4U40A

Mitogen-activated protein kinase kinase kinase kinase 4 (map4k4) bound to amppnp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
SLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Structural Plasticity and Kinase Activation in a Cohort of MAP4K4 Structures
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u40A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u40A01
4MF0A 2Y4PA 4M14A 2Y7JA 4G17A 1LR4A 4L01A 2V0DA 1DM2A 5CAQA 2B55A 1H0VA 5HVKA 4CTBA 4PDYA 4BIDA 2JDVA 2WU7A 4G9CA 5KMKA 3LLAA 4A07A 2OLCA 3ORKA 4R5YA 3TJDA 3AT2A 4OT5A 4WA9A 4I4EA 4JDJA 1PXLA 4ANSA 4IZYA 4FSZA 3GCQA 4G3EA 3QX2A 4ALWA 4C57A 4CEGA 3BLHA 4ZTQA 5I9VA 5HCXA 4UY9A 4JS8A 1FGKA 2WTKB 3FWQA 3MFUA 4O6LA 1BYGA 4RJ8A 4XCUA 3KXXA 5H8GA 2R3NA 2QO9A 4ASZA 3C51A 1BL7A 3IW4A 3PE2A 3QXOA 5KMOA 4E4NA 1IAHA 3UNZA 1Q8UA 3OF0A 1H1PA 2QKWB 2RF9A 3ITZA 5B0XA 4I5HA 4WNMA 3A99A 3SHEA 3WF8A 1VYZA 1F0QA 2JLDA 3LFFA 1A48A 5M09A 4E20A 4BL1A 3IOKA 5FXRA 3R00A 4NFNA 3TJCA 5IH6A 4XNEA 4YJVA 5I0BA 5JQ8A 4NTTA 2I0VA 4AFEA 5HE3A 3KEXA 3KN6A 3W33A 3EQDA 4RFYA 4IAKA 3DAJA 1U5QA 4JL9A 5HIBA 4XG4A 1FVTA 3KFAA 4ITHA 5GNKA 1W82A 5HHWA 3R2YA 3VBYA 4OTHA 3NLBA 2PVYA 3M11A 2WU6A 3QTIA 3MTFA 2VTAA 1M2QA 3OWLA 1VJYA 3BPRA 3D14A 3O96A 4Y73A 2OSCA 5DR2A 4DH8A 1Y91A 2R0IA 3FHRA 3GC7A 5HX6A 4V01A 2BMCA 3DV3A 3KN5A 3MFSA 3OCSA 3WYXA 3HKOA 2Z7RA 2HCKA 4JBOA 5CLPA 4RQVA 2WMAA 3NUUA 4FT0A 4L3LA 4XV3A 2O5KA 4FKIA 3PY1A 2JIUA 4ACGA 4ACMA 2BRGA 1ZYDA 3FKOA 5DEYA 3C4XA 4HYUA 3HMPA 2ZM4A 4FKQA 3BELA 3IW6A 2VNYA 4UV0A 4M68A 3PYYA 2ZV2A 5CZIA 1GZNA 2GS2A 3DTCA 1NXKA 2IVTA 4DFUA 3EN4A 4QTAA 4PMMA 4D0WA 2PZRA 2E9UA 3POZA 4IAYA 3I6UA 4O22A 4LUEA 4O2PA 4FKRA 4IB0A 5KUPA 2XK9A 3UQGA 4OBPA 4BTFA 2O0UA 4LRMA 4FGBA 4BDIA 2GS6A 4FTOA 5A54A 1UU9A 2YITA 3PXYA 3PIXA 4IQ6A 4AZEA 2PMLX 3DBCA 3NNWA 2RG5A 5AUTA 4HZRA 2BAJA 4FKWA 5BUJA 2V7AA 5TKDA 1SYKA 2VTMA 4FTUA 4GJ2A 5AR2A 5AV2A 1W8CA 4RVTA 3RZFA 3FDNA 4EEVA 4F0IA 3KVXA 4EUTA 5CAPA 2QO2A 3EFLA 4FZAB 2OFUA 4XLVA 3KRWA 5CNNA 5H9BA 4NU1A 2WKMA 3ZTXA 4W9WA 3P08A 3UC3A 3ZH8A 5BVFA 3U54A 2YJSA 3R8PA 1OUKA 2P2IA 3NW7A 2C3JA 3QQFA 2OZOA 1KUTA 5L8LA 2VWYA 5HI2A 1YHVA 2A19B 3W55A 3VWAA 3BGPA 4YP8A 4FEQA 3DAEA 5AX9A 2YDJA 5I3RA 3FI2A 2G2IA 3HV7A 4MQ1A 1SVEA 1SNUA 2OJ9A 4FICA 4FZFB 1KWPA 4GU9A 3R6XA 4M7IA 5ANGA 3WARA 4BDEA 3TUBA 1SZMA 4BCHA 1MRVA 3WI6A 1U5RA 4S34A 3ZM4A 3VBTA 1QL6A 2I0HA 4XLIA 4D9TA 3R83A 4F70A 4X2JA 4AU8A 2I40A 5CTPA 4CKIA 2AYPA 3DU8A 3VUKA 4H39A 5AMNA 1WBOA 4B8MA 5L4QA 2GHMA 3C7QA 4RFZA 4U44A 4ORKA 3C5IA 4FV8A 1XH6A 1V1KA 3HRBA 3M42A 3R1NA 4OTDA 4ACCA 1YVJA 4BCKA 3VO3A 4M97A 1KOBA 2HXQA 3R04A 4FV7A 4U7ZA 5K0XA 1ZOHA 4BCIA 2F2CB 3TNHA 3KF7A 3CXWA 4HNIA 3JVRA 3E7VA 3DXNA 1NVSA 3NGAA 4KIKB 4AG8A 4EZ5A 3U6HA 3E8DA 4J52A 5AIKA 4MBLA 3U55A 1H27A 2J50A 1KE7A 4QNAA 3MDYA 4RA5A 3SXSA 4XOZA 3II5A 2QI8A 3FSFA 2JFLA 3PUPA 4NL0A 3L8PA 3CP9A 1KOAA 4RIXA 4IAFA 2NPQA 4LQMA 3TTJA 3V01A 3LFDA 2YM6A 2HZ0A 2G01A 1KV1A 1ZXEA 4FSWA 4Q5HA 5CEKA 2VTQA 1PYXA 5EYCA 4EOJA 2O2UA 3FHIA 2W9ZB 5L6PA 2CNVA 4LGGA 4BYIA 3OBGA 1F5QA 3BQRA 4DGLC 2X9EA 3FI4A 3PG1A 5EM6A 4GIHA 2X8IA 3ERKA 4QP3A 2GDOA 3BHUA 2XK6A 2Y6OA 3SX9A 1UNHA 1Q62A 2V55A 1P2AA 1Q99A 4HGTA 3AT3A 5JSMA 1QCFA 4XOYA 4CFUA 5HNIX 3FC1X 2WPAA 3NWWA 3QKKA 5JRQA 2VTPA 4F9WA 2W4KA 5LWMA 4FVRA 3GOKA 3NVMB 3S95A 3NCGA 4EC8A 1YI6A 1IEPA 2P55A 2QR8A 2UVXA 3COIA 3Q6UA 1YXSA 2PZYA 4UWBA 4ALUA 3Q04A 4QYHA 3PLAE 3I81A 4RIWA 3WF7A 2IW6A 4DGOA 4X2FA 1PMVA 4BCNA 4CGAA 2OH0E 4AGDA 1PXOA 4HW7A 4ZMEA 1Q41A 2Y4IC 3V04A 4FTTA 1UU7A 4EQUA 2PVRA 5GIOE 3UPXA 5HE0A 5HVJA 4B6LA 4Z7HA 2GQGA 5B7VA 3BE2A 3ZZEA 3WZDA 2Z2WA 5HGIA 3SA0A 1J1BA 3IS5A 3E5AA 4BVUA 1ZAOA 4WNOA 5AR8A 5CXZA 4S31A 2F2UA 2EWAA 1QPJA 4AOJA 1R1WA 3FPMA 3LFEA 4AGCA 3IOPA 1Y8GA 3D15A 3PY3A 3V5JA 3VUDA 3BIZA 5IU2A 5C4KA 2PUNA 1PW2A 4DG0E 5IMXA 4A4XA 2A4LA 4AT3A 4O0WA 3RM7A 1CM8A 4FR4A 1R0PA 1XO2B 3JXWA 4O0YA 2XF0A 3EH9A 2F9GA 3OTUA 4IM3A 4O6EA 3UJGA 2PVJA 4ANQA 5M4UA 1GNGA 4AA0A 4RFMA 3BYVA 5CANA 3LW0A 4YPSA 3SDJA 3QZFA 2OBJA 4X3FC 4CFMA 4WNKA 4XJ0A 3QA8A 4YZ9A 3KMMA 5BVEA 1JKLA 4Y95A 3DK7A 1TQIA 4DH7A 3NX8A 3GFWA 2WTWA 3QZHA 4UN0C 4RLLA 1J7IA 4H05A 2WEVA 2BALA 2E9OA 2Z60A 3QYWA 4ZEGA 3KK9A 1PHKA 2GSFA 3ROYA 4MD7E 4F7SA 4MCVA 5AA8A 4Y5QA 4ASEA 5BMSA 4IAAA 2UZWE 4QTEA 4HVSA 3NUXA 3AG9A 3DCVA 1ZZLA 4FV9A 4LMNA 4RVMA 4WSYA 3RVGA 3VUTA 5LXMA 3E64A 3K5VA 2HW7A 2XCHA 3H10A 4FKOA 2Z02A 2CN5A 5CEOA 4L7FA 2C6TA 5LCKA 2ZVAA 3TL8A 5A46A 2XVDA 4F9YA 3AC8A 3MI9A 2OJFE 3RAIA 4IX3A 2B9IA 3HDMA 2OIBA 4G3GA 1JBPE 1YKRA 2QOIA 3VS0A 4Q9ZA 2B1PA 4X21A 1UKHA 3UP7A 3UZPA 5HG9A 3QGYA 2YIRA 4S30A 2PYWA 1GAGA 2VTIA 4V05A 5HG5A 4DFYA 4UALA 3JY9A 5AUVA 2HWPA 3HMNA 3PWYA 4X2GA 3PVWA 1FMOE 3NIZA 1CMKE 3KRRA 3O8TA 3QQLA 4G3FA 4QYGA 4WIHA 3S4QA 3TZMA 5DA3A 3ZS5A 4R1YA 3GU8A 3QTSA 3R9OA 3UTOA 2FGIA 4TTHB 4C0TA 1CSNA 3LQ8A 4CT1A 2O64A 3FLYA 2PTKA 3WZEA 3DNDA 1JVPP 5K3YA 4M66A 4G2FA 5C26A 1ZYLA 4U43A 4PTCA 5AM6A 2VAGA 2CNQA 2NO3A 3LLTA 3R1SA 4IZ5A 2X81A 4D5HA 4S2ZA 5FM3A 2DUVA 4QPSA 3EYHA 5EKNA 4LFIA 1HCLA 4U8ZA 3T8OA 3A8XA 2OKRA 2WMWA 3KXZA 4K8AA 1YWVA 3C1XA 3GCPA 5M53A 2OK1A 3CQEA 4IC8A 5HIEA 4FK6A 4YTCA 2VO7A 3QTXA 2XCKA 1CTPE 4BC6A 3VBVA 2ITOA 3ALOA 3LFSA 3QU0A 4I22A 5E8XA 3JY0A 4BHZA 5K9IA 5DR9A 3LFCA 1QPDA 4FL1A 3SOCA 1IRKA 3LCTA 1OKWA 4C38A 2PE0A 3FXXA 3VS3A 4EOOA 5CZHA 5LMKA 3Q96A 3CR0A 2G2FA 4EYJA 2GNHA 3NAYA 1GOLA 1PMUA 3FMNA 1FINA 3MPAA 3K54A 3F3TA 3RPOA 3LXKA 3FQSA 2FSTX 3GU7A 2LAVA 3PTGA 4QYFA 4R3PA 3U51A 4JDKA 5FP6A 3HDNA 1U54B 3A7FA 2VWXA 4H58A 1YW2A 3IDCA 3LCSA 4O38A 4JR3A 4RVKA 4I21A 2X7OA 5E9EA 1Q8ZA 1PXNA 2IZTA 5AV3A 5HD7A 1WAKA 3B2TA 5D41A 4F9CA 4Z16A 4CVAA 4EBVA 1MUOA 3ORLA 2UZTA 3DT1A 4KKGA 2P2HA 5IDPA 1SM2A 2EUFB 3MH3A 4L53A 3QC4A 3FAAA 4LL0A 2GFSA 4NIFA 3R8LA 5DVRA 4NYEA 4FKJA 4QRCA 5BVKA 3Q32A 4B0GA 4U9AA 1ZY5A 3EYGA 4YJQA 4ZS0A 1Q8WA 2PU8A 1OL5A 4F7NA 5JGDA 4E26A 2NNWB 3LHJA 4C7TA 3O23A 3ORIA 4UYNA 4PUZA 3PPZA 3GC9A 5JFWA 4YJNA 4DEDA 2YIWA 3NNXA 3QTZA 4K77A 5EDQA 3JS2A 1Y8YA 4K33A 5HBEA 4NK9A 3KXHA 4JDHA 4A9UA 4D1XA 4HVDA 1Z9XA 4FNYA 4KS7A 4EH8A 5BYYA 3QZGA 5C27A 3G15A 2CCIA 2C0IA 4JR7A 1ZYSA 1MQBA 3GU6A 1H1QA 3CTHA 3SXFA 2IVSA 4X6QC 4JG7A 4EOLA 4FMQA 4PDOA 1JQHA 3FZPA 5K4JA 4F99A 3UIXA 3ACKA 3Q2MA 3LOKA 4JX7A 4BCQA 3VIDA 4QP6A 5LVMA 1H08A 1OM1A 4IVBA 3GT8A 5KZIA 2XKEA 3D0EA 3C0IA 4R7BA 5BYZA 3KXNA 2YERA 3RK9A 4H36A 1V0OA 2GNLA 5F95A 3RJCA 3LKMA 4ZSGA 3W18A 1H24A 4D0XA 5JFSA 2WMQA 3OTVA 4KNBA 4KBKA 3WF6A 4ACHA 2W1HA 4O2ZA 2BRBA 2C4GA 3MFTA 4IEBA 4E6QA 4ZSAA 3AQVA 2IG7A 5F94A 4ZLYA 2WEIA 5CF4A 4UXQA 5CYIA 3OCTA 3HZTA 4GIIA 1XBCA 2Q0BA 2W17A 3NPCA 1VR2A 2GS7A 2VTNA 4QD6A 4WBBB 4WNPA 4APCA 1PMNA 1Y57A 4ZY6A 4O7NA 1UA2A 5E91A 3VS1A 2XNMA 5TE0A 1ZMWA 4UMTA 1OPLA 4MX9A 4YJRA 3VS2A 2OG8A 2PZ5A 4FTKA 5LVPA 5F1ZA 3I7CA 4I6HA 4AE9A 3LIJA 4FBXA 4DA5A 3F6XA 3BHTA 3ZXTA 4O27B 2KTYA 4R77A 5C8NA 2B52A 2C68A 4A4LA 2YDKA 2C0TA 2QOLA 3OMVA 3ZRLA 1W0XC 4W4YA 5L6OA 2BAQA 3DAKA 3REPA 3LFNA 4EZ7A 1U4DA 2Y0AA 3ZDUA 4AOIA 1XH5A 2HZNA 2ZM3A 5CSVA 4JQEA 5LMBA 3CKWA 4FZ6A 3CC6A 2ZV9A 1ZMVA 3KMUA 4ITIA 3SRVA 5AEPA 3BHVA 2YWPA 4RIYA 4Y5HA 5HQ0A 4MXXA 1BL6A 3A60A 2UUEA 3QRKA 3SRVB 1QMZA 3OVVA 4RIYB 3ODZX 4CFFA 3P4KA 4D9UA 5A3XA 3SXRA 1GJOA 5L2QA 2CLQA 4TYEA 2B9FA 2UW4A 2VWWA 4GG5A 2C1BA 4FVQA 3ZC5A 4U42A 4UMQA 3UIUA 4QMNA 2VTSA 4RWKA 3E8EA 1PRYA 3Q9WA 4CV8A 5CVGA 2PUPA 4D2PA 1WFCA 3R0TA 5FEEA 3OROA 2BDFA 4BZNA 5HG7A 4CG8A 5DOSA 3KMWA 3VQUA 4E3CA 4YBJA 4QQJA 5HICA 3RNIA 3UIBA 4I92A 4OTGA 1A9UA 5ANJA 2UZBA 3TEIA 4HGLA 2VX1A 3LAUA 2XNNA 5F4NA 4EOIA 4YZBA 3BV2A 4O7RA 4ZXTA 2VTLA 1YOJA 3F3ZA 4AXAA 2VUWA 3MIAA 3R73A 4NKSA 3S0OA 3BGQA 4FYNA 4M3QA 4E4MA 4FV4A 3W2PA 3NNUA 3TCPA 2YZAA 4BB4A 3WF9A 4IFCA 3FXZA 2PULA 2X6EA 1DI8A 3CQUA 3IDPA 5AUYA 3FKLA 3HRFA 4KRDA 1V0BA 4LUDA 4EH5A 2X4FA 4NM5A 4YC3A 4WOVA 4AZFA 4Z3VA 2FSMX 2PWLA 1OL7A 2Z7QA 2J90A 5T6KA 3DKGA 3D2IA 3G6GA 3MH0A 5E8TA 4F0GA 5I9XA 5EW8A 2OI4X 1XR1A 2YACA 3BGZA 5J9ZA 4ZJVA 3E8NA 3KULB 5CEIA 2YLEA 3Q3BA 4EK8A 1P14A 4AT5A 1Q5KA 4I6BA 2WMVA 1ZY4A 2BFXA 4CFVA 1BLXA 3R28A 4IBMA 3DTWA 3C9WA 3G9NA 4R6VA 4XMOA 3RPYA 3TZ8A 3W8QA 4EI4A 5C8KA 4YLJA 2BRMA 2Y4IB 3H9FA 4OTWA 4HVGA 2R7BA 3F61A 5EG3A 4C36A 2FA2A 4HVIA 2R3RA 1H00A 3CGOA 4XS2A 4XX9A 4MVFA 5AP6A 4ZTHA 5FTOA 3T9IA 3WOWA 3WILA 3G0EA 2HY81 5HOAA 4MXOA 5D9HA 2QLUA 3L9NA 1JSVA 4EK3A 4F7LA 2ZAZA 4LI5A 2VWBA 4M12A 5EI6A 5T68A 2HENA 4R1VA 3QCYA 4F64A 1JSUA 5EQPA 2QO7A 3W8LA 5TT7A 2ZB0A 3DPKA 4M0YA 4DN5A 3D7TA 4MD8E 3ZEWA 3VBXA 4QTCA 2J51A 3QHRA 1H1RA 2JDRA 2O8YA 4ZK5A 4FEWA 3CQWA 1UKIA 2GQRA 3MSSA 4APPA 2BFYA 1KE8A 3BCEA 4GSBA 5JGAA 4FZ7A 1ZWSA 3EL8A 1PF8A 3Q6WA 4EKKA 3QRJA 3ULZA 2V62A 1WBSA 3PSDA 1P4FA 3LXLA 4U45A 3V3VA 4J95A 2GU8A 1M52A 4IZAA 4X3FB 3CD3A 4J53A 3U9NA 3N4UA 4MD9E 3HLLA 1YOMA 5EDRA 4TWCA 2GHLA 4I5MA 4RJ5A 2IO6A 3ZHPC 4YR8A 3N4VA 3I79A 5IH5A 4FKSA 5CU6A 5HNGA 2OJIA 1DAYA 4WG4A 4WHZA 3UDBA 5HLNA 4Y83A 4NZWB 4KA3A 3D7ZA 4PDPA 3TNQB 5GJDA 2E2BA 4ONAA 1S9JA 3G33A 1YXXA 3THBA 2XIYA 3EMGA 3E87A 4MQ2A 3PWDA 5CU2A 4DCEA 4RPVA 3ORTA 4QNYA 3NSZA 3O17A 4MBJA 5DPVA 4W8EA 4B99A 2W4OA 2CSNA 3GB2A 4G16A 2RFSA 4GK2A 4FG8A 4YC6A 5EQEA 4PDSA 3A4OX 1G5SA 4D55A 3DK3A 1R0EA 2XRWA 2NP8A 2PVFA 3FUPA 2BRHA 3EQIA 3MYGA 5HTCA 3LZBA 3KK8A 2C3IB 2OXXA 2ZB1A 5AAGA 4DEEA 3HV3A 3AOXA 3O71A 3QAME 5M51A 4FODA 3H4JA 4JXFA 5IQCA 4F65A 4ERWA 2Y8OA 4XP2A 5IA2A 4H3PA 2CGVA 5EHOA 2OO8X 4JIAA 3RHKA 2W1CA 3A7IA 2JKOA 3F3UA 2PK9A 4PNIA 2ITQA 2YIQA 5DT3A 5CNOA 2CGXA 3SAYA 3P0MA 2P3GX 3NZ0A 4KS8A 5HIDA 3UVPA 3TNPC 5CWZA 4X0MA 5CQUA 3Q53A 4PL5A 4BBFA 2EB2A 5TOZA 3C0HA 4EH6A 5IUIA 4AT4A 4E5BA 4L7SA 4CFWA 2J5FA 4JAJA 4F6UA 4QT1A 1I44A 4YNOA 4II5A 3OUKA 4QTDA 3DKFA 2YJRA 5DHJA 4DTAA 3R7OA 5M4CA 1K2PA 2OJJA 2UW8A 4MXYA 3U4WA 5CF5A 4OAVB 3UO5A 3GC0A 4RWIA 2JC6A 5FXSA 3W2OA 2XM9A 4RC2A 3O7LB 4L42A 2WTIA 5CAUA 5HBJA 2J0MB 2PHKA 4J96A 3UYTA 5DEWA 3BWFA 3TWJA 2WXVA 2I1MA 3D4QA 1S9IA 2F4JA 5HKMA 3VJOA 2Y6MA 2QOFA 2GPHA 3F7ZA 3VNTA 3TV6A 4EH7A 1M2RA 2WFYA 3UQFA 3BEAA 3UZTA 1DS5A 4EKLA 1OL1A 4EC9A 2XEYA 3MW1A 2C69A 3DNEA 3HUBA 3OCBA 4RLKA 4BRXA 3JYAA 2PVLA 2GTMA 3W1FA 1KE9A 4WO5A 4EK6A 2P0CA 3POOA 4YJOA 5K5XA 3ACJA 3FMHA 5ETFA 5E1EA 5GHVA 4IB5A 2CN8A 3R2BA 4NCTA 3VF9A 5J9YA 4J71A 1OL2A 4C4IA 3OFMA 4YTHA 3EKNA 2W1IA 3HP2A 3UBDA 2BHHA 4M67A 3PDTA 4QQTA 1YXVA 3OCGA 2XJ2A 3NAXA 3JPVA 3OW4A 5DWRA 4IIRA 4L3JA 2OH4A 4FT5A 4KAOA 4CT2A 4AN2A 5JKGA 1T46A 4M69B 1MQ4A 3QRUA 4CMTA 3VQHA 2RSVA 2JIIA 3BV3A 1RW8A 4QMPA 3SKCA 3F2NA 4PP9A 2W06A 2W7XA 3DB6A 2F57A 3MV5A 3QCSA 3AMBA 4FC0A 2C47A 5AV1A 1XH8A 5I9UA 4FT3A 3VS7A 4QMVA 2E9PA 5JRSA 5IQDA 1DI9A 3E3BX 4TY1A 3DBFA 4JQ7A 3RAKA 4YO4A 4PQNA 2XUUA 4TW9A 4BDFA 4Z9LA 3CLYA 5KO1A 3PJ2A 5ANOA 2JDSA 3PIZA 3OOMA 4YPDA 3TNWA 4PMPA 4LMUA 2CHLA 1LUFA 4NSTA 5IQBA 3T9TA 2BPMA 3DLZA 5CASA 1XBAA 2PMIA 4K6ZA 4KKHA 4O21A 4RWLA 2BUJA 5ETAA 3FJQE 2R2PA 2XH5A 4W9XA 3Q4TA 3FZTA 4FGRA 2HZIA 4MK0A 3QLGA 4FTMA 4B7TA 2CJMA 5KX8A 5I4NA 3N4TA 2UZDA 1ZOGA 3E93A 3FQHA 1XH9A 3LM0A 1YOLA 2AUHA 2RFDA 3MA6A 4H1JA 5G1XA 5EK7A 3AGLA 3FMJA 3K2LA 5CVFA 4KIKA 3ZO4A 4P7EA 4O7ZA 3NR9A 3P7CA 2OFVA 1M7QA 3PSCA 4EHEA 4Z55A 4IX4A 3OY3A 2G1TA 3T3VA 1XJDA 3QD0A 3FV8A 3BYMA 3BLQA 2UZLA 4L45A 3H9RA 3R8ZA 4O84A 3R7IA 5BNJA 3DA6A 1APME 2R3KA 2X9FA 4DEAA 4XP3A 4CCUA 3RAWA 1IAJA 1H1WA 4QP7A 3PJ3A 4RT7A 2J0IA 4I5CA 1J7LA 3BKBA 3NYVA 4U80A 3ZBFA 2UZVA 3P79A 1ZLTA 3KL8A 5DRBA 5LVOA 2BHEA 2HK5A 3KVWA 4O83A 5DYJA 4GUEA 3SOAA 3ORMA 1B39A 4DEIA 2JGZA 4CCBA 2F7EE 2C5VA 4IE9A 3CPCA 4RJ7A 4CQGA 5AIRA 2HW6A 3F66A 2VNWA 4GS6A 2VX0A 4O1PA 4DE4A 4OT6A 4GFMA 2EVAA 2GNIA 3V5PA 2DYLA 4IX5A 3ZOSA 3ZDIA 4BGQA 5IQIA 5GINE 5AWMA 4BCJA 4PNKA 4FE2A 3P7BA 2JBOA 3EJ1A 3EFKA 3DZOA 4I0RA 5FDXA 2XK7A 2XS0A 3UVQA 4A06A 4NWMA 4HJOA 1GZKA 3B2WA 4L9IA 2A2AA 2X4ZA 2ERZE 3MY1A 3TIZA 4O7TA 3R1YA 3EKKA 1TQPA 4C2WA 3UOKA 5FD2A 3COMA 3BHHA 2XEZA 2FSOX 2CPKE 5JFVA 5A4QA 3KGAA 5EYDA 1ERKA 2C3LA 5HG8A 3ZSHA 3FMLA 4K18A 4EQMA 3FC2A 4BZDA 4C3RA 3AGMA 1B6CB 4KB8A 4S32A 4EJ7A 4D2RA 5HVYA 3UYSA 4D2WA 4RSSA 5M57A 2WOTA 4KIOA 1V0PA 3R63A 4QTBA 1H4LA 4EOPA 3O2MA 3BQCA 3FZ1A 5DBXA 4C59A 3N9XA 4Y8DA 1YQJA 2OIQA 2WTJA 5AR4A 5LARA 5GZ8A 3R71A 4KUJA 2VWZA 4X3JA 2BDJA 3G90X 2PSQA 4FKTA 2BCJA 5EOLA 3BU6A 2RL5A 4MYGA 5HLWA 4KD1A 4JBVA 1H07A 2XA4A 2JBPA 3KRXA 3UPZA 3AC3A 3DBQA 3DQWA 3VBQA 3W2CA 2B0QA 3ZM9A 3RWQA 4CFNA 2JAMA 1KV2A 5KNJA 2YWVA 1M7NA 1OKVA 5BVDA 2QU6A 4QP2A 5HZNA 1OIYA 2HAKA 4IB1A 5D12A 5L2SA 5CSPA 5CSWA 5KE0A 2F7ZE 5KBRA 3QQUA 5AUWA 5AV0A 3WIKA 4CXAA 5H3QA 4ANMA 4TN6A 3ZLXA 1OKYA 5J5TA 1UVRA 4OAUC 3KRJA 3LQ5A 5FRIA 5KHWA 1FVRA 1WCCA 3V51A 4P4CA 3ENHA 4XYFA 4FI1A 5BMMA 3RALA 2X7FA 1E1VA 4XV2A 4ALVA 2YIXA 4GYGA 4TPTA 5J1VA 4ZLZA 4XBRA 4DFBA 2OZAA 3EB0A 5CU4A 2J0LA 4EJNA 3RM6A 4R5SA 3HV6A 3A4PA 4FKLA 3SLSA 2OZAB 3NUYA 5CSHA 3UVRA 4WG5A 1G8AA 3KREA 2XK8A 4QMSA 3F7WA 4I5PA 3D5XA 3FYJX 3KKVA 2W1ZA 3PZHA 4JI9A 5HO8A 3ZONA 4C3FA 3EZRA 3CPBA 2P33A 3R02A 4FL2A 4H3QA 5CALA 4I6FA 4IM2A 4L6QA 1Q4LA 4RQKA 2R3FA 3TUDA 5C8MA 4LL5A 2GCDA 4L46A 3TACA 4YZDA 4BDDA 2BRNA 4CLIA 3SW4A 4PF4A 4PPCA 4FTNA 5ACKA 2JKKA 4K11A 1K3AA 4A9YA 3CS9A 2PVNA 2XNOA 4IAZA 4UZDA 4KBCA 2YABA 2QR7A 4EWHA 5BQ0A 4HVHA 1PKDA 3TDVA 3CGFA 4I41A 5AR5A 2C30A 3WE8A 4C8BA 3EFJA 4XRJA 4JIKA 3TUCA 5M07A 3SG9A 4QMTA 1XH7A 2C6MA 4OTFA 3FMKA 2WD1A 3CEKA 4PTGA 2B53A 1W84A 4FTJA 4WUAA 4W8DA 2ONLC 4D4VA 4TL0A 5IISA 4E7WA 2J9MA 2WMXA 3F3VA 4AX8A 3HGKA 5KKRC 5I9WA 1GIJA 3G6HA 5EI2A 5D1JA 4IDVA 4TKSA 3F82A 4CSVA 2QLQA 2UW0A 3LFBA 3Q9XA 5J1WA 4KIPA 3W2QA 4F09A 4Q2AA 2PMOX 5JQ5A 4QPAA 4IDTA 4OUCA 1NVQA 5M55A 5CENA 5IQFA 3GC8A 3HRCA 3FLZA 3MS9A 3ALNA 5CT0A 4HNFA 5A14A 5A4LA 5DG5A 2HELA 5FDPA 1YRPA 3SV0A 3V6RA 3KF4A 3EN5A 4MNEA 4BWXA 1BI7A 3RMFA 4BTKA 5KMIA 2OICA 5IH4A 3UMXA 3MJ2A 4J97A 4MNEB 4NEUA 4FYOA 4TWOA 5CEPA 4OTIA 1GY3A 2IJMA 4F1MA 3MESA 4GFGA 1R39A 4YNEA 1W7HA 2XJ1A 3EWHA 4MXCA 1NW1A 5IA1A 2BKKA 4BWKA 4D1SA 4I6QA 5CSXA 5HD4A 4XG2A 4ANOA 5AUUA 1XQZA 4ZSLA 4O82A 2BAKA 4N6YA 5CY3A 3RP9A 3OS3A 3PXZA 4G6NA 4S33A 1R3CA 3QQKA 1OUYA 4AZSA 5L6WL 3VC4A 2ZOQA 2VU3A 1UU3A 3E3PA 3VW8A 4KRCA 4BDGA 2FO0A 4FEXA 2OW3A 1VZOA 4GH2A 3WF5A 5JFXA 3P86A 1E1XA 4O7YA 3CJGA 4RJ4A 3MB6A 2WTCA 5K5NA 4BDKA 4EHZA 3UOJA 4AUAA 2GQSA 4C34A 2X6DA 5ETCA 5BPYA 5JEBA 4JAIA 1U54A 2XYUA 4ZSJA 3W2RA 3LJ0A 3IW8A 5JK3A 3LJ1A 5L2WA 5EM7A 1E9HA 4C37A 2C6DA 2UZUE 4YSJA 3UOLA 3ZO1A 4FT9A 2X2MA 2WMUA 4PMSA 5BX0A 5C01A 2BTRA 4IWPA 4D4SA 2ESMA 5A6NA 4RJ3A 2Z7LA 1URWA 4FKVA 5C03A 3ZSGA 1OL6A 4XG6A 3QGWA 4EOMA 5A4CA 4D5KA 4O7WA 4FKUA 4FTQA 2XIXA 4DFNA 1K9AA 3VHKA 3ZC6A 4DC2A 4RC3A 5D10A 4QYEA 4YSMA 4O7SA 4O0VA 4NW5A 2HY0A 2QHNA 3GXLA 4JJRA 1R78A 1TKIA 4K2RA 4KIQA 4YTIA 4D28A 5B2LA 5ANEA 4AN3A 4EOQA 4BCFA 2YCQA 2R3PA 3KB7A 3OXTA 4GJ3A 5H2UA 2BROA 1WBPA 2QG5A 4EHGA 2WAJA 3LXNA 3RNYA 4X2KA 4O1OA 3FE3A 2J6MA 3HNGA 4GRBA 5E7RA 3DXPA 3GCUA 1OI9A 3QKMA 4G3DA 4IADA 2O3PA 3OC1A 2YM5A 4L00A 3QWJA 4XHKB 5EH0A 3R8UA 2GMXA 2B54A 3QTWA 2I6LA 3DK6A 3ID6C 3VUHA 4YU2A 2P4IA 2GNFA 2C5NA 5CI7A 1UWJA 3UO6A 4FOCA 4BKJA 3QTUA 5IA3A 4RGJA 3PA4A 4FUYA 5FP5A 3TXOA 4FIIA 1REJA 4LV8A 2EXMA 2R3GA 3WYYA 3MVMA 2R3JA 3QX4A 3U8WA 4CYJA 4IWDA 2HOGA 4D2TA 4TNBA 5EW3A 4FTAA 1U59A 2OJGA 4ZIMA 2J0KA 3MVHA 3CBLA 1M17A 1PXPA 3ANQA 3BZ3A 4NFMA 4YZMA 4AGUA 1RJBA 4O0RA 3TKIA 4GFOA 2WHBA 4F9AA 1IR3A 2Q83A 1Q8YA 2H8HA 3OEFX 4U3YA 2BZJA 3VF8A 1ATPE 4BN1A 5B2MA 4HZSA 4JRVA 2PY3A 1UWHA 3EQCA 4FKGA 3VUGA 3L1SA 5E90A 1AQ1A 2YCRA 2UW9A 2QQ7A 5LMAA 5HTIA 3S00A 5DRDA 4YC8A 4QP1A 3R7VA 3EOCA 5I5ZA 4AW0A 5M44A 5D7VA 1FGIA 2JIVA 3NUSA 4BCMA 4F1OA 4NM3A 4NM0A 1NA7A 3LCKA 4BZOA 4QQ5A 4E5WA 5EHLA 2UZNA 4FV5A 4J99A 2O63A 3AC2A 4D1ZA 3EN7A 3IPHA 3QBNA 3BYUA 2VO0A 1JLUE 2BZHB 5ICPA 3VW6A 2WTVA 1F3MC 4QYYA 5IA5A 3VHEA 1U46A 5B2KA 4CLJA 3ZUUA 3AMYA 4KKEA 2WIHA 2JKQA 3F5UA 1WBVA 3TN8A 2QURA 2X2KA 3EQBA 3RPRA 4GMYA 4C4EA 5CU0A 5IDNA 3FXWA 4EOSA 4U97A 3BYSA 4F6SA 4AE6A 4AN9A 1ND4A 2IW9A 1YDRE 2W5HA 4G5JA 5E8VA 5FM2A 3RBWA 3SG8A 3MH1A 2R0UA 1ZMUA 2ITXA 5BUIA 3ZLYA 3L9LA 4HCUA 4RVLA 1CKPA 3DXQA 4U81A 2AC3A 4BYJA 3MFRA 5AA9A 4N6ZA 1LEWA 1YI3A 2RG6A 3QD4A 4TYJA 3OWJA 4UZHA 4FA2A 2WB8A 5J7HA 3TNIA 2QOKA 1H8FA 3QUEA 4FX3A 4E1ZA 3D83A 5HE1A 3MJ1A 2UVZA 4IVCA 3ZFYA 2HIWA 2C0OA 3RTPA 4CRLA 3C4ZA 3LFAA 4O91A 3UODA 4DTKA 2A27A 2H96A 3AXWA 3D2KA 3DB8A 1H01A 3ETAA 4GVAA 5AJQA 4DAWA 3Q52A 3I6WA 3IECA 3KCKA 4HCVA 5IG1A 1IASA 1UV5A 4HPUE 3ZYAA 3LJ2A 2G2HA 3EQGA 4ASDA 3ATTA 5DIAA 3SGCA 3W10A 3D94A 1YXTA 2ZV7A 5L2TA 3E8CA 2WIPA 4N70A 3FI8A 5CVHA 1PJKA 3FEGA 3RGFA 5KMLA 5FTQA 2UW3A 3QLFA 2HZ4A 3MY0A 3PA5A 2J4ZA 4FV3A 2VZ6A 4UEUA 1BKXA 4NTSA 5HO7A 3RINA 1UU8A 5L8KA 3HA8A 4L52A 2JDTA 3FZOA 3NCZA 4QMZA 4RWJA 3PVUA 4C4GA 5LWNA 4PWNA 4JQ8A 4L68A 1WBTA 3U6JA 3HECA 4N0SA 3ZCLA 5AX3A 5M4IA 2ITNA 4Y72A 4Y46A 4DGMA 1RDQE 2QKRA 2W05A 3HX4A 5DI1A 2XIZA 1FMKA 2VX3A 3E88A 4GEOA 4BCPA 3ANRA 3RCJA 3VS4A 2O65A 4G5PA 3IO7A 5KBQA 2ETRA 4QO9A 2FVDA 1NY3A 2WTDA 4KBAA 4CKJA 3LXPA 1ZYCA 3QD2B 2X2LA 3F3WA 3KULA 4FNWA 3S3IA 2IPXA 1WMKA 1JWHA 4BDJA 4FK3A 5ETIA 3FL5A 2IN6A 1Z57A 2BZIB 3QHWA 4RC4A 3LMHA 1MRYA 3HMOA 3OT3A 1H26A 4G31A 4CZYB 5GJFA 2IZSA 2YM4A 5AUZA 4MWHA 2F7XE 4TYHB 3Q2JA 2OWBA 3Q4UA 4AW1A 2XBJA 3VAPA 4LYNA 4QP9A 3V8WA 2WMBA 3FY2A 4RX8A 4DG3E 4F08A 3GEQA 4W4WA 4ZTRA 2WQNA 3PE1A 3NNVA 4BFMA 4BHNA 2R64A 4FIJA 5AP5A 3R7EA 3ZRKA 3GOPA 2YCSA 3EHAA 4AZVA 5FUTA 3VBWA 3HVCA 1MRUA 4IH8A 4KINA 5AUXA 4YBKA 5J8IA 3ZFMA 3HEGA 5J9LA 3I5NA 4ZAUA 5I3OA 3FLQA 4EK4A 1EH4A 2GFCA 5AAFA 4FL3A 2OF4A 2IW8A 4KSPA 3K5UA 5FBNC 5AR3A 3HV5A 4EONA 4P2KA 4PMTA 5AP1A 4G3CA 1XWSA 2J7TA 3D5WA 3PRIA 4XV9A 3L9MA 1Q3DA 2CCHA 3ZUVA 2WNTA 1WBNA 4X3FA 5CI6A 3WZJA 4MXZA 5FQDC 3GCVA 4IWOA 3CTJA 4BKYA 2E9VA 5F9EA 3DFCB 4YUQA 3SC1A 5KMJA 3BBTB 5E8WA 2OIDA 4XRLA 3DQXA 2ITZA 2DQ7X 3LPBA 1AGWA 2R5TA 3V8SA 5M08A 4XUFA 2RFNA 4RA4A 2XNEA 3GI3A 2UZEA 3MTLA 2C1AA 3OW3A 3BRBA 4PPAA 4DEBA 3DKCA 4MXAA 2VO3A 2C6EA 5BVOA 1YHSA 5EKOA 1PYEA 2WMTA 4IFGA 4G9RA 3IKAA 4ZTSA 4P5QA 4R7IA 4FV0A 4LRJA 2UZOA 4CMOA 4FEVA 1Y6BA 4R78A 2RGPA 4J8NA 3MIYA 1WVXA 5LOHA 4IACA 2H34A 4C35A 2OF2A 1PMEA 4BICA 3JR1A 1FOTA 1YDTE 2VWVA 3C0GA 3PXQA 1WVWA 3TG1A 3U87A 1L8TA 2CDZA 1Q24A 3NEWA 2ZMDA 4U0IA 3MVLA 3AMAA 4I4FA 4B4LA 4QMQA 3PP0A 4A9TA 4F1TA 3GP0A 1OECA 3PXRA 3Q4CA 3HV4A 4PPBA 4R3CA 4YHTA 3ORZA 3IGGA 4Q9SA 5AADA 5HTBA 4G1WA 4U6RA 3A2CA 3IW7A 5E4HA 1YDSE 5AR7A 5CQWA 1IG1A 3A62A 3CSVA 4C4HA 2G9XA 1TVOA 5CEQA 4DYMA 3QWKA 2FB8A 1OKZA 4FV6A 1URCA 4I1ZA 3LM5A 1WZYA 1OPJA 4CRSA 4CV9A 3O51A 4MBIA 2W1EA 3TV4A 3EQFA 5LMKC 4BIEA 1OBDA 3FZSA 3WZKA 5EM5A 2JKMA 3S2PA 2RFEA 4IW0A 4UWCA 3C4CA 2J0JA 4DH5A 1MP8A 4CD0A 3QF9A 5E8SA 3QRTA 3PVGA 1IA8A 3ZEPA 5IPJA 2CKQA 3ENMA 1ZOEA 2ERKA 4IVDA 1PXJA 5H8EA 3OT8A 4YJSA 4CG9A 3NUNA 1H25A 4A9SA 2WGJA 4WG3A 5IQAA 3OBJA 3QYZA 3BHYA 2VWIA 3PJCA 5GJGA 3JVSA 3V5WA 5EOBA 5FGKA 1CKJA 4AA4A 4CNHA 4IJ9A 4RX5A 2PVMA 4BIBA 2Z7SA 3Q5IA 4DINA 3GCSA 4HGSA 3HAMA 4O81A 5CEMA 1G3NA 3DBEA 2R9SA 4AAAA 4UMPA 1G8SA 4PL3A 2V22A 2W1FA 4D4YA 5KHXA 4GU6A 4GCJA 3ZSIA 4GW8A 4IB3A 2VRXA 3UG2A 4DEGA 4R7HA 4EK5A 2X1NA 5AAEA 3QD3A 3RAHA 4OTQA 4B9DA 1Y6AA 4GV1A 3HP5A 4D2SA 3EN9A 3QCXA 3DFAA 4ENXA 2HXLA 4YURA 3I5ZA 3R7GA 3S1HA 4IM0A 2XMYA 3IGOA 3QQJA 4JT3A 3AD4A 4TNDA 2QNJA 3T3UA 5LQFA 1FPUA 4GYIA 4UB7A 2YM7A 3PXKA 4I94A 4NW6A 3Q5ZA 5T3QA 4FG7A 2WOUA 3ULIA 5HORA 4HYIA 3EL7A 4OW8A 4QQCA 4ZY5A 3TM0A 3VS5A 3BU3A 4GVJA 3UQCA 3FBVA 1JSTA 3C4WA 4M69A 4LOQA 3U6IA 3C5UA 3E92A 2E9NA 1P5EA 3HUCA 3U4UA 2QD9A 4PV0A 4GG7A 5FTGA 3QFVA 1XKKA 4FEUA 4XEYA 4CZUA 4DITA 3IG7A 1XH4A 3COHA 3LE6A 3UE4A 1JKKA 3LCDA 1J7UA 3NYXA 3OZ6A 5J87A 2VTOA 3L9PA 3IONA 4AF3A 2REIA 4HYHA 2R3OA 3AT4A 4FSQA 3F5XA 2YN8A 4XV1A 5KMMA 4AQCA 4MAOA 4QMXA 4ZJJA 4U41A 4JX3A 3ZMMA 3EFWA 4YMJA 4FTRA 4RIOA 3VVHA 1T45A 4EHVA 3PXFA 2QOCA 2UW7A 3A7HA 2C5OA 2QOOA 2BKZA 3IW5A 1NVRA 3GQIA 5TF9A 5AV4A 4ITJA 3GFEA 5GZAA 4FNXA 4CKRA 4K0YA 2VN9A 4UXLA 5DT4A 4BCOA 3KRLA 4LGHA 4MTAA 4L67A 4NH1A 2GNGA 4DF3A 4X6RA 4XG3A 2B9JA 4EWQA 5KMNA 3ORXA 3Q9ZA 2XKDA 1H0WA 3ET7A 4EOKA 3PIYA 3UG1A 4BDCA 2XNPA 3FLSA 3VRYA 1KE5A 4DH3A 2W96B 5E1SA 4N57A 3DJ7A 4O96A 4E8AA 2C6OA 2WO6A 5FEDA 4E6DA 4QMUA 1YHWA 1PXIA 2H6DA 3FQEA 5DT0A 5EHYA 5HBHA 1W83A 1WVYA 2CMWA 3H3CA 4NKAA 4AW5A 3BE9A 4USDA 3UMWA 3SVVA 3AC5A 4YGAA 1IA9A 3UO4A 3R9HA 3H0YA 4FSUA 4FSTA 4TYGA 4U5JA 3O8UA 5J95A 4F9BA 4O0UA 4GK4A 3WIGA 3MN3A 4E93A 4RX9A 2C5YA 3C13A 3E63A 4TXCA 2XB7A 3OY1A 5EFQA 4BI2A 5JZJA 3MGYA 3QXPA 4XP0A 3QTQA 5A9UA 3NVKI 4AOTA 4F63A 4ZOGA 3A61A 3R1QA 2FH9A 1JPAA 5HE2A 4ZS4A 1NT2A 3QQHA 1STCE 2ITWA 5AP0A 4UBAA 4FG9A 3A7GA 1M14A 4EZ3A 4FSRA 4IX6A 5HCZA 4BBMA 4XH6A 3NUAA 5DR6A 1ZZ2A 3B8QA 2YLFA 4I0TA 2IVVA 4E6CA 5JT2A 5BVWA 2GTNA 2QOHA 4IZ7A 3PJ1A 3TI1A 1P4OA 3EN6A 2YFXA 4K1BA 4RZWA 4BGGA 1HOWA 3R8MA 3TT0A 4YHJA 5J7BA 4G6LA 3O50A 5CAOA 2R3IA 3K3IA 4RIXB 5CX9A 3BLRA 3P9JA 1WBWA 4GK3A 3VUMA 3P5KA 2CGUA 2ZDUA 3WE4A 4EBWA 4RMZA 4UMRA 2CLXA 3MPTA 5C4LA 3RPSA 3ZRMA 2YDIA 3DDPA 1JKSA 3P7AA 4GT5A 3FI3A 2RKUA 4OTPA 2C6IA 2OXYA 4DBXA 2PE2A 3MVJA 3BI6A 4BDAA 5HU3A 4GKHA 3H9OA 4MKCA 4O7VA 3DZQA 2QOQA 1XHAA 4IC7A 1Q61A 2EU9A 3D5UA 4QOXA 5EYKA 3BEGA 2OGVA 3EQRA 4J98A 3A8WA 5M4FA 2LGCA 2W0JA 4MH7A 5AP2A 5DE2A 2J5EA 3KU2A 4C58A 4ZSEA 5A6OA 4P90A 2IZRA 2PZIA 4KABA 4CMUA 3B8RA 4IWQA 4ZJIA 2BILB 4CFXA 4NUSA 2R3HA 4G6OA 4WUNA 2DS1A 4I20A 4UYAA 5JN2A 4EYMA 2JITA 2J2IB 5IQEA 1GZ8A 3FMMA 3GVUA 3PFQA 3DJ5A 1Q8TA 3FY0A 4RIWB 4AFJA 4BTMA 4DLJA 5IA4A 3AC4A 1ZRZA 4IHPA 5FXQA 1RE8A 2R3MA 4NJ3A 3R8VA 2RIOA 5M06A 2I0EA 2X7GA 4HPTE 2X0GA 4WD5A 2VTHA 2VTTA 4AZTA 4DBNA 2XNGA 3CY2A 4YJTA 2ITTA 3N51A 1XBBA 1J91A 4LOPA 5ANIA 2QU5A 3E7OA 3IDBA 4K9YA 3VRZA 4ANNA 4O86A 4YJPA 2YHVA 2VWUA 4GUBA 3LQ3A 4I23A 5DN3A 4BCGA 1B38A 2Q0NA 3RK5A 1ZARA 4ZTMA 2YEXA 3VJNA 4XG7A 4ERKA 3PJ8A 4BWPA 2WQBA 5ANDA 4V0GA 4WT6A 3WBLA 4E6AA 3TZ9A 4HGEA 4Y85A 4TZRA 4DGGA 1KSWA 3UZRA 1O6LA 4V0GB 4LG4A 2I7QA 4DLIA 3QRIA 5EYMA 2UW6A 2VV9A 4N4SA 3UNKA 4EH9A 2QHMA 3G51A 4L44A 5K4IA 5LVNA 4AGWA 2W99B 4YZNA 3HYHA 5BVNA 4YZCA 1QPEA 3TIYA 1OMWA 2CKOA 3F9NA 3FL4A 3NW5A 4DG2E 2FSLX 3P78A 2SRCA 1LP4A 2ZMCA 3GUBA 2AC5A 4O0SA 4U3ZA 3ZUTA 4CQEA 3UNJA 4YTFA 3RKBA 4KWPA 1BUHA 3NW6A 1LEZA 2G15A 4CZTA 3WZUA 1OB3A 2ETKA 2XBAA 3TKUA 2YM8A 3QKLA 3PLSA 3PP1A 4BI0A 3G0FA 3LFQA 4GT4A 4M84A 2BTSA 3IK3A 2ETMA 3RHXA 4QMYA 1LPUA 4WSQA 1FVVA 2C5XA 4C2VA 4ZZMA 5A4EA 1OGUA 2XP2A 5E8ZA 4M0ZA 2BR1A 2XRUA 2X8EA 3M2WA 3NRMA 5LJJA 2JEDA 2WELA 2XKCA 3F88A 4U40A 4RRVA 4OGRA 4X2NA 2WTKC 3R7UA 5E8UA 1SNXA 4WBOA 2XNBA 4A9RA 4AZWA 3ORPA 3KC3A 4PL4A 4F7JA 4DCAA 1JAMA 2CKEA 3BU5A 4DH1A 1OIUA 2ITPA 2YISA 3MPMA 3UIMA 4FV2A 4RX7A 3HL7A 3L8SA 2B9HA 2WZJA 2QC6A 3U9CA 4FF8A 2XZSA 4O0XA 4AS0A 4B8LA 4TWPA 3MBLA 4QPMA 3GQLA 3HMMA 1SVGA 4RJ6A 3R9NA 4UMUA 1X8BA 1OITA 5J79A 2YZLA 3VN9A 2XIKA 3EQHA 5EM8A 3COKA 3G2FA 3L8VA 4MF1A 4Z7GA 2PUUA 4JG8A 3CY3A 1DAWA 2BDWA 3FLWA 4L8MA 3R7YA 2IVUA 3FPQA 3Q60A 4JBPA 2PL0A 5FG8A 1AD5A 5LCJA 4RG0A 1SMHA 3TKHA 4LGDA 1Q97A 4FZDB 4C4JA 3FKNA 4BGHA 4PY1A 4MWIA 4AA5A 3QQGA 3DKOA 1VEBA 4LV5A 2FYSA 4RZVA 4CTCA 4D4RA 4EH4A 3FMEA 4AACA 1YWNA 4HYSA 4R8QA 4DT8A 3TDWA 4LM5A 1O6YA 2H9VA 2XK4A 4C62A 2VGPA 3V5LA 1BX6A 5IEYA 4O7LA 2X8DA 3MWUA 4W4VA 3ZU7A 5FWKK 2PUIA 3W2SA 3QALE 3I4BA 1REKA 3MY5A 4LRKA 3CTQA 4IXPA 3CE3A 4ZZOA 4ASXA 5BUEA 3F2RA 4I93A 4V04A 4DFZE 3RWPA 3KA0A 2JDOA 3GBZA 3OHTA 4Q5EA 3GGFA 3HMIA 3R21A 3EIDA 3KQ7A 4FIFA 4FUXA 4NCTC 4DGNA 3O0GA 4ZLOA 1Z5MA 1JOWB 3BBWA 2C6KA 3OXZA 4CYIA 2R3LA 3ELJA 2JD5A 2PE1A 4BDHA 4GKIA 5LVLA 2XKFA 1GIIA 3VUIA 4ZP5A 2VO6A 4H3BA 2EXCX 3I1AA 1A06A 4YO6A 4C3PA 4W4XA 4NIFB 4BBEA 5AP4A 5IQGA 3OG7A 3PPJA 4EUUA 3QL8A 3DY7A 3AD6A 3VULA 5EQYA 3GNIB 4IVAA 3R9RA 1W98A 5HCYA 4I3ZA 3RPVA 2WQMA 2WMSA 3QCQA 2F49A 5KCVA 5FBOA 3R9DA 2ZJWA 3NUPA 5A4TA 2ACXA 3C50A 3SD0A 4MHAA 4ZTLA 1OZ1A 3QC9A 4BF2A 5HU9A 3O8PA 4BY9E 1CKIA 4IJPA 4EQCA 1OIQA 3QUDA 3KXMA 4FSNA 3I7BA 1UNLA 3ZO3A 4J1RA 3SQQA 3DDQA 4GT3A 3F5GA 3NIEA 3KXGA 3CIKA 3LVPA 4PX6A 3OD6X 4EORA 5IUGA 5KZ0A 4QP8A 1CDKA 4ZY4A 2VTRA 2YAAA 3TZ7A 4JVGA 4DT9A 2YAKA 3TV7A 5AFVA 2ZYBA 1FQ1B 5M56A 2XYNA 4WKQA 4DFLA 5J5SA 1VYWA 1GZOA 4FTCA 4BDBA 4KSQA 2V7OA 5TO8A 3ZLSA 2QOBA 3DJ6A 4FV1A 1UNGA 4F6WA 1BMKA 3F5PA 2Z8CA 4NM7A 3PPKA 5G6VA 1PXMA 2XIRA 4JBQA 5AP3A 3IQ7A 3NYOA 4P5ZA 3UC4A 2CNUA 3V8TA 5C1QB 4JLCA 3QTRA 3R30A 3GU4A 2QODA 3DOGA 5IUHA 3PA3A 3F69A 3FMDA 5HEZA 4ANBA 5HO6A 1YXUA 4E73A 2W1GA 3KY2A 3D9VA 5D7AA 2QVSE 3RK7A 2ITUA 4D58A 3NYNA 2BZKB 4YHFA 4NT4A 5DFPA 3TTIA 4DFXE 4FTLA 1HCKA 3I0QA 2W5AA 3GENA 4M8TA 3RI1A 1O9UA 2BIYA 3ZFXA 4PP7A 5JGBA 3AC1A 4M15A 3UP2A 3BX5A 2WQEA 2OU7A 3ODYX 4J8MA 4FKPA 4FVPA 3L8XA 4UWYA 3G5DA 5JH6A 4G34A 2YIYA 3CD8A 4BI1A 4OLIA 3CCNA 2W5BA 5CT7A 3LMIA 3QA0A 5ACBC 5DLSA 4I0SA 1BI8A 4EH3A 2XM8A 4FIEA 5L2IA 1YI4A 4TWNA 4USEA 4FTIA 5I9YA 2R7IA 4A4OA 4UX9A 2YA9A 4XBUA 1ZYJA 3D5VA 4TRLA 1RQQA 2R4BA 1TQMA 4IMYA 2PZPA 3UGCA 3FYKX 2B7AA 4E4XA 2W9FB 3PZEA 2CKPA 3I60A 3Q4ZA 4R3RA 4MEDA 2QCSA 3QUPA 4A7CA 3OEZA 2A0CX 5L8JA 4BKZA 5CF6A 5D11A 4MNFA 5JZNA 3NS9A 3SW7A 3GU5A 1QPCA 3FSKA 4OR5A 4JOAA 4ZTNA 3Q9YA 4FSMA 2W1DA 4I24A 4IANA 5FEQA 3ZXZA 2C6LA 2WMRA 4AP7A 4BR3A 3MB7A 4HOKA 5EDPA 4QMOA 2PPQA 3UOHA 3EQPA 1OVEA 5AP7A 4JG6A 3OOGA 3M1SA 5DNRA 3LCOA 1FBNA 3O7LD 4ID7A 3BYOA 3PSBA 3MH2A 4M13A 2V5QA 3NDMA 5H8BA 4NJDA 3ZO2A 3V6SA 3VS6A 4AWIA 4C33A 5F20A 2UW5A 4FIHA 4ACDA 2HWOA 2DWBA 2C3KA 3PY0A 3W32A 3E62A 3A7JA 3C4FA 3ZZWA 3AD5A 3DBDA 3PRFA 4JNWA 5C9CA 2PVHA 2NRUA 3OWKA 3OUNB 4EL9A 4DHFA 4TYHA 2UVYA 2CGWA 4J7BA 5CXHA 1J1CA 4PRJA 3P1AA 5IEVA 4DTBA 2XK3A 5E92A 4F4PA 4HCTA 2ITVA 2QONA 3V5TA 3I0OA 3CKXA 4FNZA 4ANLA 2HYYA 4L43A 4YLKA 3DS6A 4USFA 4O0TA 4TYIA 2X39A 3ORNA 2VD5A 2W4JA 5CS6A 5DH3A 2R3QA 4H1MA 3ROCA 4AW2A 3G9LX 4PTEA 1PY5A 3BWJA 5FLFA 1Q3WA 2ITYA 2BVAA 5IMEA 2YCFA 2OXDA 2WQOA 3CJFA 4U79A 4D2VA 4FSYA 4DEHA 5JMSA 4E4LA 5TR6A 5I9ZA 4XG8A 1JKTA 5HLPA 5IF1A 1J3HA 1YWRA 4YJUA 5IZFA 3JUHA 4JDIA 4F0FA 4C61A 2I0YA 3HAVA 2QG7A 2JFMA 4X7QA 2YM3A 2ZDTA 4FIGA 4WRSA 5EW9A 4ZZNA 3C4EA 4OBQA 5GIPE 5K0KA 3PG3A 2FUMA 4JRNA 2PVKA 1M2PA 5IEXA 1L3RE 2ZV8A 2B4SB 3H0ZA 4RBLA 5HNBA 2XJ0A 4E5AX 3R22A 5DMZA 3LMGA 1KE6A 1O6KA 4OBOA 2PMNX 3HA6A 1H28A 2JAVA 1I09A 1OIRA 3FLNC 3EZVA 5EI8A 4C4FA 5DGZA 5GZ9A 5ITAA 5ANKA 5CF8A 3V5QA 3OXIA 2GHGA 3KCFA 2GNJA 1JNKA 5CAVA 4ZMFA 3K3JA 2NRYA 3P23A 3R01A 4QP4A 4XG9A 5CU3A 3OWPA 4WRGA 1GIHA 3F2AA 2BIKB 3RCDA 3ZBXA 5IA0A 3ATSA 5BYLA 3D7TB 4TT7A 1OBGA 2EXEA 2ZM1A 2A1AB 4EH2A 4BTJA 4QMWA 4ENYA 1SVHA 4C02A 4YLLA 1H1SA 3DGKA 3MA3A 4ARKA 4QMLA 2VTJA 1PXKA 5IQHA 4L3PA 5IKWA 5L3AA 3W16A 2EB3A 3H30A 4FT7A 3RZBA 3NMUF 5AM7A 2UV2A 2ONLA 2IZUA 4LOOA 2KULA 2Y9QA 4FOBA 5HX8A 3FZRA 1OPKA 2IWIA 5E8YA 4QMMA 5HESA 3PVBA 4IAIA 2VGOA 4OTRA 1PKGA 3QZIA 5KKRB 3ZLWA 3OP5A 3DLSA 4GL9A
chains in the Genus database with same CATH superfamily
4MF0A 2Y4PA 4M14A 2Y7JA 4G17A 1LR4A 4L01A 2V0DA 1DM2A 5CAQA 2B55A 1H0VA 5HVKA 4CTBA 1G8KA 4PDYA 4BIDA 2JDVA 2WU7A 4G9CA 5KMKA 3LLAA 4A07A 2OLCA 3ORKA 4R5YA 3TJDA 3AT2A 4OT5A 4WA9A 4I4EA 4JDJA 1PXLA 4ANSA 4IZYA 4FSZA 3GCQA 4G3EA 3QX2A 4ALWA 4C57A 4CEGA 3BLHA 4ZTQA 5I9VA 5HCXA 4UY9A 4JS8A 1FGKA 2WTKB 3FWQA 3MFUA 4O6LA 1BYGA 4RJ8A 4XCUA 3KXXA 5H8GA 2R3NA 2QO9A 4ASZA 3C51A 1BL7A 3IW4A 3PE2A 3QXOA 5KMOA 4E4NA 1IAHA 3UNZA 1Q8UA 3OF0A 1H1PA 2QKWB 2RF9A 3ITZA 5B0XA 4I5HA 4WNMA 3A99A 3SHEA 3WF8A 1VYZA 1F0QA 2JLDA 3LFFA 1A48A 5M09A 4E20A 4BL1A 3IOKA 5FXRA 3R00A 4NFNA 3TJCA 5IH6A 3PFYA 4XNEA 4YJVA 5I0BA 5JQ8A 4NTTA 2I0VA 4AFEA 5HE3A 3KEXA 3KN6A 3W33A 3EQDA 4RFYA 4IAKA 3DAJA 1U5QA 4JL9A 5HIBA 4XG4A 1FVTA 3KFAA 4ITHA 5GNKA 1W82A 5HHWA 3R2YA 3VBYA 4OTHA 3NLBA 2PVYA 3M11A 2WU6A 3QTIA 3MTFA 2VTAA 1M2QA 3OWLA 1VJYA 3BPRA 3D14A 3O96A 4Y73A 2OSCA 5DR2A 4DH8A 1Y91A 2R0IA 3FHRA 3GC7A 5HX6A 4V01A 2BMCA 3DV3A 3KN5A 3MFSA 3OCSA 3WYXA 3HKOA 2Z7RA 2HCKA 4JBOA 5CLPA 4RQVA 2WMAA 3NUUA 4FT0A 4L3LA 4XV3A 2O5KA 4FKIA 3PY1A 2JIUA 4ACGA 4ACMA 2BRGA 1ZYDA 3FKOA 5DEYA 5BV3A 3C4XA 4HYUA 3HMPA 2ZM4A 4FKQA 3BELA 3IW6A 2VNYA 4UV0A 4M68A 3PYYA 2ZV2A 5CZIA 1GZNA 2GS2A 3DTCA 1NXKA 2IVTA 4DFUA 3EN4A 4QTAA 4PMMA 4D0WA 2PZRA 2E9UA 3POZA 4IAYA 3I6UA 4O22A 4LUEA 4O2PA 4FKRA 4IB0A 5KUPA 2XK9A 3UQGA 4OBPA 4BTFA 2O0UA 4LRMA 4FGBA 4BDIA 2GS6A 4FTOA 5A54A 1UU9A 2YITA 3PXYA 3PIXA 4IQ6A 4AZEA 2PMLX 3DBCA 3NNWA 2RG5A 5AUTA 4HZRA 2BAJA 4FKWA 5BUJA 2V7AA 5TKDA 1SYKA 2VTMA 4FTUA 4GJ2A 5AR2A 5AV2A 1W8CA 4RVTA 3RZFA 3FDNA 4EEVA 4F0IA 3KVXA 4EUTA 5CAPA 2QO2A 3EFLA 4FZAB 2OFUA 4XLVA 3KRWA 5CNNA 5H9BA 4NU1A 2WKMA 3ZTXA 4W9WA 3P08A 3UC3A 3ZH8A 5BVFA 3U54A 2YJSA 3R8PA 1OUKA 2P2IA 3NW7A 2C3JA 3QQFA 2OZOA 1KUTA 5L8LA 2VWYA 5HI2A 1YHVA 2A19B 3W55A 3VWAA 4LV7A 3BGPA 4YP8A 4FEQA 3DAEA 5AX9A 2YDJA 5I3RA 3FI2A 2G2IA 3HV7A 4MQ1A 1SVEA 1SNUA 2OJ9A 4FICA 4FZFB 1KWPA 4GU9A 3R6XA 4M7IA 5ANGA 3WARA 4BDEA 3TUBA 1SZMA 4BCHA 1MRVA 3WI6A 1U5RA 4S34A 3ZM4A 3VBTA 1QL6A 2I0HA 4XLIA 4D9TA 3R83A 4F70A 4X2JA 4AU8A 2I40A 5CTPA 4CKIA 2AYPA 3DU8A 3VUKA 4H39A 5AMNA 1WBOA 4B8MA 5L4QA 2GHMA 3C7QA 4RFZA 4U44A 4ORKA 3C5IA 4FV8A 1XH6A 1V1KA 3HRBA 3M42A 3R1NA 4OTDA 4ACCA 1YVJA 4BCKA 3VO3A 4M97A 1KOBA 2HXQA 3R04A 4FV7A 4U7ZA 5K0XA 1ZOHA 4BCIA 2F2CB 3TNHA 1ST0A 3KF7A 3CXWA 1TFFA 4HNIA 3JVRA 3E7VA 3DXNA 1NVSA 3NGAA 4KIKB 4AG8A 4EZ5A 3U6HA 3E8DA 4J52A 5AIKA 4MBLA 3U55A 1H27A 2J50A 1KE7A 4QNAA 3MDYA 4RA5A 3SXSA 4XOZA 3II5A 2QI8A 3FSFA 2JFLA 3PUPA 4NL0A 3L8PA 3CP9A 1KOAA 4RIXA 4IAFA 2NPQA 4LQMA 3TTJA 3V01A 3LFDA 2YM6A 2HZ0A 2G01A 1KV1A 1ZXEA 4FSWA 4Q5HA 5CEKA 2VTQA 1PYXA 5EYCA 4EOJA 2O2UA 3FHIA 2W9ZB 4O4CA 5L6PA 2CNVA 4LGGA 4BYIA 3OBGA 1F5QA 3BQRA 4DGLC 2X9EA 3FI4A 3PG1A 5EM6A 4GIHA 2X8IA 3ERKA 4QP3A 2GDOA 3BHUA 2XK6A 2Y6OA 3SX9A 1UNHA 1Q62A 2V55A 1P2AA 1Q99A 4HGTA 3AT3A 5JSMA 1QCFA 4XOYA 4CFUA 5HNIX 3FC1X 2WPAA 3NWWA 3QKKA 5JRQA 2VTPA 4F9WA 2W4KA 5LWMA 4FVRA 3NFGB 3GOKA 3NVMB 3S95A 3NCGA 4EC8A 1YI6A 1IEPA 2P55A 2QR8A 2UVXA 3COIA 3Q6UA 1YXSA 2PZYA 4UWBA 4ALUA 3Q04A 4QYHA 3PLAE 3I81A 4RIWA 3WF7A 2IW6A 4DGOA 4X2FA 1PMVA 4BCNA 4CGAA 2OH0E 4AGDA 1PXOA 4HW7A 4ZMEA 1Q41A 2Y4IC 3V04A 4DDIA 4FTTA 1UU7A 4EQUA 2PVRA 5GIOE 3UPXA 5HE0A 5HVJA 4B6LA 4Z7HA 2GQGA 5B7VA 3BE2A 3ZZEA 3WZDA 2Z2WA 5HGIA 3SA0A 1J1BA 3IS5A 3E5AA 4BVUA 1ZAOA 4WNOA 5AR8A 5CXZA 4S31A 2F2UA 2EWAA 1QPJA 4AOJA 1R1WA 3FPMA 3LFEA 4AGCA 3IOPA 1Y8GA 3D15A 3PY3A 3V5JA 3VUDA 3BIZA 5IU2A 5C4KA 2PUNA 1PW2A 4DG0E 5IMXA 4AAYA 4A4XA 2A4LA 4AT3A 4O0WA 3RM7A 1CM8A 4FR4A 1R0PA 1XO2B 3JXWA 4O0YA 2XF0A 3EH9A 2F9GA 3OTUA 4IM3A 4O6EA 3UJGA 2PVJA 4ANQA 5M4UA 1GNGA 4AA0A 4RFMA 3BYVA 5CANA 3LW0A 4YPSA 3SDJA 3QZFA 2OBJA 4X3FC 4CFMA 4WNKA 4XJ0A 3QA8A 4YZ9A 3KMMA 5BVEA 1JKLA 4Y95A 3DK7A 1TQIA 4DH7A 3NX8A 3GFWA 2WTWA 3QZHA 4UN0C 4RLLA 1J7IA 4H05A 2WEVA 2BALA 2E9OA 2Z60A 3QYWA 4ZEGA 3KK9A 1PHKA 2GSFA 3ROYA 4MD7E 4F7SA 4MCVA 5AA8A 4Y5QA 4ASEA 5BMSA 4IAAA 2UZWE 4QTEA 4HVSA 3NUXA 3AG9A 3DCVA 1ZZLA 4FV9A 4LMNA 4RVMA 4WSYA 3RVGA 3VUTA 5LXMA 3E64A 3K5VA 2HW7A 2XCHA 3H10A 4FKOA 2Z02A 2CN5A 5CEOA 4LDTA 4L7FA 2C6TA 5LCKA 2ZVAA 3P5JC 3TL8A 5A46A 2XVDA 4AXFA 4F9YA 3AC8A 3MI9A 2OJFE 3RAIA 4IX3A 2B9IA 3HDMA 2OIBA 4G3GA 1JBPE 1YKRA 2QOIA 3VS0A 4Q9ZA 2B1PA 4X21A 1UKHA 3UP7A 3UZPA 5HG9A 3QGYA 2YIRA 4S30A 2PYWA 1GAGA 2VTIA 4V05A 5HG5A 4DFYA 4UALA 3JY9A 5AUVA 2HWPA 3HMNA 3PWYA 4X2GA 3PVWA 1FMOE 3NIZA 1CMKE 3KRRA 3O8TA 3QQLA 4G3FA 4QYGA 4WIHA 3S4QA 3TZMA 5DA3A 3ZS5A 4R1YA 3GU8A 3QTSA 3R9OA 3UTOA 2FGIA 4TTHB 4C0TA 1CSNA 3LQ8A 4CT1A 2O64A 3FLYA 2PTKA 3WZEA 3DNDA 1JVPP 5K3YA 4M66A 4G2FA 5C26A 1ZYLA 4U43A 4PTCA 5AM6A 2VAGA 2CNQA 2NO3A 3LLTA 3R1SA 4IZ5A 2X81A 4D5HA 4S2ZA 5FM3A 2DUVA 4QPSA 3EYHA 5EKNA 4LFIA 1HCLA 4U8ZA 3T8OA 3A8XA 2OKRA 2WMWA 3KXZA 4K8AA 1YWVA 3C1XA 3GCPA 5M53A 2OK1A 3CQEA 4IC8A 5HIEA 4FK6A 4YTCA 2VO7A 3QTXA 2XCKA 1CTPE 4BC6A 3VBVA 2ITOA 3ALOA 3LFSA 3QU0A 4I22A 5E8XA 3JY0A 4BHZA 5K9IA 5DR9A 3LFCA 1QPDA 4FL1A 3SOCA 1IRKA 3LCTA 1OKWA 4C38A 2PE0A 3FXXA 3VS3A 4EOOA 5CZHA 5LMKA 3Q96A 3CR0A 2G2FA 4EYJA 2GNHA 3NAYA 1GOLA 1PMUA 3FMNA 1FINA 3MPAA 3K54A 3F3TA 3RPOA 3LXKA 3FQSA 2FSTX 3GU7A 2LAVA 3PTGA 4QYFA 4R3PA 3U51A 4JDKA 5FP6A 3HDNA 1U54B 3A7FA 2VWXA 4H58A 1YW2A 3IDCA 3LCSA 4O38A 4JR3A 4RVKA 4I21A 2X7OA 5E9EA 1Q8ZA 1PXNA 2IZTA 5AV3A 5HD7A 1WAKA 3B2TA 5D41A 4F9CA 4Z16A 4CVAA 4EBVA 1MUOA 3ORLA 2UZTA 3DT1A 4KKGA 2P2HA 5IDPA 1SM2A 2EUFB 3MH3A 4L53A 3QC4A 3FAAA 4LL0A 2GFSA 4NIFA 3R8LA 5DVRA 4NYEA 4FKJA 4QRCA 5BVKA 3Q32A 4AXCA 4B0GA 3ML1A 4U9AA 1ZY5A 3EYGA 4YJQA 4ZS0A 1Q8WA 2PU8A 1OL5A 4F7NA 5JGDA 4E26A 2NNWB 3LHJA 4C7TA 3O23A 3ORIA 4UYNA 4PUZA 3PPZA 3GC9A 5JFWA 4YJNA 4DEDA 2YIWA 3NNXA 3QTZA 4K77A 5EDQA 3JS2A 1Y8YA 4K33A 5HBEA 4NK9A 3KXHA 4JDHA 4A9UA 4D1XA 4HVDA 1Z9XA 4FNYA 4KS7A 4EH8A 5BYYA 3QZGA 5C27A 3G15A 3AKJA 2CCIA 2C0IA 4JR7A 1ZYSA 1MQBA 3GU6A 1H1QA 3CTHA 3SXFA 2IVSA 4X6QC 4JG7A 4EOLA 4FMQA 4PDOA 1JQHA 3FZPA 5K4JA 4F99A 3UIXA 3ACKA 3Q2MA 3LOKA 4JX7A 4BCQA 3VIDA 4QP6A 5LVMA 1H08A 1OM1A 4IVBA 3GT8A 5KZIA 2XKEA 3D0EA 3C0IA 4R7BA 5BYZA 3KXNA 2YERA 3RK9A 4H36A 1V0OA 2GNLA 5F95A 3RJCA 3LKMA 4ZSGA 3W18A 1H24A 4D0XA 5JFSA 2WMQA 3OTVA 4KNBA 4KBKA 3WF6A 4ACHA 2W1HA 4O2ZA 4AXDA 2BRBA 2C4GA 3MFTA 4IEBA 4E6QA 4ZSAA 3AQVA 2IG7A 5F94A 4ZLYA 2WEIA 5CF4A 4UXQA 5CYIA 3OCTA 3HZTA 4GIIA 1XBCA 2Q0BA 2W17A 3NPCA 1VR2A 2GS7A 2VTNA 4QD6A 4WBBB 4WNPA 4APCA 1PMNA 1Y57A 4ZY6A 4O7NA 1UA2A 5E91A 3VS1A 2XNMA 5TE0A 1ZMWA 4UMTA 1OPLA 4MX9A 4YJRA 3VS2A 2XARA 2OG8A 2PZ5A 4FTKA 5LVPA 5F1ZA 3I7CA 4I6HA 4AE9A 3LIJA 4FBXA 4DA5A 3F6XA 3BHTA 3ZXTA 4O27B 2KTYA 4R77A 5C8NA 2B52A 2C68A 4A4LA 2YDKA 2C0TA 2QOLA 3OMVA 3ZRLA 1W0XC 4W4YA 5L6OA 2BAQA 3DAKA 3REPA 3LFNA 4EZ7A 1U4DA 2Y0AA 3ZDUA 4AOIA 1XH5A 2HZNA 2ZM3A 5CSVA 4JQEA 5LMBA 3CKWA 4FZ6A 3CC6A 2ZV9A 1ZMVA 3KMUA 4ITIA 4O4EA 3SRVA 3BHVA 5AEPA 2YWPA 4RIYA 4Y5HA 5HQ0A 4MXXA 1BL6A 3A60A 2UUEA 3QRKA 3SRVB 4DHZA 1QMZA 3OVVA 4RIYB 3ODZX 4CFFA 3P4KA 4D9UA 5A3XA 3SXRA 1GJOA 5L2QA 2CLQA 4TYEA 2B9FA 2UW4A 2VWWA 4GG5A 2C1BA 4FVQA 3ZC5A 4U42A 4UMQA 3UIUA 4QMNA 2VTSA 4RWKA 3E8EA 1PRYA 3Q9WA 4CV8A 5CVGA 2PUPA 4D2PA 1WFCA 3R0TA 5FEEA 3OROA 2BDFA 4BZNA 5HG7A 4CG8A 5DOSA 3KMWA 3VQUA 4E3CA 4YBJA 4QQJA 5HICA 3RNIA 3UIBA 4I92A 4OTGA 1A9UA 5ANJA 2UZBA 3TEIA 4HGLA 2VX1A 3LAUA 2XNNA 5F4NA 4EOIA 4YZBA 3BV2A 4O7RA 4ZXTA 2VTLA 1YOJA 3F3ZA 4AXAA 2VUWA 3MIAA 3R73A 4NKSA 3S0OA 3BGQA 4FYNA 4M3QA 4E4MA 4FV4A 3W2PA 3NNUA 3TCPA 2YZAA 4BB4A 3WF9A 4IFCA 3FXZA 2PULA 2X6EA 1DI8A 3CQUA 3IDPA 5AUYA 3FKLA 3HRFA 4KRDA 1V0BA 4LUDA 4EH5A 2X4FA 4NM5A 4YC3A 4WOVA 4AZFA 4Z3VA 2FSMX 2PWLA 1OL7A 2Z7QA 2J90A 5T6KA 3DKGA 3D2IA 3G6GA 4MUQA 3MH0A 5E8TA 4F0GA 5I9XA 5EW8A 2OI4X 4JMQA 1XR1A 2YACA 3BGZA 5J9ZA 4ZJVA 3E8NA 3KULB 5CEIA 2YLEA 3Q3BA 4EK8A 1P14A 4AT5A 1Q5KA 4I6BA 2WMVA 1ZY4A 2BFXA 4CFVA 1BLXA 3R28A 4IBMA 3DTWA 3C9WA 3G9NA 4R6VA 4XMOA 3RPYA 3TZ8A 3W8QA 4EI4A 5C8KA 4YLJA 2BRMA 2Y4IB 3H9FA 4OTWA 4HVGA 2R7BA 3F61A 5EG3A 4C36A 2FA2A 4HVIA 2R3RA 1H00A 3CGOA 4XS2A 4XX9A 4MVFA 5AP6A 4ZTHA 5FTOA 3T9IA 3WOWA 3KIOC 3WILA 3G0EA 2HY81 5HOAA 4MXOA 5D9HA 3UDZA 2QLUA 3L9NA 1JSVA 4EK3A 4F7LA 2ZAZA 4LI5A 2VWBA 4M12A 5EI6A 5T68A 2HENA 3O5AA 4R1VA 3QCYA 4F64A 1JSUA 5EQPA 2QO7A 3W8LA 5TT7A 2ZB0A 3DPKA 4M0YA 4DN5A 3D7TA 4MD8E 3ZEWA 3VBXA 4QTCA 2J51A 4DHJA 3QHRA 1H1RA 2JDRA 2O8YA 4ZK5A 4FEWA 3CQWA 1UKIA 2GQRA 3MSSA 4APPA 2BFYA 1KE8A 3BCEA 4GSBA 5JGAA 4FZ7A 1ZWSA 3EL8A 1PF8A 3Q6WA 4EKKA 2ZFYA 3QRJA 3ULZA 2V62A 1WBSA 3PSDA 1P4FA 3LXLA 4U45A 3V3VA 4J95A 2GU8A 1M52A 4IZAA 4X3FB 3CD3A 4J53A 3U9NA 3N4UA 4MD9E 3HLLA 1YOMA 5EDRA 4TWCA 2GHLA 4I5MA 4RJ5A 2IO6A 3ZHPC 4YR8A 3N4VA 3I79A 5IH5A 4FKSA 5CU6A 5HNGA 2OJIA 1DAYA 4WG4A 4WHZA 3UDBA 5HLNA 4Y83A 4NZWB 4KA3A 3D7ZA 4PDPA 3TNQB 5GJDA 2E2BA 4ONAA 1S9JA 3G33A 1YXXA 3THBA 2XIYA 3EMGA 3E87A 4MQ2A 3PWDA 5CU2A 4DCEA 4RPVA 3ORTA 4QNYA 3NSZA 3O17A 4MBJA 5DPVA 4W8EA 4B99A 2W4OA 2CSNA 4BJJB 3GB2A 4G16A 2RFSA 4GK2A 4FG8A 4YC6A 5EQEA 4PDSA 3A4OX 3AKKA 1G5SA 4D55A 3DK3A 1R0EA 2XRWA 2NP8A 2PVFA 3FUPA 2BRHA 3EQIA 3MYGA 5HTCA 3LZBA 3KK8A 2C3IB 2OXXA 2ZB1A 5AAGA 4DEEA 3HV3A 3AOXA 3O71A 3QAME 5M51A 4FODA 3H4JA 4JXFA 5IQCA 4F65A 4ERWA 2Y8OA 4XP2A 5IA2A 4H3PA 2CGVA 5EHOA 2OO8X 4JIAA 3RHKA 2W1CA 3A7IA 2JKOA 3F3UA 2PK9A 4PNIA 2ITQA 2YIQA 5DT3A 5CNOA 2CGXA 3SAYA 3P0MA 2P3GX 3NZ0A 4KS8A 5HIDA 3UVPA 3TNPC 5CWZA 4X0MA 5CQUA 3Q53A 4PL5A 4BBFA 2EB2A 5TOZA 3C0HA 4EH6A 5IUIA 4AT4A 4E5BA 4L7SA 4CFWA 2J5FA 4JAJA 4F6UA 4QT1A 1I44A 4YNOA 1OGYA 4II5A 3OUKA 4QTDA 3DKFA 2YJRA 5DHJA 4DTAA 3R7OA 5M4CA 1K2PA 2OJJA 2UW8A 4MXYA 3U4WA 5CF5A 4OAVB 3UO5A 3GC0A 4RWIA 2JC6A 5FXSA 3W2OA 2XM9A 4RC2A 3O7LB 4L42A 2WTIA 5CAUA 5HBJA 2J0MB 2PHKA 4J96A 3UYTA 5DEWA 3BWFA 3TWJA 2WXVA 2I1MA 3D4QA 1S9IA 2F4JA 5HKMA 3VJOA 2Y6MA 2QOFA 2GPHA 3F7ZA 3VNTA 3TV6A 4EH7A 1M2RA 2WFYA 3UQFA 3BEAA 3UZTA 1DS5A 4EKLA 1OL1A 4EC9A 2XEYA 3MW1A 2C69A 3DNEA 3HUBA 3OCBA 4RLKA 4BRXA 3JYAA 2PVLA 2GTMA 4FJVA 3W1FA 1KE9A 4WO5A 4EK6A 2P0CA 3POOA 4YJOA 5K5XA 3ACJA 3W0QA 3FMHA 5ETFA 5E1EA 5GHVA 4IB5A 2CN8A 3R2BA 4NCTA 3VF9A 5J9YA 4J71A 1OL2A 4C4IA 3OFMA 4YTHA 3EKNA 2W1IA 3HP2A 3UBDA 2BHHA 4M67A 3PDTA 4QQTA 1YXVA 3OCGA 2XJ2A 3NAXA 3JPVA 3OW4A 5DWRA 4IIRA 4L3JA 2OH4A 4FT5A 4KAOA 4CT2A 4AN2A 5JKGA 1T46A 4M69B 1MQ4A 3QRUA 4CMTA 4O4BB 3VQHA 2RSVA 2JIIA 3BV3A 1RW8A 4QMPA 3SKCA 3F2NA 4PP9A 2W06A 2W7XA 3DB6A 2F57A 3MV5A 3QCSA 3AMBA 2IF8A 2C47A 4FC0A 3W0RA 1XH8A 5I9UA 4FT3A 3VS7A 4QMVA 2E9PA 5JRSA 5IQDA 1DI9A 3E3BX 4TY1A 3DBFA 4JQ7A 3RAKA 4YO4A 4PQNA 3W0MA 2XUUA 4TW9A 4BDFA 4Z9LA 3CLYA 5KO1A 3PJ2A 5ANOA 2JDSA 3PIZA 3OOMA 4YPDA 3TNWA 4PMPA 4LMUA 2CHLA 1LUFA 4NSTA 5IQBA 3T9TA 2BPMA 3DLZA 5CASA 3PUFC 1XBAA 2PMIA 4K6ZA 4KKHA 4O21A 4RWLA 2BUJA 5ETAA 3FJQE 2R2PA 2XH5A 4W9XA 3Q4TA 3FZTA 4FGRA 2HZIA 4MK0A 3QLGA 4FTMA 4B7TA 2CJMA 5KX8A 5I4NA 2AEGA 3N4TA 2UZDA 1ZOGA 3E93A 3FQHA 1XH9A 3LM0A 1YOLA 2AUHA 2RFDA 3MA6A 4H1JA 5G1XA 5EK7A 3AGLA 3FMJA 3K2LA 5CVFA 4KIKA 3ZO4A 4P7EA 4O7ZA 3NR9A 3P7CA 2OFVA 1M7QA 3PSCA 4EHEA 4Z55A 4IX4A 3OY3A 2G1TA 3T3VA 1XJDA 3QD0A 3FV8A 3BYMA 3BLQA 2UZLA 4L45A 3H9RA 3R8ZA 4O84A 3R7IA 5BNJA 3DA6A 1APME 2R3KA 2X9FA 4DEAA 4XP3A 4CCUA 3RAWA 1IAJA 1H1WA 4QP7A 3PJ3A 4RT7A 2J0IA 4I5CA 1J7LA 3BKBA 3NYVA 4U80A 3ZBFA 2UZVA 3P79A 1ZLTA 2AQXA 3KL8A 5DRBA 5LVOA 2BHEA 2HK5A 3KVWA 4O83A 5DYJA 4GUEA 3SOAA 3ORMA 1B39A 4DEIA 2JGZA 4CCBA 2F7EE 2C5VA 4IE9A 5AV1A 3CPCA 4RJ7A 4CQGA 5AIRA 2HW6A 3F66A 2VNWA 4GS6A 2VX0A 4O1PA 4DE4A 4OT6A 4GFMA 2EVAA 2GNIA 3V5PA 2DYLA 4IX5A 3ZOSA 3ZDIA 4BGQA 5IQIA 5GINE 5AWMA 4BCJA 4PNKA 4FE2A 3P7BA 2JBOA 3EJ1A 3EFKA 3DZOA 4I0RA 5FDXA 2XK7A 2XS0A 3UVQA 4A06A 4NWMA 4HJOA 1GZKA 3B2WA 4L9IA 1G8JA 2A2AA 2X4ZA 2ERZE 3MY1A 3TIZA 4O7TA 3R1YA 3EKKA 1TQPA 4C2WA 3UOKA 1ST4A 5FD2A 3COMA 3BHHA 2XEZA 2FSOX 2CPKE 5JFVA 5A4QA 4F78A 3KGAA 5EYDA 1ERKA 2C3LA 5HG8A 3ZSHA 3FMLA 4K18A 4EQMA 3FC2A 4BZDA 4C3RA 3AGMA 1B6CB 4KB8A 4S32A 4EJ7A 4D2RA 5HVYA 3UYSA 4D2WA 4RSSA 5M57A 2WOTA 4KIOA 1V0PA 3R63A 4QTBA 1H4LA 4EOPA 3O2MA 3BQCA 3FZ1A 5DBXA 4C59A 3N9XA 4Y8DA 1YQJA 2OIQA 2WTJA 5AR4A 5LARA 5GZ8A 3R71A 4KUJA 2VWZA 4X3JA 2BDJA 3G90X 2PSQA 4FKTA 2BCJA 5EOLA 3BU6A 2RL5A 4MYGA 5HLWA 4KD1A 4JBVA 1H07A 2XA4A 2JBPA 3KRXA 3UPZA 3AC3A 3DBQA 3DQWA 3VBQA 3W2CA 2B0QA 3ZM9A 3RWQA 4CFNA 2JAMA 1KV2A 5KNJA 2YWVA 1M7NA 1OKVA 5BVDA 2QU6A 4QP2A 5HZNA 1OIYA 2HAKA 4IB1A 5D12A 5L2SA 5CSPA 5CSWA 5KE0A 2F7ZE 5KBRA 3QQUA 5AUWA 5AV0A 3WIKA 4CXAA 5H3QA 4ANMA 4TN6A 3ZLXA 1OKYA 5J5TA 1UVRA 4OAUC 3KRJA 3LQ5A 5FRIA 5KHWA 1FVRA 1WCCA 3V51A 4P4CA 3ENHA 4XYFA 4FI1A 5BMMA 3RALA 2X7FA 1E1VA 4XV2A 4ALVA 2YIXA 4GYGA 4TPTA 5J1VA 4ZLZA 4XBRA 4DFBA 2OZAA 3EB0A 5CU4A 2J0LA 4EJNA 3RM6A 4R5SA 3HV6A 3A4PA 4FKLA 3SLSA 2OZAB 3NUYA 5CSHA 3UVRA 4WG5A 1G8AA 3KREA 2XK8A 4QMSA 3F7WA 4I5PA 3D5XA 3FYJX 3KKVA 2W1ZA 3PZHA 2A98A 4JI9A 5HO8A 3ZONA 4C3FA 3EZRA 3CPBA 2P33A 3R02A 4FL2A 4H3QA 5CALA 4I6FA 4IM2A 4L6QA 1Q4LA 4RQKA 2R3FA 3TUDA 5C8MA 4LL5A 2GCDA 4L46A 3TACA 4YZDA 4BDDA 2BRNA 4CLIA 3SW4A 4PF4A 4PPCA 4FTNA 5ACKA 2JKKA 4K11A 1K3AA 4A9YA 3CS9A 2PVNA 2XNOA 4IAZA 4UZDA 4KBCA 2YABA 2QR7A 4EWHA 5BQ0A 4HVHA 1PKDA 3TDVA 3CGFA 4I41A 5AR5A 2C30A 3WE8A 4C8BA 3EFJA 4XRJA 4JIKA 3TUCA 5M07A 3SG9A 4QMTA 1XH7A 2C6MA 4OTFA 3FMKA 2WD1A 3CEKA 4PTGA 2B53A 1W84A 4FTJA 4WUAA 4W8DA 2ONLC 4D4VA 4TL0A 5IISA 4E7WA 2J9MA 2WMXA 3F3VA 3NFFB 4AX8A 3HGKA 5KKRC 5I9WA 1GIJA 3G6HA 5EI2A 5D1JA 4IDVA 4TKSA 3F82A 4CSVA 2QLQA 2UW0A 3LFBA 3Q9XA 5J1WA 4KIPA 3W2QA 4F09A 4Q2AA 2PMOX 5JQ5A 4QPAA 4IDTA 3W0SA 4OUCA 1NVQA 5M55A 5CENA 5IQFA 3GC8A 3HRCA 3FLZA 3MS9A 3ALNA 4FRFA 4HNFA 5CT0A 5A14A 5DG5A 5A4LA 2HELA 5FDPA 1YRPA 3SV0A 3V6RA 3KF4A 3EN5A 4MNEA 4BWXA 1BI7A 3RMFA 4BTKA 5KMIA 2OICA 5IH4A 3UMXA 3MJ2A