4U40A

Mitogen-activated protein kinase kinase kinase kinase 4 (map4k4) bound to amppnp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
SLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Structural Plasticity and Kinase Activation in a Cohort of MAP4K4 Structures
rcsb
source organism Homo sapiens
total genus 88
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u40A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u40A01
2PMIA 4WNMA 4V0GA 3P9JA 1JVPP 4ZIMA 4KD1A 5TE0A 3OEZA 3IG7A 4IWQA 4G6NA 3UIBA 2FSOX 1DAWA 3ZRKA 2BVAA 3LQ5A 3UYSA 3D5XA 4ERKA 2ZV8A 3VUDA 5IMEA 3ORLA 5TT7A 2YZLA 3C4FA 4AAAA 1YRPA 3PG3A 2FSTX 5HBJA 4FV3A 4AT5A 3PJCA 1FVRA 5FDPA 4W9WA 2XP2A 4ACCA 3C9WA 4U44A 1O9UA 4BCPA 2C6DA 2BMCA 5IDPA 3C4CA 4K8AA 2CCIA 4JQ7A 3QC9A 5AV2A 5CVGA 4Y46A 4CZTA 4NH1A 3VBYA 5HCXA 4EOMA 5A46A 4EK5A 3EQPA 5DE2A 3ATSA 3IW6A 4QMYA 5C9CA 3R9HA 4LRJA 4Q9ZA 4G5JA 4OGRA 4FF8A 2EWAA 4PMMA 4JG7A 3LHJA 2PMOX 2OG8A 3GU7A 4OTQA 1CDKA 2R3QA 5AP0A 4AW0A 3BZ3A 4GG5A 4ZP5A 4YLKA 4C2VA 5AA8A 3QTSA 4KIKA 3PA4A 4XJ0A 1FBNA 2GSFA 2WU6A 3GU4A 2C68A 2VX0A 1IASA 4ERWA 2QR7A 4AA0A 2PY3A 4B99A 2BROA 4OW8A 3A7IA 3QZGA 4UB7A 3TTJA 3R9RA 3NUSA 2R3HA 1LUFA 3D7TA 4XV3A 3W55A 4ACHA 4R3RA 4HCTA 2FVDA 3ELJA 4UWYA 4CZUA 3F2NA 3FZPA 2QR8A 3O7LD 4FK6A 4FT0A 3GC9A 2PVJA 3ODZX 3HAVA 1U5RA 5AR5A 4B4LA 4Y5HA 5LOHA 3TIYA 2Y6MA 5I9UA 2ERZE 4QMQA 2YJSA 2VTRA 3TNIA 3E62A 2Y7JA 2WHBA 4ITIA 4X3FA 1DS5A 4DEGA 4U0IA 3QFVA 3SAYA 4BBMA 3PTGA 3FLYA 4O0WA 3FI8A 4Q2AA 4B8LA 3VVHA 2FGIA 3TDVA 3PVBA 4EK6A 4O84A 1PXPA 2R3OA 2PUIA 1OL6A 1W8CA 1OL5A 2OW3A 4ZMFA 2WQOA 3CJGA 4F6WA 5LMAA 2BKKA 3Q4UA 2ESMA 3OTVA 5AUYA 4EQMA 5CT0A 2ITQA 3NRMA 3EKKA 2FB8A 2REIA 3NSZA 2YIWA 1OIRA 3DZQA 1MQ4A 1YKRA 2V7OA 5JFVA 4O0TA 4P90A 2WU7A 3QRJA 5FLFA 1J7LA 4FV6A 4ALUA 2QU6A 4AZEA 2YABA 3R8VA 4WT6A 2BFYA 2C5YA 4IAZA 4A9YA 4UMRA 4BGHA 4IMYA 3LFEA 3K5VA 4NSTA 3A62A 3H0YA 3EFJA 4XX9A 5B2LA 2B55A 3FC2A 3NUNA 1R0EA 1Q24A 3EN6A 3GC8A 4RVMA 2P33A 3FKOA 1CTPE 2X1NA 3FXXA 1P2AA 3HLLA 5AV0A 4KNBA 5EI2A 2O65A 4D4RA 2WTDA 2WMXA 1R1WA 2YIQA 1NVQA 2GNHA 3T9TA 1RJBA 4CMTA 4ACDA 5KCVA 5L6OA 4EBWA 4FKRA 3ET7A 3C4XA 2GS7A 4NFNA 5CEOA 1OI9A 3R30A 4E93A 5JMSA 2IZSA 4BWXA 4OTGA 3GFEA 2RL5A 3MSSA 3QQGA 5B7VA 2GDOA 2XCKA 1ZAOA 4X2JA 1SNXA 3MY5A 5EHYA 4D55A 5BX0A 4FKTA 4C0TA 1H01A 1JKSA 3V8SA 1WBTA 3BIZA 1J3HA 3R83A 4KB8A 5HOAA 4YJSA 5CQWA 3VNTA 3R8ZA 4C3PA 4R1VA 2YAKA 2PE0A 4E6AA 4LMUA 3AMBA 3VN9A 5K5XA 4YJRA 5AP4A 2DYLA 2XNNA 4BCHA 5CF5A 3NAYA 3VBXA 2ETRA 2QOLA 5KMOA 3QQUA 4FEUA 4QQTA 2GNLA 1Q99A 4RFZA 3QCYA 4XV2A 5FQDC 3E8DA 2OIDA 4FT9A 2BRBA 3S4QA 4D1SA 4F7NA 1AQ1A 2ZDTA 2UW3A 4GRBA 3V3VA 3VHKA 4AXAA 5IQDA 5A6NA 2OO8X 4IC8A 4ZSJA 4AOJA 4NM3A 4FTIA 2HAKA 3HRCA 4G17A 3FHRA 3RPOA 2HCKA 4S2ZA 3BLRA 4PDYA 2JDSA 3DLSA 3KXXA 4M14A 4NM5A 5D7VA 2OJJA 5FBNC 1B39A 5ACBC 4DE4A 3ORMA 2C3LA 3QX4A 5FXQA 5EG3A 4C61A 4PUZA 4RVLA 2VWXA 2XEZA 3LCOA 3PVUA 5C01A 4AA5A 2QCSA 3E8EA 2VN9A 4KSPA 4MD7E 2JDOA 3AC3A 4BZDA 2OZAB 3KRLA 1GZNA 1J7UA 3QCQA 3BYSA 4IZ7A 4G3GA 3KY2A 3NYXA 3CY3A 3A4OX 2HY0A 3DKFA 2R3IA 3GCUA 1YXTA 3Q04A 3R7EA 3U87A 2IZTA 2PMNX 3ETAA 4FL1A 2VX1A 3H30A 3RM7A 4QQJA 4MF0A 3PJ3A 1WBWA 2V62A 5EYKA 2BILB 4HCUA 5IQAA 4CLJA 2E9VA 4PP9A 3QF9A 4U3YA 2NNWB 3PXFA 4DCAA 2WO6A 1KE6A 4E26A 4EHZA 2RFSA 3OBGA 2F7ZE 3MIAA 3AD5A 4ZJJA 2QOBA 4EK8A 4FTQA 5E8WA 1L8TA 3PDTA 4I5HA 3KMMA 5IDNA 3GCVA 4GV1A 2CKQA 4I0SA 4KWPA 5HLNA 3PWDA 2C69A 1I44A 4C4HA 3DJ7A 4G9CA 2WTKB 5EI8A 3KK9A 1FVVA 2J9MA 2X6DA 3R9DA 4JAJA 4JDJA 3D0EA 5CI7A 1OB3A 2R2PA 4G3DA 4X2FA 5CENA 5BVFA 3Q96A 1WBVA 2X4ZA 3PXKA 4IX6A 3SG9A 1Q41A 5LMBA 4FIIA 4GK3A 1JQHA 5LARA 4PNKA 1ZMWA 2A0CX 3ZBFA 5GIOE 4QMUA 4IB0A 5IA4A 3R7GA 3W16A 2PULA 2XNOA 4D4YA 3P7CA 4RX8A 2XRUA 4AFJA 4D0XA 4O7TA 4DTKA 3COMA 4CLIA 3SC1A 4DINA 5CF6A 2BFXA 4O1OA 3GC7A 3AMAA 2A4LA 4FT3A 4ASDA 4IH8A 3FLWA 3IECA 1ZARA 1Z57A 3BYVA 2VAGA 2OIQA 3BQRA 5KMLA 2V5QA 2B53A 3LIJA 3JY9A 3FYJX 2YWVA 4KS7A 4EH2A 2G2HA 4NYEA 5HBEA 1Q8ZA 3FV8A 1BX6A 2OH4A 4BDJA 3D94A 4QQCA 4BY9E 1BL6A 5EDQA 4APCA 4ZS4A 2PVNA 5I9ZA 3PLAE 3DB8A 4USDA 3RI1A 3WIKA 4IM2A 4WO5A 3Q4TA 1XBCA 1XBAA 3NPCA 3TNPC 4OAUC 2B4SB 3RGFA 4DFYA 4GUBA 4YNEA 1XH7A 2I0HA 4M0YA 4TZRA 4AF3A 4BCOA 4KKGA 2DWBA 1OPJA 1WFCA 2XRWA 4GFGA 4MXXA 5ANGA 2XNGA 1PYXA 2IVUA 4XG3A 4XOZA 3O96A 5HD4A 5HQ0A 3MVMA 1LR4A 2OH0E 3L8SA 4BDIA 3NUAA 3Q9YA 4GH2A 1H1WA 3MN3A 3ZO1A 4BDCA 2P2IA 3PP1A 4IW0A 4Z9LA 3ZLYA 3QCSA 4E5WA 4IC7A 3HGKA 5JT2A 1YHSA 3EQBA 5DR2A 2C5XA 3C0GA 4AOTA 2B1PA 5H8EA 4XG2A 3V6RA 4BICA 3FE3A 4FT7A 4BB4A 4F7JA 1ZMVA 4G34A 3RK9A 4RC3A 4FI1A 3GGFA 3UOKA 3LKMA 3W32A 2WPAA 3KKVA 3Q4ZA 4O0YA 2W1EA 4BDGA 4O6EA 5E8TA 2CHLA 5DRDA 5E92A 4BF2A 4Q5EA 2I7QA 3WZJA 4AT3A 4MK0A 2W1HA 1KE9A 4TW9A 3QQFA 5A3XA 5E8SA 2WIPA 3V6SA 3BELA 2RKUA 3AOXA 3EQRA 3NNVA 1NY3A 3NYNA 3GU6A 4YR8A 5I9XA 3ENMA 2VX3A 3ORXA 1OBDA 2YCQA 3P79A 5KZIA 4UX9A 5D1JA 4FZ7A 2HELA 3VUIA 2WTVA 2C5VA 2X81A 4DEHA 3HMIA 1WMKA 3FMJA 4FUYA 3SDJA 3MW1A 3QGYA 5EHOA 4TNDA 4FKQA 1GAGA 2CN5A 4A07A 2Z7LA 4UEUA 4M7IA 3AT3A 4EC9A 5CF4A 4TYHA 1ZXEA 3C0HA 4O38A 5HE1A 1IAJA 3AC8A 4FTMA 4A4XA 3C4ZA 4I4FA 3DKGA 3Q9ZA 3P0MA 5HO7A 4IEBA 3VS5A 1IA9A 3NW5A 3E63A 1YOLA 3QHRA 1CKIA 2O63A 2PE2A 5JGAA 5CEIA 5IQCA 3LCKA 3LFFA 4O21A 4FSUA 4FC0A 3D5UA 2BRHA 5IZFA 4IDVA 1URCA 5AIRA 3OS3A 4J52A 4P7EA 3IDPA 3CY2A 5FD2A 2PK9A 4FKWA 3L9LA 1P5EA 2CKPA 1K9AA 3KEXA 1OECA 5BVEA 5I4NA 3MH0A 4UBAA 3ZFYA 1XH8A 4BYJA 3FY0A 2UVYA 1YDRE 2ZV9A 3BQCA 1Q3WA 4I23A 3BEAA 1GY3A 2Y8OA 4RIXA 3MB6A 3T9IA 2PE1A 4QP2A 1JKLA 3TKIA 3ZC6A 3VBVA 1OL2A 3OG7A 3JS2A 4IE9A 4PL5A 5CS6A 4GJ2A 3G15A 2CGVA 4O86A 4K18A 4JDHA 4NU1A 4KKEA 3EL8A 3T3VA 5FXRA 2PSQA 5HNIX 3OWKA 4QMMA 2JD5A 3OEFX 2ZM3A 4XRJA 4QNYA 4LQMA 5K0KA 3ULIA 4IIRA 2GQRA 2H96A 4XP2A 1RE8A 2WEVA 5AUZA 5IQGA 3EYGA 3KRJA 1Y91A 5D9HA 1BI7A 4N0SA 2A2AA 1UU9A 4PNIA 1J1CA 3L9MA 4AUAA 3CQWA 4E6CA 5IA1A 3U55A 2XK8A 3KULA 3DB6A 5DBXA 4IVCA 1OPLA 5EFQA 2JFMA 2GQSA 2R3NA 3RP9A 2KTYA 5AV1A 4YNOA 3UG1A 4OAVB 3KB7A 4JI9A 4JRVA 1PJKA 2Y4PA 3ZLXA 1LP4A 5CALA 3TNQB 4R78A 4QYFA 3HMNA 3SX9A 4CNHA 4L68A 4QP7A 4X6RA 1TVOA 3G6GA 2B52A 3ERKA 2XK4A 4G6OA 3UZRA 2VWZA 5AADA 3L8VA 4KRDA 3WE4A 4E3CA 5CANA 1LEZA 3IKAA 3T8OA 1Q8WA 3VW8A 3OWPA 3QLFA 4UV0A 4BHZA 5L2QA 4BFMA 5CI6A 1UU7A 2A19B 3W2CA 3O8UA 3OCSA 5I9YA 5AX9A 3LFQA 2YZAA 5BVWA 2EXMA 2P3GX 5FTOA 2XIKA 2YLFA 3S2PA 1YW2A 4GUEA 4YJQA 4OLIA 3PIZA 4QYGA 5IMXA 2E9NA 3C5UA 2X7FA 3B8QA 3Q6WA 2X8DA 5F94A 5CU4A 4MBJA 3NX8A 4G5PA 4DH3A 4F0IA 4FG9A 3RK7A 3MI9A 4FTJA 2UZEA 3BYOA 2C1BA 2B9IA 3Q53A 4YHFA 2C6IA 2WTCA 3ZZEA 5J79A 2JC6A 3COKA 4MCVA 5HHWA 4RIOA 4C59A 4D5HA 4HPTE 4BIBA 4JBPA 1R0PA 3QWKA 3KREA 5HX6A 5EYCA 4IZYA 3NZ0A 4RWIA 3CEKA 1UU3A 3RAIA 2PZ5A 3OBJA 4C35A 4UWCA 3NEWA 3QLGA 4XEYA 5EM5A 3GT8A 5FUTA 4QMZA 4NM0A 1RW8A 4GCJA 3ZUTA 4MH7A 4LI5A 2W1IA 3FZRA 3SOAA 3HV7A 5EM6A 4Y8DA 4MWIA 4WG3A 5DEWA 5IEXA 4R7HA 3P7BA 1IA8A 3SG8A 4IVDA 4YSJA 3L1SA 3UDBA 2ETKA 4TY1A 4YZCA 3SHEA 4F4PA 5JGBA 4FKGA 4FR4A 3FLNC 3TDWA 5L2IA 5M4IA 1MQBA 5ICPA 3OF0A 3QYWA 4RLKA 3FYKX 1J1BA 3MV5A 3JVRA 2J90A 4QMNA 2ZV7A 5AV4A 2IWIA 3MVHA 3WZEA 4IANA 4RJ8A 5B2MA 3JY0A 3M11A 3R28A 3IPHA 4J71A 4XUFA 4DT9A 3F7ZA 3W8LA 1XWSA 2C0TA 4XHKB 3FLZA 3R7UA 5DR6A 4B6LA 1TQMA 2VTOA 2W9ZB 3QQJA 5FM3A 1YI6A 4LUEA 4M15A 5J87A 5HZNA 3D9VA 3M42A 4UWBA 1U54B 3GOPA 4HVGA 4A9UA 4DG3E 3LFBA 4FKJA 2H6DA 2B7AA 4RIWB 1PKGA 5CU0A 5ETAA 4QTAA 3UIMA 4QPMA 5CU3A 2XBJA 3O7LB 4AN9A 5KMMA 4I0TA 3NDMA 2WOTA 3QTXA 4FBXA 4F1MA 4JG6A 1L3RE 5L4QA 3UZPA 1OKVA 2JKKA 3DFAA 5HNGA 5DT4A 1CKPA 3OXTA 3O17A 3LQ8A 1XBBA 4BGGA 4HVDA 4D28A 4WSYA 1OMWA 1NXKA 1K2PA 2WMTA 3G9LX 2ZV2A 4GW8A 4RJ4A 2HWPA 2BKZA 4EBVA 5CEKA 3SA0A 2CKOA 2BDFA 5IQEA 2WTJA 2YM4A 4F70A 4IVBA 4W4WA 4ZEGA 4IAIA 3RHKA 1GJOA 5CQUA 4ZJVA 2HY81 2NO3A 3DY7A 1VZOA 1V0BA 1H0WA 3KVWA 1W0XC 2WZJA 5KO1A 4DHFA 4OBPA 3LAUA 2QNJA 2ZDUA 4YZ9A 3LCSA 3TNHA 1SZMA 4AE6A 5AIKA 1YVJA 3QTIA 4BBEA 2OKRA 2P0CA 2XIZA 5CNOA 2UW0A 2YIXA 4RJ3A 3FY2A 1WVYA 4OT5A 5LXMA 4RZVA 3G5DA 4KBAA 3HRBA 1YXSA 4LL5A 5L6WL 5ANEA 2OICA 3GEQA 4USEA 2RIOA 2EXCX 3COIA 3GB2A 5M4CA 2QO9A 5I3OA 4NTTA 5ETFA 2XKDA 1YDTE 2RFEA 4FV4A 5J95A 3FHIA 5HU9A 3ANRA 4ZJIA 1RDQE 4YZMA 3ZBXA 5DEYA 2F7EE 4FZ6A 2GCDA 1MUOA 3WI6A 4MD9E 4RT7A 3VUHA 2IVTA 3HYHA 4KIQA 1HOWA 3TWJA 2XVDA 4ZMEA 2JAMA 2DUVA 4ZZMA 3U6JA 3QC4A 3LJ1A 4CYJA 2Z7SA 3Q3BA 4ANMA 4DT8A 1ZZLA 3A61A 2OJIA 4GT4A 4I94A 4ITHA 5E8VA 4EK3A 2XZSA 4QMXA 4CGAA 2QOFA 4N57A 3Q9XA 4O7LA 1R39A 3V8WA 1JSTA 2LGCA 3E7OA 5BVKA 3ULZA 3LFAA 3KF4A 2BZIB 3ZSHA 2XIRA 3Q2JA 4AOIA 3DBQA 3I5NA 4NK9A 3R8MA 2GS6A 4RIYB 4C3RA 4RIYA 4UZHA 5ETCA 3U8WA 4EH8A 4IAYA 1UKIA 4BTKA 3VBQA 1REKA 3HV4A 4EWHA 1Q97A 2FUMA 2RFDA 4C4JA 2IZRA 3RM6A 4LOQA 4DGGA 3VRZA 4FIEA 4FSMA 5K4IA 5CSVA 5CAUA 3PXYA 4QP1A 3NW6A 3NUYA 4G9RA 4MBIA 4I0RA 2YIYA 2X7GA 1WAKA 5TR6A 4O2PA 3KXMA 4AX8A 3F3TA 3UPXA 3AC4A 4TNBA 4ZTQA 4J99A 1ZOHA 3IOPA 1Y8YA 3UVRA 3ZOSA 3K3IA 4QP4A 2OJ9A 5KMIA 5KKRB 1UWHA 4J98A 3IQ7A 4FV2A 4X21A 3DAJA 4KIOA 3S1HA 3FZOA 3KGAA 3DJ6A 3LMHA 3FPQA 5JN2A 3PP0A 1OUYA 5KNJA 2XK3A 3QD0A 4KKHA 5LVPA 5J8IA 2UVXA 3L8XA 4WBOA 3R7OA 4EZ3A 4K6ZA 2WTWA 1P14A 5JQ5A 2BUJA 3NCGA 4A4OA 5CZHA 4FTKA 4RZWA 4FTCA 2YEXA 4QTEA 3LZBA 3KRXA 1YDSE 2FSMX 4ZY4A 2ITNA 4GEOA 5EKOA 4R7BA 5A4LA 5C4KA 3QRTA 2VNWA 2YCRA 4FEQA 4FKSA 4NW6A 1YQJA 3VBTA 5JZJA 4Z55A 1PXMA 3QZIA 5CY3A 3EMGA 5H2UA 2HW6A 4OTRA 2EXEA 2C4GA 1W84A 4R6VA 2C6MA 2UZTA 3LCDA 3MB7A 2I0VA 3HP2A 2BHHA 3HA6A 4JR3A 5C03A 1MRVA 3QA8A 4ALVA 1SVGA 4S34A 4YJUA 5DFPA 5ACKA 1OL1A 3UG2A 5LWMA 3ZH8A 1H26A 4OTFA 4E5AX 1O6YA 4EOQA 4RX9A 4UZDA 5DI1A 3NVMB 1G8SA 1GIJA 3C50A 2OU7A 2DQ7X 1JKTA 2CNUA 3UP2A 3R0TA 4PV0A 2UW5A 4FGBA 5A9UA 3P78A 3GQIA 4E20A 4J53A 3BHUA 4EOLA 1WCCA 1PXIA 4APPA 3G2FA 4E8AA 4YZNA 1CM8A 4L6QA 5A4TA 5HORA 3LQ3A 5CAOA 4DYMA 3QZFA 2ITYA 5AP3A 2YISA 1CMKE 1G5SA 3MVJA 3R7IA 4W4XA 2HZ0A 3BYMA 5C8MA 4DEDA 2PZPA 4NIFB 4EL9A 3FL4A 4F99A 2PUNA 2JKQA 3UZTA 4XMOA 4UYNA 2ITTA 2R3GA 4J8NA 4DLJA 4EHEA 3DK7A 3R71A 2WTKC 5FP6A 4AQCA 4MQ1A 2NRUA 4LOOA 4IADA 3FMHA 2VTSA 3EB0A 3VUTA 2VZ6A 4L3JA 4M97A 5AMNA 3MFSA 5BMMA 3L9PA 5CEMA 4LV8A 5M09A 3TJCA 4ANOA 3BU5A 5DT0A 1FMKA 2XYUA 4D4VA 4AACA 3AC2A 2CCHA 3OT8A 5KE0A 2HZ4A 1OGUA 4R3PA 3ALNA 4FNYA 4GL9A 4UMQA 5DVRA 3RMFA 2V7AA 1FGIA 1ZYCA 2UW7A 4RRVA 5IG1A 1PXNA 4AP7A 2VV9A 5AR7A 2J50A 4RBLA 5BNJA 3PA3A 2ITUA 3OUNB 3I0QA 3CXWA 3H3CA 5HVYA 5LVNA 1PMUA 3GUBA 3W10A 4O0UA 3F61A 4BDKA 2VUWA 4AZVA 3PUPA 1DAYA 1KSWA 2FO0A 4FVQA 4FKIA 4JL9A 3BHVA 5IISA 4Y95A 3JR1A 3PVGA 3ZU7A 2ZB0A 2XJ1A 4A9RA 1E9HA 3LMGA 3KXGA 5CAPA 1JSVA 3RCJA 4K0YA 4CTCA 5CAQA 5HIDA 5I3RA 3FWQA 2ZAZA 2W7XA 1F5QA 5L8JA 4BI1A 5BUJA 4FKLA 2H9VA 4KA3A 4RWJA 3H9FA 3I81A 5C27A 4XYFA 3KXHA 3N51A 5AR4A 4W8DA 5ANKA 4X7QA 4RJ7A 3BHHA 1Q8YA 3IW7A 4FSNA 3QTRA 4IJPA 1WBSA 5EW8A 2ZJWA 4PQNA 3MY0A 3RAWA 1SVEA 3NVKI 4IJ9A 4QYEA 2VO6A 4BBFA 2QKRA 3IOKA 3CE3A 1OPKA 4I6QA 4KRCA 3QKKA 4JIKA 1PY5A 3VS2A 3ZHPC 5A6OA 4PMTA 4TPTA 5IQBA 2ETMA 3GCPA 2PHKA 2E9UA 4KS8A 5CZIA 3U4UA 1YOMA 4BYIA 4L53A 2ONLC 3WZUA 4QP6A 3E5AA 3CIKA 3HECA 3QGWA 5HG7A 4PWNA 4QMOA 4BWPA 4FSWA 5LVOA 3QRIA 1UKHA 4RWLA 1NVSA 1YHWA 5EW9A 3N4VA 4ZS0A 3WYYA 4X0MA 2IW8A 5DIAA 3M1SA 3ORKA 3WF6A 3MVLA 4ENYA 4F7LA 3K3JA 2YAAA 3UQGA 4FIHA 3W2OA 1NT2A 2J5FA 4R3CA 3RWQA 3GOKA 4Q5HA 4C7TA 3VS6A 2ZMDA 5AP5A 5T68A 2E9OA 4LGHA 3G90X 4J7BA 2RG6A 3OW4A 4HYHA 2BAKA 2WXVA 3CQUA 3RJCA 1UWJA 4RX7A 4H1MA 4RA5A 3DOGA 3A60A 3V01A 3ZMMA 4GKIA 4YPSA 1ZYLA 3NNXA 5FWKK 5CVHA 3VBWA 3HVCA 3SV0A 3C13A 5CAVA 3OD6X 3S0OA 1WBNA 2QHNA 3EIDA 2G2FA 3QTUA 2PPQA 3LVPA 4G6LA 4XRLA 3HAMA 3QKMA 2OZAA 2VTMA 1S9IA 3BPRA 4AZFA 3PVWA 3OXIA 2OFVA 3VAPA 1JNKA 5HLPA 3N9XA 4GMYA 5AP7A 3UE4A 3BV2A 4IAAA 4DTAA 2B9JA 2J0JA 4RVKA 4MQ2A 3IDBA 4XCUA 1FINA 2QOCA 3VIDA 2W17A 4FNWA 3RNIA 3OOGA 1CKJA 2YWPA 2QOQA 2PZIA 3AG9A 1NVRA 4J8MA 3BGPA 3PZHA 4I4EA 4NJ3A 3P86A 3E92A 2BCJA 4YHTA 4AW2A 2O2UA 3OUKA 4OTPA 4HZSA 4FICA 1YI4A 3CTHA 4MKCA 3UVPA 1DM2A 4S30A 2XM8A 4L01A 3DK3A 4ZSAA 4AA4A 3IW4A 4ACGA 4G2FA 2LAVA 3ZM4A 5IA5A 4EK4A 5KX8A 2AUHA 5I0BA 4GK2A 4QMPA 3GC0A 4FL3A 4PDPA 3ZDIA 2R4BA 3WIGA 3FKNA 4K9YA 4DGOA 3FMLA 2F2CB 4ZLZA 3UPZA 1OUKA 2OFUA 3LFNA 4UXQA 1H1SA 3E8CA 3H9OA 4ZOGA 5KMJA 4EH5A 2CLXA 2UW4A 1PHKA 4U79A 1SMHA 4QNAA 3TM0A 3MH2A 2WTIA 3QCXA 5CWZA 5DPVA 5IKWA 4C8BA 3ID6C 3F88A 4YO6A 4YBKA 4NUSA 1F0QA 2QOHA 3VS3A 2ITVA 3EZRA 2W99B 5LCJA 4Z16A 2UZVA 4K11A 4ZSLA 3FQSA 5AFVA 4QP3A 3GQLA 3QKLA 5D10A 2J5EA 4FZDB 4LM5A 2VTTA 3ZO2A 3C51A 3ZTXA 4CYIA 4ASZA 4EH9A 3F5GA 2OZOA 2YA9A 3GU8A 4C37A 4W8EA 1Q61A 4D2TA 5E9EA 3FBVA 4HPUE 4JR7A 3NMUF 4L7FA 4FX3A 4XG6A 3OCGA 3R02A 3V5JA 1TKIA 4LGGA 3G0EA 4BRXA 1M2PA 3K5UA 3MPTA 5HICA 2R3LA 3CKWA 1JOWB 3LW0A 4XG9A 3LPBA 1FQ1B 1REJA 4JDIA 4FG7A 5K0XA 5KBQA 4DH1A 4YTHA 4O91A 5DOSA 3WBLA 2O3PA 3RVGA 2RG5A 2W06A 2GQGA 4QPSA 3VJOA 4BZNA 3ZC5A 3E87A 3MFTA 4CTBA 1JAMA 5GJDA 5CYIA 4AGUA 3BYUA 3IS5A 3COHA 5DGZA 3Q32A 5FDXA 4AS0A 4TYJA 4GFMA 5AM7A 4LRKA 4M3QA 2CGUA 4KINA 3ZEWA 2VTHA 3KRRA 3EFLA 4NTSA 4AT4A 1LPUA 3CD8A 2OF2A 4YSMA 5IF1A 2PL0A 3A7GA 3F3VA 5HESA 4FIGA 3G51A 2VGPA 1VJYA 1X8BA 2QOIA 3EQIA 2QURA 3HDMA 3QAME 1ZY5A 3A2CA 4WNKA 2JDRA 3H9RA 4DH8A 5AX3A 2ITPA 4EONA 1ATPE 1QPEA 3DK6A 3WZKA 3ZO3A 3LXPA 4Z7GA 5HU3A 2W1CA 5HCZA 3MY1A 3NCZA 4FA2A 4D2PA 5BVDA 3D7ZA 3MESA 3I1AA 2I6LA 4BTMA 1UNGA 2J7TA 5HVJA 4FVPA 4O7ZA 3KL8A 2PVFA 2YACA 4FTNA 5EH0A 3OC1A 5E8UA 4WHZA 3VS4A 4LRMA 4OBQA 3UC4A 4CFMA 4BDBA 4FZAB 3RHXA 4F08A 2J4ZA 2ZOQA 2W96B 4MXCA 5LVLA 4EOPA 2NP8A 4FL2A 3U51A 5JRSA 3ATTA 3ANQA 4JAIA 3PPJA 4BL1A 3E64A 5C8NA 4M13A 4DEIA 2OI4X 4IWDA 3MPAA 4GS6A 5FG8A 3I7CA 3BHYA 4ZTRA 1Q8TA 2C6OA 5HG9A 3QQLA 4MWHA 3NNWA 1WVWA 3PG1A 4HVIA 2XNBA 4YBJA 5BQ0A 4AZTA 3DQWA 3BWFA 4AGDA 3UTOA 3FZSA 3T3UA 4Y83A 5J5SA 5CSPA 3FEGA 4BVUA 3S00A 3EWHA 2C6TA 4D9UA 4LGDA 4D2WA 4E73A 4YP8A 4DTBA 3UO5A 2XS0A 3EQCA 3II5A 4TTHB 1VYWA 3Q2MA 5J1WA 3A99A 3P7AA 1BL7A 1H24A 3FUPA 1H08A 4IWOA 4FEXA 3RWPA 4I22A 3EYHA 4ZK5A 5J9YA 3BE9A 3FC1X 5J7HA 2PZYA 3VS1A 5M08A 1KV2A 4FIJA 3FSFA 1K3AA 3EKNA 2C3KA 3Q4CA 4M12A 4DFXE 3VRYA 5HI2A 2WGJA 4CT2A 4DAWA 5LMKC 3MFRA 4KIPA 1F3MC 3QD3A 1ZZ2A 3WE8A 4CFWA 2F49A 5AR3A 1FGKA 2WQNA 1JWHA 2OLCA 3HL7A 4RC2A 5E4HA 3DDQA 3VO3A 5E7RA 3MS9A 2OXXA 1P4OA 1A06A 3HKOA 1OL7A 3U6HA 5LWNA 4D1XA 2Q83A 4I5PA 4FKUA 2C47A 4J1RA 3RBWA 3FXWA 2AYPA 3DJ5A 4DH7A 4GJ3A 2CSNA 4WBBB 5ANJA 3KCFA 2C30A 5TO8A 2YERA 2FH9A 2VU3A 5HD7A 2XM9A 5AAFA 4YU2A 3E7VA 3NWWA 4J95A 2UZNA 2YCSA 4IDTA 2BRNA 5HG5A 2R3MA 3UVQA 3U9NA 4C4FA 4F63A 2W1GA 3I60A 4FEWA 3A7HA 2F2UA 2IJMA 3MTFA 4AZWA 1NA7A 4JG8A 5FXSA 5DA3A 3HZTA 4DH5A 3CGOA 3F3ZA 3TT0A 4LV5A 3GP0A 2HENA 4CFVA 5EOLA 1YXXA 5CXZA 3LFDA 4CMUA 4DFZE 3EFWA 2CN8A 1YHVA 4I6BA 3MPMA 2JAVA 5L2SA 3ACJA 3QTQA 4GT3A 2IPXA 4FSYA 3NS9A 3W1FA 4EOOA 2XK6A 3I6WA 4RJ5A 5GINE 4CD0A 4PY1A 4AW1A 5B2KA 2YFXA 5F95A 4EI4A 3EQGA 3G33A 2I0YA 2VTLA 4JIAA 1I09A 4YLJA 2I0EA 4DGLC 2GNGA 2HK5A 4E6QA 3LM0A 2QO7A 3OXZA 4XH6A 1V0PA 3R1NA 3H10A 3V5QA 5H8GA 2OSCA 2QG7A 4IXPA 3QBNA 4BDDA 5TKDA 2EUFB 4IAFA 4F65A 5B0XA 4DEEA 4M0ZA 4RWKA 4XP0A 4E5BA 4PTCA 4QPAA 5DH3A 1OKYA 4C57A 1NW1A 3MTLA 3CPBA 3U9CA 4YTIA 1ZOGA 4HYIA 4XG7A 1YOJA 4CV8A 5J9ZA 2PVYA 2VTJA 3NAXA 4O7RA 3POZA 4GSBA 3ZFXA 2C0OA 5TOZA 3F2RA 2R9SA 3TKUA 3QYZA 1G3NA 3HA8A 3KMWA 3MIYA 2IG7A 1VEBA 1M17A 3BBWA 2E9PA 2VO3A 4QT1A 4DEAA 5M44A 5M51A 3QQKA 4YO4A 2F9GA 4I5CA 4XNEA 4D2RA 2QKWB 2BZJA 5HEZA 5L2TA 3F66A 4FV1A 4FZFB 2GNJA 2ERKA 5BVNA 3CS9A 4I41A 5KKRC 3D2IA 2PVRA 5CLPA 5D7AA 3TTIA 4EC8A 4GFOA 5HCYA 4L45A 2J0IA 1VR2A 2CLQA 5E8XA 5FEDA 4PMSA 4JVGA 3OCBA 5DG5A 2BHEA 4ALWA 2PUUA 3GENA 5LCKA 5EHLA 3VQHA 3CGFA 4C4EA 3BRBA 4O7SA 2WMRA 3VWAA 4L3PA 3C5IA 4L52A 5L6PA 2O8YA 3FI2A 3W18A 2YJRA 3W2PA 2Q0BA 3FL5A 4AGWA 3LM5A 4N6YA 3FMMA 4XLVA 4D9TA 4CV9A 3BE2A 5CASA 1OKWA 2IW6A 4FV9A 4ID7A 4P4CA 3NGAA 4TWOA 2WMUA 1XH9A 4EUTA 3VF9A 1JPAA 1HCKA 3O0GA 1U54A 3AXWA 3KN5A 3AT4A 2YDKA 2UUEA 4MNEB 5I5ZA 5KHXA 2BIKB 3FSKA 4RIWA 3ITZA 5HIBA 1W7HA 3OZ6A 4YURA 5HE0A 3KQ7A 4HGTA 5LMKA 4PDOA 1B38A 3R00A 1M2QA 2GNFA 4ZTNA 4RQKA 5AAEA 2HXLA 2YIRA 4MF1A 1UVRA 4FTRA 3WARA 2XNPA 5IH4A 4DBXA 4QMSA 4O83A 2UV2A 2XF0A 3UODA 4FNXA 3P08A 2RSVA 2HW7A 3NYVA 4PRJA 4BCJA 3PA5A 4FODA 2A1AB 3BHTA 2YHVA 2XJ2A 4OTDA 4II5A 3BGQA 4D2SA 4BIEA 5AJQA 5ITAA 3SXRA 2R64A 3KC3A 4L9IA 4ACMA 1XQZA 3KU2A 2W9FB 4N4SA 4YHJA 4ANSA 3AMYA 4I6HA 2R7BA 4UXLA 3QUEA 1XR1A 3C7QA 2CGXA 2XUUA 3PY3A 4H1JA 3NIEA 5H3QA 2PU8A 3I4BA 5LJJA 2VGOA 3AGMA 3MJ1A 4GU9A 2C6LA 4X2NA 2W1ZA 3MA6A 3ZLWA 4AE9A 3VUKA 2OF4A 4FEVA 1E1VA 3Q9WA 1XH6A 3UIXA 2J0MB 2R3KA 3QTZA 3VQUA 2XK9A 3WF8A 2OXDA 4CRSA 2XA4A 4I5MA 5IH5A 2XKCA 1AD5A 2W4OA 2BTRA 4KAOA 4QYHA 3DBEA 4CEGA 3D5WA 3D14A 4U3ZA 3F5UA 4RG0A 5L2WA 5J7BA 3OTUA 4ORKA 3ZO4A 4UMTA 2XJ0A 4L42A 5E8ZA 2JGZA 1BMKA 2X8EA 3HUBA 3QWJA 4QP9A 4I92A 2IN6A 4O6LA 3REPA 4CG9A 2P4IA 4E7WA 3TZ7A 1KV1A 3LOKA 4BN1A 2AC5A 3ZDUA 3TZ9A 2NPQA 2BZHB 3UGCA 3R7YA 4R77A 3DFCB 3DLZA 3DAKA 4X3FC 1KOBA 4QMVA 4OTWA 4TYIA 5IUGA 3MBLA 2JIIA 2GTMA 4K2RA 4IFCA 2VWYA 5IUIA 4A9SA 5IQFA 3H0ZA 4FMQA 3A7JA 4PL3A 3SLSA 4H58A 4UY9A 1QPCA 3FKLA 4NJDA 3ROCA 4CFFA 4WG4A 4YJVA 4IM3A 2C6EA 1PXLA 2J6MA 1BUHA 4EHVA 4U42A 3LCTA 3O71A 5ANIA 1OZ1A 4AW5A 4BTFA 3MFUA 4KBCA 2GPHA 2PVHA 2QODA 4FK3A 4C3FA 5J9LA 2O0UA 3PSCA 5M55A 4DGNA 2WKMA 3QUPA 4RVTA 4YZDA 5DYJA 4QMLA 4M69B 1OM1A 3ZRLA 4J97A 3ENHA 3AGLA 3R1QA 4FSRA 3PE2A 1TQIA 2BDJA 3AD6A 3D2KA 3I5ZA 4TKSA 4O0RA 5BMSA 4QTBA 3CR0A 4OTHA 1V1KA 2WQBA 2W1DA 3SRVB 3W33A 4E4MA 2QLQA 4FYOA 4F9YA 4WOVA 2GU8A 5DNRA 3C4WA 1IEPA 3TG1A 1ZY4A 4NZWB 4FT5A 4RLLA 2IO6A 4ZY6A 4ZTMA 1PXOA 4U45A 4I1ZA 4LMNA 3W2SA 2SRCA 2Y9QA 4P5ZA 4D5KA 1Q8UA 1WBPA 2VWWA 1ZYJA 4WRGA 4FIFA 4EQCA 4XS2A 5AP1A 4GU6A 4XG8A 3QXOA 4MX9A 4ASEA 3BGZA 5IPJA 4JOAA 4L8MA 4HNFA 1PF8A 2VWBA 3P23A 5ANOA 1U4DA 4MD8E 4MHAA 3PPKA 3LJ0A 2VTQA 4D1ZA 1QL6A 2V0DA 4NWMA 4O22A 4B0GA 2GMXA 2GTNA 4XLIA 4EWQA 2YM5A 3CP9A 5CSWA 4V0GB 2JBPA 1PXKA 3NNUA 3WOWA 2XIYA 3LFSA 4V01A 2R7IA 1ZWSA 4AG8A 4EJ7A 3KXZA 4TT7A 2BZKB 3FDNA 2KULA 3O50A 5AV3A 1GIHA 3IONA 3ZUVA 4I20A 3BX5A 5A54A 3O2MA 3GNIB 4ZXTA 5FBOA 3TIZA 4DLIA 1KUTA 4A7CA 4IBMA 4LFIA 4U80A 1OIYA 2W05A 4BGQA 2C1AA 2R5TA 3OY1A 3UNKA 5EW3A 4O1PA 4CXAA 3LXNA 4X6QC 4E4LA 2WIHA 5HO6A 2QHMA 2PVKA 4H3QA 2BALA 4TN6A 5CVFA 3L9NA 5HO8A 1OVEA 4FTTA 1H28A 2BIYA 4ANBA 5AEPA 4FKOA 2YM6A 2BPMA 2X7OA 4XOYA 4GK4A 4Z3VA 2W1FA 4NIFA 1H27A 1BYGA 3OP5A 4I93A 2YDIA 3DXNA 3MYGA 3IW8A 4B8MA 3KN6A 2QD9A 4YJNA 3DTWA 3EQFA 3ZSIA 4O81A 4E4NA 3EL7A 2CPKE 2VO7A 5EI6A 5C1QB 4KIKB 4RFMA 4DEBA 2HZNA 4UYAA 5M4FA 3IK3A 3TXOA 5D41A 3E3BX 2DS1A 1XH4A 4GIIA 3CTQA 3HNGA 3UQCA 3SQQA 3QA0A 3TNWA 2G1TA 4MXOA 5L3AA 1UA2A 3HMPA 2VTAA 3D7TB 4CKJA 3WYXA 4EKKA 3TUCA 3BKBA 3FAAA 3Q5IA 3D5VA 2I1MA 2WQEA 1FMOE 4NFMA 3ZYAA 2VTPA 4UN0C 4MBLA 1ND4A 2B9FA 4YZBA 3GXLA 1ZLTA 4U8ZA 2X9FA 2QONA 3HV3A 2VWUA 4JBOA 3V51A 2VTNA 3O8TA 4DBNA 5K4JA 3I79A 2R3JA 3G0FA 3PSDA 1OIQA 1ZMUA 3DTCA 4X3FB 3RALA 4HW7A 5JH6A 4ZTHA 2OBJA 5AA9A 5M53A 2JIVA 3NUUA 3ODYX 3FZ1A 4IHPA 3UYTA 4CMOA 4HZRA 3KFAA 4RPVA 4F0GA 5F9EA 4FOCA 4Q9SA 3WF5A 1GOLA 3ZCLA 5GJGA 3B2WA 4GIHA 3I6UA 4QOXA 3FJQE 3KF7A 4TXCA 5J1VA 4FSZA 3PXRA 3GCSA 2IVSA 5EYDA 3QALE 4MAOA 4U40A 2GHGA 4R5YA 5KZ0A 2YITA 4BI2A 4IM0A 2XMYA 3PY0A 4CFUA 3N4TA 3ZXTA 2PTKA 4HNIA 4M67A 5BYZA 1G8AA 2F7XE 4QO9A 2B9HA 2GFCA 3KA0A 2HYYA 3JPVA 3K54A 1ZRZA 4BC6A 3RZBA 5D11A 4PPCA 4Y5QA 2BTSA 1GNGA 1U46A 2OWBA 3ORPA 4ARKA 2FA2A 5EM7A 3VC4A 1W83A 1Q4LA 2WNTA 3FXZA 3RPYA 4IX3A 3WF9A 5E90A 4RX5A 5K3YA 4RA4A 5HTCA 4ZTSA 3V04A 2PYWA 3UBDA 1OBGA 5KBRA 2X6EA 4PTGA 4IVAA 3DQXA 4W4VA 5GIPE 5IQHA 2G01A 4JQ8A 2Z2WA 4F1TA 2ITZA 3HX4A 4FVRA 4JJRA 3R9NA 5G1XA 4CFXA 3ROYA 4S32A 4C2WA 4PF4A 5EDRA 5AUTA 3O51A 4H3PA 5DMZA 4WIHA 1S9JA 4TYGA 4TWPA 4PX6A 5EOBA 4WNPA 2ZYBA 3B2TA 4PPAA 1U5QA 2WAJA 2X0GA 3UNJA 3LXKA 4ZLOA 4MTAA 1Y6AA 1XH5A 3ORZA 3RAHA 5C8KA 4AU8A 3DDPA 4WSQA 4FTUA 3LFCA 4M66A 4IB1A 4Y72A 4YUQA 1YI3A 3F6XA 4G3EA 4IZ5A 4IWPA 3PIXA 4G16A 2VWVA 1XO2B 3DBFA 4PL4A 4PDSA 3MGYA 5HE2A 2IW9A 4BDAA 5JK3A 5BYLA 2BRGA 1H25A 4U6RA 3SW7A 1IAHA 4O2ZA 3HV5A 2UZWE 3QTWA 3EZVA 5CSHA 2GHLA 2Z7QA 3BI6A 4G1WA 4E6DA 1Y8GA 5M57A 4I6FA 3DAEA 2QG5A 5C4LA 4DFLA 1SVHA 4RC4A 5EQEA 3DZOA 4TWCA 1YXVA 3OY3A 5IA3A 1YWRA 4MXYA 3TEIA 4CKRA 3NLBA 3QX2A 4U41A 3P1AA 4YJPA 3QRKA 3F9NA 4F9BA 4GT5A 5BVOA 4D0WA 5F4NA 2BDWA 3LJ2A 4GYGA 1IG1A 2FYSA 4EUUA 3R04A 3DXPA 2IVVA 2UZOA 4E4XA 4FGRA 3PLSA 3R21A 1E1XA 3DPKA 3JUHA 4YC8A 5DLSA 4EZ5A 2Y0AA 4C4IA 2VTIA 1UNHA 3HMMA 4NKSA 4QTCA 4S31A 4ZSGA 3OWLA 3A7FA 3THBA 1ZYDA 3ZEPA 3TUDA 2VO0A 2ZM1A 4F64A 2CNQA 3R8PA 2UZDA 3EH9A 5EQYA 2R3FA 3TN8A 4IB5A 4F09A 3OW3A 3A8WA 5EYMA 3SXFA 2GNIA 5G6VA 4F9WA 1STCE 3PJ2A 2HZIA 5BPYA 2YN8A 1H8FA 4XV1A 1VYZA 2F4JA 3QZHA 2ITWA 2HOGA 3HRFA 4EYJA 1Q62A 2BAJA 3CCNA 4FE2A 4F0FA 5A14A 4FTOA 4MYGA 5EQPA 2X4FA 3IGGA 2UW6A 2XYNA 4D58A 4EOKA 5H8BA 3UO6A 2ZVAA 3O8PA 2EU9A 3AC1A 4OT6A 4YC6A 5E1EA 4RMZA 4CCBA 3OFMA 5LVMA 1J91A 3ORNA 3QRUA 3RKBA 3UMXA 2W5BA 3RPSA 1ERKA 4I3ZA 4JDKA 1SNUA 4LYNA 4OTIA 4QP8A 5HE3A 5JQ8A 2FSLX 4R8QA 3EQDA 4DA5A 3QXPA 3MA3A 4O7NA 2W4KA 2CKEA 4AZSA 1BLXA 3Q52A 4GYIA 1O6KA 1YWNA 3UOJA 4CG8A 3TV4A 4IB3A 3GFWA 1QPJA 4FOBA 5JZNA 4ENXA 4R5SA 3CPCA 3D4QA 3VUMA 1PXJA 5L8KA 2UZLA 4BWKA 2G9XA 1Q5KA 4V05A 2JKMA 4WG5A 5GZ9A 4UALA 4L7SA 2OJFE 3EHAA 4TWNA 4H3BA 2WMAA 3RNYA 4FUXA 4RJ6A 3NW7A 4FKVA 3EN9A 2WMVA 3DCVA 3TKHA 3BLQA 3CD3A 2GS2A 3HUCA 4IX4A 4AGCA 4UMUA 4HJOA 4O7YA 2JEDA 3TV6A 3IO7A 5F1ZA 3HEGA 3JYAA 4FG8A 5IUHA 4RFYA 3E8NA 1T46A 4NT4A 1Z5MA 1CSNA 1H1PA 2WD1A 5T6KA 4D2VA 5JGDA 2R0UA 2V22A 2QO2A 2ONLA 1W82A 1KE5A 4QMTA 3VW6A 1A48A 4F1OA 2OJGA 4MVFA 5FM2A 3DNDA 4L43A 3NUPA 2J0KA 2PZRA 5T3QA 2YCFA 4M8TA 4DG0E 5JRQA 1LEWA 2V55A 3KCKA 2VWIA 1JBPE 4ZY5A 3F82A 1B6CB 4GG7A 5CU6A 1GZKA 3MDYA 5JEBA 1BKXA 3SXSA 4U97A 5DRBA 5AWMA 4IFGA 3QHWA 2QLUA 4W4YA 2E2BA 3RK5A 3PRIA 4KUJA 5AP2A 3QUDA 4IX5A 5BUEA 4HGSA 3UOHA 2Y6OA 3NYOA 4WD5A 3TJDA 4ASXA 3IW5A 2UZBA 4Y85A 5CEQA 3BU6A 3F3UA 3HP5A 3RPVA 3VF8A 1T45A 2CGWA 4BCNA 4BR3A 1UV5A 4C33A 3EQHA 3UMWA 5IA0A 1H1RA 2G15A 1PW2A 1APME 5FGKA 3FI4A 3TACA 5AAGA 5A4QA 5M4UA 4HGEA 5FTQA 2ITXA 3VHEA 4Y73A 5AUUA 2OGVA 5JFXA 3B8RA 5FRIA 3PZEA 1R3CA 2Q0NA 3ZSGA 4TYEA 4WKQA 1OIUA 1SM2A 3HMOA 3DBDA 2ZB1A 2JKOA 4PTEA 2J2IB 4PP7A 5ANDA 4DGMA 3TUBA 3GVUA 4EORA 2X2KA 3VS7A 5GZ8A 1PKDA 1XHAA 1P4FA 4BDEA 1V0OA 2HXQA 3BV3A 1Y57A 3PPZA 5CU2A 4P2KA 2ZMCA 4CCUA 3H4JA 5HTBA 3UIUA 2P2HA 3LLTA 3AC5A 5CT7A 3NR9A 5KMKA 1HCLA 3Q60A 4O7WA 2X9EA 4LOPA 4JBQA 4TYHB 3PJ8A 3SVVA 3KMUA 2UW9A 4IAKA 2WMSA 3RZFA 4FV5A 4CQGA 5C26A 3RAKA 4YTCA 1BI8A 4S33A 3R1SA 5HGIA 2CJMA 4JX7A 3VUGA 1MP8A 2WOUA 4YLLA 4BCFA 2WEIA 1H0VA 4JT3A 1Y6BA 2JBOA 3P4KA 4YMJA 4H36A 4FV7A 1MRUA 3UO4A 2CDZA 3PXQA 3W2RA 4DFBA 2UVZA 3QD4A 3PE1A 3CC6A 4U43A 4WUNA 4ANLA 3V5LA 2WFYA 3ZRMA 3TL8A 3FQEA 3MJ2A 4NKAA 3OVVA 4NEUA 4XBRA 3QQHA 5FTGA 4HVSA 4EH3A 3R7VA 3UC3A 1J7IA 5BUIA 3NIZA 3BWJA 4BCGA 5HNBA 5FP5A 1A9UA 4RIXB 3R1YA 2O64A 5EK7A 4ITJA 4EOSA 4HYSA 4U9AA 3ZLSA 4O0VA 5IEYA 3MH1A 2XCHA 1KE7A 2CMWA 1FPUA 3WF7A 4H05A 2EB3A 5FEEA 3CSVA 3R01A 3WILA 5FEQA 4A4LA 2VNYA 4C62A 5LQFA 4BDFA 4YGAA 3FLSA 4C4GA 2BAQA 2A27A 4KBKA 4EJNA 3PRFA 2GHMA 3POOA 2EB2A 3UNZA 3EFKA 5DN3A 3ZFMA 3EN7A 3R73A 4HCVA 3TCPA 3RCDA 3ORTA 3V5TA 4LL0A 4YC3A 4EEVA 3F5PA 1FVTA 2W5AA 3E3PA 3KULB 3A8XA 4O27B 2YM3A 2Z02A 4BKZA 4BCQA 2GFSA 1U59A 2W4JA 2ZM4A 3DNEA 3DT1A 1KOAA 2WQMA 3EOCA 4L44A 4ONAA 4NCTC 5E1SA 2JFLA 4Z7HA 4A06A 3FI3A 4EYMA 4U81A 3ZONA 3ALOA 5HTIA 2R0IA 5JFWA 2VD5A 3E88A 3R22A 2JIUA 4XV9A 5DT3A 4QQ5A 3C0IA 3FMDA 3PXZA 5AUVA 3SGCA 3FZTA 4ZSEA 3V5WA 5IH6A 3V8TA 2J0LA 1PMEA 3VS0A 4J96A 1PYEA 2WELA 4USFA 4BTJA 2QQ7A 2PUPA 4WA9A 2NRYA 2ACXA 3EJ1A 4O0SA 3ZS5A 2XNEA 3FLQA 4BDHA 2OXYA 2X39A 1PRYA 4JBVA 2JDTA 4H39A 3TZMA 4CSVA 5AR2A 4MEDA 3EN4A 4EH7A 3BLHA 3HDNA 1QPDA 3AT2A 3AQVA 3FMEA 1EH4A 3LXLA 2ITOA 5GJFA 4WRSA 4NL0A 4DFUA 3GU5A 4FV8A 4BCMA 5E91A 3I0OA 1PMVA 3ACKA 4B7TA 3AD4A 4QTDA 4PPBA 3FQHA 3CBLA 4JS8A 3FMNA 3R63A 4C38A 2R3RA 5HLWA 2Y4IC 4HVHA 2XIXA 2QU5A 3R9OA 4BI0A 4HYUA 4IZAA 4F6SA 5J5TA 3WZDA 3N4UA 4X2KA 4CQEA 4AWIA 1XJDA 4ZLYA 3E93A 3BEGA 2C5OA 3EN5A 3QD2B 3DKOA 3F5XA 3UOLA 5HBHA 4F7SA 3P5KA 5AR8A 4K77A 3PFQA 4E1ZA 3OOMA 5I9WA 2JITA 2OIBA 4F9AA 2X2MA 3UP7A 5CF8A 4I21A 4ANNA 4M84A 2XEYA 3U54A 3PSBA 1PMNA 2B0QA 2B54A 3PYYA 1YXUA 3F7WA 4WNOA 2X2LA 2QOKA 3R6XA 1M52A 1FOTA 4M68A 1AGWA 1IRKA 4OUCA 5EDPA 3DA6A 2YM7A 4I24A 5JFSA 5K5NA 1O6LA 4QYYA 3U6IA 2PVMA 3QL8A 4P5QA 2C0IA 2H8HA 4OR5A 5GNKA 3TI1A 3DBCA 3DGKA 3K2LA 5L8LA 5CSXA 1H00A 3OMVA 4XBUA 4G31A 4X3JA 5HKMA 2RFNA 4YJTA 3DS6A 3S3IA 4EOIA 4KSQA 3F69A 1Q3DA 2W5HA 5GHVA 1JLUE 4ANQA 1IR3A 4MNEA 2HWOA 4XP3A 4G3FA 4ZAUA 3C4EA 5DWRA 3KVXA 4EQUA 2PMLX 3VULA 3TZ8A 3NUXA 3LE6A 4RSSA 4GVJA 3BU3A 4F9CA 5K9IA 4LUDA 1M7QA 1QMZA 2HIWA 3O23A 4W9XA 3OCTA 4FKPA 4AFEA 4RGJA 5KMNA 2IZUA 4JX3A 3RINA 1ZOEA 5HIEA 4B9DA 2Z60A 3F3WA 2C3IB 2RGPA 5IQIA 3HV6A 3D15A 4IQ6A 4BCIA 4FV0A 4JQEA 5AUXA 3V5PA 2AC3A 4A9TA 3PIYA 5CX9A 3C1XA 5EM8A 3IGOA 4X2GA 5JKGA 2CNVA 1RQQA 4K1BA 3PY1A 5ETIA 4BCKA 4FSTA 1YWVA 2XKEA 3OHTA 4C36A 4CFNA 4TRLA 5H9BA 4CVAA 4GKHA 1W98A 2QC6A 3TV7A 5I9VA 1KWPA 5F20A 3ZUUA 1JKKA 5E8YA 3SD0A 1Z9XA 3R2BA 3DU8A 3Q6UA 3OT3A 4DG2E 1DI8A 3KK8A 5DHJA 2EVAA 4JLCA 4EH6A 5IU2A 3LMIA 2UZUE 3G6HA 1OITA 4NM7A 2PWLA 3KXNA 4MXZA 3R2YA 4L67A 3QU0A 1GZOA 3U4WA 4DCEA 4ZZNA 3UJGA 3DV3A 3I7BA 3IDCA 5IEVA 1TQPA 3MH3A 4HOKA 4EKLA 2XKFA 3CLYA 3DKCA 3KRWA 4C58A 5IA2A 2I40A 2WMWA 2VRXA 4NCTA 3SW4A 4L46A 2XB7A 4BHNA 4CKIA 5HVKA 3PJ1A 5EKNA 5A4CA 5CEPA 4V04A 2Z8CA 4UMPA 5DR9A 4BKYA 3MWUA 5CTPA 3CJFA 1GZ8A 3ZXZA 4DN5A 4QRCA 4AN3A 4EOJA 4CT1A 2XH5A 2YM8A 3GCQA 1WZYA 4IACA 3OWJA 3RTPA 2R3PA 4O7VA 3CQEA 1XKKA 3FMKA 3D83A 2QVSE 4QMWA 4YPDA 3GBZA 4MXAA 4EHGA 3DXQA 4O96A 5A4EA 4L00A 5GZAA 1MRYA 5CNNA 5JSMA 4JXFA 1UNLA 3F2AA 3W8QA 2JLDA 1M14A 1URWA 4F6UA 5KHWA 3UQFA 2C6KA 3CTJA 1H1QA 2WB8A 4FTLA 5AP6A 4XG4A 3SKCA 3VJNA 2PVLA 3JXWA 2QOOA 2YDJA 4JRNA 4ZTLA 1JSUA 3A4PA 4TL0A 2C3JA 1M7NA 4AN2A 3ZM9A 1OKZA 2RF9A 4RQVA 4D4SA 3GI3A 2UW8A 4O82A 2J51A 4BKJA 2W0JA 4M69A 1ZYSA 1GIIA 3FPMA 5AM6A 1QCFA 4CZYB 2Y4IB 4JNWA 1WVXA 5TF9A 4L3LA 4OBOA 4DFNA 3SRVA 3ZZWA 3R8UA 4R7IA 5CXHA 3M2WA 4U7ZA 4EH4A 4WUAA 1M2RA 5M06A 1R78A 2O5KA 1H07A 4C34A 2YLEA 4PMPA 4KABA 2WMBA 2XBAA 4N6ZA 4YJOA 3S95A 2P55A 5BYYA 3LLAA 2JDVA 5HG8A 4ZZOA 3Q5ZA 4FYNA 2XNMA 2G2IA 4DF3A 2BR1A 1WBOA 3CKXA 4K33A 4BIDA 4DC2A 1KE8A 4EZ7A 2QI8A 3JVSA 5M07A 4O0XA 1H4LA 4FNZA 2X8IA 2XK7A 4FSQA 4BZOA 2WMQA 4G3CA 3PWYA 2BRMA 4LG4A 4MNFA 3G9NA 4NW5A 1SYKA 3W2QA 4YTFA 5KUPA 5M56A 4QD6A 3RPRA 1DI9A 5D12A 3L8PA 3BCEA 2C5NA 4HGLA 4DITA 3OROA 2F57A 3SOCA 2Z7RA 4C02A 4U5JA 4GVAA 2OK1A 3ORIA 4CRLA 3BBTB 1UU8A 3R8LA 2H34A 4FTAA 5AUWA 5HX8A 4R1YA 4N70A
chains in the Genus database with same CATH superfamily
2PMIA 4WNMA 4V0GA 3P9JA 1JVPP 4ZIMA 4KD1A 5TE0A 3OEZA 3IG7A 4IWQA 4G6NA 3UIBA 2FSOX 1DAWA 3ZRKA 2BVAA 3LQ5A 3UYSA 3D5XA 1W2DA 4ERKA 2ZV8A 3VUDA 5IMEA 3ORLA 5TT7A 2YZLA 3C4FA 4AAAA 1YRPA 3PG3A 2FSTX 5HBJA 4FV3A 4AT5A 3PJCA 1FVRA 5FDPA 4W9WA 2XP2A 4ACCA 3C9WA 4U44A 1O9UA 4BCPA 2C6DA 2BMCA 5IDPA 4AQKA 3C4CA 4K8AA 2CCIA 4JQ7A 3QC9A 4AXEA 5AV2A 5CVGA 4Y46A 4CZTA 4NH1A 3VBYA 5HCXA 4EOMA 5A46A 4EK5A 3EQPA 5DE2A 3ATSA 3IW6A 4QMYA 5C9CA 3R9HA 4LRJA 4Q9ZA 4G5JA 4OGRA 4FF8A 2EWAA 4PMMA 4JG7A 3LHJA 2PMOX 2OG8A 3GU7A 4OTQA 1CDKA 2R3QA 5AP0A 4AW0A 3BZ3A 4GG5A 4ZP5A 4YLKA 4C2VA 5AA8A 3QTSA 4KIKA 3PA4A 4XJ0A 1FBNA 2GSFA 2WU6A 3GU4A 2C68A 2VX0A 1IASA 4ERWA 2QR7A 4AA0A 2PY3A 4B99A 2BROA 4OW8A 3A7IA 3QZGA 4UB7A 3TTJA 3R9RA 3NUSA 2R3HA 1LUFA 3D7TA 4XV3A 2XAOA 3W55A 4ACHA 4R3RA 4HCTA 2FVDA 3ELJA 4UWYA 4CZUA 3F2NA 3FZPA 2QR8A 3O7LD 4FK6A 4FT0A 3GC9A 2PVJA 3ODZX 4O4BB 3HAVA 1U5RA 5AR5A 4B4LA 4Y5HA 5LOHA 3TIYA 2Y6MA 5I9UA 2ERZE 4QMQA 2YJSA 2VTRA 3TNIA 3E62A 2Y7JA 2WHBA 4ITIA 4X3FA 1DS5A 4DEGA 4U0IA 3QFVA 3SAYA 4BBMA 3PTGA 3FLYA 4O0WA 3FI8A 4Q2AA 4B8LA 3VVHA 2FGIA 3TDVA 3PVBA 4EK6A 4O84A 1PXPA 2R3OA 2PUIA 1OL6A 1W8CA 1OL5A 2OW3A 4ZMFA 2WQOA 3CJGA 4F6WA 5LMAA 2BKKA 3Q4UA 2ESMA 3OTVA 5AUYA 4EQMA 5CT0A 2ITQA 3NRMA 3EKKA 2FB8A 2REIA 3NSZA 2YIWA 1OIRA 3DZQA 1MQ4A 1YKRA 2V7OA 5JFVA 4O0TA 4P90A 2WU7A 3QRJA 5FLFA 1J7LA 4FV6A 4ALUA 2QU6A 4AZEA 2YABA 3R8VA 4WT6A 2BFYA 2C5YA 4IAZA 4A9YA 4UMRA 4BGHA 4IMYA 3LFEA 3K5VA 4NSTA 3A62A 3H0YA 3EFJA 4XX9A 5B2LA 2B55A 3FC2A 3NUNA 4DDIA 1R0EA 1Q24A 3EN6A 3GC8A 4RVMA 3NFGB 2P33A 3FKOA 1CTPE 2X1NA 3FXXA 1P2AA 3HLLA 5AV0A 4KNBA 5EI2A 2O65A 4D4RA 2WTDA 2WMXA 1R1WA 2YIQA 1NVQA 2GNHA 3T9TA 1RJBA 4CMTA 4ACDA 5KCVA 5L6OA 4EBWA 4FKRA 3ET7A 3C4XA 2GS7A 4NFNA 5CEOA 1OI9A 3R30A 4E93A 5JMSA 2IZSA 4BWXA 4OTGA 3GFEA 2RL5A 3MSSA 3QQGA 5B7VA 2GDOA 2XCKA 1ZAOA 4X2JA 1SNXA 3MY5A 5EHYA 4D55A 5BX0A 4FKTA 4C0TA 1H01A 1JKSA 3V8SA 1WBTA 3BIZA 1J3HA 3R83A 4KB8A 5HOAA 4YJSA 5CQWA 3VNTA 3R8ZA 4C3PA 4R1VA 2YAKA 2PE0A 4E6AA 4LMUA 3AMBA 3VN9A 5K5XA 4YJRA 5AP4A 2DYLA 2XNNA 4BCHA 5CF5A 3NAYA 3VBXA 2ETRA 2QOLA 5KMOA 3QQUA 4FEUA 4QQTA 2GNLA 1Q99A 4RFZA 3QCYA 4XV2A 5FQDC 3E8DA 2OIDA 4FT9A 2BRBA 3S4QA 4D1SA 4F7NA 1AQ1A 2ZDTA 2UW3A 4GRBA 3V3VA 3VHKA 4AXAA 5IQDA 5A6NA 2OO8X 4IC8A 4ZSJA 4AOJA 3BLAA 4NM3A 4FTIA 2HAKA 3HRCA 4G17A 3FHRA 3RPOA 3UDZA 2HCKA 4S2ZA 3BLRA 4PDYA 2JDSA 3DLSA 3KXXA 4M14A 4NM5A 5D7VA 4QEBA 2OJJA 5FBNC 1B39A 5ACBC 4DE4A 3ORMA 2C3LA 3QX4A 5FXQA 5EG3A 4C61A 3UDSA 4PUZA 4RVLA 2VWXA 2XEZA 3LCOA 3PVUA 5C01A 4AA5A 2QCSA 3E8EA 2VN9A 4KSPA 4MD7E 2JDOA 3AC3A 4BZDA 2OZAB 3KRLA 1GZNA 1J7UA 3QCQA 3BYSA 4IZ7A 4G3GA 3KY2A 3NYXA 3CY3A 3A4OX 2HY0A 3DKFA 2R3IA 3GCUA 1YXTA 3Q04A 3R7EA 3U87A 2IZTA 2PMNX 3ETAA 4FL1A 2VX1A 3H30A 3RM7A 4QQJA 4MF0A 3PJ3A 1WBWA 2V62A 5EYKA 2BILB 4HCUA 5IQAA 4CLJA 2E9VA 4PP9A 3QF9A 4U3YA 2NNWB 3PXFA 4DCAA 2WO6A 1KE6A 4E26A 4EHZA 2RFSA 3OBGA 2F7ZE 3MIAA 3AD5A 4ZJJA 2QOBA 4EK8A 4FTQA 5E8WA 1L8TA 3PDTA 4I5HA 3KMMA 5IDNA 3GCVA 4GV1A 2CKQA 4I0SA 4KWPA 5HLNA 3PWDA 2C69A 1I44A 4C4HA 3DJ7A 4G9CA 2WTKB 5EI8A 3KK9A 1FVVA 2J9MA 2X6DA 3R9DA 4JAJA 4JDJA 3D0EA 5CI7A 1OB3A 2R2PA 4G3DA 4X2FA 5CENA 5BVFA 3Q96A 1WBVA 2X4ZA 3PXKA 4IX6A 3SG9A 1Q41A 5LMBA 4FIIA 4GK3A 1JQHA 5LARA 4PNKA 1ZMWA 2A0CX 3ZBFA 5GIOE 4QMUA 4IB0A 5IA4A 3R7GA 3W16A 2PULA 2XNOA 4D4YA 3P7CA 4RX8A 2XRUA 4AFJA 4D0XA 4O7TA 4DTKA 3COMA 4CLIA 3SC1A 4DINA 5CF6A 2BFXA 4O1OA 3GC7A 3AMAA 2A4LA 4FT3A 4ASDA 4IH8A 3FLWA 3IECA 1ZARA 1Z57A 3BYVA 2VAGA 2OIQA 3BQRA 5KMLA 2V5QA 2B53A 3LIJA 3JY9A 3FYJX 2YWVA 4KS7A 4EH2A 2G2HA 4NYEA 5HBEA 1Q8ZA 3FV8A 1BX6A 2OH4A 4BDJA 3D94A 4QQCA 4BY9E 1BL6A 5EDQA 4APCA 4ZS4A 2PVNA 5I9ZA 3PLAE 3DB8A 4USDA 3RI1A 3WIKA 4IM2A 4WO5A 3Q4TA 1XBCA 1XBAA 3NPCA 3TNPC 4OAUC 2B4SB 3RGFA 4DFYA 4GUBA 4YNEA 1XH7A 2I0HA 1TZDA 4M0YA 4TZRA 4AF3A 4BCOA 4KKGA 2DWBA 1OPJA 1WFCA 2XRWA 4GFGA 4MXXA 5ANGA 2XNGA 1PYXA 2IVUA 4XG3A 4XOZA 3O96A 5HD4A 5HQ0A 3MVMA 1LR4A 2OH0E 3L8SA 4BDIA 3NUAA 3Q9YA 4GH2A 1H1WA 3MN3A 3ZO1A 4BDCA 2P2IA 3PP1A 4IW0A 4Z9LA 3ZLYA 3QCSA 4E5WA 4IC7A 3HGKA 5JT2A 1YHSA 3EQBA 5DR2A 2C5XA 3C0GA 4AOTA 2B1PA 5H8EA 4JMQA 4XG2A 3V6RA 4BICA 3FE3A 4FT7A 4BB4A 4F7JA 1ZMVA 4G34A 3RK9A 4RC3A 4FI1A 3GGFA 3UOKA 3LKMA 3W32A 2WPAA 3KKVA 3Q4ZA 4O0YA 2W1EA 4BDGA 4O6EA 5E8TA 2CHLA 5DRDA 5E92A 4BF2A 4Q5EA 2I7QA 3WZJA 4AT3A 4MK0A 2W1HA 1KE9A 4TW9A 3QQFA 5A3XA 5E8SA 2WIPA 3V6SA 3BELA 2RKUA 3AOXA 3EQRA 3NNVA 1NY3A 3NYNA 3GU6A 4YR8A 5I9XA 3ENMA 2VX3A 3ORXA 1OBDA 2YCQA 3P79A 5KZIA 4UX9A 5D1JA 4FZ7A 2HELA 3VUIA 2WTVA 2C5VA 2X81A 4DEHA 2XANA 3HMIA 1WMKA 3FMJA 4FUYA 3SDJA 3MW1A 3QGYA 5EHOA 4TNDA 4FKQA 1GAGA 2CN5A 4A07A 2Z7LA 4UEUA 4M7IA 3AT3A 4EC9A 5CF4A 4TYHA 1ZXEA 3C0HA 4O38A 5HE1A 1IAJA 3AC8A 4FTMA 4A4XA 3C4ZA 4I4FA 3DKGA 3Q9ZA 3P0MA 5HO7A 4IEBA 3VS5A 1IA9A 3NW5A 3E63A 1YOLA 3QHRA 1CKIA 2O63A 2PE2A 5JGAA 5CEIA 5IQCA 3LCKA 3LFFA 4O21A 4FSUA 1VLRA 4FC0A 3D5UA 3ML1A 2BRHA 5IZFA 4IDVA 1URCA 5AIRA 3OS3A 4J52A 4P7EA 3IDPA 3CY2A 5FD2A 2PK9A 4FKWA 3L9LA 1P5EA 2CKPA 1K9AA 3KEXA 1OECA 5BVEA 5I4NA 3MH0A 4UBAA 3ZFYA 1XH8A 4BYJA 3FY0A 2UVYA 1YDRE 2ZV9A 3BQCA 1Q3WA 4I23A 3BEAA 1GY3A 2Y8OA 4RIXA 3MB6A 3T9IA 2PE1A 4QP2A 1JKLA 3TKIA 3ZC6A 3VBVA 1OL2A 3OG7A 3JS2A 4IE9A 4PL5A 5CS6A 4GJ2A 3G15A 2CGVA 4O86A 4K18A 4JDHA 4NU1A 4KKEA 3EL8A 3T3VA 5FXRA 2PSQA 5HNIX 3OWKA 4QMMA 2JD5A 3OEFX 2ZM3A 4XRJA 4QNYA 4LQMA 5K0KA 3ULIA 4IIRA 2GQRA 2H96A 4XP2A 1RE8A 2WEVA 5AUZA 5IQGA 3EYGA 3KRJA 1Y91A 5D9HA 1BI7A 4N0SA 2A2AA 1UU9A 4PNIA 1J1CA 3L9MA 4AUAA 3CQWA 4E6CA 5IA1A 3U55A 2XK8A 3KULA 3DB6A 5DBXA 4IVCA 1OPLA 5EFQA 2JFMA 2GQSA 2R3NA 3RP9A 2KTYA 5AV1A 4YNOA 3UG1A 4OAVB 3KB7A 4JI9A 4JRVA 1PJKA 2Y4PA 3ZLXA 1LP4A 5CALA 3TNQB 4R78A 4QYFA 3HMNA 3SX9A 4CNHA 4L68A 4QP7A 4X6RA 1TVOA 3G6GA 2B52A 3ERKA 2XK4A 4G6OA 3UZRA 2VWZA 5AADA 3L8VA 4KRDA 3WE4A 4E3CA 5CANA 1LEZA 3IKAA 3T8OA 1Q8WA 3VW8A 3OWPA 3QLFA 4UV0A 4BHZA 5L2QA 4BFMA 5CI6A 1UU7A 2A19B 3W2CA 3O8UA 3OCSA 5I9YA 5AX9A 3LFQA 2YZAA 5BVWA 2EXMA 2P3GX 5FTOA 2XIKA 2YLFA 3S2PA 1YW2A 4GUEA 4YJQA 4OLIA 3PIZA 4QYGA 5IMXA 2E9NA 3C5UA 2X7FA 3B8QA 3Q6WA 2X8DA 5F94A 5CU4A 4MBJA 3NX8A 4G5PA 4DH3A 4F0IA 4FG9A 3RK7A 3MI9A 4FTJA 2UZEA 3BYOA 2C1BA 2B9IA 3Q53A 4YHFA 2C6IA 2WTCA 3ZZEA 5J79A 2JC6A 3COKA 4MCVA 5HHWA 4RIOA 4C59A 4D5HA 4HPTE 4BIBA 4JBPA 1R0PA 3QWKA 3KREA 5HX6A 5EYCA 4IZYA 3NZ0A 4RWIA 3CEKA 1UU3A 3RAIA 2PZ5A 3OBJA 4C35A 4UWCA 3NEWA 3QLGA 4XEYA 5EM5A 3GT8A 5FUTA 4QMZA 4NM0A 1RW8A 4GCJA 3ZUTA 4MH7A 4LI5A 2W1IA 3FZRA 3SOAA 3HV7A 5EM6A 4Y8DA 4MWIA 4WG3A 5DEWA 5IEXA 4R7HA 3P7BA 1IA8A 3SG8A 4IVDA 4YSJA 4F78A 3L1SA 3UDBA 2ETKA 4TY1A 4YZCA 3SHEA 4F4PA 5JGBA 4FKGA 4FR4A 3FLNC 3TDWA 5L2IA 5M4IA 1MQBA 5ICPA 3OF0A 3QYWA 4RLKA 3FYKX 1J1BA 3MV5A 3JVRA 2J90A 4QMNA 2ZV7A 5AV4A 2IWIA 3MVHA 3WZEA 4IANA 4O4EA 4RJ8A 5B2MA 3JY0A 3M11A 3R28A 3IPHA 4J71A 4XUFA 3UDTA 4DT9A 3F7ZA 3W8LA 1XWSA 2C0TA 4XHKB 3FLZA 3R7UA 5DR6A 4B6LA 1TQMA 2VTOA 2W9ZB 3QQJA 5FM3A 1YI6A 4LUEA 4M15A 5J87A 5HZNA 3D9VA 3M42A 4UWBA 1U54B 3GOPA 3TYKA 4HVGA 4A9UA 4DG3E 3LFBA 4FKJA 2H6DA 2B7AA 4RIWB 1PKGA 5CU0A 5ETAA 4QTAA 3UIMA 4QPMA 5CU3A 2XBJA 3O7LB 4AN9A 5KMMA 4I0TA 3NDMA 2WOTA 3QTXA 4FBXA 4F1MA 4JG6A 1L3RE 5L4QA 3UZPA 1OKVA 2JKKA 3DFAA 5HNGA 5DT4A 1CKPA 3OXTA 3O17A 3LQ8A 1XBBA 4BGGA 4HVDA 4D28A 4WSYA 1OMWA 1NXKA 1K2PA 2WMTA 3G9LX 2ZV2A 4GW8A 4RJ4A 2HWPA 2BKZA 4EBVA 5CEKA 4LV7A 3SA0A 2CKOA 2BDFA 5IQEA 2WTJA 2YM4A 4F70A 4IVBA 4W4WA 4ZEGA 4IAIA 3RHKA 1GJOA 5CQUA 4ZJVA 2HY81 2NO3A 3DY7A 1VZOA 1V0BA 1H0WA 3KVWA 1W0XC 2WZJA 5KO1A 4DHFA 4OBPA 3LAUA 2QNJA 2ZDUA 4YZ9A 3LCSA 3TNHA 1SZMA 4AE6A 3W0SA 3W0QA 2AQXA 1YVJA 3QTIA 5AIKA 4BBEA 2OKRA 2P0CA 2XIZA 5CNOA 2UW0A 2YIXA 4RJ3A 3FY2A 1WVYA 4AXFA 4OT5A 5LXMA 4RZVA 3G5DA 4KBAA 3HRBA 1YXSA 4LL5A 5L6WL 5ANEA 2OICA 3GEQA 4USEA 2RIOA 2EXCX 3COIA 3GB2A 5M4CA 2QO9A 5I3OA 4NTTA 5ETFA 2XKDA 1YDTE 2RFEA 4FV4A 5J95A 3FHIA 5HU9A 3ANRA 4ZJIA 1RDQE 4YZMA 3ZBXA 5DEYA 2F7EE 4FZ6A 2GCDA 1MUOA 3WI6A 4MD9E 4RT7A 3VUHA 2IVTA 3HYHA 4KIQA 1HOWA 3TWJA 2XVDA 4ZMEA 2JAMA 2DUVA 4ZZMA 3U6JA 3QC4A 3LJ1A 3AKLA 4CYJA 2Z7SA 3Q3BA 4ANMA 4DT8A 1ZZLA 3A61A 2OJIA 4GT4A 4I94A 4ITHA 5E8VA 4EK3A 2XZSA 4QMXA 4CGAA 2QOFA 4N57A 3Q9XA 4O7LA 1R39A 3V8WA 1JSTA 2LGCA 3E7OA 5BVKA 3ULZA 3LFAA 3KF4A 2BZIB 3ZSHA 2XIRA 3Q2JA 4AOIA 3DBQA 3I5NA 4NK9A 3R8MA 2GS6A 4RIYB 4C3RA 4RIYA 4UZHA 5ETCA 3U8WA 4EH8A 4IAYA 1UKIA 4BTKA 3VBQA 1REKA 3HV4A 4EWHA 1Q97A 2FUMA 2RFDA 4C4JA 2IZRA 3RM6A 4LOQA 4DGGA 3VRZA 4FIEA 4FSMA 5K4IA 5CSVA 5CAUA 3PXYA 4QP1A 3NW6A 3NUYA 4G9RA 4MBIA 4I0RA 2YIYA 2X7GA 1WAKA 5TR6A 4O2PA 3KXMA 4AX8A 3F3TA 3UPXA 3AC4A 4TNBA 4ZTQA 4J99A 1ZOHA 3IOPA 1Y8YA 3UVRA 3ZOSA 3K3IA 4QP4A 2OJ9A 5KMIA 5KKRB 1UWHA 4J98A 3IQ7A 4FV2A 4X21A 2AEGA 3DAJA 4KIOA 3S1HA 3FZOA 3KGAA 3DJ6A 3LMHA 3FPQA 5JN2A 3PP0A 1OUYA 5KNJA 2XK3A 3QD0A 4KKHA 5LVPA 5J8IA 2UVXA 3L8XA 4WBOA 3R7OA 4EZ3A 4K6ZA 2WTWA 1P14A 5JQ5A 2BUJA 3NCGA 4A4OA 5CZHA 4FTKA 4RZWA 4FTCA 2YEXA 2X0QA 4QTEA 3LZBA 3KRXA 1YDSE 2FSMX 4ZY4A 2ITNA 4GEOA 5EKOA 4R7BA 5A4LA 5C4KA 3QRTA 2VNWA 2YCRA 4FEQA 4FKSA 4NW6A 1YQJA 3VBTA 5JZJA 4Z55A 1PXMA 3QZIA 5CY3A 3EMGA 5H2UA 2HW6A 4OTRA 2EXEA 2C4GA 1W84A 4R6VA 2C6MA 2UZTA 3LCDA 3MB7A 2I0VA 3HP2A 4AAYA 2BHHA 3HA6A 4JR3A 5C03A 1MRVA 3QA8A 4ALVA 1SVGA 4S34A 4YJUA 5DFPA 5ACKA 1OL1A 3UG2A 5LWMA 3ZH8A 1H26A 4OTFA 4E5AX 1O6YA 4EOQA 4RX9A 4UZDA 5DI1A 3NVMB 1G8SA 1GIJA 3C50A 2OU7A 2DQ7X 1JKTA 2CNUA 3UP2A 3R0TA 4PV0A 2UW5A 4FGBA 5A9UA 3P78A 3GQIA 4E20A 4J53A 3BHUA 4EOLA 1WCCA 1PXIA 4APPA 3G2FA 4E8AA 4YZNA 1CM8A 4L6QA 5A4TA 5HORA 3LQ3A 5CAOA 4DYMA 3QZFA 2ITYA 5AP3A 2YISA 1CMKE 1G5SA 3MVJA 3R7IA 4W4XA 2HZ0A 3BYMA 5C8MA 4DEDA 2PZPA 4NIFB 4EL9A 3FL4A 4F99A 2PUNA 2JKQA 3UZTA 4XMOA 4UYNA 2ITTA 2R3GA 4J8NA 4DLJA 4EHEA 3DK7A 3R71A 2WTKC 5FP6A 4AQCA 4MQ1A 2NRUA 4LOOA 4IADA 3FMHA 2VTSA 3EB0A 3VUTA 2VZ6A 4L3JA 4M97A 5AMNA 3MFSA 5BMMA 3L9PA 5CEMA 4LV8A 5M09A 3TJCA 4ANOA 3BU5A 5DT0A 1FMKA 2XYUA 4D4VA 4AACA 3AC2A 2CCHA 3OT8A 5KE0A 2HZ4A 1OGUA 4R3PA 3ALNA 4FNYA 4GL9A 4UMQA 5DVRA 3RMFA 2V7AA 1FGIA 1ZYCA 2UW7A 4RRVA 5IG1A 1PXNA 4AP7A 2VV9A 5AR7A 2J50A 4RBLA 5BNJA 3PA3A 2ITUA 3OUNB 3I0QA 3CXWA 3H3CA 5HVYA 5LVNA 1PMUA 3GUBA 3W10A 4O0UA 3F61A 4BDKA 2VUWA 4AZVA 3PUPA 1DAYA 1KSWA 2FO0A 4FVQA 4FKIA 4JL9A 3BHVA 5IISA 4Y95A 3JR1A 3P5JC 3PVGA 3ZU7A 2ZB0A 2XJ1A 4A9RA 1E9HA 3LMGA 3KXGA 5CAPA 1JSVA 3RCJA 4K0YA 4CTCA 5CAQA 5HIDA 5I3RA 3FWQA 2ZAZA 2W7XA 1F5QA 5L8JA 4BI1A 5BUJA 4FKLA 2H9VA 4KA3A 4RWJA 3H9FA 3I81A 5C27A 4XYFA 3KXHA 3N51A 5AR4A 4W8DA 5ANKA 4X7QA 4RJ7A 3BHHA 1Q8YA 3IW7A 4FSNA 3QTRA 4IJPA 1WBSA 5EW8A 2ZJWA 4PQNA 3MY0A 3RAWA 2XAMA 1SVEA 3NVKI 4IJ9A 4QYEA 2VO6A 4BBFA 2QKRA 3IOKA 3CE3A 1OPKA 4I6QA 4KRCA 3QKKA 4JIKA 1PY5A 3VS2A 3ZHPC 5A6OA 4PMTA 4TPTA 5IQBA 2ETMA 3GCPA 2PHKA 2E9UA 4KS8A 5CZIA 3U4UA 1YOMA 4BYIA 4L53A 2ONLC 3WZUA 4QP6A 3E5AA 3CIKA 3HECA 3QGWA 5HG7A 4PWNA 4QMOA 4BWPA 4FSWA 5LVOA 3QRIA 1UKHA 4RWLA 1NVSA 1YHWA 5EW9A 3N4VA 4ZS0A 3WYYA 4X0MA 2IW8A 5DIAA 3M1SA 3ORKA 3WF6A 3MVLA 4ENYA 4F7LA 3K3JA 2YAAA 3UQGA 4FIHA 3W2OA 1NT2A 2J5FA 4R3CA 3RWQA 3GOKA 4Q5HA 4C7TA 3VS6A 2ZMDA 5AP5A 5T68A 2E9OA 4LGHA 3G90X 4J7BA 2RG6A 3OW4A 4HYHA 2BAKA 2WXVA 3CQUA 3RJCA 1UWJA 4RX7A 4H1MA 4RA5A 3DOGA 3A60A 3V01A 3ZMMA 4GKIA 4YPSA 1ZYLA 3NNXA 5FWKK 2A98A 5CVHA 3VBWA 3HVCA 3SV0A 3C13A 5CAVA 3OD6X 3S0OA 1WBNA 2QHNA 3EIDA 2G2FA 3QTUA 2PPQA 5BV3A 3LVPA 4G6LA 4XRLA 2XARA 3HAMA 3QKMA 2OZAA 2VTMA 1S9IA 3BPRA 4AZFA 3PVWA 3OXIA 2OFVA 3VAPA 1JNKA 5HLPA 3N9XA 4GMYA 5AP7A 3UE4A 3BV2A 4IAAA 4DTAA 2B9JA 2J0JA 4RVKA 4MQ2A 3IDBA 4XCUA 1FINA 2QOCA 3VIDA 2W17A 4FNWA 3NFFB 3RNIA 3OOGA 1CKJA 2YWPA 2QOQA 2PZIA 3AG9A 1NVRA 4J8MA 3BGPA 3PZHA 4I4EA 4NJ3A 3P86A 3E92A 2BCJA 4YHTA 4AW2A 2O2UA 3OUKA 4OTPA 4HZSA 4FICA 1YI4A 3CTHA 4MKCA 3UVPA 1DM2A 4S30A 2XM8A 4L01A 3DK3A 4ZSAA 4AA4A 3IW4A 4ACGA 4G2FA 2LAVA 3ZM4A 5IA5A 4EK4A 5KX8A 2AUHA 5I0BA 4GK2A 4QMPA 3GC0A 4FL3A 4PDPA 3ZDIA 2R4BA 3WIGA 3FKNA 4K9YA 4DGOA 3FMLA 2F2CB 4ZLZA 3UPZA 1OUKA 2OFUA 3LFNA 4UXQA 1H1SA 3E8CA 3H9OA 4ZOGA 5KMJA 4EH5A 2CLXA 2UW4A 1PHKA 4U79A 1SMHA 4QNAA 3TM0A 3MH2A 2WTIA 3QCXA 5CWZA 5DPVA 5IKWA 4C8BA 3ID6C 3F88A 4YO6A 4YBKA 4NUSA 1F0QA 2QOHA 3VS3A 2ITVA 3EZRA 2W99B 5LCJA 4Z16A 2UZVA 4K11A 4ZSLA 3FQSA 5AFVA 4QP3A 3GQLA 3QKLA 5D10A 2J5EA 4FZDB 4LM5A 2VTTA 3ZO2A 3C51A 3ZTXA 4CYIA 4ASZA 4EH9A 3F5GA 2OZOA 2YA9A 3GU8A 4C37A 4W8EA 1Q61A 4D2TA 5E9EA 3FBVA 4HPUE 4JR7A 3NMUF 4L7FA 4FX3A 4XG6A 3OCGA 3R02A 3V5JA 1TKIA 4LGGA 3G0EA 4BRXA 4DHIB 1M2PA 3K5UA 3MPTA 5HICA 2R3LA 3CKWA 1JOWB 3LW0A 4XG9A 3LPBA 1FQ1B 1REJA 4JDIA 4FG7A 5K0XA 5KBQA 4DH1A 4YTHA 4O91A 5DOSA 3WBLA 2O3PA 3RVGA 2RG5A 2W06A 2GQGA 4QPSA 3VJOA 4BZNA 3ZC5A 3E87A 3MFTA 4CTBA 1JAMA 5GJDA 5CYIA 4AGUA 3BYUA 3IS5A 3COHA 5DGZA 3Q32A 5FDXA 4AS0A 4TYJA 4GFMA 5AM7A 4LRKA 4M3QA 2CGUA 4KINA 3ZEWA 2VTHA 3KRRA 3EFLA 4NTSA 4AT4A 1LPUA 3CD8A 2OF2A 4YSMA 5IF1A 2PL0A 3A7GA 3F3VA 5HESA 4FIGA 3G51A 2VGPA 1VJYA 1X8BA 2QOIA 3EQIA 2QURA 3HDMA 3QAME 1ZY5A 3A2CA 4WNKA 2JDRA 3H9RA 4DH8A 5AX3A 2ITPA 4EONA 1ATPE 1QPEA 3DK6A 3WZKA 3ZO3A 3LXPA 4Z7GA 5HU3A 2W1CA 5HCZA 3MY1A 3NCZA 4FA2A 4D2PA 5BVDA 3D7ZA 3MESA 3I1AA 2I6LA 4BTMA 1UNGA 2J7TA 5HVJA 4FVPA 4O7ZA 3KL8A 2PVFA 2YACA 4FTNA 5EH0A 3OC1A 5E8UA 4WHZA 3VS4A 4LRMA 4OBQA 3UC4A 4CFMA 4BDBA 4FZAB 3RHXA 1XMLA 4F08A 2J4ZA 2ZOQA 2W96B 4MXCA 5LVLA 4EOPA 2NP8A 4FL2A 3U51A 5JRSA 3ATTA 3ANQA 4JAIA 3PPJA 4BL1A 3E64A 5C8NA 4M13A 4DEIA 2OI4X 4IWDA 3MPAA 4GS6A 5FG8A 3I7CA 3BHYA 4ZTRA 1Q8TA 2C6OA 4FRFA 5HG9A 3QQLA 2ZFYA 4MWHA 3NNWA 1WVWA 3PG1A 4HVIA 2XNBA 4YBJA 5BQ0A 4AZTA 3DQWA 3BWFA 4AGDA 3UTOA 3FZSA 3T3UA 4Y83A 5J5SA 5CSPA 3FEGA 4BVUA 3S00A 3EWHA 2C6TA 4D9UA 4LGDA 4D2WA 4E73A 4YP8A 4DTBA 3UO5A 2XS0A 3EQCA