VA 4CTCA 4R3PA 4O7NA 1XWSA 4GK2A 2C6MA 2JKOA 4I5PA 3TG1A 3U4UA 3UMWA 2E9OA 2WGJA 4FKQA 4AA5A 3S0OA 5IQBA 1Y91A 3LQ3A 4M14A 4D2TA 5HE3A 3P78A 1DAWA 2FB8A 4NW5A 3W8QA 3WF6A 4ACGA 4PDOA 3F5XA 3DS6A 2F49A 3TIYA 4I0TA 1M2QA 2UW5A 2VV9A 5C03A 3TWJA 5I9ZA 3JR1A 4FZDB 3SLSA 4U7ZA 2NNWB 5DIAA 4JBPA 2UZLA 4MX9A 5KMNA 2F4JA 4C37A 4E5BA 4EQMA 4OAUC 2Z7SA 1QPDA 3KF7A 3HMIA 2XMYA 4AU8A 2XS0A 4RVTA 2C6KA 3VUTA 4H1JA 2GS2A 2XKFA 2C6DA 2YWVA 2YJSA 3GCQA 2GCDA 2Y6MA 3LJ0A 3V5LA 3CBLA 3RHXA 5HI2A 2HIWA 2ITVA 1K2PA 3BIZA 4JBOA 4YTIA 5GJGA 4FA2A 2F7XE 2PTKA 1LEWA 5I9VA 2RFDA 4HYUA 5JQ5A 3TNHA 4JRVA 5BYLA 4UMTA 3TV4A 1BLXA 5HO6A 5J7BA 4P90A 3ZBFA 5L2SA 3VWAA 1LUFA 4FNYA 3NR9A 5E91A 4FSUA 3A61A 5DT3A 3A7GA 3GI3A 3O50A 2GS7A 2W9FB 3HX4A 4PTCA 4YLKA 3FZOA 4XG9A 4ZY5A 1CKJA 4JRNA 4X3FC 3B8RA 2J4ZA 3GU7A 5F1ZA 1OI9A 4AOTA 1PYEA 3P79A 1YHVA 1ZZLA 2W1DA 2UW0A 3S3IA 2PVMA 3QWJA 5IQCA 2CNUA 5EI6A 4G5JA 2C1AA 1NVQA 2FSLX 3EHAA 3B2TA 4AW1A 4JNWA 4JOAA 5EHYA 5CEPA 2VD5A 3ZUTA 4B8MA 2V0DA 3OBJA 1L8TA 2ZMCA 3SQQA 4USEA 4FV1A 1EH4A 4DGOA 5IA4A 3UIUA 3RWPA 3H4JA 3C4EA 2QVSE 1XH7A 2C5VA 4L43A 5CQUA 5M06A 2EXCX 4MXXA 3LFDA 4CT2A 4I92A 4RIWA 5J95A 4DBXA 5HCXA 2Y8OA 5ANKA 4U80A 3R7IA 3WARA 5AA9A 5JFXA 3OEZA 3PA5A 3R01A 1CMKE 3JYAA 3Q04A 1B39A 3QZIA 2Y4PA 4ORKA 4O0XA 4ZS4A 3PJ3A 3SW4A 3CQWA 5I0BA 3D2IA 4E6CA 4O38A 4J8MA 1B6CB 4RIXB 2W9ZB 3BBWA 5E8UA 3W32A 1B38A 2CGUA 5CSHA 2A2AA 1UU8A 1GJOA 5EDPA 4AG8A 3Q4CA 4E26A 4TT7A 3QLFA 1E1VA 3R63A 2V62A 4L7FA 3LIJA 4C61A 2RG6A 3R1QA 1NA7A 4AT3A 3QCSA 4GT4A 4F7NA 4FKIA 3KXMA 3ZDIA 3ETAA 3R8LA 4UALA 1J7LA 1PY5A 4KIPA 2CKEA 5KHXA 1ZYJA 5E8WA 2B9FA 3AC5A 1PHKA 4JBVA 4YZCA 4R3CA 4P5ZA 2BRNA 2JDSA 2JIIA 4S34A 1PRYA 1Q3WA 1PMUA 2XP2A 1VEBA 3PVUA 2WMTA 3FZSA 4D5HA 3QQGA 5IMEA 2PMIA 2CDZA 3QRKA 1OL2A 4A9RA 2ZB1A 3FY2A 4QNYA 5M44A 2YHVA 3R02A 5EM8A 4BGQA 4KBKA 5JQ8A 1ZMWA 5DG5A 4IM3A 4X3FB 4HPUE 4MD9E 3L9PA 4ZSAA 5C1QB 1WBWA 4Y73A 4IB0A 3RAWA 2PHKA 2VTNA 1IASA 3CY2A 5ANDA 5DT0A 1YOMA 2W4OA 4CSVA 3QAME 4ASEA 4ACDA 5K0KA 4MHAA 2PVRA 2BPMA 3ET7A 4OBOA 5GZ8A 2B9JA 2BIYA 4BBEA 3K3JA 3ZC6A 5AP2A 3IPHA 3LXLA 3VUKA 2WPAA 2WMWA 1V0PA 4M69B 3PXFA 4UY9A 3A99A 4XG7A 4BCQA 1TQIA 2GQGA 3HUCA 3LFNA 3D9VA 4AW5A 1VJYA 3Q2MA 2VTHA 3VS3A 2C3LA 5HNIX 3N4TA 2VU3A 5HNBA 3ORTA 4AT5A 2W96B 3G90X 2J0IA 4TYEA 1URCA 4GEOA 4ENXA 5CAVA 3AC4A 2XVDA 3RPSA 4HGLA 2OZAA 4YPDA 2FA2A 3C4WA 4QTBA 5H3QA 3RKBA 4BWPA 2JIUA 4EOMA 4U6RA 3IS5A 5ETFA 1F0QA 4PTEA 3QFVA 4I4EA 4E4LA 5HU9A 3ZM9A 1OKZA 3AOXA 4M84A 4TYHA 3TZ9A 2VTSA 2QHMA 4JQ7A 5GZAA 1JBPE 4J96A 1WAKA 4FT0A 3MJ2A 5A4CA 3DBQA 3EWHA 2C6TA 1OB3A 1DAYA 2WMBA 4UB7A 2XJ1A 2DQ7X 2OIQA 3AC8A 3DLZA 3HLLA 3GBZA 5FTQA 2ZVAA 4RG0A 4U3ZA 4QPSA 3PP0A 5EG3A 1T45A 5CTPA 3R73A 4DLIA 4ZZOA 2ZOQA 3ALOA 3R30A 4FT3A 4RVLA 5EW9A 4BBMA 4O81A 5J7HA 3LZBA 1S9JA 4C7TA 3ODYX 4M7IA 2GTMA 3MESA 4FTJA 4FGRA 5J5TA 2PMOX 3SXFA 5KMKA 3RAIA 3PXKA 4I5MA 3FMNA 3R00A 4YO6A 3EQHA 3FQHA 2W1ZA 3FZRA 3LJ1A 4G3FA 4FKOA 3ACKA 5FM2A 3A4OX 2JDRA 2IVTA 4Q5HA 1ZYSA 2W05A 4AFEA 4Z16A 4OTPA 2G2IA 3VAPA 2GFSA 2YZAA 3FY0A 3TTJA 3MDYA 4DEGA 4EHGA 3EQRA 3C0GA 3MGYA 1YDSE 2FSOX 5JRQA 4O6EA 1U4DA 1H4LA 4XMOA 3WE4A 4C38A 5HIBA 1YI6A 5LXMA 4GG5A 4NYEA 1O6LA 2WD1A 3UG1A 5D12A 5A3XA 4ZTSA 3N51A 4M0ZA 3C9WA 4RGJA 4RPVA 3UIXA 5M08A 4TYIA 2I1MA 5CLPA 2JC6A 2VGOA 4FKUA 1E1XA 4JDHA 3G33A 4PUZA 3PYYA 4CQGA 3ERKA 3RK9A 1W98A 4NKAA 5DRBA 4IAAA 3UO4A 2C6EA 4LUEA 1OBDA 4BZNA 4E6DA 4XG3A 1HCLA 4CXAA 4ANSA 2Z60A 3BGQA 3KK9A 4FYOA 3UTOA 1ZMVA 5HTBA 4NSTA 3ZU7A 2XRUA 4NCTA 2IG7A 4IC8A 3R0TA 2PMNX 4N57A 5KZIA 1SVGA 2JBOA 3ZEWA 1M52A 2W5HA 3CTJA 4QMSA 3S95A 1SMHA 1BX6A 2WTIA 2GHLA 3Q4ZA 4DGGA 2J51A 2Z2WA 3Q96A 5HG8A 2ETMA 2P3GX 4L68A 5L8KA 3EQCA 4Y5HA 1H00A 5CU4A 3N4VA 3FWQA 5D9HA 3SVVA 3IKAA 3JPVA 4G17A 4D4VA 2X0GA 4M12A 4OTQA 4AOJA 2UZWE 2OH0E 3F7ZA 5CVGA 2R7IA 3UVQA 4AZSA 4O0TA 2YAKA 4C58A 2X8IA 2IW9A 2OU7A 4BKJA 5EYMA 4F99A 4YU2A 1YI3A 2WNTA 3FMHA 4FSZA 4EK4A 4IZ7A 5AMNA 5HESA 4BDKA 4KKHA 5BX0A 4A07A 4FTTA 3RGFA 3UDBA 4BZOA 2A0CX 2VNWA 1U54B 2V7AA 3COMA 2YM7A 5IZFA 4J95A 3VBTA 4C35A 4FNXA 2YM4A 3VF9A 4F4PA 1APME 5A4TA 4G31A 4I93A 5DA3A 2XM8A 3TZ8A 3ZRKA 2J5EA 3QRJA 5CT7A 4MBIA 4WT6A 1VYZA 2X1NA 1Z57A 4X21A 4Z3VA 2GDOA 2WU6A 4KRCA 3FYJX 2ITOA 3CJFA 5IQGA 3LW0A 3IGGA 2IJMA 3CXWA 2ITTA 4FGBA 5CS6A 4IB3A 4PMTA 1PKDA 5EYCA 4L01A 5CYIA 3UJGA 4MXYA 3MFRA 4UMRA 4YJTA 3ROYA 2IO6A 3BE2A 2YDJA 4JS8A 2HWPA 3IOKA 4YJOA 3RPRA 3R9NA 4GVAA 1YVJA 5GINE 2WO6A 3R22A 4OUCA 2ZB0A 3AQVA 2PUNA 2PVKA 2ZV7A 5IUGA 4I5HA 4FV9A 4L67A 2QG5A 4ZOGA 5JZNA 2A27A 3ZO2A 4DG3E 3KFAA 5M4UA 3OWKA 2BRMA 3GU4A 4RRVA 2GSFA 4W8DA 5AAGA 5DI1A 4QTDA 3HKOA 4JDKA 3PA4A 4C2VA 3OWJA 4LYNA 5F95A 2CSNA 2IW6A 4RJ7A 5CF6A 4BCKA 1V0BA 4YC3A 4GW8A 3FXZA 3UOHA 5LVPA 3OROA 4PF4A 3BYVA 4YSMA 3SOCA 3KREA 2QKRA 3HMOA 4YO4A 2XEYA 3NNXA 3EZRA 3OT3A 2GNIA 5KBRA 5DR9A 3G9NA 4KKGA 3KN6A 2CN5A 3TTIA 3QA8A 2QC6A 2X6DA 5CU3A 3W2CA 3A7IA 3SW7A 2Y6OA 1Q8ZA 3KMWA 3NZ0A 5A4LA 5BMSA 4L3PA 5KCVA 3EFJA 4CRLA 2VWVA 2WQOA 4WA9A 2QURA 4AT4A 1JPAA 1Q8TA 2X4FA 3QC9A 4YJQA 5FXSA 4BCNA 3THBA 4HCTA 4L52A 1YWVA 3WI6A 3N4UA 3ANQA 3OG7A 2R3JA 4OAVB 4ANOA 1MUOA 3AD5A 3LAUA 4PTGA 4I23A 3FC2A 3KXHA 4AP7A 4C4JA 1A9UA 2Y4IC 5JKGA 3W2SA 4W8EA 2CGVA 3KRLA 3CSVA 4F7LA 1Q4LA 2ZV9A 5C4KA 4UWYA 2VTAA 4TKSA 3PY3A 4M69A 3IDCA 2EVAA 2ZMDA 4EH2A 4D2WA 2UW7A 2GNJA 4DFZE 4GG7A 2VNYA 3UIBA 2PL0A 2JD5A 3DK7A 5L2IA 3LLAA 2BFXA 3MVLA 4YLLA 2PULA 3PSDA 3VHKA 3KXNA 5IA3A 5IU2A 4FEXA 2WAJA 1WCCA 4O0SA 5C8NA 5AUVA 5KMMA 2C6OA 3NRMA 3OCSA 3Q53A 3MVJA 4RJ4A 4TTHB 3MWUA 2XBJA 4DT8A 3DB8A 4FTQA 3GC9A 2VO3A 1JKTA 1W83A 2HAKA 3PPZA 3PWDA 4WUAA 3TV7A 3ULIA 3R8PA 4BHZA 3VW6A 4IDTA 3O8PA 1TKIA 3F69A 2HZ4A 2YDIA 2PYWA 5A6NA 1QCFA 3PG3A 2CCIA 5C4LA 3FBVA 3UYSA 4JJRA 2JFMA 4EH5A 5HE1A 4RWJA 5LVMA 2WQMA 4MCVA 4I41A 5K4IA 4UYNA 2BDFA 4WD5A 4AN9A 3QUDA 4EJNA 4BF2A 3V5JA 3QYWA 5M4IA 3VUDA 1DM2A 2YCFA 1Y6BA 4F0FA 4QP6A 3OW3A 3F2AA 1CKIA 2R3HA 5G1XA 4MF1A 3HV3A 3PIXA 4IX4A 3UOKA 1LEZA 2ERZE 2GS6A 2UW6A 2C0IA 3R7GA 1KV1A 1UNGA 2X8DA 4JI9A 4L3JA 4AZTA 4BTKA 1SVEA 3O2MA 5BVDA 4IZAA 3V01A 5DR6A 5C01A 2XIKA 3T3UA 3FXXA 2QOKA 4CG8A 4F7SA 4Y5QA 3F3UA 3I60A 5E7RA 4O2PA 5T6KA 3VNTA 4O7RA 4LG4A 5BPYA 5FGKA 2DWBA 3E64A 4L44A 1XBBA 2JKKA 2YWPA 3DV3A 5A54A 5FTGA 2O5KA 4HGEA 1WVYA 1R39A 3NUYA 5JGBA 2CNQA 3RAHA 2GHGA 5GIOE 3LMGA 4NM5A 4BI0A 3OMVA 4LFIA 4BCJA 3UP7A 2UUEA 5JSMA 2WMXA 2XRWA 2UZBA 4AN2A 2YISA 3UIMA 4RFMA 3ZLXA 3CPCA 3E5AA 5FEDA 4DG2E 4ONAA 2IVSA 4L42A 3VF8A 3VUHA 3RTPA 1Y8GA 2ERKA 3P86A 2WTVA 4KINA 4U44A 3UVRA 1GAGA 2QQ7A 2VTLA 4M66A 2JITA 5FM3A 4X2KA 4OBPA 4FTMA 4O2ZA 3VUMA 3DAJA 2OJIA 2W1CA 5KNJA 4CFXA 3DDPA 2Z7RA 3FLZA 2WTKB 4OTHA 4RZVA 3OEFX 4FTIA 4R1VA 2XK3A 5HGIA 3LPBA 5AR2A 5CVHA 3ATSA 4FEUA 5ANJA 3V51A 3CR0A 4EBVA 4GJ2A 4USDA 4Y46A 2X7FA 1IG1A 3IGOA 3OWPA 4AUAA 2KULA 3P0MA 4A4LA 3MVHA 2I0YA 2JIVA 3RZBA 3H9RA 5HX6A 3TKHA 2YN8A 4BHNA 4BIDA 1FOTA 4ASXA 1FVTA 2FH9A 3QU0A 1YXUA 3RPVA 3CE3A 3H30A 1H1RA 1AQ1A 4RX8A 4EH7A 3FPMA 4RIYA 3LFEA 2BRBA 4WIHA 4D1XA 4O82A 2YCSA 3R6XA 3BGPA 4A9UA 5M09A 1J91A 1Q61A 4WRGA 4FUYA 4Y95A 3MFTA 3TJDA 5ICPA 2P33A 1GZKA 5CEQA 4IX3A 3VS2A 4B6LA 3L9LA 2ZJWA 4RIOA 3WZUA 5HG9A 3FMDA 2Q0BA 3C51A 3JY9A 2CGXA 3BGZA 4XG6A 3PWYA 3OUNB 2WU7A 4LL5A 4Y83A 3GXLA 2UW4A 4M67A 2GPHA 5M56A 4RC4A 3EFWA 3O7LD 5DWRA 4JVGA 3RINA 4K1BA 3ORKA 4YJUA 3RAKA 5GNKA 3E8NA 3I7BA 5CSXA 3QXOA 3CQEA 3ZFYA 4G6LA 5BVKA 4CD0A 1W82A 3UNKA 2W0JA 4IMYA 4J98A 2PE2A 2QHNA 4XEYA 4NK9A 1XH9A 3POOA 4QP1A 2OO8X 4S31A 1ZOHA 2QCSA 3HDMA 5EI2A 3DB6A 5F94A 4O21A 1UV5A 4ZXTA 3QTWA 2J0MB 4EOPA 4EI4A 4A9TA 4JIAA 5AV2A 3ZUVA 4IIRA 5T3QA 5HVYA 4OLIA 4QMZA 2WZJA 3Q3BA 5IQIA 2VGPA 3HV7A 3AGMA 2PU8A 4FSYA 4FV4A 3QQFA 5FBNC 3EQGA 4ZTNA 4WG5A 3DT1A 3NCZA 1OL5A 4XLIA 2XK4A 2XKDA 1JLUE 2R7BA 5F4NA 5AX3A 1OBGA 4E1ZA 2OGVA 4KABA 3D94A 4OTGA 3QQKA 4F09A 1YOJA 2ITQA 3QHRA 3RALA 3RK7A 1STCE 2C68A 3LCTA 2C5OA 2ZAZA 3FSFA 4X2NA 2R3PA 4CZUA 3OXZA 4X6RA 5M57A 4F1TA 2ITYA 3HA6A 4Q5EA 3ZXZA 4F65A 4UMPA 5IQAA 2R3OA 5FP5A 4H05A 3PLAE 4LMUA 2O3PA 1SNXA 3EN4A 1WVXA 2C5XA 3COKA 3EKNA 3EQDA 4LQMA 4MD7E 3G2FA 3TACA 3DNEA 3QRUA 1MRYA 2J50A 3E3PA 2PZYA 5CAOA 4BR3A 5J87A 3BHHA 1RW8A 3D15A 2XEZA 5DT4A 3VS1A 3ODZX 3F2NA 1YXXA 1RQQA 1JSTA 5ANEA 4IJPA 4D58A 2W5AA 4IZYA 1BL6A 4FEQA 4FK3A 5C8KA 4NUSA 3PDTA 4BI1A 3MA3A 2QOIA 4DHFA 4CV8A 5DBXA 3GVUA 4ZZMA 4BCHA 1DI9A 2R3KA 1JKSA 3CD3A 4E7WA 4S33A 3BBTB 2X8EA 4C57A 3KCFA 4EHZA 3KMMA 5DFPA 2Q83A 4QP7A 2PMLX 4XRLA 3S1HA 3CGOA 4DITA 1ZLTA 5E8VA 4E20A 1MP8A 2QOLA 4NJ3A 1UA2A 3U6HA 1CSNA 5EYDA 4Q2AA 3GCSA 1GIJA 1VZOA 2Y0AA 3AC3A 4O1PA 5AUZA 4JL9A 2OI4X 3HGKA 2B9HA 2VWIA 3BE9A 4PNIA 3KL8A 4WG4A 4CLJA 2C5NA 3EIDA 2G9XA 3LM5A 4W4XA 1Q8YA 2EXMA 5HU3A 2X2MA 4YURA 4FSWA 5JH6A 4PRJA 3Q9WA 4EC8A 3JUHA 1BL7A 2CGWA 3IW5A 5AR4A 2DUVA 4UN0C 5FDPA 1KE9A 1YRPA 3IW4A 3MN3A 4N0SA 3A4PA 1QPCA 2ESMA 3DBEA 4FNZA 5IH6A 4QMXA 5BVFA 4O27B 2BZJA 5DPVA 5CSVA 4F9BA 3VS4A 3MB6A 3WIGA 3FV8A 2QI8A 2B9IA 2UZEA 4G6NA 4EOIA 5J9ZA 5CWZA 3NW5A 5DE2A 5E8ZA 1SYKA 3KKVA 3E92A 5K5NA 1WBVA 2Q0NA 4H1MA 3W2RA 3DA6A 3FXWA 4X7QA 3FKLA 1MQBA 3F3WA 3K5VA 4BKYA 3QC4A 3QQUA 3E88A 3DQXA 4E3CA 2JBPA 2I6LA 4LV5A 3QTXA 2C4GA 4U5JA 4AZVA 4MQ2A 4BTMA 4IVDA 2H6DA 5FTOA 1G5SA 4XG2A 5HVKA 2HW7A 3UPZA 5ACBC 3QTQA 2WTJA 1JAMA 3A2CA 1ZARA 2C5YA 3BYOA 2QOBA 3MSSA 4RZWA 4AN3A 1FVVA 4BCOA 3MTFA 1M7NA 1ZY5A 4L45A 3PY0A 2J7TA 5IA1A 5JFWA 2J6MA 4EZ7A 1I09A 2WOUA 1WBOA 4U9AA 2YAAA 4UMQA 4GYGA 1J1CA 5LARA 3BPRA 4ASDA 4DEAA 2YACA 5J9YA 3C13A 3FMJA 4FIFA 4IAYA 5TT7A 3OZ6A 3TXOA 3ZO4A 4F6WA 4UEUA 2C47A 2ZV2A 5CI6A 2F57A 5HQ0A 1AD5A 4PMMA 4DE4A 3W2QA 2YM5A 4KA3A 3ZZEA 1PMNA 5CZHA 5IDNA 3FLNC 2J0KA 1OMWA 4IB1A 4EZ5A 1OL6A 4FV6A 3G6HA 3UZTA 2QNJA 3LHJA 1BMKA 4EOSA 4O7WA 4FIIA 1ND4A 4EYJA 3KGAA 1KSWA 4RT7A 4AW0A 3U54A 2VTRA 4BDHA 1NT2A 3PUPA 4BDFA 2FO0A 2QD9A 4EOKA 2OK1A 3C50A 4XS2A 4F7JA 3KC3A 3W55A 1DI8A 5E4HA 5DHJA 4GL9A 2B0QA 4E4MA 4FG8A 4EUUA 4YZBA 5BYYA 3VN9A 2A19B 2H96A 3FKNA 5ACKA 3ZFMA 2QR8A 4U81A 3PJCA 3C4XA 3BYUA 4MBJA 3KXXA 3E93A 4YP8A 5CF8A 2B52A 3QTZA 1SZMA 3BEGA 4D2RA 3UOLA 1BKXA 4MVFA 4QTCA 4U41A 3NNUA 4W9XA 2OFUA 3NIZA 4NTTA 1ZMUA 4BDDA 1F3MC 4F70A 4C4IA 5A4EA 2XM9A 3F5GA 5ITAA 2B1PA 1SVHA 3QCYA 2B4SB 4APCA 5KKRC 5TE0A 2QO7A 4AXAA 3DY7A 4IFGA 2V5QA 2BROA 4KIKA 2HELA 4NCTC 4PPBA 3EB0A 4WBBB 2W06A 2WQEA 4F9YA 3D4QA 4IAFA 4NZWB 4EWHA 2OFVA 5E92A 4E5WA 4EWQA 2C1BA 4BTFA 4WNOA 5CQWA 3QD0A 4QO9A 4AA4A 4D4SA 3W1FA 1L3RE 5BUJA 1P4FA 4EONA 5IH4A 4JT3A 4W9WA 3Q32A 3QD4A 4LOOA 3DTWA 2BZKB 4FK6A 1GZOA 2UW9A 4G16A 5HORA 4IBMA 4NFNA 4IVAA 2YIRA 3JS2A 2F9GA 3DNDA 1VYWA 2RG5A 2ZM4A 2BIKB 3RP9A 3UE4A 5DMZA 4IAKA 3CKWA 3OY1A 3GNIB 2RL5A 3U9CA 3BLHA 1V0OA 4QOXA 4D0WA 4QMNA 5IUIA 3AXWA 4CFUA 4GS6A 4D9UA 1PMEA 3Q60A 2BUJA 1PXKA 2JDVA 3FC1X 4LRJA 4Y85A 4EK8A 4PQNA 3K3IA 5LJJA 3IOPA 4YNEA 1FINA 3CEKA 4DA5A 3C1XA 4IJ9A 4R3RA 1ZZ2A 2QLUA 4GJ3A 5CI7A 4ZEGA 4H36A 3IECA 1KE8A 3MW1A 4FX3A 1UNHA 4O6LA 3LMHA 4FZFB 5HKMA 4X0MA 4JLCA 4AQCA 2OKRA 1M7QA 2OIDA 3OTVA 1W84A 3E3BX 4FT5A 4O91A 3V8WA 4JAJA 5JZJA 3NVMB 4XH6A 4YJNA 2O63A 5IA5A 2F2CB 3QQLA 4EH9A 4B9DA 4DINA 4GT5A 3FLYA 3DDQA 1YWNA 3HRFA 3UQCA 4WBOA 3C5IA 2QONA 4FV0A 3FHRA 3UYTA 3ZFXA 3D83A 2OXXA 3LXNA 2BKZA 3FI3A 3F82A 3DOGA 4U97A 4CRSA 5BUIA 4BDCA 4RWKA 4CCBA 2F7ZE 3UQGA 2HZIA 5KX8A 3NUXA 4II5A 2H8HA 4I0RA 4YGAA 3NX8A 3RVGA 4C4HA 4F6SA 5HLWA 1ZYCA 1NVSA 4PP7A 3FL5A 3NIEA 5CXZA 5HLNA 3LCKA 4FICA 4I3ZA 3V6RA 5I3RA 3HV6A 2RKUA 4FKLA 3S2PA 3H0YA 1RE8A 4FL2A 5F9EA 2X9FA 4UV0A 3W10A 1WFCA 4ANBA 5BQ0A 2RIOA 3HMNA 2QOFA 5HIDA 3R83A 4C59A 4F63A 4LGGA 4TWPA 4UZDA 3MH1A 3SAYA 3LJ2A 2VO0A 1OM1A 1URWA 3DU8A 4GK4A 1G8AA 2XIRA 2O64A 3FLQA 4MBLA 3RCDA 5EM7A 3GT8A 4KRDA 3VW8A 4CMTA 4FI1A 1OL7A 5CNNA 4L3LA 3A7FA 2EWAA 3RHKA 1GNGA 4ZJVA 4DG0E 2H9VA 5L8JA 4B99A 4P4CA 5FDXA 4PP9A 5AP0A 4D0XA 3FMLA 1AGWA 3L8PA 3TV6A 3ZMMA 1OUYA 5CF4A 2CCHA 4B0GA 4DH3A 3R8MA 2VAGA 2YCQA 3CC6A 4FVQA 5EH0A 4HVGA 3A7HA 2GNLA 4FEWA 1S9IA 4GFMA 1GZNA 2BHHA 2R3FA 3DBCA 4RX9A 3VBWA 3H0ZA 3PZEA 2BZHB 5EW8A 2CKOA 2YIWA 4FKGA 4AW2A 3NYNA 4J1RA 3CY3A 4PPCA 4DFYA 3R7VA 5BVNA 2PZPA 2X6EA 3OCGA 4CEGA 2XB7A 1ZY4A 5AV1A 4L8MA 1UWJA 3VS7A 2X7GA 5EKNA 4HYSA 2XNBA 4BI2A 3ID6C 5TKDA 3GGFA 3ANRA 3CPBA 1YKRA 3F6XA 1YHSA 2CPKE 2QO9A 4ZSGA 4M97A 4XP0A 3JXWA 1G3NA 2UZTA 4QP8A 4AE6A 3PJ8A 3R7EA 3NUPA 5HBJA 3ELJA 1P5EA 3FI2A 2G2FA 5TO8A 3OUKA 1XH5A 5IQHA 4J99A 4U42A 4MKCA 5FD2A 3MPMA 4OT6A 4FODA 4KUJA 2VZ6A 3SGCA 4X2JA 3EMGA 2YITA 3NUSA 3D2KA 4F0IA 4A9SA 2VX3A 3OVVA 4OTWA 3COIA 5IEYA 3QKLA 4LV8A 4WSYA 3ZC5A 4BCPA 3I5ZA 1RJBA 2PVHA 2WMRA 5E8SA 4QMOA 4IDVA 4L53A 4RIXA 4PL4A 1JQHA 3WIKA 2X2KA 3UPXA 3I0QA 4AGWA 3BHYA 2DYLA 2C69A 5M53A 4EHEA 5D1JA 1H1WA 3M42A 2IW8A 3UO5A 2CKPA 3KRXA 1PXNA 4XJ0A 3MPAA 3E7VA 4BIBA 5B2LA 2ITZA 2B7AA 3G9LX 3T9TA 2UW8A 3MY0A 3PE2A 4FTNA 3DK6A 4ITJA 4GMYA 4USFA 2XZSA 1R3CA 2OF2A 4AGUA 4D5KA 3I4BA 1I44A 4YTHA 4LRMA 1UU7A 2NPQA 3NYVA 4QMYA 3E8CA 3MI9A 3TI1A 5HOAA 5K3YA 4C3RA 3UZRA 1Q8WA 4TYGA 5JN2A 4TWNA 4XV2A 4BDEA 3SXRA 3WILA 4YJRA 3C0HA 4B8LA 1FVRA 4OTDA 2JGZA 1H0VA 1ZRZA 3NLBA 1LPUA 1PXLA 4RQKA 2YJRA 3E63A 3A60A 4FNWA 3S00A 3TEIA 1P4OA 4BWKA 3PXQA 4O7TA 4RJ6A 4C33A 1OKWA 4MNEA 3ZLYA 1O6YA 2ETRA 3II5A 4Q9SA 4Y8DA 3KXZA 4NFMA 1Q5KA 4GFGA 4QMVA 4EK5A 5H9BA 2NRYA 5I9YA 3UP2A 2B54A 1PXPA 2VX1A 5CASA 5LVNA 2W1IA 2R9SA 4M15A 3TM0A 4E6AA 3BHTA 4EKKA 3CJGA 5BUEA 3QHWA 2AYPA 3COHA 4YTFA 1XBAA 4JDJA 4MXZA 3MV5A 4ZTRA 4KIKB 4I6HA 2B53A 3AT2A 3EL8A 3M11A 4ACCA 2WFYA 1ZAOA 1RDQE 4A9YA 3CS9A 3IG7A 3NGAA 2ZDUA 1H1PA 4O7VA 5IISA 3NWWA 4HYHA 1OITA 4CMOA 1GIHA 2X81A 4IM0A 2ETKA 5B2MA 2YIQA 4QPAA 3OT8A 2OZAB 4CNHA 2XYNA 1R0EA 4HVDA 3KY2A 4BBFA 3KA0A 2W5BA 3QTIA 2ITUA 3KVXA 2GNGA 4K9YA 4TNDA 2Y9QA 2WOTA 5GZ9A 2E9NA 4FV7A 4BWXA 5TF9A 2E9VA 4FZ6A 1R0PA 3MPTA 4FV5A 4XBRA 4HJOA 4C4EA 5IEVA 2GTNA 2E9PA 3CIKA 5AX9A 2VWXA 2VWYA 3GU8A 4O0UA 4BRXA 5EM5A 3FHIA 4S2ZA 4XBUA 1PF8A 2PUIA 5EFQA 2EU9A 4DTAA 5M4CA 4CFFA 1H28A 3EYGA 4QD6A 1H01A 3LFCA 1U54A 4K11A 4C4FA 2W4KA 3A7JA 4KB8A 4EOJA 3GENA 4RFZA 3FE3A 3P9JA 4CKJA 3KK8A 1PXMA 4BYJA 2Z8CA 1UKIA 2WXVA 2LGCA 4MD8E 2OBJA 3EH9A 3P1AA 5AFVA 3IDPA 4DGNA 3VJNA 4FR4A 4BTJA 3ZTXA 2IZRA 2I0HA 4RLLA 1H08A 1DS5A 4O7SA 3PJ2A 1CM8A 2YM3A 3ENHA 2XH5A 3GP0A 4GUEA 2QOCA 4BCGA 3QTRA 2QOHA 5DLSA 1W8CA 1UU3A 1E9HA 1M2PA 4QYHA 3RI1A 3HV4A 5AP5A 5AEPA 1W0XC 5AUUA 4CFNA 4LRKA 3ORMA 4C0TA 3GC0A 4IX6A 3PE1A 4OTRA 5AIRA 3SXSA 4LL0A 2VTJA 4N70A 1WMKA 4CT1A 3UNZA 4EH8A 3R1YA 4YZDA 2EXEA 3BYSA 4TYJA 3VUIA 3U55A 3MB7A 4JG6A 2W1FA 1IEPA 4EL9A 3NMUF 1PMVA 5LQFA 4HGSA 5CZIA 1TQPA 3ZLWA 4O83A 3LFFA 2YLEA 4O0VA 5DOSA 4ZTLA 1GZ8A 3FL4A 4WKQA 4IQ6A 4RA4A 4O0YA 4RC2A 5L2TA 1J7UA 4RWIA 4W4YA 1ZXEA 1FPUA 3DKOA 3CCNA 2C6IA 4JAIA 2VWUA 3EQBA 3FZPA 4NIFA 3NVKI 3BI6A 3TZ7A 4IANA 3TN8A 4C34A 3LVPA 4RX7A 3C7QA 3VS6A 4O96A 3VBYA 4YSJA 4DFBA 2C0TA 3IW7A 4EK3A 2QLQA 5AAEA 4YHFA 5HVJA 1T46A 2JAVA 3UQFA 2HOGA 3ATTA 3AT4A 4KIQA 4L6QA 3QKMA 1KE6A 1LP4A 2R64A 5LWMA 2JKQA 2UZDA 1OPKA 3P7BA 4E6QA 3UMXA 4JDIA 3QL8A 3C4FA 3GFWA 3P7CA 3KU2A 4QMWA 3L8VA 3QBNA 5CU2A 3QXPA 5E1EA 4FTLA 5IG1A 2FUMA 2VTTA 3O71A 4G34A 3LKMA 3W33A 4ZAUA 2YCRA 5BVOA 2BAKA 3WE8A 2J90A 3KULB 2BRHA 1OIUA 2W1GA 4ZY4A 4PDYA 3TT0A 3NUNA 3FMMA 2OJJA 4ZY6A 4GUBA 4ANQA 1TVOA 3KULA 3FYKX 4Z9LA 3ZSHA 4PDPA 5HICA 2YA9A 3PXZA 4DEEA 4QTEA 5M4FA 3DTCA 3HV5A 4R7HA 2EB3A 4OGRA 5DVRA 4EOLA 4JX7A 2BILB 5L8LA 4NM3A 1PYXA 5J1WA 5M51A 3UNJA 2RFEA 3F7WA 3ZLSA 1GY3A 2XNEA 2XKEA 1KOBA 5LVLA 2YZLA 3C4ZA 1FQ1B 4G3GA 3C5UA 4EH3A 4ZLZA 2HW6A 3KCKA 3DZOA 2NP8A 1FGIA 4MXAA 4N6ZA 4ZSLA 3TNIA 4ALWA 5CAUA 4AFJA 4F1OA 3MYGA 4IX5A 4TYHB 5JGDA 5EHLA 3OXTA 4NT4A 5GJFA 1H1QA 1O9UA 4NM0A 4BC6A 3EQPA 4I4FA 2VTIA 4MEDA 4YPSA 1QPEA 4M0YA 3W2PA 2OIBA 5IQEA 2H34A 3AMAA 2WIHA 3GU6A 3DKFA 4HVSA 4BICA 5AA8A 3D0EA 3VHEA 4MF0A 4R7BA 4X2FA 5H8GA 3SOAA 4P2KA 3ZO3A 4CTBA 4WOVA 3KRWA 5FQDC 4FT9A 5A4QA 3PG1A 5AUTA 5JT2A 3VUGA 4BVUA 4BL1A 4BZDA 2G01A 3FZTA 5CSWA 3VS0A 5B0XA 5C8MA 3ZS5A 3CTHA 2OICA 2WEIA 4DEIA 2P2HA 4GIHA 3FQSA 4DFUA 4LOPA 4G9CA 4EYMA 3TKIA 4UXLA 2WMUA 3BLRA 5ANGA 4CKRA 4M8TA 4CKIA 4AGCA 5AADA 2R3RA 3TJCA 3MFUA 4GU6A 4BYIA 3FI8A 3DK3A 2YM6A 2JDOA 4L46A 1KE5A 2OSCA 3WZDA 2R0UA 2UZOA 1XH8A 2E9UA 5BVWA 5J5SA 5BNJA 4IAZA 4QP9A 1XQZA 1U59A 3U4WA 4F08A 5E90A 1M2RA 4QYGA 4WNPA 1KOAA 3AG9A 5HCYA 3ZRMA 2ZYBA 1PKGA 3PFQA 2WMQA 4QQ5A 4XV3A 4CYJA 4D4YA 3SC1A 5FLFA 1YDTE 1YXTA 4DFLA 5KMLA 3VVHA 4PY1A 4DH8A 4L9IA 3BU6A 5DR2A 3F9NA 4AWIA 4BGHA 3D5WA 4DC2A 3Q2JA 4AS0A 4NW6A 2FSMX 4ANLA 4E93A 5I9WA 4QTAA 3G5DA 5TR6A 4FE2A 2QODA 3FLWA 3KN5A 5L6PA 3GC8A 3JVSA 4ZK5A 3ZZWA 2WEVA 2J5FA 4XV1A 5I5ZA 2W1HA 4DGLC 2XJ2A 1ZOGA 5KBQA 3JVRA 2GQSA 3HRBA 5AP6A 3HP2A 3KQ7A 1J7IA 2PPQA 4CLIA 5EQPA 3RPYA 5LMBA 4GU9A 4E5AX 4XP2A 4JG7A 5AR3A 3Q6UA 3TKUA 3P23A 4FV8A 5AP7A 3DXPA 3LOKA 3V04A 4FG9A 1U46A 5I4NA 5EKOA 4O1OA 3E62A 4BKZA 3UVPA 5M07A 4RQVA 4ERWA 4Y72A 5AM7A 3BYMA 5EYKA 2G15A 3DFAA 3G51A 3Q52A 3W2OA 4DEDA 4HGTA 1IAHA 1Q62A 3VS5A 2XUUA 3R1NA 2XF0A 4EQCA 4OTIA 4EKLA 2AC5A 4RIYB 4YTCA 4UWCA 1IRKA 3DZQA 4GSBA 3QA0A 4K2RA 4FSQA 3NUUA 3UODA 3QUEA 1YXSA 1ERKA 3NDMA 4F1MA 4BIEA 1PXIA 5CU0A 4UBAA 4PMSA 4AOIA 4FF8A 1YWRA 2Y7JA 1XO2B 3NNVA 5E8XA 5CY3A 2BKKA 3ZRLA 3D5UA 3LM0A 3PSBA 3VQUA 2OJ9A 3I6WA 1Q97A 4GKIA 1SNUA 3AGLA 1CDKA 2JKMA 3NUAA 5HO7A 3CD8A 3KF4A 3G0FA 3W8LA 2WHBA 4CFWA 3GCPA 4FKPA 3DBDA 4FYNA 4RJ5A 2A4LA 4R7IA 4ALVA 5A14A 3EN7A 3F61A 4YMJA 4FVPA 5ETIA 4QNAA 2R0IA 5CT0A 3VRYA 4H3BA 4DT9A 3PVGA 4OBQA 4FT7A 3EOCA 3AD4A 3DJ6A 4FTRA 5CXHA 3GOPA 5G6VA 4A06A 3BZ3A 5FXQA 3PXRA 5CALA 4FKVA 5D11A 4I1ZA 3V5QA 3Q4UA 4KSPA 4AAAA 4IM2A 3R71A 3VC4A 5KMOA 1IR3A 1KUTA 3IW8A 5J8IA 4QYEA 2ZM1A 5FEQA 2HENA 4DTBA 3DJ5A 4M3QA 3MBLA 4ANMA 3RNYA 5AP4A 3MY5A 5AUXA 3L1SA 2YIYA 3KEXA 1CTPE 3QD2B 4DH1A 3D7ZA 5CEKA 4NIFB 2WMVA 3VIDA 4PMPA 4EORA 4EH6A 3GOKA 2XNNA 3NNWA 2YM8A 3LCOA 3QX4A 3AMYA 3GEQA 4O0RA 4QYFA 5FRIA 1MQ4A 3QX2A 1NY3A 1R1WA 2KTYA 2VN9A 5HCZA 4BDIA 2NO3A 2W7XA 4D1ZA 4HNFA 2XCKA 5DEWA 3POZA 4UX9A 4FZ7A 5EQYA 2WTKC 2FSTX 3OS3A 2YIXA 2BAJA 2BTRA 5E1SA 5GJDA 4CGAA 4I0SA 2IVUA 4EK6A 3U8WA 5HD4A 5DN3A 2VTPA 3PRFA 3EJ1A 4J53A 3ITZA 4KS8A 4EC9A 3E87A 2JEDA 4S32A 3VBXA 2GQRA 3ZBXA 4ACMA 3O17A 5I9XA 4XV9A 3KB7A 4V01A 2WTCA 3RZFA 3MH3A 3DKCA 4UWBA 3U6IA 3NW7A 3OW4A 3Q9XA 4K33A 3W18A 3D14A 5IH5A 5TOZA 3HNGA 3ZHPC 4BDJA 3DXQA 4EJ7A 5J79A 1JSVA 1OIQA 4ZJJA 4BB4A 3WOWA 2PVNA 3BWJA 3TNQB 1PJKA 1NVRA 4PX6A 3ZXTA 1P14A 4OW8A 3FQEA 4JR3A 4CG9A 4XOZA 2GNHA 4RWLA 3PIYA 3CGFA 1JSUA 2BCJA 3SV0A 2UW3A 3K2LA 3TUCA 3S4QA 4D55A 4B4LA 4AX8A 4QP2A 4FV2A 4ERKA 4BDGA 1XHAA 4C62A 4I5CA 4G5PA 3FLSA 4YHTA 3EZVA 4C8BA 5D41A 4K77A 2XJ0A 3VO3A 2Z7QA 2XBAA 5K5XA 2XK6A 3AT3A 4FG7A 3R1SA 2GU8A 4F6UA 4MNFA 4GFOA 4YJSA 3UO6A 4KNBA 3QTSA 3QALE 3GQIA 4Z55A 2ITNA 4FUXA 5HX8A 4V05A 3SG8A 4NTSA 2CLQA 2P0CA 4DAWA 5A9UA 4YZ9A 1Y57A 3A8WA 5CX9A 4DCAA 2YERA 3UC4A 3HMPA 3BKBA 4AZFA 3PJ1A 2HZNA 1XKKA 2GMXA 3F3ZA 2C3KA 1WBTA 3M1SA 5AV0A 4O7YA 4KIOA 3Q9YA 4QYYA 3E8EA 3OTUA 2QOOA 5LMAA 3EQIA 5HTCA 2WTWA 4FKTA 3HAVA 4A4OA 4LOQA 2ITXA 2R3IA 3R9HA 5AR5A 3BLQA 4HW7A 2XIZA 4Q9ZA 3UOJA 3AC1A 4XX9A 3TNWA 3HVCA 4QP4A 4AE9A 4H39A 1P2AA 3PXYA 4WUNA 5IMXA 1F5QA 2REIA 3O8TA 5HHWA 3VJOA 1V1KA 3EN6A 4FKWA 3WZEA 1OKYA 2HCKA 3QKKA 4GK3A 3U9NA 2ONLC 2X4ZA 3OD6X 3PVBA 4E4NA 4N6YA 3TUDA 4IH8A 4XOYA 4KKEA 2O0UA 2C3IB 2B55A 3E7OA 3EYHA 5A6OA 3ZM4A 4BDAA 5K0XA 3NS9A 4ZTMA 4TN6A 4TZRA 2G1TA 4R6VA 4I21A 4PDSA 2PE0A 4MXCA 4G3CA 4TW9A 5BMMA 4EZ3A 2PZIA 4HOKA 1QMZA 2JAMA 2RFSA 4D2PA 4XRJA 3FPQA 4FMQA 3SX9A 4W4WA 3R9DA 4UZHA 5EOBA 2CHLA 2WMSA 4FTKA 4E4XA 5IDPA 4R77A 4R78A 4PV0A 2OZOA 5AUWA 5ANOA 5E8TA 1ATPE 3Q9ZA 3NPCA 3RM7A 3C0IA 2QG7A 3H9OA 2ITWA 3O51A 4UXQA 4Z7GA 3ZONA 4KS7A 2I0VA 2UV2A 2WKMA 1YW2A 5ANIA 4HCVA 3R7YA 5KUPA 2GFCA 2HXQA 5HD7A 2XK8A 3O8UA 3PIZA 3ZSGA 4A7CA 4UYAA 2ACXA 4R8QA 5I3OA 4V04A 4C3FA 4F9CA 5AV4A 1Y8YA 1ZWSA 4ID7A 1W7HA 2C0OA 3DLSA 4PL3A 4G9RA 2LAVA 4YR8A 4GIIA 5LVOA 4RVMA 4GH2A 3WZJA 3ZSIA 5HZNA 5IPJA 5HBHA 1NW1A 2BALA 4U8ZA 4I6BA 3OY3A 1YXVA 2UVYA 4I22A 3I1AA 4NM7A 4FSRA 3MJ1A 3GU5A 5IEXA 5JRSA 1OUKA 4ZTHA 3RM6A 4ITIA 4YUQA 5D10A 3N9XA 3EN9A 3QYZA 3BV3A 4ARKA 4CV9A 4I6FA 2IPXA 3PPJA 4JQEA 2BDJA 2PVYA 2JLDA 5JEBA 3MIAA 4TRLA 4D2SA 4K6ZA 3PTGA 4EEVA 1JOWB 5L2QA 4ENYA 4OR5A 1PXJA 4FIHA 5A46A 4ZLYA 3LLTA 2YLFA 5LWNA 3NYOA 4E8AA 5K4JA 5HG7A 1QPJA 3OBGA 4FSTA 2HY0A 4EUTA 5F20A 3ALNA 1FGKA 4M68A 1JWHA 3V5TA 2VTMA 2X9EA 2BDWA 2UZNA 2PSQA 3CTQA 4FKSA 3RWQA 4XP3A 4ANNA 4IZ5A 5AR8A 3FAAA 2CLXA 1OECA 4YBKA 3LFSA 3CLYA 3OHTA 4DEHA 4D28A 5IA0A 3F3VA 1REJA 5CVFA 2W1EA 2W17A 2HWOA 5FWKK 1UU9A 3WYXA 2A1AB 4ZJIA 5CF5A 2X7OA 1KE7A 4KSQA 1Z9XA 3ORZA 2OLCA 1TQMA 5DYJA 3R28A 3HMMA 1FMOE 3BU5A 2GNFA 2BTSA 2PE1A 3D5VA 1K9AA 3NAYA 4PWNA 3W16A 4LM5A 4C36A 3BWFA 1H8FA 2OH4A 4MXOA 1VR2A 5B2KA 2Y4IB 2IN6A 3LCSA 4GYIA 3WF5A 4WG3A 3DQWA 1YI4A 3HL7A 4RFYA 3ROCA 3ULZA 2OXYA 1Q41A 3I5NA 5HEZA 3NEWA 3R2BA 4C4GA 1Y6AA 5JK3A 5HE0A 3WYYA 4LGDA 2XA4A 3MH0A 5E9EA 3QF9A 2VUWA 3A8XA 3BCEA 4R5SA 3LXKA 1SM2A 3KRRA 2E2BA 3LXPA 1OL1A 3H9FA 2AC3A 1U5RA 3R8VA 5KHWA 2HY81 5FBOA 3EL7A 2QU6A 1ZYDA 3P7AA 3I0OA 5AP1A 4Z7HA 3F66A 3FUPA 4MAOA 3WF7A 2R3GA 3AD6A 3GFEA 4AA0A 4DYMA 4WO5A 3M2WA 2YEXA 3ZCLA 4M13A 4AGDA 4ZTQA 4ZLOA 3ORNA 4MK0A 3BQCA 4QMLA 4ZP5A 3AC2A 2FVDA 4EHVA 4QQTA 3TUBA 3SHEA 1JKLA 4HPTE 3DAEA 3PLSA 3UZPA 2FYSA 2PZRA 3IO7A 4IWDA 4RSSA 1OIRA 1KV2A 3HDNA 4KBAA 5EHOA 5DNRA 1UKHA 2C3JA 1ZYLA 4GCJA 4J8NA 3ZYAA 4ALUA 5LCJA 1XH4A 3FMKA 3ORLA 1JVPP 2VWBA 4FOCA 1OZ1A 1Q3DA 4LI5A 4NH1A 4TXCA 4XG8A 5IKWA 3WF9A 4A4XA 4FTOA 2QR7A 4FBXA 3I81A 3BV2A 4EOQA 4FTUA 1XH6A 4XG4A 2R3QA 3SD0A 2UZUE 4U43A 5KKRB 3HEGA 5LMKC 3Q5ZA 3K54A 5AUYA 4NEUA 2OJGA 4MTAA 1Z5MA 5EDQA 3MY1A 3VRZA 4IWOA 4GKHA 4YBJA 1M17A 2RGPA 3PVWA 4X6QC 3T8OA 2BHEA 3DGKA 3H10A 3KMUA 3LQ8A 3BU3A 3GCUA 3QGYA 4GVJA 4KD1A 3U51A 1H1SA 2BZIB 2JFLA 3L8SA 4QMQA 2XK9A 2XNPA 5B7VA 5DGZA 3V5PA 4QT1A 3ZOSA 3EQFA 3HAMA 1OIYA 4HCUA 5HG5A 3V5WA 4DBNA 4U40A 2V22A 4FIGA 4FIEA 4P5QA 2WIPA 1M14A 3QRTA 4V0GB 3QZGA 3OXIA 4XLVA 3SG9A 1YDRE 1X8BA 2W4JA 4CYIA 2V7OA 2PK9A 4U79A 3RPOA 2CNVA 4O86A 3RCJA 4S30A 2XNGA 2J9MA 3PP1A 2GHMA 5AAFA 3VULA 2IWIA 4GT3A 1OGUA 1NXKA 4X2GA 5D7AA 4D2VA 5H2UA 2IZSA 4V0GA 4APPA 3DJ7A 3OCTA 3U6JA 3I79A 4W4VA 4H3QA 4CFVA 4D9TA 4YC6A 5AR7A 5DRDA 2Z02A 2PWLA 3C4CA 4FTAA 3DPKA 4QRCA 3TDVA 5CEOA 3FSKA 4FKRA 3TCPA 3FZ1A 5IUHA 3DAKA 3R9OA 4ITHA 3NSZA 5BVEA 4XCUA 1YOLA 4FSMA 1MRUA 5FXRA 2J0JA 3B8QA 3NCGA 3F2RA 5EM6A 4BY9E 5L6WL 4DLJA 1WBSA 5KMIA 2JDTA 2BRGA 4C3PA 4GV1A 4DTKA 5L2WA 3G15A 5D7VA 2SRCA 4G3DA 4EQUA 2PY3A 2ONLA 4G6OA 4I24A 1GOLA 1REKA 4FC0A 1ZOEA 1KWPA 3R7UA 3RNIA 4ZSEA 2PUPA 3Q5IA 1H25A 4RX5A 3QUPA 3ACJA 3R8UA 1Q24A 2VO7A 2FGIA 3R7OA 1BI7A 1IA9A 3OOGA 4G3EA 4X3JA 5FUTA 1FBNA 5ETCA 3HP5A 4BN1A 4GRBA 4I94A 4YJPA 3MH2A 3UBDA 5HNGA 3F3TA 3FI4A 3UC3A 2R2PA 4WNKA 1PW2A 4P7EA 1Q8UA 4FIJA 5EDRA 4FKJA 3FKOA 3HRCA 3MA6A 3OOMA 2WELA 4HYIA 2I7QA 4N4SA 3FEGA 5CSPA 2CKQA 4KAOA 1XJDA 3CKXA 2HZ0A 4DGMA 3F88A 3LFBA 3V8SA 4ZMEA 1BUHA 4EH4A 3Q4TA 2QKWB 5EW3A 5EI8A 1WVWA 3SKCA 1PXOA 3Q6WA 4XYFA 2UZVA 3QGWA 3PSCA 3BEAA 4FL3A 5LOHA 4I6QA 3PPKA 4IW0A 4NKSA 3MVMA 5L3AA 4IE9A 3T9IA 3HA8A 3GC7A 3FDNA 3REPA 3ORIA 3NAXA 4KWPA 5H8EA 1BI8A 4MYGA 4XUFA 3MFSA 3IONA 5C27A 4C02A 3QRIA 5CEMA 4PPAA 4D1SA 2P4IA 4QMMA 3P4KA 2P55A 4KBCA 3V3VA 4MQ1A 4BCIA 5ETAA 5FG8A 5AWMA 4FTCA 2RFNA 3ENMA 5DEYA 5E8YA 5H8BA 4PNKA 4TNBA 5KO1A 5LMKA 4ZIMA 1IAJA 5IA2A 2PVFA 2WTDA 4HZRA 3D7TA 4HZSA 5K9IA 4YZMA 3PZHA 3KXGA 3LQ5A 3O0GA 3JY0A 3BHUA 2OJFE 3P5KA 3WZKA 4CZTA 5JFVA 3KVWA 5KMJA 4F64A 3NW6A 3LFQA 2R3NA 5I9UA 3F5PA 1O6KA 3L9MA 4LMNA 3BX5A 1LR4A 4IAIA 4L7SA 4XNEA 5HO8A 2CN8A 2R3MA 2OW3A 2X39A 4AF3A 1WBNA 4FSNA 5EOLA 3OFMA 3OP5A 2ZM3A 3LCDA 3QQJA 4IADA 3ZDUA 2DS1A 3QTUA 4CFMA 4J7BA 1BYGA 4MWIA 4B7TA 2VRXA 3L8XA 4CCUA 5HLPA 4IHPA 2R3LA 3G6GA 2EB2A 3VBVA 3EFKA 1J1BA 3UGCA 4AACA 4NL0A 3K5UA 5J9LA 2ZV8A 4IB5A 4DCEA 2UVZA 4DFNA 1Q99A 3GQLA 4K8AA 4PL5A 4JXFA 3LFAA 3DKGA 2IVVA 2XIYA 3VQHA 3O23A 4O0WA 5L6OA 2NRUA 3BELA 3QZHA 4ZZNA 4F9WA 3GB2A 4NJDA 4FZAB 2BFYA 3GCVA 1UNLA 2P2IA 4RJ3A 4AZEA 4CZYB 4R5YA 2YFXA 3O7LB 5GIPE 3IK3A 1HCKA 4G2FA 4IWQA 4RC3A 4NU1A 3MS9A 2PZ5A 1JKKA 5AM6A 4RIWB 5DH3A 2XK7A 5AV3A 2O65A 2O2UA 4OTFA 2I0EA 4WSQA 4FVRA 5FP6A 2BMCA 3P08A 3D5XA 4YLJA 2UVXA 2HK5A 3QZFA 4H3PA 4JX3A 4TY1A 4U45A 1H27A 5KZ0A 4FOBA 3FMEA 3RK5A 3GUBA 3QD3A 4XHKB 2C30A 3BQRA 2XIXA 2RF9A 2R5TA 4RVKA 3RJCA 3HECA 1H07A 3I7CA 3MIYA 3KRJA 4JIKA 2IZTA 5BYZA 2OWBA 3ORPA 4QMUA 4TWOA 3QQHA 3QCXA 5FEEA 3EKKA 2WQBA 3QLGA 2X2LA 4NWMA 3RMFA 4DH7A 1WZYA 5HTIA 5CANA 1H26A 2VWZA 3F5UA 2QU5A 4QQCA 3WF8A 4ZMFA 2QOQA 3DFCB 2VTOA 3MTLA 4QPMA 4DH5A 4F9AA 3ZH8A 2ZDTA 1CKPA 4QMPA 3O96A 4CVAA 5C26A 5M55A 5CAQA 5CEIA 3A62A 4O22A 2YDKA 4I20A 4IC7A 2O8YA 4YNOA 3SRVA 3LE6A 4J52A 4L00A 3IQ7A 4MWHA 2QO2A 4TPTA 3ZEPA 2OXDA 1OPJA 4RBLA 4U3YA 4G1WA 3OWLA 4WNMA 4TL0A 4J71A 5JFSA 2RSVA 5EQEA 2WB8A 4K18A 3LMIA 3TDWA 3QCQA 5CU6A 4BDBA 5IQFA 4FEVA 4U0IA 4IACA 4YJVA 4K0YA 2EUFB 1J3HA 3B2WA 4X3FA 3T3VA 2AUHA 4JG8A 4FV3A 2WQNA 5JGAA 2IZUA 3I6UA 4JBQA 1A06A 2PUUA 1HOWA 5AP3A 4ZSJA 3VBQA 3ZO1A 5HIEA 1H0WA 2PVLA 3DBFA 2W99B 3OC1A 5LCKA 4RMZA 3L9NA 4OT5A 3PY1A 3TNPC 4O84A 1XBCA 2WMAA 3ORXA 4IVCA 4CQEA 2G2HA 4UMUA 2F7EE 4JQ8A 1R78A 2VWWA 2XCHA 5CNOA 4HVIA 4HVHA 4RA5A 3TZMA 2F2UA 4ZS0A 2R4BA 1JNKA 2BVAA 2PVJA 3NYXA 4H58A 2Z7LA 1OVEA 4R1YA 4RJ8A 4BFMA 3CP9A 3DXNA 2HYYA 5EK7A 1FMKA 5IQDA 4FL1A 3D7TB 4DN5A 5HBEA 4MH7A 4LUDA 5GHVA 3HUBA 2J0LA 2YABA 3V6SA 3RBWA 3PRIA 3R2YA 5T68A 4BCFA 5CENA 4JR7A 3QWKA 1A48A 2XNOA 1YQJA 2J2IB
chains in the Genus database with same CATH superfamily
3UG2A 3AMBA 5AIKA 4WHZA 3TIZA 3IW6A 3SA0A 2V55A 1XMMA 3AKJA 2X0PA 3SDJA 2VTQA 2C6LA 2OG8A 3HYHA 4QP3A 4QQJA 4DEBA 3R9RA 3BHVA 3DCVA 4BGGA 4D4RA 4O7ZA 5CAPA 4QMTA 1UWHA 4EBWA 1XR1A 2ZFYA 2VO6A 1IA8A 3CQUA 3WBLA 2I40A 4RLKA 3OF0A 3SRVB 4HNIA 4LGHA 4YC8A 2HXLA 4YZNA 1U5QA 5L4QA 1K3AA 2BR1A 5HE2A 5KE0A 1YHWA 5AJQA 1WBPA 4DF3A 4IFCA 4IWPA 3PA3A 3H3CA 4O7LA 4BCMA 2OF4A 4J97A 1UVRA 1OKVA 3U87A 3EFLA 2BAQA 1QL6A 4E73A 3R21A 1GIIA 2VX0A 4MNEB 3FJQE 4IVBA 3R8ZA 4DFXE 1OPLA 4CMUA 1G8SA 4ACHA 1H24A 4IEBA 4YHJA 2XNMA 4IXPA 3ZUUA 4EOOA 2ITPA 2XYUA 3G0EA 3V8TA 5JMSA 2CMWA 3R04A 4F0GA 2XKCA 5IF1A 3HZTA 3IDBA 3BRBA 4WRSA 5C9CA 4AZWA 4TWCA 3EN5A 3E8DA 3OCBA 4ASZA 4C2WA 1MRVA 2CJMA 3TL8A 5J1VA 4CTCA 4R3PA 4O7NA 1XWSA 4O4BB 4GK2A 2C6MA 2JKOA 4I5PA 3TG1A 3U4UA 3UMWA 2E9OA 2WGJA 4FKQA 4AA5A 3S0OA 5IQBA 1Y91A 3LQ3A 4M14A 4D2TA 5HE3A 3P78A 1DAWA 2FB8A 4NW5A 3W8QA 3WF6A 4ACGA 4PDOA 3DS6A 3F5XA 2F49A 3TIYA 4I0TA 1M2QA 2UW5A 2VV9A 5C03A 3TWJA 5I9ZA 3JR1A 4FZDB 3SLSA 4U7ZA 2NNWB 5DIAA 4JBPA 2UZLA 4MX9A 5KMNA 2F4JA 4C37A 4E5BA 4EQMA 4OAUC 2Z7SA 1QPDA 3KF7A 3HMIA 2XMYA 4AU8A 2XS0A 4RVTA 2C6KA 3VUTA 4H1JA 2GS2A 2XKFA 2C6DA 2YWVA 2YJSA 3GCQA 2GCDA 2Y6MA 3LJ0A 3V5LA 3CBLA 3RHXA 5HI2A 2HIWA 2ITVA 1K2PA 3BIZA 4JBOA 4YTIA 5GJGA 4FA2A 2F7XE 2PTKA 1LEWA 5I9VA 2RFDA 4HYUA 5JQ5A 3TNHA 4JRVA 5BYLA 4UMTA 3TV4A 1BLXA 5HO6A 5J7BA 4P90A 3ZBFA 5L2SA 3VWAA 1LUFA 4FNYA 3NR9A 3PUFC 5E91A 4FSUA 1W2FA 3A61A 3A7GA 3GI3A 3O50A 2GS7A 2W9FB 3HX4A 4PTCA 4YLKA 3FZOA 4XG9A 4ZY5A 1CKJA 4JRNA 4X3FC 3W0SA 3B8RA 2J4ZA 3GU7A 5F1ZA 1OI9A 4AOTA 1PYEA 3P79A 1YHVA 1ZZLA 2W1DA 2UW0A 3S3IA 2PVMA 3QWJA 5IQCA 2CNUA 5EI6A 4G5JA 2C1AA 1NVQA 2FSLX 3EHAA 3B2TA 4AW1A 4JNWA 4JMQA 4JOAA 5EHYA 5CEPA 2VD5A 3ZUTA 4B8MA 2V0DA 3OBJA 1L8TA 2ZMCA 3SQQA 4USEA 4FV1A 1EH4A 4DGOA 5IA4A 3UIUA 3RWPA 3H4JA 3C4EA 2QVSE 1XH7A 2C5VA 4L43A 5CQUA 5M06A 2EXCX 4MXXA 3LFDA 4CT2A 4I92A 4RIWA 5J95A 4DBXA 5HCXA 2Y8OA 5ANKA 4U80A 3R7IA 3WARA 5AA9A 5JFXA 3OEZA 3PA5A 3R01A 1CMKE 3JYAA 3Q04A 1B39A 3QZIA 2Y4PA 4ORKA 4O0XA 4ZS4A 3PJ3A 3SW4A 3CQWA 5I0BA 3D2IA 4E6CA 4O38A 4J8MA 1B6CB 4RIXB 2XALA 2W9ZB 3BBWA 5E8UA 3W32A 1B38A 2CGUA 5CSHA 2A2AA 1UU8A 1GJOA 5EDPA 4AG8A 3Q4CA 4E26A 4TT7A 3QLFA 1E1VA 3R63A 2V62A 4L7FA 3LIJA 4C61A 2RG6A 3R1QA 1NA7A 4AT3A 3QCSA 4GT4A 4F7NA 4FKIA 3KXMA 3ZDIA 3ETAA 3R8LA 4UALA 1J7LA 1PY5A 4KIPA 2CKEA 5KHXA 1ZYJA 5E8WA 2B9FA 3AC5A 1PHKA 4JBVA 4YZCA 4R3CA 4P5ZA 2BRNA 2JDSA 2JIIA 4S34A 1PRYA 1Q3WA 1PMUA 2XP2A 1VEBA 3PVUA 2WMTA 3FZSA 4D5HA 3QQGA 5IMEA 2PMIA 2CDZA 3QRKA 1OL2A 4A9RA 2ZB1A 3FY2A 4QNYA 5M44A 2YHVA 3R02A 5EM8A 4BGQA 4KBKA 5JQ8A 3KIOC 1ZMWA 5DG5A 4IM3A 4X3FB 4HPUE 4MD9E 3L9PA 4ZSAA 5C1QB 1WBWA 4Y73A 4IB0A 3RAWA 2PHKA 2VTNA 1IASA 3CY2A 5ANDA 5DT0A 1YOMA 2W4OA 4CSVA 3QAME 4ASEA 4ACDA 5K0KA 4MHAA 2PVRA 2BPMA 3ET7A 4OBOA 5GZ8A 2B9JA 2BIYA 4BBEA 3K3JA 3ZC6A 5AP2A 3IPHA 3LXLA 3VUKA 2WPAA 2WMWA 1V0PA 4M69B 3PXFA 4UY9A 4FJVA 3A99A 4XG7A 4BCQA 1TQIA 2GQGA 3HUCA 3LFNA 3D9VA 4AW5A 1VJYA 3Q2MA 2VTHA 3VS3A 2C3LA 5HNIX 3N4TA 2VU3A 5HNBA 3ORTA 4AT5A 2W96B 3G90X 2J0IA 4TYEA 1URCA 4GEOA 4ENXA 5CAVA 3AC4A 2XVDA 4AXDA 3RPSA 4HGLA 2OZAA 4YPDA 2FA2A 3C4WA 4QTBA 5H3QA 3RKBA 4BWPA 2JIUA 4EOMA 4U6RA 3IS5A 5ETFA 1F0QA 4PTEA 3QFVA 4I4EA 4E4LA 5HU9A 3ZM9A 1OKZA 3AOXA 3UDTA 4M84A 4TYHA 3TZ9A 2VTSA 2QHMA 4JQ7A 5GZAA 1JBPE 4J96A 1WAKA 4FT0A 3MJ2A 5A4CA 3DBQA 3EWHA 2C6TA 1OB3A 1DAYA 2WMBA 4UB7A 2XJ1A 2DQ7X 2OIQA 3AC8A 3DLZA 3HLLA 3GBZA 5FTQA 2ZVAA 4RG0A 4U3ZA 1XMLA 4QPSA 3PP0A 5EG3A 1T45A 5CTPA 3R73A 4DLIA 4ZZOA 2ZOQA 3ALOA 3R30A 4FT3A 4RVLA 5EW9A 4BBMA 4O81A 5J7HA 3LZBA 1S9JA 4C7TA 3ODYX 4M7IA 2GTMA 3MESA 4FTJA 4FGRA 5J5TA 2PMOX 3SXFA 3O5AA 5KMKA 3RAIA 3PXKA 4I5MA 3FMNA 3R00A 4YO6A 3EQHA 3FQHA 2W1ZA 3FZRA 3LJ1A 4G3FA 4FKOA 3ACKA 5FM2A 3A4OX 2JDRA 2IVTA 4Q5HA 1ZYSA 2W05A 4AFEA 4Z16A 4OTPA 2XAMA 2G2IA 3VAPA 2GFSA 2YZAA 3FY0A 3TTJA 3MDYA 4DEGA 4EHGA 3EQRA 3C0GA 3MGYA 1YDSE 2FSOX 5JRQA 4O6EA 1U4DA 1H4LA 4XMOA 3WE4A 4C38A 5HIBA 1YI6A 5LXMA 4GG5A 4NYEA 1O6LA 2WD1A 3UG1A 5D12A 5A3XA 4ZTSA 3N51A 4M0ZA 3C9WA 4RGJA 4RPVA 3UIXA 5M08A 4TYIA 2I1MA 5CLPA 2JC6A 2VGOA 4FKUA 1E1XA 4JDHA 3G33A 4PUZA 3PYYA 4CQGA 3ERKA 3RK9A 1W98A 4NKAA 5DRBA 4IAAA 3UO4A 2C6EA 4LUEA 1OBDA 4BZNA 4E6DA 4XG3A 1HCLA 4CXAA 3TMOA 4ANSA 2Z60A 3BGQA 3KK9A 4FYOA 3UTOA 1ZMVA 5HTBA 4NSTA 3ZU7A 2XRUA 4NCTA 2IG7A 4IC8A 3R0TA 2PMNX 4N57A 5KZIA 1SVGA 2JBOA 3ZEWA 1M52A 2W5HA 3CTJA 4QMSA 3S95A 1SMHA 1BX6A 2WTIA 2GHLA 3Q4ZA 4DGGA 2J51A 2Z2WA 3Q96A 5HG8A 2ETMA 2P3GX 4L68A 5L8KA 3EQCA 4Y5HA 1H00A 5CU4A 3N4VA 3FWQA 5D9HA 3SVVA 3IKAA 3JPVA 4G17A 4D4VA 2X0GA 4M12A 4OTQA 4AOJA 2UZWE 2OH0E 3F7ZA 5CVGA 2R7IA 3UVQA 4AZSA 4O0TA 2YAKA 4C58A 4QDVA 2X8IA 2IW9A 2OU7A 4BKJA 5EYMA 4F99A 4YU2A 1YI3A 2WNTA 3FMHA 4FSZA 4O4DA 4EK4A 4IZ7A 5AMNA 5HESA 4BDKA 4KKHA 5BX0A 4A07A 4FTTA 3RGFA 3UDBA 4BZOA 4AAYA 2A0CX 2VNWA 1U54B 2V7AA 3COMA 2YM7A 5IZFA 1W2CA 4J95A 3VBTA 4C35A 4FNXA 2YM4A 3VF9A 4F4PA 1APME 5A4TA 4G31A 4I93A 5DA3A 2XM8A 3TZ8A 3ZRKA 2J5EA 3QRJA 5CT7A 4MBIA 4WT6A 1VYZA 2X1NA 1Z57A 4X21A 4Z3VA 2GDOA 2WU6A 4KRCA 3FYJX 2ITOA 3CJFA 3UDSA 3LW0A 3IGGA 2IJMA 3CXWA 4DHIB 2ITTA 4FGBA 5CS6A 4IB3A 4PMTA 1PKDA 5EYCA 4L01A 5CYIA 3UJGA 4MXYA 3MFRA 4UMRA 4YJTA 3ROYA 2IO6A 3BE2A 2YDJA 4JS8A 2HWPA 3IOKA 4YJOA 3RPRA 3R9NA 4GVAA 1YVJA 5GINE 2WO6A 3R22A 4OUCA 2ZB0A 3AQVA 2PUNA 2PVKA 2ZV7A 5IUGA 4I5HA 4FV9A 4L67A 2QG5A 4ZOGA 5JZNA 2A27A 3ZO2A 4DG3E 3KFAA 5M4UA 3OWKA 2BRMA 3GU4A 4RRVA 2GSFA 4W8DA 5AAGA 5DI1A 4QTDA 3HKOA 4JDKA 3PA4A 4C2VA 3OWJA 4LYNA 5F95A 3NFGB 2CSNA 2IW6A 4RJ7A 5CF6A 4BCKA 1V0BA 4YC3A 4GW8A 3FXZA 3UOHA 5LVPA 3OROA 4PF4A 3BYVA 4YSMA 3SOCA 3KREA 2QKRA 2XARA 3HMOA 4YO4A 2XEYA 3NNXA 3EZRA 3OT3A 2GNIA 5KBRA 5DR9A 3G9NA 4KKGA 3KN6A 2CN5A 3TTIA 3QA8A 2QC6A 2X6DA 5CU3A 3W2CA 3A7IA 3SW7A 2Y6OA 1Q8ZA 3KMWA 3NZ0A 5A4LA 5BMSA 4L3PA 5KCVA 3EFJA 2NYAA 4CRLA 2VWVA 2WQOA 4WA9A 2QURA 4AT4A 1JPAA 1Q8TA 2X4FA 3QC9A 4YJQA 5FXSA 4BCNA 3THBA 4HCTA 4L52A 1YWVA 3WI6A 3N4UA 3ANQA 3OG7A 2R3JA 4OAVB 4ANOA 1MUOA 3AD5A 3LAUA 4PTGA 4I23A 3FC2A 3KXHA 4AP7A 4C4JA 1A9UA 2Y4IC 5JKGA 3W2SA 4W8EA 2CGVA 3KRLA 3CSVA 4F7LA 1Q4LA 2ZV9A 5C4KA 4UWYA 2VTAA 4TKSA 3PY3A 4M69A 3IDCA 2EVAA 2ZMDA 4EH2A 4D2WA 2UW7A 2GNJA 4DFZE 4GG7A 2VNYA 3UIBA 2PL0A 2JD5A 3DK7A 5L2IA 3LLAA 2BFXA 3MVLA 4YLLA 2PULA 3PSDA 3VHKA 3KXNA 5IA3A 5IU2A 4FEXA 2WAJA 1WCCA 4O0SA 5C8NA 5AUVA 5KMMA 2C6OA 3NRMA 3OCSA 3Q53A 3MVJA 4RJ4A 4TTHB 3MWUA 2XBJA 4DT8A 3DB8A 4FTQA 3GC9A 2VO3A 1JKTA 1W83A 2HAKA 3PPZA 3PWDA 4WUAA 3TV7A 3ULIA 3R8PA 4BHZA 3VW6A 4IDTA 3O8PA 1TKIA 3F69A 2HZ4A 2YDIA 2PYWA 5A6NA 1QCFA 3PG3A 2CCIA 5C4LA 3FBVA 3UYSA 4JJRA 2JFMA 4EH5A 5HE1A 4RWJA 5LVMA 2WQMA 4MCVA 4I41A 5K4IA 4UYNA 2BDFA 4WD5A 4AN9A 3QUDA 4EJNA 4BF2A 3V5JA 3QYWA 5M4IA 3VUDA 1DM2A 2YCFA 1Y6BA 4F0FA 4QP6A 3OW3A 3F2AA 1CKIA 2R3HA 5G1XA 4MF1A 3HV3A 3PIXA 4IX4A 3UOKA 1TFFA 1LEZA 2ERZE 2GS6A 2UW6A 2C0IA 3R7GA 1KV1A 1UNGA 2X8DA 4JI9A 4L3JA 4AZTA 4BTKA 1SVEA 3O2MA 5BVDA 4IZAA 3V01A 5DR6A 5C01A 2XIKA 3T3UA 3FXXA 2QOKA 4CG8A 4F7SA 4Y5QA 3F3UA 3I60A 5E7RA 4O2PA 5T6KA 3VNTA 4O7RA 4LG4A 5BPYA 5FGKA 2DWBA 3E64A 4L44A 1XBBA 2JKKA 2YWPA 4DHZA 3DV3A 5A54A 5FTGA 2O5KA 4HGEA 1WVYA 1R39A 3NUYA 5JGBA 2CNQA 3RAHA 2GHGA 5GIOE 3LMGA 4NM5A 4BI0A 3OMVA 4LFIA 4BCJA 3UP7A 2UUEA 5JSMA 2WMXA 2XRWA 2UZBA 4AN2A 2YISA 3UIMA 4RFMA 3ZLXA 3CPCA 3E5AA 5FEDA 4DG2E 4ONAA 2IVSA 4L42A 3VF8A 3VUHA 3RTPA 1Y8GA 2ERKA 3P86A 2WTVA 4KINA 4U44A 3UVRA 1GAGA 2QQ7A 2VTLA 4M66A 2JITA 5FM3A 4X2KA 4OBPA 4FTMA 4O2ZA 3VUMA 3DAJA 2OJIA 2W1CA 5KNJA 4CFXA 3DDPA 2Z7RA 3FLZA 2WTKB 4OTHA 4RZVA 3OEFX 4FTIA 4R1VA 2XK3A 5HGIA 3LPBA 5AR2A 5CVHA 3ATSA 4FEUA 5ANJA 3V51A 3CR0A 4EBVA 4GJ2A 3PFYA 4USDA 4Y46A 2X7FA 1IG1A 3IGOA 3OWPA 4AUAA 2KULA 3P0MA 4A4LA 3MVHA 2I0YA 2JIVA 3RZBA 3H9RA 5HX6A 3TKHA 2YN8A 4BHNA 4BIDA 1FOTA 4ASXA 1FVTA 2FH9A 3QU0A 1YXUA 3RPVA 3CE3A 3H30A 1H1RA 1AQ1A 4RX8A 4EH7A 3FPMA 4RIYA 3LFEA 2BRBA 4WIHA 4D1XA 4O82A 2YCSA 3R6XA 3BGPA 4A9UA 5M09A 1J91A 1Q61A 4WRGA 4FUYA 4Y95A 3MFTA 3TJDA 5ICPA 2P33A 1GZKA 5CEQA 4IX3A 3VS2A 4B6LA 3L9LA 3BL7A 2ZJWA 4RIOA 3WZUA 5HG9A 3FMDA 2Q0BA 3C51A 3JY9A 2CGXA 3BGZA 4XG6A 3PWYA 3OUNB 2WU7A 4LL5A 4Y83A 3GXLA 2UW4A 4M67A 2GPHA 5M56A 4RC4A 3EFWA 3O7LD 5DWRA 4JVGA 3RINA 4K1BA 3ORKA 4YJUA 3RAKA 5GNKA 3E8NA 3I7BA 5CSXA 3QXOA 3CQEA 3ZFYA 4G6LA 5BVKA 4CD0A 1W82A 3UNKA 2W0JA 4IMYA 4J98A 2PE2A 2QHNA 4XEYA 4NK9A 1XH9A 3POOA 4QP1A 2OO8X 4S31A 1ZOHA 2QCSA 3HDMA 5EI2A 3DB6A 5F94A 4O21A 1UV5A 4ZXTA 4DHJA 3QTWA 2J0MB 4EOPA 4EI4A 4A9TA 4JIAA 5AV2A 3ZUVA 4IIRA 5T3QA 5HVYA 4OLIA 4QMZA 2WZJA 3Q3BA 5IQIA 2VGPA 3HV7A 3AGMA 2PU8A 4FSYA 4FV4A 3QQFA 5FBNC 3EQGA 4ZTNA 4WG5A 3DT1A 3NCZA 1OL5A 4XLIA 2XK4A 2XKDA 1JLUE 2R7BA 5F4NA 5AX3A 1OBGA 4E1ZA 2OGVA 4KABA 3D94A 4OTGA 3QQKA 4F09A 1YOJA 2ITQA 3QHRA 3RALA 3RK7A 1STCE 2C68A 3LCTA 2C5OA 2ZAZA 3FSFA 4X2NA 2R3PA 4CZUA 3OXZA 4X6RA 5M57A 4F1TA 2ITYA 3HA6A 4Q5EA 3ZXZA 4F65A 4UMPA 5IQAA 2R3OA 5FP5A 4H05A 3PLAE 4LMUA 2O3PA 1SNXA 3EN4A 1WVXA 2C5XA 3COKA 3EKNA 3EQDA 4LQMA 4MD7E 3G2FA 3TACA 3DNEA 3QRUA 1MRYA 2J50A 3E3PA 2PZYA 5CAOA 4BR3A 5J87A 3BHHA 1RW8A 3D15A 2XEZA 5DT4A 3VS1A 3ODZX 3F2NA 1YXXA 1RQQA 1JSTA 5ANEA 4IJPA 4D58A 2W5AA 4IZYA 1BL6A 4FEQA 4FK3A 5C8KA 4NUSA 3PDTA 4BI1A 3MA3A 2QOIA 4DHFA 4CV8A 5DBXA 3GVUA 4ZZMA 4BCHA 1DI9A 2R3KA 1JKSA 3CD3A 4E7WA 4S33A 3BBTB 2X8EA 4C57A 3KCFA 4EHZA 3KMMA 5DFPA 2Q83A 4QP7A 2PMLX 4XRLA 3S1HA 3CGOA 4DITA 1ZLTA 5E8VA 4E20A 1MP8A 2QOLA 4NJ3A 1UA2A 3U6HA 1CSNA 5EYDA 4Q2AA 3GCSA 4LV7A 1GIJA 1VZOA 2Y0AA 3AC3A 4O1PA 5AUZA 4JL9A 2OI4X 3HGKA 2B9HA 2VWIA 3BE9A 4PNIA 3KL8A 4WG4A 4CLJA 4BJJB 2C5NA 3EIDA 2G9XA 3LM5A 4W4XA 1Q8YA 2EXMA 5HU3A 2X2MA 3BL9A 4YURA 4FSWA 5JH6A 4PRJA 3Q9WA 4EC8A 3JUHA 1BL7A 2CGWA 3IW5A 5AR4A 2DUVA 4UN0C 5FDPA 1KE9A 1YRPA 3IW4A 3MN3A 4N0SA 3A4PA 1QPCA 2ESMA 3DBEA 4FNZA 5IH6A 4QMXA 5BVFA 4O27B 2BZJA 5DPVA 5CSVA 4F9BA 3VS4A 3MB6A 3WIGA 3FV8A 2QI8A 2B9IA 2UZEA 4G6NA 4EOIA 5J9ZA 5CWZA 3NW5A 5DE2A 5E8ZA 1SYKA 3KKVA 3E92A 5K5NA 1WBVA 2Q0NA 4H1MA 3W2RA 3DA6A 3FXWA 4X7QA 3FKLA 1MQBA 3F3WA 3K5VA 4BKYA 3QC4A 3QQUA 3E88A 3DQXA 4E3CA 2JBPA 2I6LA 4LV5A 2XANA 2X0OA 3QTXA 2C4GA 4U5JA 4F78A 4AZVA 4MQ2A 4BTMA 4IVDA 2H6DA 5FTOA 1G5SA 4XG2A 5HVKA 2HW7A 3UPZA 5ACBC 3QTQA 2WTJA 1JAMA 3A2CA 1ZARA 2C5YA 3BYOA 2QOBA 3MSSA 4RZWA 4AN3A 1FVVA 4BCOA 3MTFA 1M7NA 1ZY5A 4L45A 3PY0A 2J7TA 5IA1A 5JFWA 2J6MA 4EZ7A 1I09A 2WOUA 1WBOA 4U9AA 2YAAA 4UMQA 4GYGA 1J1CA 5LARA 3BPRA 4ASDA 4DEAA 2YACA 5J9YA 3C13A 3FMJA 4FIFA 4IAYA 5TT7A 3OZ6A 3TXOA 3ZO4A 4F6WA 4UEUA 2C47A 2ZV2A 5CI6A 2F57A 5HQ0A 1AD5A 4PMMA 4MUQA 4DE4A 3W2QA 2YM5A 4KA3A 3ZZEA 1PMNA 5CZHA 5IDNA 3FLNC 2J0KA 1OMWA 4IB1A 4EZ5A 1OL6A 4FV6A 3G6HA 3UZTA 3W0NA 2QNJA 3LHJA 1BMKA 4EOSA 4O7WA 4FIIA 4FRFA 1ND4A 4EYJA 3KGAA 1KSWA 4RT7A 4AW0A 3U54A 2VTRA 4BDHA 1NT2A 3PUPA 4BDFA 2FO0A 2QD9A 4EOKA 2OK1A 3C50A 4XS2A 4F7JA 3KC3A 3W55A 1DI8A 5E4HA 5DHJA 4GL9A 2B0QA 4E4MA 4FG8A 4EUUA 4YZBA 5BYYA 3VN9A 2A19B 2H96A 3FKNA 5ACKA 3ZFMA 2QR8A 4U81A 3PJCA 3C4XA 3BYUA 4MBJA 3KXXA 3E93A 4YP8A 5CF8A 2B52A 3QTZA 1SZMA 3BEGA 4D2RA 3UOLA 1BKXA 4MVFA 4QTCA 4U41A 3NNUA 4W9XA 2OFUA 3NIZA 4NTTA 1ZMUA 4BDDA 1F3MC 4F70A 4C4IA 5A4EA 2XM9A 3F5GA 5ITAA 2B1PA 1SVHA 3QCYA 2B4SB 4APCA 5KKRC 5TE0A 2QO7A 4AXAA 3DY7A 4IFGA 2V5QA 2BROA 4KIKA 2HELA 4NCTC 4PPBA 3EB0A 4WBBB 2W06A 2WQEA 4F9YA 3D4QA 4IAFA 4NZWB 4EWHA 2OFVA 5E92A 4E5WA 4EWQA 2C1BA 4BTFA 4WNOA 5CQWA 3QD0A 4QO9A 4AA4A 4D4SA 3W1FA 1L3RE 5BUJA 1P4FA 4EONA 5IH4A 4JT3A 4W9WA 3Q32A 3QD4A 4LOOA 3DTWA 2BZKB 4FK6A 1GZOA 2UW9A 4G16A 5HORA 4IBMA 4NFNA 4IVAA 2YIRA 3JS2A 2F9GA 3DNDA 1VYWA 2RG5A 2ZM4A 2BIKB 3RP9A 3UE4A 5DMZA 4IAKA 3CKWA 3OY1A 3GNIB 2RL5A 3U9CA 3BLHA 1V0OA 4QOXA 4D0WA 4QMNA 5IUIA 4BJJA 3AXWA 4CFUA 4GS6A 4D9UA 1PMEA 3Q60A 2BUJA 1PXKA 2JDVA 3FC1X 4LRJA 4Y85A 4EK8A 4PQNA 3K3IA 5LJJA 3IOPA 4YNEA 1FINA 3CEKA 4DA5A 3C1XA 4IJ9A 4R3RA 4I6LA 1ZZ2A 2QLUA 4GJ3A 2XAOA 5CI7A 4ZEGA 4H36A 3IECA 1KE8A 3MW1A 4FX3A 1UNHA 4O6LA 3LMHA 4FZFB 5HKMA 4X0MA 4JLCA 4AQCA 2OKRA 1M7QA 2OIDA 3OTVA 1W84A 3E3BX 4FT5A 4O91A 3V8WA 4JAJA 5JZJA 3NVMB 4XH6A 4YJNA 2O63A 5IA5A 2F2CB 3QQLA 4EH9A 4B9DA 4DINA 4GT5A 3FLYA 3DDQA 1YWNA 3HRFA 3UQCA 4WBOA 3C5IA 2QONA 4FV0A 3FHRA 3UYTA 3ZFXA 3D83A 2OXXA 3LXNA 2BKZA 3FI3A 3F82A 3DOGA 4U97A 4CRSA 5BUIA 4BDCA 4RWKA 4CCBA 2F7ZE 3UQGA 2HZIA 5KX8A 3NUXA 4II5A 2H8HA 4I0RA 4YGAA 3NX8A 3RVGA 4C4HA 4F6SA 5HLWA 1ZYCA 1NVSA 4PP7A 3FL5A 3NIEA 5CXZA 5HLNA 3LCKA 4FICA 4I3ZA 3V6RA 5I3RA 3HV6A 2RKUA 4FKLA 3S2PA 3H0YA 1RE8A 4FL2A 5F9EA 2X9FA 4UV0A 3W10A 1WFCA 4ANBA 5BQ0A 2RIOA 3HMNA 2QOFA 5HIDA 3R83A 4C59A 4F63A 4LGGA 4TWPA 4UZDA 3MH1A 3SAYA 3LJ2A 2VO0A 1OM1A 1URWA 3DU8A 4GK4A 1G8AA 2XIRA 2O64A 3FLQA 4MBLA 3RCDA 5EM7A 3GT8A 4KRDA 3VW8A 4CMTA 4FI1A 1OL7A 5CNNA 4L3LA 3A7FA 2EWAA 3RHKA 1GNGA 4ZJVA 4DG0E 2H9VA 5L8JA 4B99A 4P4CA 5FDXA 4PP9A 5AP0A 4D0XA 3FMLA 1AGWA 3L8PA 3TV6A 3ZMMA 1OUYA 5CF4A 2CCHA 4B0GA 4DH3A 3R8MA 2VAGA 2YCQA 3CC6A 4FVQA 5EH0A 4HVGA 3A7HA 2GNLA 4FEWA 1W2DA 1S9IA 4GFMA 1GZNA 2BHHA 2R3FA 3DBCA 4RX9A 3VBWA 3H0ZA 3PZEA 2BZHB 5EW8A 2CKOA 2YIWA 4FKGA 4AW2A 3NYNA 4J1RA 3CY3A 4PPCA 4DFYA 3R7VA 5BVNA 2PZPA 2X6EA 3OCGA 4CEGA 2XB7A 1ZY4A 5AV1A 4L8MA 1UWJA 3VS7A 2X7GA 5EKNA 4HYSA 2XNBA 4BI2A 3ID6C 5TKDA 3GGFA 3ANRA 3CPBA 1YKRA 1YHSA 2CPKE 2QO9A 3F6XA 4ZSGA 4M97A 4XP0A 3JXWA 1G3NA 2UZTA 4QP8A 4AE6A 3PJ8A 3R7EA 3NUPA 5HBJA 3ELJA 1P5EA 3FI2A 2G2FA 5TO8A 3OUKA 1XH5A 5IQHA 4J99A 4U42A 4MKCA 5FD2A 3MPMA 4OT6A 4FODA 4KUJA 2VZ6A 3SGCA 4X2JA 3EMGA 2YITA 3NUSA 3D2KA 4F0IA 4A9SA 2VX3A 3OVVA 4OTWA 3COIA 5IEYA 3QKLA 4LV8A 4WSYA 3ZC5A 4BCPA 3I5ZA 1RJBA 2PVHA 2WMRA 5E8SA 4QMOA 4IDVA 4L53A 4RIXA 4PL4A 1JQHA 3WIKA 2X2KA 3W0RA