4U40A

Mitogen-activated protein kinase kinase kinase kinase 4 (map4k4) bound to amppnp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
b'SLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Structural Plasticity and Kinase Activation in a Cohort of MAP4K4 Structures
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u40A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u40A01
4GUEA 5E90A 2ITTA 4AF3A 4U97A 1FMKA 3RM7A 3D83A 3I7BA 2OW3A 1PXKA 3I0OA 4ANLA 2C6OA 4QYFA 4F6UA 5IH6A 5LVPA 4DGGA 4Y83A 3TDWA 4FTAA 4XG6A 3KEXA 4NM0A 3OP5A 2VX0A 3SG9A 3O7LD 3QZFA 2CGUA 4C33A 4ZJJA 5AFVA 2PZPA 2UZWE 3A7HA 3LAUA 3P7BA 3CCNA 4IAFA 4RJ6A 3W10A 5IUGA 3QL8A 4IBMA 3VVHA 5BVNA 3P86A 4EZ3A 3FZTA 3ZZWA 2WMUA 2OFUA 4JX3A 2W4KA 4HYUA 4MQ1A 5L2QA 1XBAA 4I5PA 3DU8A 3IW6A 3RCDA 2VTQA 2JAVA 4FBXA 3PA5A 4FG8A 2QVSE 3TNPC 2RFDA 3EYGA 1PXNA 4RIWB 5K5XA 5T68A 3FHRA 3K2LA 4V0GB 4XUFA 3FE3A 2BRMA 1YHSA 2Q0NA 2W1IA 5M06A 3RHKA 2XMYA 4BGHA 4O7YA 3HECA 4QMUA 4RIWA 4S2ZA 3OF0A 5LVOA 3VBWA 1GIIA 4PTEA 4IWPA 5DT3A 5BQ0A 4UWCA 4ZTMA 5GIPE 2XYUA 4RJ8A 2HCKA 5E8YA 4G2FA 4CFXA 3UYSA 3MTFA 1ZOEA 4L3JA 1GIHA 4FTRA 2XP2A 5JGBA 3F2NA 3GNIB 2GS6A 3RP9A 5CALA 3H4JA 4E6QA 2UV2A 4OTPA 5FXSA 5DRDA 3QQLA 4FKTA 1PXMA 4BDJA 3KF4A 5HLWA 5FXRA 2R7BA 2P4IA 4AQCA 4K33A 3ATTA 4YPDA 4ZSAA 4I5MA 2C1BA 2ZV2A 3VULA 2GDOA 3RZBA 2BFXA 2EXCX 2W99B 1GIJA 2XEZA 4FVRA 4I0TA 5CAQA 3L9NA 3W2RA 4FVQA 1U5RA 4X2KA 2OJGA 3EQIA 4X2JA 5H8BA 1KE6A 3VS1A 1SVGA 3DAJA 1H27A 2J50A 3QZGA 4H39A 3NYVA 3F7WA 4FT7A 4IVAA 3FMNA 3MIAA 4QMTA 4D55A 1L8TA 3Q6UA 1IG1A 1P4OA 4FOCA 3LFQA 4QPAA 1OUYA 5L2TA 3CIKA 3AD5A 3C51A 4AOIA 4WOVA 4BKZA 1WBPA 3CQWA 3BBTB 3E88A 3F5PA 2WMAA 3LFDA 4AN3A 4IIRA 2R3NA 2ITVA 2O2UA 2ZJWA 3HZTA 5FP6A 3DXPA 4LUEA 4LOPA 4D2RA 5CF4A 3KL8A 4I94A 2YIXA 2W5BA 4IDTA 4FYOA 3BHYA 5JEBA 2J90A 2QOKA 4CLIA 5J1WA 2GSFA 4X2GA 3G6GA 2OLCA 4R6VA 4G5PA 5KMNA 4AGUA 2QOLA 2IVTA 4YZMA 2RFEA 2XF0A 3ATSA 3SRVB 2J51A 2YACA 1JAMA 4AZVA 3R7EA 2EB3A 4OUCA 3KGAA 5EQEA 3ORLA 2GS2A 3MY5A 3OXZA 2C4GA 2I0VA 3QRIA 4FIIA 4HPTE 3MJ2A 3PY0A 4C3PA 2WMVA 2PTKA 1J7IA 3VUIA 4XG4A 1FBNA 1W7HA 4FSYA 4IM0A 3MFSA 4TYHA 5GZ9A 4KKGA 1KV2A 2WU6A 4MXAA 5IEYA 4J7BA 4AFEA 3G33A 1U59A 1WFCA 3E63A 3GU4A 2B9HA 3PWDA 2XK7A 3PVWA 1UWHA 2B9FA 4FV7A 1XH6A 4KSQA 1ERKA 3SX9A 3QUPA 4Y5HA 1JKLA 2YHVA 2GMXA 1G5SA 3FQHA 3QQGA 4L00A 4E6CA 1BI8A 5F1ZA 4RIYB 3W8LA 2PVRA 3NVMB 3VBYA 3PPJA 3RGFA 2X8DA 3ZXTA 3RPSA 4C62A 3ZH8A 2JDOA 3M1SA 4IWOA 3SW4A 2OIQA 3LCTA 3DBCA 2QD9A 2QNJA 5JK3A 3EH9A 4C3RA 4RIYA 3A7GA 3LCSA 3WYXA 5AP7A 4O7SA 1XH4A 4BCJA 4HJOA 4QMPA 4R1YA 3C9WA 3LFSA 4O0RA 5LVLA 3VS4A 4AZSA 5DR6A 4JLCA 4HVIA 5G1XA 2VO6A 2XH5A 4NCTC 1PYXA 5C4KA 3DK7A 3AQVA 1OBDA 4F7NA 3Q9WA 2WMXA 2R7IA 4HPUE 3AD4A 3ZOSA 4MXZA 3HV5A 4F7SA 4EUTA 4KA3A 4CNHA 5A3XA 2R9SA 3C4EA 1M2RA 4LV8A 3FLWA 4U41A 1GY3A 3Q9YA 4MBIA 1GAGA 3I5ZA 4S30A 5EHYA 2KULA 4UALA 3MVHA 4OT5A 2I7QA 2YLFA 3FMEA 5CS6A 4ANOA 4M68A 4MF0A 2Z2WA 3PY1A 2F9GA 3JVRA 3MV5A 5EOLA 4FTUA 1DS5A 3A7JA 3NNVA 1PKGA 1PXIA 2B53A 2R3OA 3GCUA 3NYOA 3QKLA 3G5DA 4DFYA 3F3ZA 5CQUA 2XCHA 5DVRA 4ZAUA 3IPHA 2BR1A 5I9YA 5EYKA 3O17A 4UWYA 2C3KA 3K3JA 3FL5A 3ZXZA 4TYEA 4WUAA 2JAMA 1BL7A 3CTJA 3V8TA 4A9YA 4IB0A 4EBVA 4EWQA 4Q2AA 4FL1A 5KMKA 5L3AA 5M4IA 3NGAA 5CAVA 5FM2A 4DG2E 5BUIA 3D5XA 3R04A 2VWZA 5AR2A 1Q4LA 2VGPA 4W9XA 4EK4A 3NUUA 1DAYA 3D2IA 3HAVA 3OBJA 4IE9A 2OZOA 3TNHA 4AS0A 4KINA 4FEUA 5I9XA 4O1OA 1BKXA 4RG0A 3DJ5A 1E1XA 4LGDA 4QMLA 1QPCA 1SNXA 3VBQA 4JS8A 4BDBA 4LGHA 4JG6A 2Z7QA 3BU3A 5I9VA 2QURA 2ZMCA 3SA0A 2XKDA 2NNWB 2O3PA 2QOFA 3EQDA 3GGFA 3ANQA 2DWBA 3IOPA 1K2PA 4NIFA 5FWKK 5CXHA 3PLAE 2WB8A 5M08A 4P4CA 1PXPA 2R0IA 4M66A 4WUNA 4FNZA 3L8XA 4YBKA 3HRCA 4E73A 3WF7A 2BDJA 4D1ZA 2A1AB 4CTBA 5KHXA 2R4BA 3QCYA 1IRKA 5AAGA 1G8SA 3D9VA 1TQPA 1SM2A 3DJ7A 4RIOA 5AUTA 3POOA 2DYLA 3Q4ZA 3TV7A 4AOTA 1JVPP 3HAMA 4JBPA 5T6KA 2JITA 3WIKA 3PJ3A 5KMIA 3IGGA 4GV1A 3R6XA 2OF4A 3AC5A 5LCJA 4Z9LA 1JSTA 1WZYA 4JIKA 3A62A 4BDKA 3IONA 5M4CA 4BCHA 2X8EA 3AT4A 2YCFA 3ZO2A 2R3QA 2FGIA 4FKPA 2ETMA 3FQSA 4EZ7A 3NNWA 4P2KA 3E8EA 3G9LX 2XIZA 4FT5A 4R3PA 4IX6A 3KB7A 4WA9A 4BI1A 5B0XA 5FTGA 4OAUC 1FQ1B 4XV1A 5DEWA 5D41A 2V62A 2HENA 3LIJA 4WNMA 4AT5A 3PP1A 4K1BA 4IVBA 1ZOHA 4J52A 1H1RA 2Y6OA 5HG9A 4FZAB 3VUTA 1OKWA 1NVRA 2WELA 1MUOA 2C5YA 2G15A 3GC8A 3CD3A 1YHWA 4V01A 4ZOGA 3LLAA 3LMIA 2BZKB 3E3BX 1XHAA 2C5VA 2W9ZB 3C4XA 4ACCA 1GZKA 3I6WA 4FSTA 5DR9A 3TJCA 3F66A 4EC9A 4ZSLA 5HCYA 4OTWA 2BRNA 5CF5A 1O6KA 1YDRE 4B4LA 3CSVA 2R3PA 2BDFA 5IQBA 2EWAA 4BCIA 3QD0A 3R2YA 3U4WA 3BU5A 3R8ZA 3DY7A 3BYMA 3EQRA 2YCQA 1YDTE 4I6HA 4U8ZA 3BPRA 3GC0A 4ENXA 3TUDA 3SOCA 4CMTA 4FEQA 2QKRA 3KXHA 4WG3A 2QU6A 4EOKA 2AYPA 4U80A 4USDA 3AMYA 3IK3A 2J0KA 4XOZA 2BIYA 4AACA 3UPXA 3U6JA 3U8WA 1OPLA 2ZDTA 3RK7A 4X2FA 3EQCA 3QTUA 4O81A 4O27B 1FGKA 3OTVA 3ROCA 1A9UA 4BIEA 4DFNA 4MD9E 2UVZA 1L3RE 5DPVA 4F0GA 3TZMA 5J7HA 2WTIA 1KUTA 4ITIA 5JFVA 3GI3A 4M69A 4YC3A 3Q32A 2HY0A 4CG9A 1NY3A 4GK3A 4HGSA 4E26A 4FI1A 5IQEA 4FL2A 4FTJA 3T9TA 2UVXA 3ZCLA 5ANKA 2X9FA 3BELA 3BHUA 3KA0A 4KRCA 2W17A 3OVVA 2R3FA 4FSRA 5EW3A 4U79A 1UNGA 1VJYA 5HEZA 4R3RA 2PVMA 3F7ZA 3HDNA 2VU3A 5CYIA 1U46A 4CZYB 1Q41A 2WU7A 1EH4A 2ZB0A 2HW7A 3UOLA 4EK6A 2A19B 2C5XA 2ZOQA 3PVGA 3LJ2A 4FL3A 1A48A 4R7HA 3IQ7A 4QYHA 2R3MA 4DN5A 5AUZA 4NU1A 4CCUA 3R8LA 3FLYA 2WXVA 2HAKA 4FV8A 1DI9A 1OIRA 3LQ8A 4UWBA 3P23A 4X6QC 5HE1A 4EOIA 1CMKE 4PPCA 1I09A 2WPAA 2CNUA 4AP7A 2XBJA 3IDCA 3RAKA 4K11A 4FEWA 3OD6X 4O0WA 3IW4A 4E3CA 3SDJA 5JT2A 3MSSA 2J5FA 1CSNA 1W84A 3D15A 2ZM4A 3ODZX 1GJOA 4MWHA 3FEGA 4MNFA 2J9MA 3UNKA 4M3QA 3ZO4A 5K0KA 4AN2A 3A2CA 3RNYA 2V55A 3E87A 3C50A 3SKCA 5D10A 3UZRA 4DCEA 4I4FA 3NNXA 5CI6A 4FEVA 3E7OA 4BC6A 2GTNA 3PVUA 4ASXA 4E4MA 4CV9A 4DEDA 4PNIA 5HGIA 4EYJA 3P5KA 4IM2A 2R3JA 4B8MA 4YTIA 4FTLA 3WE4A 4BCOA 5AV4A 2CKOA 2OJFE 4UN0C 3NEWA 4E6AA 5HOAA 3OEZA 3MVMA 3L8SA 3MIYA 3QTSA 2OXXA 3LFCA 4JDKA 4L52A 5IQAA 1ZARA 5L4QA 2A2AA 2KTYA 4KRDA 2Z7SA 4ACHA 4YPSA 3QTRA 2YDKA 4G9CA 5HE0A 4QTEA 5HNGA 2X0GA 3NCZA 3ZS5A 1ZRZA 3BQRA 1WVWA 4XG2A 4GSBA 2B9IA 3QZIA 5JFXA 4IZAA 2YERA 4BCNA 1OI9A 4XG9A 3R2BA 4IH8A 1LP4A 5CSVA 3U4UA 3DKGA 4ZSGA 5EI2A 1LPUA 4OTIA 4QMQA 2E9NA 2YM6A 3KF7A 3MI9A 5M57A 1ZMUA 3A4OX 3C4WA 3W2QA 3O71A 2XNMA 3L9PA 4LRJA 3NIEA 4S34A 2YLEA 4BKYA 4CGAA 3DQWA 4CT1A 4ZTSA 3GU6A 1ZYSA 3LXKA 5E91A 3PA3A 4R5YA 3OT8A 3Q04A 2C6EA 3G9NA 4Q9SA 4FZ7A 5HVJA 2J5EA 3RPRA 3MS9A 2ACXA 4G3FA 5LJJA 5CAPA 4ZK5A 4NTTA 3COIA 2IW9A 2W5AA 4C58A 4LRMA 4EQUA 4KNBA 2X39A 3R9DA 3LMGA 3JY0A 4P5ZA 2W1EA 1YDSE 5HU9A 2NP8A 3GC9A 3NPCA 2W05A 1W98A 4BWPA 1OBGA 2VRXA 4LMNA 4R5SA 2XNPA 4EI4A 5BUEA 3DNEA 4FIGA 5ETCA 3SC1A 5HX6A 1PMUA 4EH7A 3WIGA 3C5UA 3EQFA 4YZDA 4K0YA 4EHVA 3FUPA 2CHLA 1YWRA 1J91A 3QLFA 4JX7A 4ASZA 2F2CB 5E8ZA 5D1JA 3TT0A 5AP3A 3MY1A 3N9XA 2QU5A 5IQDA 3QD2B 4F0IA 4O0YA 2WO6A 4FKQA 4BZOA 4FZ6A 4FIHA 5EW9A 3UVRA 4L6QA 4C0TA 3MFUA 3VF8A 3NR9A 4N70A 4AGWA 2RF9A 3FLQA 2OXYA 2VO0A 2XK3A 4FT0A 4A9UA 3C5IA 3EFJA 2VWYA 1P5EA 4JL9A 3VS7A 3DB6A 5HIDA 4FK6A 4TYIA 5DT4A 5CSHA 5IH4A 4UB7A 1IAJA 1B6CB 1ZYDA 3EHAA 5D12A 3V5WA 2ZV8A 3R7OA 3TZ7A 4U44A 3UIBA 4GG5A 4W9WA 4P7EA 4ZLOA 3UC3A 4G16A 5HORA 4V05A 4RFZA 3OUKA 4I21A 3R1NA 5LMAA 2ONLC 5EH0A 5M09A 4BDIA 4GU6A 3RZFA 5CQWA 3COHA 4MX9A 3REPA 3KCKA 3H10A 2CN8A 5IUIA 3WI6A 4DFBA 4ERWA 4PDYA 3FZRA 3DDQA 1H28A 2X2MA 3WZDA 3CXWA 2B55A 1Q5KA 3Q4UA 1OL1A 2PVKA 3SXRA 2WQBA 2VTOA 3R0TA 4EHZA 3AC8A 5JMSA 1ZYLA 4L68A 5DLSA 3TM0A 4ANSA 4MNEB 2QOHA 4G3DA 2JKOA 2GQGA 3TV6A 4RWKA 1K3AA 3HV6A 4A7CA 4E20A 3K5VA 3MFRA 2ZM1A 2X2LA 3FQEA 2GNIA 2IVVA 4MNEA 4DEBA 5HU3A 3ZEWA 1M14A 2WQNA 3I7CA 3PXZA 4OW8A 3NIZA 1Q3WA 4PMTA 4YLJA 4C3FA 4E4LA 4B8LA 5EHOA 4D1XA 3O96A 1RJBA 5I0BA 4R7BA 3QD3A 3R7UA 2WMWA 5HNIX 3ENHA 3Q53A 4G31A 5C8KA 3FMMA 1UU7A 3KK9A 1O9UA 3P1AA 3E62A 2WMQA 2UZNA 4EORA 4FV4A 3ORXA 4U42A 3AT2A 2V7OA 3OCBA 4GK2A 4KKHA 4YHJA 3FI8A 5HO7A 1K9AA 5JSMA 1ZMVA 3BYVA 5J95A 1ZAOA 3BU6A 3C1XA 4DE4A 2W06A 3WF5A 4YUQA 2XNOA 3QCSA 2XNNA 5DH3A 4EC8A 3R9RA 4D0XA 3NX8A 5F94A 4F63A 3BGZA 4EHGA 4NFNA 4O7RA 4U43A 2C6LA 4KS8A 1ZY4A 3PIZA 1UNHA 2Z02A 5TO8A 1KOBA 4L45A 5FBNC 4AW0A 3A7FA 2J0IA 5HKMA 3QXOA 5JRSA 2IW6A 1SMHA 3ROYA 4W8DA 2I0YA 3DB8A 3NDMA 5BNJA 5CY3A 3UBDA 2BFYA 3CGFA 4LUDA 1DAWA 3EOCA 4QTBA 3BLRA 2ETRA 4TWPA 4EQCA 2VTLA 2R0UA 4FE2A 2ITYA 1QL6A 3EN7A 3B2TA 3V04A 5CVGA 2G1TA 1ZZLA 4BCQA 3M11A 2VTRA 4RA4A 4YLKA 3TKUA 2YISA 3JXWA 5ACBC 5DNRA 3S2PA 2BAJA 3G6HA 3O50A 4UYNA 1YOMA 2XBAA 3OG7A 4A06A 2YIWA 2YM3A 5KO1A 3ORPA 5EQYA 1SVHA 3SOAA 4EQMA 4F6WA 4F70A 3MB7A 5C01A 1YW2A 5DBXA 3ZDIA 3E5AA 3NUPA 4F1MA 3FZSA 1OIQA 3GQLA 4DLIA 3CR0A 2F49A 4BDGA 4O7NA 1M2QA 2R5TA 3KU2A 4NYEA 5C8MA 4F09A 5CAOA 3NW6A 3EYHA 3NWWA 2Y4IC 4FIEA 4GW8A 4JNWA 4BICA 5AEPA 4DEEA 4GRBA 1QMZA 2E2BA 3HVCA 3AGLA 4RGJA 2X6DA 4TXCA 4E5AX 3LCDA 3R30A 1XR1A 3MJ1A 4MAOA 4JDHA 3FSKA 4FX3A 3UGCA 4CVAA 3P78A 5JN2A 4J71A 3OY3A 4N4SA 5HQ0A 3BYUA 3MPMA 2Y7JA 3UNZA 3AMAA 4CXAA 2PUPA 2Y4PA 3QX2A 4LFIA 1XBBA 3VC4A 3D14A 5BUJA 2A0CX 3O2MA 2FYSA 2UZUE 3UIUA 4BI0A 5AAEA 4USEA 3SG8A 3QA8A 4H3PA 3SD0A 3LFBA 5J87A 4QP8A 5KMMA 3VUMA 2G2FA 2ZB1A 3GFWA 4FT9A 3MDYA 3H30A 5ANGA 2BAKA 3KXNA 2CGVA 1VEBA 2ZAZA 2GCDA 4BTKA 3TUBA 3ORIA 1ZLTA 1URCA 2Y8OA 3PLSA 4DFUA 3FI2A 3QRTA 4IX5A 2PE2A 3HRFA 4NTSA 3UOKA 2Z7LA 1YXTA 4GMYA 3W18A 2R64A 5LVMA 3R1QA 5H8EA 4XRLA 2J7TA 3BX5A 3SGCA 2WMSA 3AC2A 2WGJA 3HUCA 3KULA 4WG5A 5AP0A 1YHVA 4XP0A 5DFPA 5HBJA 5M56A 4TY1A 2JIIA 3GFEA 5HG7A 1GZNA 4CKRA 2XUUA 3TXOA 5IA4A 3UC4A 4AUAA 5EDQA 1KV1A 1W83A 2ITZA 3T9IA 2UW8A 4QP2A 3QHWA 3U87A 5HVKA 1R3CA 3NMUF 4H05A 2ITNA 3L8PA 3WE8A 3ZFXA 3S95A 3RWQA 1V0OA 4FTTA 3MYGA 5G6VA 3QUEA 3Q5ZA 2A27A 5AMNA 4HNFA 4O7VA 5CSPA 3UZPA 3LKMA 3VHKA 4CYIA 2FUMA 3DS6A 3HGKA 4WRGA 4YJPA 3ID6C 3OOGA 5IDNA 4FVPA 4I6BA 4LYNA 3VJOA 4BDEA 2OH0E 4NM5A 1JKKA 3E8CA 3PVBA 5HO6A 4CYJA 4M12A 5IPJA 2QOIA 3RKBA 3NAXA 4G6OA 1F0QA 2PMNX 4XS2A 2YM8A 5FTOA 3R02A 2W7XA 5BX0A 3DFCB 1OGUA 4G34A 3DV3A 3KVWA 5KE0A 2VTMA 4NKAA 2W1ZA 3QCXA 2YFXA 3HL7A 4UMRA 2P0CA 2VNYA 2QO9A 4YJQA 5M44A 2CMWA 3R9HA 3DBQA 1BX6A 1J3HA 3BZ3A 3D7TB 4OT6A 2VTNA 2O0UA 2XM8A 3P0MA 3KXGA 1OKZA 3AC4A 1UV5A 4AT3A 4G3CA 5LWNA 3NZ0A 4QQJA 5I5ZA 3VUGA 1YXSA 3VW6A 2YM7A 3D7TA 3UPZA 2XEYA 4ZTQA 3FMKA 4RWLA 4ZJIA 2IPXA 2ONLA 2JGZA 5IU2A 3DOGA 2QOOA 5BVKA 3UG2A 1R0PA 5J9YA 1UWJA 3V51A 3ZU7A 4FYNA 4K6ZA 4TYHB 1STCE 1Q8WA 4YNOA 5ETFA 5K9IA 2V7AA 2XM9A 4K9YA 4L67A 3FXXA 4RZWA 4QP9A 2R3KA 4XCUA 5K0XA 5L8LA 3PRIA 4ANBA 2JKMA 3T3VA 3UOJA 4UY9A 1OM1A 4FICA 5IA5A 3BWFA 3MWUA 1JSUA 4IJPA 4BTMA 2FSLX 4FTCA 5BVFA 1XQZA 2I1MA 3V5QA 3NUYA 4D9UA 3R9NA 4AA4A 3LFAA 5L2IA 3U6IA 1QPJA 3QRJA 3FBVA 3TL8A 5M51A 4YJNA 3NUNA 3VS0A 1GOLA 4RIXB 1Y91A 4PNKA 4QNAA 2OKRA 4OTHA 3ZSIA 5JZNA 4EOJA 4S31A 4K77A 2E9UA 3EQHA 5GINE 2F7XE 1M7NA 3C0GA 4WD5A 1NA7A 3CQUA 4LOOA 3CJGA 4RIXA 3UVQA 4I20A 4AA5A 2W1GA 5A46A 5LXMA 3DZOA 5CENA 4ERKA 2RG6A 3ZRKA 1P14A 3TACA 2PUIA 2PZIA 2GS7A 2JIUA 2XNGA 3FZ1A 3KRJA 4YZNA 3V6RA 4X2NA 1PF8A 5K3YA 4OBQA 4YJOA 5FP5A 4G3EA 2HXQA 4WG4A 4EOPA 1PKDA 4LQMA 4CQEA 3MY0A 3BQCA 3WILA 2X7OA 3C0IA 3GQIA 4FKLA 5F4NA 3QCQA 3HDMA 3FLNC 4F99A 1WBNA 5HLPA 3F5XA 3FXZA 3DFAA 4X7QA 1Y8GA 4FV1A 4DA5A 3QTXA 4G6LA 5AUUA 2VGOA 3FPMA 5AV1A 3G90X 4LG4A 4XV9A 5DT0A 2PE1A 5DEYA 2CKPA 1XJDA 2EB2A 4F65A 3QD4A 4QP1A 1Q8UA 2EU9A 4YP8A 2GQSA 4KABA 4U7ZA 3QHRA 4BFMA 3Q96A 2Y9QA 3TEIA 5A4CA 3Q2MA 2IJMA 2VTTA 2GNJA 3KN5A 3TV4A 5EFQA 3OWPA 3PDTA 3FV8A 4AG8A 4PF4A 4AZWA 3QYWA 1JBPE 4I0SA 3D0EA 3C0HA 2RIOA 5CI7A 5M53A 4TT7A 2X4FA 2BHHA 2PZRA 2OIBA 2O65A 5HTIA 4QRCA 3VBTA 3UNJA 5E8SA 4PPAA 4CMUA 2Y4IB 5HO8A 3NYXA 4MK0A 4C38A 3LJ0A 5AP2A 3SQQA 2Z8CA 2PVFA 4FNWA 4UXQA 4DT8A 4EOMA 3ZLSA 2HY81 3T8OA 5A4EA 3GOKA 4DEIA 3I5NA 3IECA 4OTQA 4C4JA 1WCCA 4APPA 2RG5A 3UQFA 2XNBA 2XIXA 3ANRA 2JFLA 3CKWA 5BYLA 4MTAA 4W4VA 3QAME 4GH2A 1JKTA 3FJQE 1KWPA 1Y8YA 2ZYBA 4FUXA 4DBXA 1FMOE 4NIFB 4OGRA 4XOYA 3PZHA 2IVUA 2IZTA 3I81A 4I22A 4L43A 4YC6A 4QMXA 3R8PA 2OU7A 1TQMA 1SVEA 2ITOA 2JBOA 4XX9A 5F95A 2GHLA 5HE3A 5CU0A 4J53A 2O63A 2C6IA 2VTSA 4FIFA 4G17A 4M67A 4A4OA 3F88A 2UW6A 4YMJA 5CEQA 3K54A 2CCIA 1BI7A 4CFMA 3TKHA 4CRLA 5IA2A 4RBLA 5BVEA 3QQUA 4XG8A 4PMMA 3GC7A 3CBLA 4FMQA 2UW7A 4JRVA 3WZEA 4C7TA 3ULZA 3CPCA 4GYIA 4OR5A 1ZMWA 1BLXA 2BHEA 3KCFA 4X21A 3ZUUA 1BL6A 2QG5A 3EMGA 3GEQA 4JAJA 4ZY6A 5BVOA 3KVXA 2OK1A 2YM4A 3ZBXA 3FL4A 4R77A 3ZDUA 3O0GA 5E8WA 3KXMA 4ZMEA 2VTPA 3W2PA 1YXUA 2NO3A 4EOOA 5CXZA 4DGMA 4YLLA 4GUBA 4PY1A 1BUHA 4BIDA 4BDAA 3RBWA 4JBOA 1Q97A 2RGPA 3A99A 4BKJA 4C4FA 4HW7A 3UQGA 1YXVA 3OXIA 4KUJA 2CKQA 3MGYA 3PXQA 3ULIA 3CKXA 3W8QA 3SXSA 5E9EA 5IA0A 4UEUA 5LMKA 1G8AA 1KE5A 4BHNA 3ERKA 5C1QB 2UZEA 3GU7A 4K18A 2QLQA 3ZUVA 4B6LA 2E9PA 4FTNA 1VR2A 1Y6AA 2UZLA 2C3LA 3PUPA 3V6SA 3ORZA 2XRUA 3DT1A 2YEXA 3EIDA 3HA6A 4X3JA 4E7WA 5LWMA 1H01A 4G1WA 5M55A 2QKWB 5CAUA 2OI4X 2UUEA 1WVYA 4KB8A 5KUPA 4LL5A 5FG8A 3E64A 4BDHA 3PTGA 2C3IB 1OL5A 4ZSEA 2WTVA 5HCZA 3VO3A 5TE0A 1H0WA 2OH4A 3ELJA 5EM7A 4EH4A 4QYEA 5CEIA 4D1SA 4RWJA 1ND4A 3RPOA 3UTOA 3W2OA 3P9JA 1JKSA 4UZDA 4C2WA 5E1SA 4CKIA 1W0XC 4ORKA 4UX9A 4PX6A 4KS7A 3ZEPA 4RA5A 1RW8A 4FKRA 4GK4A 4F9YA 4NWMA 2B54A 4ZTHA 2X7GA 2GNLA 5E8UA 5HTCA 2G2IA 5EOBA 4NL0A 2YA9A 4G5JA 5A4QA 2WQEA 1U4DA 4JAIA 3KC3A 1HCKA 2WKMA 4FKJA 1J7LA 4GU9A 5JKGA 3DAKA 2W0JA 5CANA 5C9CA 5D9HA 1WBTA 5IA1A 4M69B 4NJDA 4DITA 1PXOA 2EVAA 3F9NA 3BE9A 3R7VA 2CLXA 2WMRA 3L1SA 4BL1A 1RDQE 4QMWA 3RK9A 4H1JA 5IZFA 2RKUA 4I5HA 5HBEA 4HGTA 2QLUA 2OXDA 2UW5A 4HZRA 4IFGA 1YVJA 3EFWA 3KMWA 4O0TA 4WNOA 2RFSA 4X0MA 4A4LA 4WKQA 3L9MA 2E9OA 1CKIA 3IDPA 3SAYA 2OICA 4C2VA 3FDNA 3NUXA 3OZ6A 3E93A 2QQ7A 5JZJA 4I24A 4NJ3A 4HVDA 1PMEA 4C8BA 4IHPA 5TT7A 2R3GA 4A07A 4D2SA 4YZBA 4MKCA 1JPAA 4FODA 4F1OA 3R21A 2UZDA 3BYOA 1XH5A 2W1CA 2FB8A 1GZ8A 3GXLA 2REIA 4RVKA 5H2UA 4F1TA 5AX3A 3A8XA 5I3OA 4YO4A 5AV0A 1GZOA 2BKZA 5GJGA 3PJ1A 3OOMA 5D7AA 2C47A 4WIHA 2UZTA 4DBNA 1PRYA 2OZAA 3U6HA 3KFAA 4EJ7A 3MA3A 4OTRA 3DKCA 4O1PA 3UMXA 4JIAA 1VZOA 4A9TA 3DPKA 3QTIA 2QC6A 4JI9A 4MBJA 4AZTA 4U81A 3PZEA 5ANJA 1OL2A 1TKIA 5TOZA 5CVFA 4WBOA 4GG7A 5HIBA 4E5BA 4IZ5A 3TI1A 3RJCA 3U9CA 2B7AA 2UW0A 4M0YA 3ACKA 4CKJA 4WO5A 4M84A 4EOSA 5DYJA 4MQ2A 3QWJA 3D94A 3U9NA 1B38A 2C69A 4PPBA 1QPDA 2YCSA 4UV0A 3PJCA 4FTIA 2P55A 3F3UA 4WHZA 3E92A 4M0ZA 1OL7A 3OHTA 4ONAA 3BHVA 4ZTNA 5K4JA 1QPEA 2CDZA 3EWHA 4N6ZA 4RVTA 5EHLA 4Y8DA 3PXKA 4IANA 5AR8A 5FEEA 4FT3A 4C4HA 2VO7A 4O86A 3AG9A 3BBWA 4MWIA 2ERKA 4DGNA 1R1WA 5I9UA 3N4UA 2BROA 2WTWA 3DZQA 3OC1A 5L6WL 2QOBA 4MEDA 1PW2A 2FH9A 4MBLA 4RZVA 3H0ZA 4FSUA 4TWNA 5L6OA 3CY2A 3IGOA 4GIIA 3DDPA 3MN3A 2QI8A 2PSQA 3NUSA 4O96A 5I4NA 1REKA 3G0EA 3PJ8A 4FR4A 2YIQA 4GT4A 3A7IA 4O6LA 2W96B 5CVHA 4HZSA 2P2HA 4Q5EA 3P7CA 5CZIA 3TTJA 4U0IA 4QMOA 5AWMA 5BMMA 3KRRA 3CP9A 5KHWA 4QP7A 3LE6A 1JSVA 2HZ4A 5AADA 5AJQA 3RM6A 3VBXA 3F69A 2CGXA 3FMHA 1GNGA 4RWIA 4ASDA 3I4BA 4TWCA 2PK9A 4XP2A 4R3CA 2YJRA 4QP3A 4GVAA 4QMNA 1OKYA 4XHKB 2QHMA 4ALVA 4ACDA 4KIOA 2BRBA 3DLZA 1H4LA 2P33A 5FUTA 3VQHA 1M2PA 2ZV7A 3UO5A 3I1AA 4LMUA 1O6LA 5A4TA 1OB3A 5IMXA 4YHTA 4MVFA 4EH6A 3EN4A 5IF1A 3EQBA 3LPBA 2NRYA 5LCKA 4F0FA 1F3MC 3NS9A 4BWKA 5FRIA 5JFWA 1OMWA 3M42A 5KMLA 3DAEA 1H8FA 4IC8A 5AUYA 4ANMA 1CKJA 3LVPA 4HYIA 4QP6A 3Q5IA 4HVSA 2OJJA 3NVKI 2W9FB 3L8VA 4W4YA 3VBVA 3DK6A 5EK7A 4KBAA 2HZNA 3FLZA 2F7ZE 4YBJA 4KWPA 5HG8A 3MB6A 4DGLC 2F4JA 2VNWA 3GVUA 4RX5A 4FGRA 3QA0A 4YZCA 2YAAA 4IAYA 3TJDA 4E93A 3QTQA 3OCTA 1YRPA 1NT2A 3VIDA 3MTLA 2XA4A 1PY5A 4EK8A 2PZYA 3R28A 3V5TA 4ZLZA 3QKMA 2XYNA 3DA6A 3UQCA 3CTHA 3FSFA 5H8GA 4LRKA 3RPYA 2QHNA 2PMLX 3D7ZA 4CD0A 3CS9A 1J1CA 4D9TA 1FOTA 1IA9A 4YJVA 2Q0BA 5JQ8A 1H08A 2VN9A 2ZM3A 4MYGA 2C3JA 2GNFA 2JKQA 3S0OA 4O38A 3NSZA 1Q3DA 1YI4A 4KAOA 3Q4TA 5EM6A 4N57A 2JDTA 4OAVB 5E4HA 2JFMA 4FSZA 4IXPA 1MQ4A 2XRWA 4XYFA 4YHFA 5EKNA 4FTQA 3JS2A 4QTCA 3TUCA 4QMVA 5E1EA 1FVRA 3T3UA 4CT2A 5EYMA 3PFQA 4S33A 1KOAA 4JG7A 4IVDA 5AV2A 3UJGA 4ZY5A 4EBWA 4DC2A 4FKSA 4LV5A 2AC3A 2QOQA 3FKNA 2ITXA 3RAWA 2CKEA 1FVVA 3BEAA 4RLKA 4BCFA 2PZ5A 4BGGA 3I60A 3O23A 4BRXA 5CEPA 3II5A 2BZJA 4FKUA 3CTQA 5FEQA 3KY2A 4FV9A 3UO6A 3WF6A 2WQMA 2HIWA 3PPZA 4HGLA 4AA0A 3GENA 3C4ZA 4KIPA 4I23A 2PVNA 4IEBA 5L8KA 2FSTX 3E8NA 2YJSA 4FKIA 2BTSA 3PP0A 2HZ0A 3E8DA 3R71A 4MXXA 5ANIA 5BVWA 5KMJA 4NM3A 1YI3A 3GOPA 3CJFA 4G6NA 4ZZOA 1PMVA 3BHTA 4U9AA 1BMKA 1JNKA 5IQCA 1ZZ2A 3D5VA 3QC4A 4JVGA 3I0QA 3COMA 3W2CA 3BWJA 1KE8A 2YN8A 2E9VA 4PMPA 3VJNA 4BYJA 4DHFA 3LM0A 3I6UA 4XRJA 4JQ7A 2B4SB 3RPVA 3TNQB 4F9WA 3AD6A 4K2RA 5I3RA 1UVRA 5IQFA 2ITQA 2YM5A 4MXOA 3ZSGA 1XH7A 4UMQA 4YSMA 3TZ9A 4EWHA 4DGOA 4FNYA 2IWIA 4X3FA 4D4SA 2VWXA 4EKLA 2XCKA 4ZSJA 5DA3A 4RFYA 3FXWA 3ZC6A 3R9OA 3F6XA 3ZLWA 3ZYAA 4GYGA 1TQIA 3CLYA 2B9JA 2X4ZA 2ZMDA 4FKGA 3UG1A 4BN1A 4BHZA 4HVHA 2Z7RA 4LOQA 4M14A 4M97A 4FIJA 4WSQA 2XB7A 5IKWA 3GCQA 4FZFB 5DE2A 3KN6A 3WARA 3RVGA 3O8UA 3MW1A 3OROA 3HKOA 2QG7A 3R22A 2ESMA 3Q3BA 4RC3A 2HOGA 3W1FA 3VUKA 3R73A 4QPMA 2VX1A 5CSXA 3RCJA 5CF6A 1I44A 2AC5A 2BUJA 4RQVA 3IS5A 3LFNA 3E3PA 2H6DA 3EN9A 2WTCA 4JQEA 1OZ1A 4I6QA 4ZTLA 4JJRA 4IZ7A 5HIEA 2PPQA 5E92A 2RFNA 1NVQA 1M52A 2I6LA 4RMZA 5M4FA 2YITA 2CSNA 4ZY4A 5GZ8A 3H9FA 4DEAA 4RT7A 4AGCA 3LZBA 1Q8ZA 3V5LA 3D5WA 4J95A 2FVDA 4QNYA 2G9XA 3PRFA 1G3NA 1APME 2C68A 3MH2A 4ID7A 3WF9A 2YCRA 3WF8A 4DFZE 3NUAA 1H24A 4EONA 5LQFA 1MRUA 2OFVA 3QALE 5E8TA 4DH5A 4C4EA 2WNTA 4GKIA 3EKNA 4YURA 3C4CA 3AXWA 4ACMA 2JDVA 4FV5A 1IAHA 3JY9A 4AZFA 2VO3A 4BZNA 2XIRA 4XP3A 5C03A 4TL0A 5AM7A 3HX4A 5LARA 1CM8A 4XV3A 5DHJA 3VS3A 3SHEA 3ZFYA 3NRMA 1OL6A 3GCSA 4L3LA 4ALWA 5I9ZA 4H3QA 2W1FA 4BTJA 3QRKA 4J8NA 4HYSA 3QUDA 2OG8A 3SW7A 5EYCA 2VWUA 2XKCA 4XV2A 2PMOX 2O8YA 5A4LA 3FPQA 1O6YA 4EHEA 1H1PA 4NW5A 5AA8A 4L53A 1MRVA 4JDIA 3THBA 4EZ5A 2BIKB 3GUBA 4IAZA 4S32A 3HEGA 4AAAA 4E4NA 4ENYA 3O8PA 4J99A 4V04A 4WBBB 4QPSA 2QO7A 2XVDA 2YZAA 3ORNA 4PP7A 2XIYA 5ETAA 3BLHA 2J2IB 3DTCA 3TG1A 5EI6A 3O7LB 3KULB 3ALOA 4L8MA 3OW4A 4O83A 4L9IA 3DBDA 4O0SA 2Y0AA 4QD6A 4DTKA 4L46A 4O21A 1JWHA 3CPBA 2X1NA 3FI3A 3GB2A 3Q6WA 4NEUA 4XEYA 4G3GA 2XKFA 3TNWA 4YJUA 3PG3A 4L7SA 2YIRA 4EOQA 5AUVA 4JQ8A 1PMNA 2GFSA 5AR4A 4PRJA 5GNKA 3P7AA 2WFYA 3QU0A 4E8AA 4JT3A 3E7VA 4USFA 3N51A 5LMKC 3NAYA 2IG7A 2WZJA 3LXNA 5JH6A 2JC6A 4GEOA 3WYYA 2PWLA 1YOLA 2BRGA 3OCSA 3QQJA 4FEXA 5HCXA 4PWNA 5LVNA 1IA8A 3WBLA 3ALNA 5GJFA 4F6SA 3UMWA 3PXFA 5A54A 3KMUA 4I0RA 5AIRA 5CEKA 2WEVA 3FZOA 5IUHA 2FO0A 5GIOE 2QR8A 2XJ2A 1V1KA 2YABA 3V5PA 3TTIA 4TWOA 4NM7A 3QFVA 1V0PA 5DN3A 3R7YA 5IEVA 4I93A 4DH3A 3RI1A 4Z3VA 3UP2A 1U54B 3F5UA 3AOXA 4ASEA 2C0IA 3QGYA 2OJ9A 4V0GA 4D2TA 4JR7A 2GNGA 4YTCA 2BZIB 2CCHA 3D4QA 3A4PA 3OWJA 5ICPA 2BVAA 2ZVAA 4XLVA 3DJ6A 4ZLYA 4RJ4A 1U54A 3FC1X 2VTJA 4EK5A 2RSVA 5HICA 4ZJVA 3R8UA 4NKSA 3LHJA 5JGDA 3DXQA 4FF8A 4L3PA 2YWPA 3TNIA 4FSMA 2R3HA 2I40A 4ANNA 4BCPA 3GCVA 3I79A 1YWNA 1WBVA 1YWVA 4KBCA 1IEPA 5FM3A 1M7QA 3LXLA 4D5KA 1FINA 3F2AA 4C37A 5CU3A 3AC3A 1VYWA 3QQKA 5IQGA 3Q9ZA 2DQ7X 4D4RA 2BAQA 3AMBA 3ZUTA 5HVYA 3UVPA 4C02A 4GJ3A 3F61A 4UXLA 3IW8A 3PWYA 2WMTA 4I1ZA 4O7ZA 4IWQA 3FWQA 4AT4A 1OITA 3D5UA 2F57A 2HWPA 4FKWA 4PL3A 3PA4A 4U45A 3COKA 2LGCA 1ATPE 3KQ7A 3PSBA 4H1MA 5DG5A 3V3VA 4FTMA 5CZHA 1J7UA 1CDKA 5FD2A 3PE2A 3ZM4A 1Z9XA 4R78A 3EFKA 3K3IA 3BKBA 4AXAA 4DEHA 5KBQA 3LW0A 2I0HA 4AE9A 4IAAA 4TPTA 4ZP5A 4BWXA 4AW2A 4FV2A 4RVMA 2H96A 1REJA 4IVCA 2WOTA 3QC9A 3AGMA 3PY3A 5FQDC 3G2FA 3KXXA 2WTKC 1Q8TA 2PHKA 3O51A 2XJ1A 3JPVA 5E8VA 1ZYJA 4YTFA 5KKRC 4HYHA 5LMBA 3EJ1A 5CLPA 4CFUA 3GT8A 4QYYA 1W8CA 2C6KA 4G9RA 4IWDA 4K8AA 5DI1A 5J5TA 3Q2JA 3TZ8A 3DBEA 5AM6A 5EDPA 3WOWA 2GFCA 3C7QA 3VAPA 2W1HA 3OXTA 3VN9A 5EM5A 4O7WA 4MD7E 4DINA 4ARKA 1H1WA 1FVTA 5AA9A 3HYHA 4EOLA 2VWWA 3BGPA 5HBHA 4ZS4A 3BEGA 4YJSA 3SRVA 4M15A 3ZRMA 4AW1A 3BIZA 3ET7A 3N4VA 1F5QA 5AR3A 3VS6A 4M7IA 4XBRA 5AX9A 3VUDA 3TIYA 3UIXA 3UO4A 2XK4A 3B8QA 4JBVA 1DI8A 4QP4A 2BALA 2Z60A 3QBNA 5DR2A 3R7GA 4EH5A 3GCPA 3DXNA 5CU2A 2ZV9A 3KXZA 3NCGA 4LL0A 4FKOA 3JYAA 2LAVA 2HK5A 4F64A 1UA2A 2BDWA 4YNEA 4YJTA 3RMFA 4MXCA 4O84A 5GJDA 3POZA 3JUHA 4QO9A 4WT6A 2VV9A 2YIYA 1YXXA 4JR3A 4L01A 4AX8A 4NH1A 1R78A 4FTOA 4PDSA 5CNNA 5B2LA 3HLLA 5KNJA 1UKHA 3TDVA 4YC8A 3U54A 2JBPA 4GFOA 5F9EA 5JGAA 5C4LA 3Q4CA 3BRBA 4EH9A 1E9HA 3EFLA 4I92A 3C13A 3RALA 5CF8A 1CTPE 1T46A 4RC4A 1LR4A 2PY3A 2YDJA 5BPYA 4ITJA 4O0VA 1H1SA 4Y5QA 4ZZNA 4OTGA 1YOJA 3ZLYA 5A6NA 4J96A 3LQ3A 4II5A 4QQTA 1OECA 1YKRA 2B1PA 4DH1A 3CC6A 4H36A 1UU8A 5BVDA 3UZTA 4CQGA 3S4QA 1UU9A 2W4OA 4TTHB 4QMSA 2IN6A 3DNDA 4Y85A 3ZZEA 2VWIA 4XG3A 4HVGA 2BZHB 3DCVA 5ACKA 4AZEA 4LM5A 1S9JA 2PVYA 3LCOA 1P4FA 3ZONA 1NW1A 3CY3A 4QMZA 2BMCA 5HG5A 4UZHA 5FTQA 3FI4A 2IO6A 3GBZA 4NSTA 3FMJA 4BBMA 3OWKA 2Q83A 2VZ6A 1UNLA 4YO6A 5L2WA 2W1DA 3QQFA 1WAKA 1H0VA 3GP0A 3IW7A 2HZIA 4YGAA 3M2WA 5AP5A 3QTZA 4N0SA 2C0TA 2GHMA 5HHWA 4OLIA 5KZ0A 2ETKA 4I5CA 1BYGA 3RHXA 5HNBA 3R01A 1HOWA 4F4PA 2DUVA 5BYZA 5DOSA 3BI6A 3CQEA 2QO2A 3KRLA 5DIAA 3UOHA 2JEDA 4QOXA 2JD5A 3LFEA 2X2KA 4NK9A 3MFTA 4I4EA 5J1VA 3A8WA 3SVVA 2GNHA 4JOAA 3V5JA 5BMSA 3HV3A 1B39A 2P3GX 1SYKA 4CSVA 1OUKA 2GTMA 4CFVA 4UMUA 5KX8A 2H9VA 5ANOA 5B2MA 4DLJA 2XIKA 3PXRA 1ZY5A 4NFMA 3UP7A 5AAFA 2BCJA 3R8VA 3PYYA 5A6OA 3ENMA 4IDVA 4HCUA 5CTPA 4C34A 3BV3A 2BKKA 3U51A 4F7LA 2ITWA 3FHIA 3B8RA 4D28A 2WOUA 2GHGA 5LOHA 4PMSA 4YSJA 3FKOA 3OBGA 2NRUA 3N4TA 4EH3A 2V22A 2OF2A 4F9BA 4I3ZA 4XBUA 4RVLA 3ACJA 4LI5A 3A60A 5GHVA 5K5NA 4C36A 2EXEA 4PL5A 3SV0A 4R8QA 5AP4A 4L42A 4KSPA 4RQKA 4YTHA 4CZUA 4TNBA 4W4WA 4QYGA 2YWVA 4RC2A 4ZZMA 3W55A 3QKKA 3TN8A 5CT7A 1HCLA 5TKDA 3VS2A 1H07A 2B52A 3FMDA 4PL4A 4W4XA 4UYAA 3VRYA 3R8MA 4F08A 2B0QA 3TKIA 4TYGA 2BTRA 4RX7A 5AUWA 3OUNB 3HA8A 2QOCA 4FV3A 3F2RA 4WRSA 1YQJA 4PTCA 2X9EA 5A9UA 2WIPA 3MPTA 4BR3A 2I0EA 5HD4A 5M4UA 3S1HA 2HWOA 2XK6A 3F3TA 4BGQA 2OGVA 5CU6A 2EUFB 5KBRA 1UKIA 4U3YA 2PVJA 4TNDA 2CGWA 4FNXA 4IM3A 3ODYX 3FMLA 1Q24A 1QCFA 1RE8A 1ZOGA 2GU8A 3EL8A 3JVSA 4TZRA 5AIKA 4ZS0A 3VS5A 4AU8A 3UODA 5A14A 4NUSA 4GVJA 4O2ZA 4EH2A 4HNIA 1XH8A 3WZUA 5CNOA 4Y72A 2WAJA 3WZKA 1OVEA 1OIYA 5DMZA 4Q5HA 5IQHA 1XWSA 3A61A 5DRBA 1JLUE 4C4GA 3SLSA 4DTAA 4RLLA 2R3LA 5KZIA 4O22A 2WTJA 4FSWA 1Y6BA 2XKEA 4RX9A 3S3IA 4FV0A 2XNEA 4D2PA 3NLBA 4DFLA 4O0XA 2FA2A 4IFCA 4AGDA 5B7VA 3EQPA 3MVJA 3O8TA 3EB0A 4X3FC 5J8IA 4AFJA 3MPAA 4R7IA 3GU8A 3CD8A 4BI2A 4IB3A 5CSWA 3ZFMA 4AE6A 2C6DA 1NVSA 2HXLA 3IO7A 1AGWA 3HMMA 3LM5A 2WTKB 1H00A 4JRNA 3VUHA 1URWA 4DAWA 2C5OA 4U6RA 4TKSA 5KKRB 5L6PA 3LQ5A 4ZEGA 4ZIMA 1Q8YA 1AQ1A 3R83A 2OZAB 4DEGA 4ZMFA 5IH5A 3GU5A 4YR8A 1ZWSA 3V01A 2BRHA 3PXYA 4IX3A 3VW8A 5ITAA 1VYZA 3PJ2A 3DLSA 1AD5A 3QLGA 3MH0A 3PIXA 4OTFA 5HI2A 2PVLA 2XK9A 3CE3A 4U40A 4CV8A 4Z16A 4WNPA 3OS3A 4WNKA 4PUZA 4E1ZA 1JOWB 2XK8A 5FDXA 5IISA 3LFFA 4QMMA 4EH8A 2QCSA 3R1SA 4J8MA 3EKKA 1ZXEA 4IW0A 4CG8A 4PP9A 3QXPA 4R1VA 2V5QA 3VQUA 5J9LA 2VX3A 3IW5A 5HX8A 1WBSA 2SRCA 3IKAA 3AC1A 4IZYA 4FTKA 2IZRA 1T45A 2PVHA 3QWKA 4QQ5A 4BDCA 4EUUA 5JQ5A 4IADA 5CEMA 1TVOA 3LLTA 3G51A 4DG3E 3DQXA 4C59A 4XG7A 3FZPA 4D0WA 4DG0E 4D2WA 5D7VA 5FXQA 3LMHA 3PSCA 3QZHA 4HCTA 4CFNA 4MH7A 2ITPA 4FSQA 4PDPA 2H34A 4E5WA 1Q61A 3B2WA 3ETAA 4FOBA 4NT4A 2DS1A 3ZLXA 3RWPA 4A9SA 5FDPA 4AOJA 3OFMA 5EDRA 3ORTA 2XS0A 3CEKA 5IQIA 4W8EA 4ZXTA 5JRQA 3RAIA 2QONA 1WMKA 3ZTXA 4Z7GA 4O7LA 1OIUA 1LEZA 3HMPA 5HTBA 1Q62A 4HGEA 1Z57A 1PXLA 3HNGA 4BBEA 3DKOA 3R7IA 2F7EE 3D2KA 1WBWA 5H9BA 4CRSA 1CKPA 3RTPA 4NCTA 3UIMA 1YI6A 2X8IA 3WZJA 3ZM9A 2VTIA 3ZO3A 2O5KA 4C57A 4DF3A 3EZRA 3ZRLA 4L7FA 2JKKA 4IJ9A 4FUYA 1UU3A 4XJ0A 5BYYA 5EM8A 2YZLA 2OSCA 4MHAA 5E8XA 2UZVA 4MF1A 4XH6A 3ZHPC 3BYSA 4FV6A 1KE9A 2J0LA 4Q9ZA 3C4FA 4RRVA 4FSNA 4ALUA 4U5JA 4B7TA 3OW3A 2G01A 2JLDA 1M17A 2J6MA 3W16A 2WHBA 4HOKA 3JR1A 2O64A 1OPJA 4IMYA 1X8BA 3U55A 2UW4A 1R39A 5GZAA 2GQRA 1OKVA 4F9AA 3EQGA 1V0BA 5HE2A 3NNUA 4UBAA 5I9WA 5TF9A 4O91A 4TYJA 3HRBA 2P2IA 4RJ7A 3RAHA 4H58A 2PYWA 2HW6A 2W4JA 3ZO1A 4C4IA 4JXFA 5E7RA 4FC0A 4GCJA 4LGGA 4IAIA 5CWZA 2VAGA 1PJKA 4BCMA 1Q99A 2OJIA 4RJ5A 1XBCA 1FPUA 4KIQA 5JFSA 2CPKE 4NZWB 5IMEA 4BVUA 2XZSA 1H26A 4FGBA 3VRZA 3KK8A 2PULA 4P90A 3LJ1A 2WQOA 4BZDA 4FK3A 3V8WA 4EJNA 3V8SA 3QTWA 4F9CA 1WBOA 2CNQA 1IASA 1MRYA 3H0YA 5HESA 3EZVA 3OWLA 3UYTA 2EXMA 3KRWA 4Y46A 4UMTA 5HLNA 2WTDA 2QODA 5DGZA 4A4XA 3LOKA 1JQHA 3PSDA 1W82A 2J4ZA 4KBKA 2PE0A 2CN5A 3NW5A 3TCPA 4CTCA 3HMOA 4EL9A 2WEIA 5ETIA 4D4YA 2UW3A 4QMYA 3HMIA 3PG1A 5FEDA 4B0GA 2HYYA 3OTUA 2IZSA 4MXYA 4O6EA 5C27A 5J79A 5C8NA 1FGIA 4RFMA 3FY2A 4FG9A 4FZDB 4OBPA 4RPVA 2BILB 4BCGA 4M8TA 1LEWA 3CGOA 5EQPA 1R0EA 2H8HA 4HCVA 4QTDA 5AR7A 5L2SA 3BE2A 2ITUA 4BB4A 2YAKA 3TIZA 4I41A 2ZDUA 4PQNA 4BBFA 5ANEA 4NW6A 4GT3A 3DKFA 1MQBA 2OIDA 4RJ3A 3HUBA 2C5NA 2OWBA 3ZC5A 1Z5MA 3F5GA 3H3CA 1OPKA 4AWIA 2WMBA 2J0MB 2UVYA 4C35A 4DH8A 2QR7A 2UZBA 3UE4A 5J7BA 3KKVA 2C30A 3W32A 4CLJA 4BYIA 4BDFA 4XMOA 3G15A 2CJMA 4N6YA 3RINA 4PTGA 3F3VA 3RNIA 4O0UA 4GFGA 2WD1A 3KRXA 2UZOA 5HZNA 3P4KA 4GJ2A 4J98A 1PYEA 3OY1A 2C6TA 1NXKA 4GIHA 4D58A 1WVXA 4FG7A 1H1QA 3QGWA 2VTHA 4IC7A 2R3RA 4L44A 2OO8X 3UDBA 3HV4A 3FKLA 5AV3A 3QQHA 2VD5A 4CEGA 2X7FA 2C0OA 4DH7A 5KMOA 4DTBA 4OTDA 5AUXA 4TW9A 2X6EA 5FGKA 4BDDA 3L9LA 3FYKX 4APCA 4ACGA 3F82A 4BCKA 2ERZE 4KIKB 4JBQA 3PIYA 4J1RA 3H9OA 1Y57A 2JIVA 2VWVA 2Y6MA 3FY0A 5FBOA 5EKOA 2PL0A 5L8JA 5TR6A 4O82A 4GFMA 5AR5A 3BGQA 3ZMMA 1ZYCA 4KIKA 1XH9A 3RK5A 5IDPA 3R1YA 4X3FB 5J5SA 4O2PA 5EYDA 4D5HA 4QQCA 2XJ0A 3FAAA 2VTAA 1RQQA 1PHKA 4GS6A 4C61A 3QF9A 4X6RA 4H3BA 4P5QA 5DWRA 3VHEA 3W33A 3IOKA 4JG8A 5IG1A 3FC2A 3Q52A 4MD8E 4PDOA 4PV0A 1P2AA 5EI8A 3W2SA 2PU8A 1XKKA 3NYNA 1LUFA 2CLQA 3P79A 2BPMA 1PXJA 3ORKA 4CFWA 4F7JA 3EN6A 5CX9A 2UW9A 4DCAA 4EK3A 5CT0A 4TN6A 3EN5A 3AT3A 3FLSA 5F20A 3QYZA 4KKEA 2PUUA 1S9IA 4M13A 4Y95A 3DBFA 5CU4A 2C6MA 2VWBA 2IZUA 5ANDA 5T3QA 3LXPA 2VUWA 3MH1A 3OEFX 3Q9XA 3PPKA 5FLFA 3KREA 5J9ZA 3S00A 3OCGA 4BY9E 4QT1A 3ZBFA 3MESA 4RSSA 5AP6A 3MA6A 4ANQA 4IAKA 4WSYA 4B99A 3OMVA 4RX8A 4QTAA 4XNEA 4IB5A 3SXFA 2HELA 5HD7A 4IACA 3MBLA 2OBJA 1SZMA 4DT9A 4MCVA 4YU2A 3VF9A 5K4IA 3G0FA 3BCEA 2R3IA 4E6DA 3ZSHA 5IA3A 3QX4A 5CASA 3BHHA 2WIHA 4EEVA 4GKHA 2G2HA 3HMNA 2FSMX 3BLQA 4FA2A 3F3WA 4BIBA 4B9DA 3DGKA 4IB1A 1IR3A 4DFXE 4U3ZA 4D2VA 2J0JA 4AW5A 5EW8A 2YDIA 4CMOA 3HP2A 3R63A 5AP1A 3EL7A 5CEOA 4FKVA 3HP5A 3IDBA 4J97A 3QRUA 2V0DA 3Q60A 5H3QA 4AN9A 3ORMA 4DYMA 4UMPA 2IVSA 3H9RA 4IQ6A 4CFFA 4I6FA 5B2KA 3BV2A 3DTWA 1KE7A 2AUHA 3LCKA 4CZTA 3NW7A 2JDSA 3MH3A 4EYMA 4GT5A 1XO2B 2NPQA 4TRLA 2R2PA 5KCVA 5M07A 2F2UA 1MP8A 1E1VA 2FSOX 2W5HA 3KMMA 3VNTA 4Y73A 4Z55A 5IEXA 3ITZA 1SNUA 5D11A 2RL5A 4JDJA 4OBOA 4BF2A 3K5UA 3FYJX 2GPHA 4A9RA 4D4VA 5C26A 1KSWA 4E4XA 1DM2A 2JDRA 3VWAA 4Z7HA 1U5QA 2A4LA 3P08A 4YZ9A 2CNVA 5EG3A 2PMIA 4XLIA 3OT3A 3R00A 3PE1A 3HV7A 4YJRA 4O7TA 1A06A 3MVLA 3IG7A 4ITHA 2IW8A 2C1AA 4IX4A 4EKKA 4GL9A 4KD1A 2X81A 1J1BA 3TWJA 2PUNA 4CCBA 4ZTRA 4BTFA 3DK3A 1H25A
chains in the Genus database with same CATH superfamily
4GUEA 5E90A 2ITTA 4AF3A 4U97A 1FMKA 3RM7A 3D83A 3I7BA 2OW3A 1PXKA 3I0OA 4ANLA 2C6OA 4QYFA 4F6UA 5IH6A 5LVPA 4DGGA 4Y83A 3TDWA 4FTAA 4XG6A 3KEXA 4NM0A 3OP5A 2VX0A 3SG9A 3O7LD 3QZFA 2CGUA 4C33A 4ZJJA 5AFVA 2PZPA 2UZWE 3A7HA 3LAUA 3P7BA 3CCNA 4IAFA 4RJ6A 3W10A 5IUGA 3QL8A 4IBMA 3VVHA 5BVNA 4FRFA 3P86A 4EZ3A 3FZTA 3ZZWA 2WMUA 2OFUA 4JX3A 2W4KA 4HYUA 4MQ1A 5L2QA 1XBAA 4I5PA 3DU8A 3IW6A 3RCDA 2VTQA 2JAVA 4FBXA 3PA5A 4FG8A 2QVSE 3TNPC 2RFDA 3EYGA 1PXNA 4RIWB 5K5XA 5T68A 3FHRA 3K2LA 4V0GB 4XUFA 3FE3A 2BRMA 1YHSA 2Q0NA 2W1IA 5M06A 3RHKA 2XMYA 4BGHA 4O7YA 3HECA 4QMUA 4RIWA 4S2ZA 3OF0A 5LVOA 3VBWA 1GIIA 4PTEA 4IWPA 5DT3A 5BQ0A 4UWCA 4ZTMA 5GIPE 2XYUA 4RJ8A 2HCKA 5E8YA 4G2FA 4CFXA 3UYSA 3MTFA 1ZOEA 4L3JA 1GIHA 4FTRA 2XP2A 5JGBA 3F2NA 3GNIB 2GS6A 3RP9A 5CALA 1G8JA 3H4JA 4E6QA 2UV2A 4OTPA 5FXSA 5DRDA 3QQLA 4FKTA 1PXMA 4BDJA 3KF4A 4O4BB 5FXRA 2R7BA 2P4IA 5HLWA 4AQCA 4K33A 3ATTA 4YPDA 4ZSAA 4I5MA 2C1BA 2ZV2A 3VULA 2GDOA 3RZBA 2BFXA 2EXCX 2W99B 1GIJA 2XEZA 4FVRA 4I0TA 5CAQA 3L9NA 3W2RA 4FVQA 1U5RA 4X2KA 2OJGA 3EQIA 4X2JA 5H8BA 1KE6A 3VS1A 1SVGA 3DAJA 1H27A 2J50A 3QZGA 4H39A 3NYVA 3F7WA 4FT7A 4IVAA 3FMNA 3MIAA 4QMTA 4D55A 1L8TA 3Q6UA 1IG1A 1P4OA 4FOCA 3LFQA 4QPAA 1OUYA 5L2TA 3CIKA 3AD5A 3C51A 4AOIA 4WOVA 4BKZA 1WBPA 3CQWA 3BBTB 3E88A 3F5PA 2WMAA 3LFDA 4AN3A 4IIRA 2R3NA 2ITVA 2O2UA 2ZJWA 3HZTA 5FP6A 3DXPA 1XMLA 4LUEA 4LOPA 4D2RA 5CF4A 3KL8A 4I94A 2YIXA 2W5BA 4IDTA 4FYOA 3BHYA 5JEBA 2J90A 2QOKA 4CLIA 5J1WA 2GSFA 4X2GA 3G6GA 2OLCA 4R6VA 3TMOA 4G5PA 5KMNA 4AGUA 2QOLA 2IVTA 4YZMA 2RFEA 2XF0A 3ATSA 3SRVB 2J51A 3O5AA 2YACA 1JAMA 4AZVA 3R7EA 2EB3A 4OUCA 3KGAA 5EQEA 3ORLA 2GS2A 3MY5A 3OXZA 2C4GA 2I0VA 3QRIA 4FIIA 4HPTE 3MJ2A 3PY0A 4C3PA 2WMVA 3W0MA 2PTKA 1J7IA 3VUIA 4XG4A 1FBNA 1W7HA 4FSYA 4IM0A 3MFSA 4TYHA 5GZ9A 4KKGA 3PUFC 1KV2A 2WU6A 4MXAA 5IEYA 4J7BA 4AFEA 3G33A 1U59A 1WFCA 3E63A 3GU4A 2B9HA 3PWDA 2XK7A 3PVWA 1UWHA 2B9FA 4FV7A 1XH6A 4KSQA 1ERKA 3SX9A 3QUPA 4Y5HA 1JKLA 2YHVA 2GMXA 1G5SA 3FQHA 3QQGA 4L00A 4E6CA 1BI8A 5F1ZA 4RIYB 3W8LA 2PVRA 3NVMB 3VBYA 3PPJA 3RGFA 2X8DA 3ZXTA 3RPSA 4C62A 3ZH8A 2JDOA 3M1SA 4IWOA 3SW4A 2OIQA 3LCTA 3DBCA 2QD9A 2QNJA 5JK3A 3EH9A 4C3RA 4RIYA 3A7GA 3LCSA 3WYXA 5AP7A 4O7SA 1XH4A 4BCJA 4HJOA 4QMPA 4R1YA 3C9WA 3LFSA 4O0RA 5LVLA 3VS4A 4AZSA 1XMMA 5DR6A 4JLCA 4HVIA 5G1XA 2VO6A 2XH5A 4NCTC 1PYXA 5C4KA 3DK7A 3AQVA 1OBDA 4F7NA 3Q9WA 2WMXA 2R7IA 4HPUE 3AD4A 3ZOSA 4MXZA 3HV5A 4F7SA 4EUTA 4KA3A 4CNHA 5A3XA 2R9SA 3C4EA 1M2RA 4LV8A 3FLWA 4U41A 1GY3A 3Q9YA 4MBIA 3W0PA 1GAGA 3I5ZA 4S30A 5EHYA 2KULA 4UALA 3MVHA 4OT5A 2I7QA 2YLFA 3FMEA 5CS6A 4ANOA 4M68A 4MF0A 2Z2WA 3PY1A 2F9GA 3JVRA 3MV5A 5EOLA 4FTUA 3NFFB 1DS5A 3A7JA 3NNVA 1PKGA 1PXIA 2B53A 2R3OA 3GCUA 3NYOA 3QKLA 3G5DA 4DFYA 3F3ZA 5CQUA 2XCHA 5DVRA 4ZAUA 3IPHA 2BR1A 5I9YA 5EYKA 3O17A 4UWYA 2C3KA 3K3JA 3FL5A 3ZXZA 4TYEA 4WUAA 2JAMA 1BL7A 3CTJA 3V8TA 4A9YA 4IB0A 4EBVA 4EWQA 4Q2AA 4FL1A 5KMKA 5L3AA 5M4IA 3NGAA 5CAVA 5FM2A 4DG2E 5BUIA 3D5XA 3R04A 2VWZA 5AR2A 1Q4LA 2VGPA 4W9XA 4EK4A 3NUUA 1DAYA 3D2IA 3HAVA 3OBJA 4IE9A 2OZOA 3TNHA 4AS0A 4KINA 4FEUA 5I9XA 4O1OA 1BKXA 4RG0A 3DJ5A 1E1XA 4LGDA 4QMLA 1QPCA 1SNXA 3VBQA 4JS8A 4BDBA 4LGHA 4JG6A 2Z7QA 3UDZA 3BU3A 5I9VA 2XAMA 2QURA 2ZMCA 3SA0A 2XKDA 2NNWB 2O3PA 2QOFA 3EQDA 3GGFA 3ANQA 2DWBA 3IOPA 1K2PA 4NIFA 5FWKK 5CXHA 3PLAE 2WB8A 5M08A 4P4CA 1PXPA 2R0IA 4M66A 4WUNA 4FNZA 3L8XA 4YBKA 3HRCA 4E73A 3WF7A 2BDJA 4D1ZA 2A1AB 4CTBA 5KHXA 2R4BA 3QCYA 1IRKA 5AAGA 4JMQA 1G8SA 3D9VA 1TQPA 1SM2A 3DJ7A 4RIOA 5AUTA 3POOA 2DYLA 3Q4ZA 3TV7A 4AOTA 1JVPP 3HAMA 4JBPA 5T6KA 2JITA 3WIKA 3PJ3A 5KMIA 3IGGA 4GV1A 3R6XA 2OF4A 3AC5A 5LCJA 4Z9LA 1JSTA 1WZYA 4JIKA 3A62A 4BDKA 3IONA 5M4CA 4BCHA 2X8EA 3AT4A 2YCFA 3ZO2A 2R3QA 2FGIA 4FKPA 2ETMA 3FQSA 4AXFA 4EZ7A 3NNWA 4P2KA 3E8EA 3G9LX 2XIZA 4FT5A 4R3PA 4IX6A 3KB7A 4WA9A 4BI1A 5B0XA 5FTGA 4OAUC 1FQ1B 4XV1A 5DEWA 5D41A 2V62A 2HENA 3LIJA 4WNMA 4AT5A 3PP1A 4K1BA 4IVBA 1ZOHA 4J52A 1H1RA 2Y6OA 5HG9A 4FZAB 3VUTA 1OKWA 1NVRA 2WELA 1MUOA 2C5YA 2G15A 3GC8A 3CD3A 1YHWA 4V01A 4ZOGA 3LLAA 3LMIA 2BZKB 3E3BX 1XHAA 2C5VA 2W9ZB 3C4XA 4ACCA 1GZKA 3I6WA 4FSTA 5DR9A 3TJCA 3F66A 4EC9A 4ZSLA 5HCYA 4OTWA 2BRNA 5CF5A 1O6KA 1YDRE 4B4LA 3CSVA 2R3PA 2BDFA 5IQBA 2EWAA 4BCIA 3QD0A 3R2YA 3U4WA 3BU5A 3R8ZA 3DY7A 3BYMA 3EQRA 2YCQA 1YDTE 4I6HA 4U8ZA 3BPRA 3GC0A 4ENXA 3TUDA 3SOCA 4CMTA 4FEQA 2QKRA 3KXHA 4WG3A 2QU6A 4EOKA 3BLAA 2AYPA 4U80A 4USDA 3AMYA 3IK3A 2J0KA 4XOZA 2BIYA 4AACA 3UPXA 3U6JA 3U8WA 1OPLA 2ZDTA 3RK7A 4X2FA 3EQCA 3QTUA 4O81A 4O27B 1FGKA 3OTVA 3ROCA 1A9UA 4BIEA 4DFNA 4MD9E 2UVZA 1L3RE 5DPVA 4F0GA 3TZMA 5J7HA 2WTIA 1KUTA 4ITIA 5JFVA 3GI3A 4M69A 4YC3A 3Q32A 2HY0A 4CG9A 1NY3A 4GK3A 4HGSA 4E26A 4FI1A 5IQEA 4FL2A 4FTJA 3T9TA 2UVXA 3ZCLA 5ANKA 2X9FA 3BELA 3BHUA 3KA0A 4KRCA 2W17A 3OVVA 2R3FA 4FSRA 5EW3A 4U79A 1UNGA 1VJYA 5HEZA 4R3RA 2PVMA 3F7ZA 3HDNA 2VU3A 5CYIA 1U46A 4CZYB 1Q41A 2WU7A 1EH4A 2ZB0A 2HW7A 3UOLA 4EK6A 2A19B 2C5XA 2ZOQA 3PVGA 3LJ2A 4FL3A 1A48A 4R7HA 3IQ7A 4QYHA 2R3MA 4DN5A 5AUZA 4NU1A 4CCUA 3R8LA 3FLYA 2WXVA 2HAKA 4FV8A 1DI9A 1OIRA 3LQ8A 4UWBA 3P23A 4X6QC 5HE1A 4EOIA 1CMKE 4PPCA 1I09A 2WPAA 2CNUA 4AP7A 2XBJA 3IDCA 3RAKA 4K11A 4FEWA 3OD6X 4O0WA 3IW4A 4E3CA 3SDJA 5JT2A 3MSSA 2J5FA 1CSNA 1W84A 3D15A 2ZM4A 3ODZX 1GJOA 4MWHA 3FEGA 4MNFA 2J9MA 3UNKA 4M3QA 3ZO4A 5K0KA 4AN2A 3A2CA 3RNYA 2V55A 3E87A 3C50A 3SKCA 5D10A 4O4DA 4DCEA 4I4FA 3UZRA 3NNXA 5CI6A 4FEVA 3E7OA 4BC6A 2GTNA 3PVUA 4ASXA 4E4MA 4CV9A 4DEDA 4PNIA 5HGIA 4EYJA 3P5KA 4IM2A 2R3JA 4B8MA 4YTIA 4FTLA 3WE4A 4BCOA 5AV4A 2CKOA 2OJFE 4UN0C 3NEWA 4E6AA 5HOAA 3OEZA 3MVMA 3L8SA 3MIYA 3QTSA 2OXXA 3LFCA 4JDKA 4L52A 5IQAA 1ZARA 5L4QA 2A2AA 2KTYA 4KRDA 2Z7SA 4ACHA 4YPSA 3QTRA 2YDKA 4G9CA 5HE0A 4QTEA 5HNGA 2X0GA 3NCZA 3ZS5A 1ZRZA 3BQRA 1WVWA 4XG2A 4GSBA 2B9IA 3QZIA 5JFXA 4IZAA 2YERA 4BCNA 1OI9A 4XG9A 3R2BA 4IH8A 1LP4A 5CSVA 3U4UA 3DKGA 4ZSGA 5EI2A 1LPUA 4OTIA 4QMQA 2E9NA 2YM6A 3KF7A 3MI9A 5M57A 1ZMUA 3A4OX 3C4WA 3W2QA 3O71A 2XNMA 3L9PA 4LRJA 4DHZA 3NIEA 4S34A 2YLEA 4BKYA 4CGAA 3DQWA 4CT1A 4ZTSA 3GU6A 1ZYSA 3LXKA 5E91A 3PA3A 4R5YA 3OT8A 3Q04A 2C6EA 3G9NA 4Q9SA 4FZ7A 5HVJA 2J5EA 3RPRA 3MS9A 2ACXA 4G3FA 5LJJA 5CAPA 1W2CA 4ZK5A 4NTTA 3COIA 2IW9A 2W5AA 4C58A 4LRMA 4EQUA 4KNBA 2X39A 3R9DA 3LMGA 3JY0A 4P5ZA 2W1EA 1YDSE 5HU9A 2NP8A 3GC9A 3NPCA 2W05A 1W98A 4BWPA 1OBGA 2VRXA 4LMNA 4R5SA 2XNPA 4EI4A 5BUEA 3DNEA 4FIGA 5ETCA 3SC1A 5HX6A 1PMUA 4EH7A 3WIGA 3C5UA 3EQFA 4YZDA 4K0YA 4EHVA 3FUPA 2CHLA 1YWRA 1J91A 3QLFA 4JX7A 2AEGA 4ASZA 2F2CB 5E8ZA 5D1JA 3TT0A 5AP3A 3MY1A 3N9XA 2QU5A 5IQDA 3QD2B 4F0IA 4O0YA 2WO6A 4FKQA 3UDSA 4BZOA 4FZ6A 4FIHA 5EW9A 3UVRA 4L6QA 4C0TA 3MFUA 3VF8A 3NR9A 4N70A 4AGWA 2RF9A 3FLQA 2OXYA 2VO0A 2XK3A 4FT0A 4A9UA 3C5IA 3EFJA 2VWYA 1P5EA 4JL9A 3VS7A 3DB6A 5HIDA 4FK6A 4TYIA 5DT4A 5CSHA 5IH4A 4UB7A 1IAJA 1B6CB 1ZYDA 3EHAA 5D12A 3V5WA 2ZV8A 3R7OA 3TZ7A 4U44A 3UIBA 4GG5A 4W9WA 4P7EA 4ZLOA 3UC3A 4G16A 5HORA 4V05A 4RFZA 3OUKA 4I21A 3R1NA 5LMAA 2ONLC 5EH0A 5M09A 4BDIA 4GU6A 3RZFA 5CQWA 3COHA 4MX9A 3REPA 3KCKA 3H10A 2CN8A 5IUIA 3WI6A 4DFBA 4ERWA 4PDYA 3FZRA 3DDQA 1H28A 2X2MA 3WZDA 3CXWA 2B55A 1Q5KA 3Q4UA 1OL1A 2PVKA 3SXRA 2WQBA 2VTOA 3R0TA 4EHZA 3AC8A 5JMSA 1ZYLA 4L68A 5DLSA 3TM0A 4ANSA 4MNEB 2QOHA 4G3DA 2JKOA 2GQGA 3TV6A 4RWKA 1K3AA 3HV6A 4A7CA 4E20A 3K5VA 3MFRA 2ZM1A 2X2LA 3FQEA 2GNIA 2IVVA 4MNEA 4DEBA 5HU3A 3ZEWA 1M14A 2WQNA 3I7CA 3PXZA 4OW8A 3NIZA 1Q3WA 4PMTA 4YLJA 4C3FA 4LV7A 4E4LA 4B8LA 5EHOA 4D1XA 3O96A 1RJBA 5I0BA 4R7BA 3VONA 3QD3A 3R7UA 2WMWA 5HNIX 3ENHA 3Q53A 4G31A 5C8KA 3FMMA 1UU7A 3KK9A 1O9UA 3P1AA 3E62A 2WMQA 2UZNA 4EORA 4FV4A 3ORXA 4U42A 3AT2A 2V7OA 3OCBA 4GK2A 4KKHA 4YHJA 3FI8A 5HO7A 1K9AA 5JSMA 1ZMVA 3BYVA 5J95A 1ZAOA 3BU6A 3C1XA 4DE4A 2W06A 4O4CA 3WF5A 4YUQA 2XNOA 3QCSA 2XNNA 5DH3A 4EC8A 3R9RA 4D0XA 3NX8A 5F94A 4F63A 3BGZA 4EHGA 4NFNA 4O7RA 4U43A 2C6LA 4KS8A 1ZY4A 3PIZA 2XAOA 1UNHA 2Z02A 5TO8A 1KOBA 4L45A 5FBNC 4AW0A 3A7FA 2J0IA 5HKMA 3QXOA 5JRSA 2IW6A 1SMHA 3ROYA 4W8DA 2I0YA 3DB8A 3NDMA 5BNJA 5CY3A 3UBDA 2BFYA 3CGFA 4LUDA 1DAWA 3EOCA 4QTBA 3BLRA 2ETRA 4TWPA 4EQCA 2VTLA 2R0UA 4FE2A 2ITYA 1QL6A 3EN7A 3B2TA 3V04A 5CVGA 2G1TA 1ZZLA 4BCQA 3M11A 2VTRA 4RA4A 4YLKA 3TKUA 2YISA 3JXWA 5ACBC 5DNRA 3S2PA 2BAJA 3G6HA 3O50A 4UYNA 1YOMA 2XBAA 3OG7A 4A06A 2YIWA 2YM3A 5KO1A 3ORPA 5EQYA 1SVHA 3SOAA 4EQMA 4F6WA 4F70A 3MB7A 5C01A 1YW2A 5DBXA 3ZDIA 3E5AA 3NUPA 4F1MA 3FZSA 1OIQA 3GQLA 4DLIA 3CR0A 2F49A 4BDGA 4O7NA 1M2QA 2R5TA 3KU2A 4NYEA 5C8MA 4F09A 5CAOA 3NW6A 3EYHA 3NWWA 2Y4IC 4FIEA 4GW8A 4JNWA 4BICA 5AEPA 4DEEA 4LDTA 4GRBA 1QMZA 2E2BA 3HVCA 3AGLA 4RGJA 2X6DA 4TXCA 4E5AX 3LCDA 3R30A 1XR1A 3MJ1A 4MAOA 4JDHA 3FSKA 4FX3A 3UGCA 4CVAA 3P78A 5JN2A 4J71A 3OY3A 4N4SA 5HQ0A 3BYUA 3MPMA 2Y7JA 3UNZA 3AMAA 4CXAA 2PUPA 2Y4PA 3QX2A 4LFIA 1XBBA 3VC4A 3D14A 5BUJA 2A0CX 3O2MA 2FYSA 2UZUE 3UIUA 4BI0A 5AAEA 4USEA 3SG8A 3QA8A 4H3PA 3SD0A 3LFBA 5J87A 4QP8A 5KMMA 4O4FA 3VUMA 2G2FA 2ZB1A 3GFWA 1TFFA 4FT9A 3MDYA 3H30A 5ANGA 2BAKA 3KXNA 2CGVA 1VEBA 2ZAZA 2GCDA 4BTKA 3AKLA 3TUBA 3ORIA 1ZLTA 1URCA 2Y8OA 3PLSA 4DFUA 3FI2A 3QRTA 4IX5A 2PE2A 3HRFA 4NTSA 3UOKA 2Z7LA 1YXTA 4GMYA 3W18A 2R64A 2X0PA 5LVMA 3R1QA 5H8EA 4XRLA 2J7TA 3BX5A 3SGCA 2WMSA 3AC2A 2WGJA 3HUCA 3KULA 4WG5A 5AP0A 1YHVA 4XP0A 5DFPA 5HBJA 5M56A 3AKKA 4TY1A 2JIIA 3GFEA 5HG7A 1GZNA 4CKRA 2XUUA 3TXOA 5IA4A 3UC4A 4AUAA 5EDQA 1KV1A 1W83A 2ITZA 3T9IA 2UW8A 4QP2A 3QHWA 3U87A 5HVKA 1R3CA 3NMUF 4H05A 2ITNA 3L8PA 3WE8A 3ZFXA 3S95A 3RWQA 1V0OA 4FTTA 3MYGA 5G6VA 3QUEA 3Q5ZA 2A27A 5AMNA 4HNFA 4O7VA 5CSPA 3UZPA 3LKMA 3VHKA 4CYIA 2FUMA 3DS6A 3HGKA 4WRGA 4YJPA 3ID6C 1TZDA 3OOGA 5IDNA 4FVPA 4I6BA 4LYNA 3VJOA 4BDEA 2OH0E 4NM5A 1JKKA 3E8CA 3PVBA 5HO6A 4CYJA 4M12A 5IPJA 2QOIA 3RKBA 3NAXA 4G6OA 2XALA 1F0QA 2PMNX 4XS2A 2YM8A 5FTOA 3R02A 2W7XA 5BX0A 3DFCB 1OGUA 4G34A 3DV3A 3KVWA 5KE0A 2VTMA 4NKAA 2W1ZA 3QCXA 2YFXA 3HL7A 4UMRA 2P0CA 4BJJA 2VNYA 2QO9A 4YJQA 5M44A 2CMWA 3R9HA 3DBQA 1BX6A 1J3HA 3BZ3A 3D7TB 4OT6A 2VTNA 2O0UA 2XM8A 3P0MA 3KXGA 1OKZA 3AC4A 1UV5A 4AT3A 4G3CA 5LWNA 3NZ0A 4QQJA 5I5ZA 3VUGA 1YXSA 3VW6A 2YM7A 3D7TA 3UPZA 2XEYA 4ZTQA 3FMKA 4RWLA 4ZJIA 2IPXA 2ONLA 2JGZA 5IU2A 3DOGA 2QOOA 5BVKA 3UG2A 1R0PA 5J9YA 1UWJA 3V51A 3ZU7A 4FYNA 4K6ZA 4TYHB 1STCE 1Q8WA 4YNOA 5ETFA 5K9IA 2V7AA 2XM9A 4K9YA 4L67A 3FXXA 4RZWA 4QP9A 2R3KA 4XCUA 5K0XA 5L8LA 3PRIA 4ANBA 2JKMA 3T3VA 3UOJA 4UY9A 1OM1A 4FICA 5IA5A 3BWFA 3MWUA 1JSUA 4IJPA 4BTMA 2FSLX 4FTCA 5BVFA 1XQZA 2I1MA 3V5QA 3NUYA 4D9UA 3R9NA 4AA4A 3LFAA 5L2IA 3U6IA 1QPJA 3QRJA 3FBVA 3TL8A 5M51A 4YJNA 3NUNA 3VS0A 1GOLA 4RIXB 1Y91A 4PNKA 4QNAA 2OKRA 4OTHA 3ZSIA 5JZNA 4EOJA 4S31A 4K77A 2E9UA 3EQHA 5GINE 3W0RA 2F7XE 1M7NA 3C0GA 4WD5A 1NA7A 3CQUA 4LOOA 3CJGA 4RIXA 3UVQA 4I20A 4AA5A 2W1GA 5A46A 5LXMA 3DZOA 5CENA 4ERKA 2RG6A 4AXCA 3ZRKA 1P14A 4MUQA 3TACA 2PUIA 2PZIA 2GS7A 2JIUA 2XNGA 3FZ1A 3KRJA 4YZNA 3V6RA 4X2NA 1PF8A 5K3YA 4OBQA 4YJOA 5FP5A 4G3EA 2HXQA 4WG4A 4EOPA 1PKDA 4LQMA 4CQEA 3MY0A 3BQCA 3WILA 2X7OA 3C0IA 3GQIA 4FKLA 5F4NA 3QCQA 3HDMA 3FLNC 4F99A 1WBNA 5HLPA 3F5XA 3FXZA 3DFAA 4X7QA 1Y8GA 4FV1A 4DA5A 3QTXA 4G6LA 5AUUA 2VGOA 4DHIB 3FPMA 5AV1A 3G90X 4LG4A 4XV9A 5DT0A 2PE1A 5DEYA 2CKPA 1XJDA 2EB2A 4F65A 3QD4A 4QP1A 1Q8UA 2EU9A 4YP8A 2GQSA 4KABA 4U7ZA 3QHRA 4BFMA 3Q96A 2Y9QA 3TEIA 5A4CA 3Q2MA 2IJMA 2VTTA 2GNJA 3KN5A 3TV4A 2XANA 5EFQA 3OWPA 3PDTA 3FV8A 4AG8A 4PF4A 4AZWA 3QYWA 1JBPE 4I0SA 3D0EA 3C0HA 2RIOA 5CI7A 5M53A 4TT7A 2X4FA 2BHHA 2PZRA 2OIBA 2O65A 5HTIA 4QRCA 3VBTA 3UNJA 5E8SA 4PPAA 4CMUA 5BV3A 2Y4IB 5HO8A 3NYXA 4MK0A 4C38A 3LJ0A 5AP2A 3SQQA 2Z8CA 2PVFA 4FNWA 4UXQA 4DT8A 4EOMA 3ZLSA 2HY81 3T8OA 5A4EA 3GOKA 4DEIA 3I5NA 3IECA 4OTQA 4C4JA 1WCCA 4APPA 2RG5A 3UQFA 2XNBA 2XIXA 3ANRA 2JFLA 3CKWA 5BYLA 4MTAA 4W4VA 3QAME 4GH2A 1JKTA 3FJQE 1KWPA 1Y8YA 2ZYBA 4FUXA 4DBXA 1FMOE 4NIFB 4OGRA 4XOYA 3PZHA 2IVUA 2IZTA 3I81A 4I22A 4L43A 4YC6A 4QMXA 3R8PA 2OU7A 1TQMA 1SVEA 2ITOA 2JBOA 4XX9A 5F95A 3BL7A 2GHLA 5HE3A 5CU0A 4J53A 2O63A 2C6IA 2VTSA 4FIFA 4G17A 4M67A 4A4OA 3F88A 2UW6A 4YMJA 5CEQA 3K54A 2CCIA 1BI7A 4CFMA 3TKHA 4CRLA 5IA2A 4RBLA 5BVEA 3QQUA 4XG8A 4PMMA 3GC7A 3CBLA 4FMQA 2UW7A 4JRVA 3WZEA 4C7TA 3ULZA 3CPCA 4GYIA 4OR5A 1ZMWA 1BLXA 2BHEA 3KCFA 4X21A 3ZUUA 1BL6A 2QG5A 3EMGA 3GEQA 4JAJA 4ZY6A 5BVOA 3KVXA 2OK1A 2YM4A 3ZBXA 3FL4A 4R77A 3ZDUA 3O0GA 5E8WA 3KXMA 4ZMEA 2VTPA 3W2PA 1YXUA 2NO3A 4EOOA 5CXZA 4DGMA 4YLLA 4GUBA 4PY1A 1BUHA 4BIDA 4BDAA 3RBWA 4JBOA 1Q97A 2RGPA 3A99A 4BKJA 4C4FA 4HW7A 3UQGA 1YXVA 3OXIA 4KUJA 2CKQA 3MGYA 3PXQA 3ULIA 3CKXA 3W8QA 3SXSA 5E9EA 5IA0A 4UEUA 5LMKA 1G8AA 1KE5A 4BHNA 3ERKA 5C1QB 2UZEA 3GU7A 4K18A 2QLQA 3ZUVA 4B6LA 2E9PA 4FTNA 1VR2A 1Y6AA 2UZLA 2C3LA 3PUPA 3UDTA 3V6SA 3ORZA 2XRUA 3DT1A 2YEXA 3EIDA 3HA6A 4X3JA 4E7WA 5LWMA 1H01A 4G1WA 5M55A 2QKWB 5CAUA 2OI4X 2UUEA 1WVYA 4KB8A 5KUPA 4LL5A 5FG8A 3E64A 4BDHA 3PTGA 2C3IB 1OL5A 4ZSEA 2WTVA 5HCZA 3VO3A 5TE0A 1H0WA 2OH4A 3ELJA 5EM7A 4EH4A 4QYEA 5CEIA 4D1SA 4RWJA 1ND4A 3RPOA 3UTOA 3W2OA 3P9JA 1JKSA 4UZDA 4C2WA 5E1SA 4CKIA 1W0XC 4ORKA 4UX9A 4PX6A 4KS7A 3ZEPA 4RA5A 1RW8A 4FKRA 4GK4A 2ZFYA 4F9YA 4NWMA 2B54A 4ZTHA 2X7GA 2GNLA 5E8UA 5HTCA 2G2IA 5EOBA 4NL0A 2YA9A 4G5JA 5A4QA 2WQEA 1U4DA 4JAIA 3KC3A 1HCKA 2WKMA 4FKJA 1J7LA 4GU9A 5JKGA 3DAKA 2W0JA 5CANA 5C9CA 5D9HA 1WBTA 5IA1A 4M69B 4NJDA 4DITA 1PXOA 2EVAA 3F9NA 3BE9A 3R7VA 2CLXA 2WMRA 3L1SA 4BL1A 1RDQE 4QMWA 3RK9A 4H1JA 5IZFA 2RKUA 4I5HA 5HBEA 4HGTA 2QLUA 2OXDA 2UW5A 4HZRA 4IFGA 1YVJA 3EFWA 3KMWA 4O0TA 4WNOA 2RFSA 4X0MA 4A4LA 4WKQA 3L9MA 2E9OA 1CKIA 3IDPA 3SAYA 2OICA 4C2VA 3FDNA 3NUXA 3OZ6A 3E93A 2QQ7A 5JZJA 4I24A 4NJ3A 4HVDA 1PMEA 4C8BA 4IHPA 5TT7A 2R3GA 4A07A 4D2SA 4YZBA 4MKCA 1JPAA 4FODA 4F1OA 3R21A 2UZDA 3BYOA 1W2DA 1XH5A 2FB8A 1GZ8A 2W1CA 2REIA 3GXLA