2IN6A

Wee1 kinase complex with inhibitor pd311839
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
279
structure length
256
Chain Sequence
b'MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wee1-like protein kinase
publication title Synthesis and structure-activity relationships of N-6 substituted analogues of 9-hydroxy-4-phenylpyrrolo[3,4-c]carbazole-1,3(2H,6H)-diones as inhibitors of Wee1 and Chk1 checkpoint kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 256
sequence length 279
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2in6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2in6A01
2PZIA 4Z9LA 3FMDA 4R77A 4M13A 5DOSA 3BQRA 1GIJA 1KV2A 3I7BA 3PJ1A 2OFUA 3U4UA 4GK2A 2VWXA 3MIYA 1H24A 4E4XA 4AW5A 5IH6A 1UU9A 4DT8A 5ANOA 3NW5A 4A9UA 3D2KA 2CLQA 2XS0A 4IAYA 4WG5A 4BZDA 4CFMA 1V0BA 4J1RA 2AC3A 4ZY4A 2UW7A 5E8YA 3L8PA 1M7NA 4G1WA 3QXPA 2WOUA 3WZEA 2QVSE 3ZLWA 4AOJA 3WZJA 2PTKA 2XNGA 4BWXA 3HVCA 4DC2A 3IPHA 4MWHA 4CG8A 5AR4A 4PV0A 2BKZA 1ZZ2A 3HECA 3MYGA 3WZDA 4E6CA 4QMNA 5CZHA 5LJJA 2UZTA 1XQZA 4RQVA 4RX9A 1PXNA 3I7CA 4GS6A 3N4TA 2HCKA 2H96A 4I6QA 4DEBA 1NT2A 2VNYA 4LGHA 3AMYA 1YDTE 3WARA 4C8BA 4FA2A 5HNBA 5M08A 2ITUA 2GQRA 4FT7A 3MVLA 4J97A 3VF8A 5FXRA 1JKKA 4CXAA 4D55A 4ALVA 2OH4A 4DTBA 4JG8A 2ITOA 3ZZWA 3PXKA 4EZ3A 1W8CA 1Q41A 2WD1A 1OL6A 3EYGA 4IE9A 4C59A 4GH2A 4X6RA 4W4WA 4II5A 4WD5A 2BZKB 2I6LA 4FKQA 2YIYA 4YUQA 2BIKB 3G0EA 4FKOA 3TKIA 3LVPA 1F3MC 4RQKA 1Y57A 3PJCA 2NRUA 2IVUA 2VD5A 2IW6A 4KABA 4KIQA 3EQDA 2HAKA 2PVNA 3GCUA 4OAVB 4D4VA 5AUUA 2FSMX 3OXTA 3PP0A 4P2KA 1WBOA 3MY0A 5BQ0A 4CVAA 5J7HA 3DQXA 5H9BA 4QMMA 5IUIA 4MNFA 2EXMA 3FE3A 3IONA 5E92A 3GFEA 4G3DA 3FI4A 3KULB 5AP5A 2C4GA 2IO6A 2ITYA 4MXZA 3PYYA 2IG7A 2ZM3A 3ORPA 2OF2A 3F7WA 1HOWA 3QTIA 2OJJA 5CSXA 5I5ZA 1T46A 2QOQA 4YLKA 5A6OA 1A06A 4LL5A 5JKGA 3COIA 1JKTA 2C3LA 4HYSA 3F5UA 3PFQA 4I41A 3ZLYA 4XV2A 2J7TA 1M2RA 4HGTA 4HPUE 1YI3A 3ETAA 4CYJA 5JGDA 5E1SA 2ZOQA 3KRWA 1GY3A 2HY81 1Q8YA 3KRRA 3KA0A 3OWLA 5CU2A 3AXWA 3EL7A 5A3XA 1YI6A 3DAJA 4Q9ZA 3R9NA 2BIYA 4W4VA 1VZOA 2QG5A 4JG7A 4Q5HA 4APCA 4BICA 2CKOA 3LHJA 4DBXA 3TWJA 5HG5A 4IB0A 4DGLC 3PPKA 1BMKA 2Z7RA 5AUVA 4LI5A 5DE2A 2C5OA 3VS5A 3UIXA 5J87A 3MVHA 3MH3A 2V62A 2B9JA 4K0YA 1S9JA 2VTMA 1W84A 4LMNA 4M69A 5DEWA 4E5BA 5AUTA 3QX2A 4RSSA 1XKKA 1O6YA 3R71A 5EDQA 4YURA 5AV1A 1SVGA 2QO2A 2CJMA 2XNEA 2QLUA 2WTCA 3T3VA 4V01A 4FIHA 2J50A 4J71A 4Y83A 3UOLA 2QU5A 3HMIA 3G9LX 3QLGA 4B6LA 2VTOA 3GCVA 4WRSA 4DTKA 3P7BA 5FTGA 2YWPA 4YJPA 5ETIA 1Y6AA 3FXWA 5TR6A 4E4LA 2XRWA 5AMNA 1KE5A 1SVHA 2YDKA 3DB8A 2Z7SA 4JIAA 4PL3A 4RJ6A 4RPVA 3KB7A 4D5KA 2B9IA 4IWQA 4BN1A 3D7ZA 1VYZA 3AD4A 3PP1A 4I20A 4QTCA 3G6HA 2XB7A 3FQEA 3Q9WA 4DCEA 3P7AA 3UC3A 2VWBA 3NDMA 3DBQA 2BAKA 1UU7A 4ZTHA 3TN8A 3ZS5A 1GOLA 3BE2A 3OTVA 4XV9A 2XKFA 4FV7A 4HJOA 4CFVA 4NJ3A 3LCTA 1W98A 4X3JA 3T9IA 3FZTA 3K5VA 4UXQA 4WRGA 2YLEA 3RPRA 4BRXA 4BCKA 3P08A 2PE2A 3REPA 5KMJA 5GIPE 5ANDA 2HENA 3HV5A 4FKWA 4UWYA 1NA7A 3NR9A 4C4FA 4DN5A 3FL4A 2BDJA 4IVCA 2XNNA 4O2ZA 3FQSA 2RFNA 3HDNA 4DINA 2O64A 3CIKA 4I0SA 3OUNB 4FZ7A 3RK9A 3UPZA 5FP6A 3BEAA 4I6HA 3JXWA 3PPJA 4G3FA 3TZ8A 1OPKA 2YAAA 2CSNA 4BGHA 5EQEA 2BZJA 4ZSJA 4BHZA 4ZTNA 4R78A 4GG5A 2JDOA 4JDJA 4QTBA 4EWQA 4AT5A 2R3KA 1WVYA 3D14A 4XS2A 2W96B 5AM7A 3NUXA 4D2PA 3FZRA 3WI6A 3FUPA 4RIYB 2CLXA 3E63A 4XG7A 4L01A 5AR2A 3DXNA 5BVDA 2W4KA 4OTDA 2EVAA 2RKUA 3RCJA 4BCMA 3CP9A 1Q8UA 3QC4A 2BZHB 3SW7A 1H1QA 1PXKA 4ZZNA 2PVKA 3ZBFA 5CQWA 3FWQA 2OH0E 3UYTA 5F95A 1T45A 4BC6A 4OTWA 3NUNA 3IS5A 1UU8A 3OY3A 2W1IA 2Y4IB 4BBFA 2YM7A 3SKCA 1OECA 3EFJA 4NFMA 3VRZA 4UXLA 4EJNA 2VWYA 3R7EA 4B99A 4BDCA 1L3RE 4GJ3A 3QL8A 3OBGA 3Q5IA 1Z9XA 4HGSA 5BUEA 2VO6A 2OKRA 1XH7A 2GMXA 1S9IA 4MNEA 4QQCA 3SXRA 4UN0C 2GTMA 5CF5A 1JBPE 3KXGA 2X8DA 3UMWA 4EL9A 4F09A 4DFNA 4L53A 3QRIA 4UMQA 2IW9A 4DHFA 5CI7A 3KMUA 4XV1A 4GU9A 3MGYA 4ZP5A 2HELA 5FM2A 3CTHA 4ZXTA 4D2TA 4D4RA 3AQVA 5LVNA 5ANKA 2PVJA 4FNXA 4GL9A 1JLUE 4FK6A 4DITA 2C5NA 3Q4CA 4YLJA 5CALA 4JXFA 1RDQE 2PVRA 4FSNA 1M14A 1TQIA 3RP9A 2X9EA 2OF4A 5DLSA 4GCJA 5DHJA 2J0LA 4GG7A 5LXMA 1OB3A 3KRXA 3H4JA 2UZBA 4KSQA 4M14A 4FV2A 4AZWA 5IG1A 4AE6A 4ZTSA 1WVXA 3EQGA 3SQQA 4R3CA 3RVGA 4F7JA 4QPAA 4FV5A 3MVJA 4IB3A 3BHHA 1ZY5A 4GIHA 1HCKA 3AT3A 4W8EA 4HPTE 5DEYA 5K5XA 3P5KA 4U45A 5KMIA 1H07A 4ZMFA 2GNIA 1M17A 3RCDA 3NNVA 4YTHA 3AT2A 3GC0A 4G9CA 4NKAA 3F3VA 1XH9A 4PQNA 1DAWA 4EOKA 5HLNA 3S2PA 4OR5A 4CZYB 1J1BA 5H2UA 1UKIA 3IO7A 3PZHA 2VTPA 3IW8A 3K3JA 3WF5A 4BGQA 3OF0A 3R1NA 4CV8A 1SMHA 3H9RA 3LLTA 4O84A 3SAYA 3QZGA 4ZY6A 3MTLA 4LRKA 4MK0A 1JOWB 3FZOA 3CY3A 3HP2A 1REKA 3CD8A 3H10A 4NH1A 4RIWA 4RX7A 3ANRA 3BWFA 3AT4A 4IB1A 4FSQA 4U80A 2ETKA 2YN8A 4GYIA 2FO0A 1YHWA 4FZFB 1APME 3D7TB 5CI6A 3PXRA 5IMXA 2UW8A 2CKEA 1OKWA 3HX4A 3VW8A 3V5PA 2XP2A 5F9EA 3TDWA 5HD4A 4OTGA 4N6YA 3I4BA 3R8VA 2BILB 2YCQA 3ATSA 1HCLA 3VRYA 4E6AA 3W32A 3HA6A 4ITJA 4YPDA 3ZHPC 4E73A 3Q2MA 3FXXA 5GIOE 3DK3A 4OLIA 3FBVA 4J7BA 2J0MB 2BVAA 2WQOA 4MXXA 1QPJA 3ET7A 4P7EA 4U8ZA 3VQUA 4IW0A 3R8PA 4N70A 5D12A 5CF6A 3G15A 2JAMA 3UQGA 1LEZA 2VTQA 4AGDA 3LCSA 4X0MA 5AAEA 3O17A 2UUEA 1QPCA 1PKGA 3KMMA 1IAJA 3RI1A 2WELA 3NYXA 4B9DA 3C4XA 3DKGA 5I9WA 4F1TA 5IUGA 2CNQA 3TNWA 5CT7A 4GT3A 5A4QA 1P14A 1ZZLA 4BCGA 5IQBA 3ZO2A 4FZDB 2G9XA 2W5BA 3O23A 3C0GA 4LQMA 3PLAE 2UW0A 5I0BA 2GS2A 3SHEA 3C7QA 1URCA 3TZ9A 4CGAA 1VJYA 4J53A 4M15A 3R9HA 2GDOA 2ZV2A 2YJSA 3WIKA 4DA5A 3U6JA 3U4WA 3TUBA 2GQSA 4FG7A 2PZPA 3HLLA 4PUZA 4ACMA 5KMMA 1ZOGA 4F1OA 1LPUA 3NUUA 3UTOA 3VC4A 1YOJA 4QT1A 4JL9A 5EKOA 3AC3A 1ZAOA 2WXVA 5HG9A 3VBWA 4M8TA 4DG3E 2J6MA 3LFEA 5JMSA 4U81A 4DGGA 4R5SA 3C4WA 3OROA 3W8LA 3PVGA 2CHLA 4B7TA 2ITNA 3QTRA 3BEGA 2A0CX 3UZTA 3VUMA 5A6NA 2DQ7X 3FMLA 2OJ9A 2YFXA 3MA3A 2KULA 3VAPA 3GQLA 5AA8A 3W2RA 1WAKA 2F9GA 4BCFA 2XM8A 3KKVA 2UVYA 5LVMA 1XH8A 4O0YA 3GC9A 4A07A 5AV2A 3MFUA 4RIXA 5CLPA 3KGAA 5AWMA 4BZNA 1PXMA 3SGCA 4CFNA 4BBMA 1M52A 5HE1A 4BCHA 3HAVA 5J79A 4MD7E 4FF8A 3DK7A 5JZNA 4O7YA 5EOBA 4IDTA 5IQEA 5KUPA 3TIZA 3U9CA 1Y6BA 3ELJA 3L8SA 4RT7A 2Q0BA 5AR8A 4C4IA 4KINA 4I1ZA 2ZB1A 1JWHA 3CTQA 4M3QA 3O7LD 4IEBA 4MF0A 1NVRA 3FLYA 2A1AB 3Q5ZA 4IAIA 5HQ0A 4Y5HA 2JKOA 5CXZA 1Q3WA 5GNKA 3QLFA 2WO6A 3MV5A 4KD1A 5FM3A 4AP7A 4IAAA 4IX3A 3PA4A 3LJ2A 4EHVA 3AOXA 1DM2A 4UZHA 3R02A 2VTRA 3E7OA 3FL5A 5GZ8A 5HO7A 3RK5A 4H05A 4LMUA 4R5YA 3DV3A 3EQFA 5AP2A 1FMKA 5KZIA 3V5LA 2YIWA 5IA4A 5IEYA 4L9IA 4L52A 3V51A 2CCIA 3Q4ZA 5EI2A 4QMOA 3NAYA 3N9XA 2XH5A 4FL3A 4L8MA 5CENA 5CEKA 5EHYA 2GNLA 3D0EA 1OIYA 1JNKA 3PIYA 4FMQA 4OW8A 3W55A 3TI1A 4AGWA 3DOGA 4GVJA 4DH7A 1R39A 3V6SA 5E91A 3CCNA 3SRVA 4CRSA 4E3CA 1KE9A 3F3TA 3IKAA 2EXCX 5J5SA 3FZPA 2Y9QA 3OXZA 5JEBA 4FTMA 4F70A 3G5DA 5HG8A 3KK9A 5DRBA 3MPMA 5LWNA 3R9OA 3D4QA 4KBKA 2E9PA 3MVMA 1PMNA 2QR7A 1Q8TA 4ASDA 4N0SA 1UVRA 3E87A 4KIOA 4NIFA 3FPMA 3FEGA 4MKCA 4IZAA 2X6DA 3S3IA 4XRJA 3PJ3A 5IQFA 3MS9A 3FPQA 2EB3A 2WU6A 1JVPP 3AG9A 3BLQA 4UMTA 4ZOGA 5HLPA 2P4IA 3RZFA 5KMLA 2ZYBA 4IACA 3U6HA 3F5XA 3R1SA 4F6SA 4AN2A 3HRCA 3LMGA 2ZV9A 4AGUA 3EHAA 3NX8A 2Y4IC 2GNHA 4TYHA 4DYMA 3D15A 2QOHA 2JKMA 2VTAA 2OJFE 4J52A 4ERWA 5K9IA 4K18A 2B7AA 1O6LA 4G6LA 4WHZA 4W9WA 1H1RA 3QRJA 3TTJA 3V6RA 3EL8A 3LLAA 2HIWA 3O2MA 4FSWA 4GRBA 4RVMA 3BHUA 3FDNA 4GU6A 3ORZA 4BVUA 3ENMA 3DLZA 3VS7A 3QBNA 4O7NA 1R0PA 2ZJWA 3UGCA 4USFA 1FVTA 4EOMA 4EUUA 4X3FB 5KMKA 4LRJA 1OKYA 4TNBA 3LFFA 3QYZA 4M68A 3VUTA 5HTCA 1QMZA 5HG7A 2JDVA 2FSTX 3ORIA 2X81A 5JQ5A 4O96A 2IWIA 1YWNA 3VBTA 4E5WA 4NL0A 4CFUA 5F4NA 5T3QA 1TVOA 1XH4A 2H6DA 3HMOA 4IWDA 3NIEA 5AM6A 5J95A 4C3PA 3BU6A 5DI1A 1YHSA 3KN6A 4AF3A 2XIRA 3BYVA 3RM7A 2ITQA 2PE1A 5CTPA 4C33A 3ATTA 3K2LA 4KA3A 3PVUA 3QHWA 3NNUA 5HX6A 2PVFA 5HLWA 3KQ7A 4GKHA 2JITA 1I09A 3VJNA 3KXNA 1YQJA 4RFYA 3W2CA 1ZYJA 4DGOA 4QQJA 3QQKA 4TKSA 2IJMA 2VWWA 4MXCA 4D2RA 2J4ZA 2Q0NA 3C4CA 4JJRA 2CKPA 3NYNA 3ZZEA 3HV3A 5EYDA 1WBVA 1ZY4A 4KBAA 3QUEA 4TNDA 5M4CA 1O9UA 4QMVA 2NP8A 1IG1A 4QP2A 4OAUC 3CSVA 4EHZA 1PRYA 4HOKA 3OCTA 4EHGA 2XIXA 1KE7A 1PJKA 4FKLA 4MYGA 1B38A 4RLLA 5FBOA 3ZSGA 5D7VA 1YXXA 4BGGA 4NEUA 4MNEB 3NCGA 2WKMA 3I60A 4HCUA 3QU0A 4QNYA 4DFYA 2IZRA 1IA8A 3BX5A 3D5XA 4YC6A 4YHJA 4L44A 4FKGA 1Y91A 2ERKA 4EK6A 3PXZA 5IQAA 2P3GX 5C8MA 3DBDA 3I5ZA 1BYGA 1UV5A 3MJ2A 2Z8CA 2C3IB 4QYFA 4S2ZA 1X8BA 3TV4A 4BR3A 3HRFA 4FK3A 4IZ7A 3DT1A 3V04A 2CNUA 3PG3A 4O0VA 2H9VA 2WMQA 5BVWA 1JSVA 1JSUA 5C4KA 3KRJA 3VO3A 3FMJA 3KF4A 2A4LA 4PMSA 5DPVA 2OLCA 4FEUA 2YISA 3MIAA 5I3OA 3PXFA 4FKUA 4YJQA 4TYEA 2XNPA 4AA0A 3LCDA 3DKCA 3P4KA 5JFSA 4H36A 3QTSA 2J2IB 3FLNC 3VULA 4G9RA 1ZLTA 2B1PA 4NK9A 3RPVA 4Y85A 3R8MA 4DF3A 4BKZA 5KNJA 4PMMA 4C4GA 3HV6A 4CYIA 1H1SA 4R1VA 3KN5A 4W4YA 1GZOA 5IF1A 4ZSLA 4EOLA 1CKJA 4QTEA 3RAIA 4TTHB 4AU8A 3QQLA 3QD4A 2C30A 4UMPA 4MVFA 2QOKA 3CQUA 3KF7A 3OZ6A 4GV1A 3LFDA 4KKHA 5IA3A 3QGWA 3E88A 4PP7A 4EYMA 5IEXA 2SRCA 3OVVA 2ITTA 3NIZA 4RIWB 4MAOA 4ZSGA 4ASEA 3GU6A 5AP0A 1XO2B 5AJQA 5GINE 3A60A 2CNVA 3R01A 1MRUA 3ZTXA 3UO6A 3D5VA 3VHKA 4A4OA 3FMMA 3K3IA 4WA9A 5HU3A 4YSJA 2ONLA 5IQDA 2JC6A 4I5PA 4FTJA 3KU2A 4OTHA 4GT4A 4YC3A 2F7EE 3WF7A 4ZZOA 1WBNA 2JD5A 4ZJIA 1OL1A 3QTQA 4DLJA 2QR8A 3MFSA 4APPA 5FG8A 2I0YA 2HW7A 3PXQA 4R6VA 4FTIA 2PUUA 2R3RA 4ANMA 3QWJA 2ZV7A 3WE8A 4JOAA 4FEVA 3R73A 4YJUA 3HAMA 2WTVA 1J1CA 2QD9A 4YBKA 2WMUA 4D2VA 4E5AX 5HKMA 2QOOA 5CEOA 1ZXEA 2XCKA 4X2GA 2WQEA 3WYYA 2OSCA 3DKFA 4KAOA 5CSWA 1Q99A 3S95A 4CQEA 4JT3A 3EQHA 1OVEA 3POZA 2Y6MA 2YCRA 4M97A 4BYJA 2GPHA 5M56A 3UVRA 4KIPA 4BI1A 1KV1A 5FUTA 4YZMA 3SOAA 3ORNA 1K9AA 3MY5A 4EH7A 2RFSA 4DH5A 3FMHA 3U8WA 3PJ8A 4YP8A 2UVXA 2QC6A 4TWPA 2OZAA 3BBWA 4MXYA 3DAEA 1LP4A 4Z16A 2GU8A 1WBPA 3CPBA 4HVDA 2XK3A 2PY3A 2QCSA 4YJRA 1MP8A 2WTKB 4M0YA 2UW6A 5ANIA 2PUPA 2PMOX 3NMUF 3BQCA 3RM6A 4WSQA 3NLBA 4U44A 3FC1X 3KVXA 4ZZMA 4FTOA 3B8RA 4FUYA 2JLDA 3TIYA 2PVMA 3ZC5A 4F9CA 2OZOA 3CR0A 4UALA 2PL0A 4NYEA 1UWJA 1BLXA 3QF9A 4FV9A 3Q4UA 5JRQA 4QYGA 3CY2A 3FHIA 3BLHA 3QZFA 4LG4A 3PVBA 3R7OA 3BHTA 4O1PA 4F7SA 3PDTA 4FNYA 1XBBA 3PSBA 4EI4A 3COKA 3TDVA 1OITA 3QHRA 4NWMA 5BX0A 3PWDA 3TV6A 3BHYA 4EOOA 4KSPA 3F66A 3N51A 5AV3A 4EQUA 5K3YA 3BPRA 3OEZA 1M2PA 4Q2AA 3UZPA 1PYXA 3HV4A 2CGVA 4I6FA 3FKOA 3GCQA 3ORXA 2VTJA 3R9RA 2Z02A 5DMZA 2JIVA 4XG8A 2QNJA 4XLVA 2IW8A 1VEBA 5F94A 3BV2A 4YMJA 2O65A 2QOLA 2R0UA 4YJOA 3DA6A 3B2TA 4H39A 4ZMEA 4FL1A 3PE2A 4YTFA 2QKWB 4RIXB 3ZFXA 3EQIA 3I0OA 4XBUA 4JI9A 5HD7A 2R3NA 2XIZA 3ODZX 5AX3A 5HE3A 3KVWA 4I93A 5IKWA 4ENYA 2VWIA 4FTLA 4QMUA 4HYUA 2OXYA 5ACKA 2J0KA 4QMLA 1OKZA 5LQFA 1IAHA 3HKOA 3WZUA 4C58A 5CZIA 2C6MA 1W0XC 3QAME 1Z5MA 5DT4A 5GZ9A 4C57A 4JDIA 2VTIA 3PSDA 3EQCA 3HEGA 4ZEGA 5DVRA 5L6PA 5K5NA 4FTRA 4PMTA 3LW0A 5EM7A 4R7BA 5CAQA 4GKIA 3R9DA 3FZ1A 3VQHA 1BKXA 4TYGA 4ANQA 4ARKA 1OGUA 2GSFA 3HL7A 4HNIA 3OC1A 4NM0A 5C01A 3FXZA 3P9JA 4IFCA 4M12A 5M57A 4I3ZA 1DAYA 2XYNA 1OBGA 4LUDA 4JBVA 2BZIB 3H30A 2UV2A 2PULA 4FEXA 3QZIA 3U6IA 2HZ4A 2Z7QA 2R64A 4FKSA 4G3EA 4BDJA 4X3FC 2EWAA 3MPTA 4KNBA 5EDRA 3R28A 3GU7A 5AUXA 3EH9A 4BTMA 5BNJA 3JVSA 5C9CA 3GQIA 4O21A 2J0IA 4YJSA 3VF9A 2PVHA 4UMRA 2UW9A 5K4IA 3SRVB 3UOHA 5JFWA 3A7JA 4FIFA 3FHRA 4V0GA 1QCFA 2HXLA 2WFYA 2Z2WA 4IANA 4IADA 5C8KA 3QTWA 4QO9A 4FL2A 4XG2A 4IBMA 5D1JA 2QG7A 3W2QA 4O22A 3OWPA 3EN7A 4GVAA 2YEXA 3LCOA 3ZRLA 5GZAA 2YWVA 4OT6A 4ANNA 4PDSA 2J9MA 4NIFB 2WMRA 4GJ2A 3ZU7A 5JFVA 2QOFA 4ITIA 1KE6A 3ALNA 4J95A 1KOBA 1M2QA 4EOPA 4QQTA 1PF8A 4ZLYA 5BVFA 4BCIA 3EYHA 1UKHA 4FG8A 1CTPE 1YVJA 5J5TA 1Q97A 3F61A 3AC1A 3QKLA 4BY9E 3Q6UA 1H27A 3MN3A 3U55A 3BBTB 3CQWA 4WO5A 3NYVA 1J7IA 3JVRA 2OI4X 4K2RA 3W10A 4EWHA 5IQIA 4D58A 5BUIA 3A7GA 5A9UA 5KX8A 4O81A 1ZYDA 4FC0A 2YLFA 1XBCA 3WF6A 3UO4A 4TPTA 3V5JA 2GHGA 2XM9A 3P79A 3LIJA 5CNNA 5EHLA 3THBA 3VUGA 4X2JA 5HE0A 4D0XA 3HMPA 2YAKA 4MF1A 5F1ZA 5KZ0A 1DI8A 4WNMA 4G6OA 5L8LA 1U4DA 4O38A 3SVVA 4NM5A 4F7LA 3ZC6A 4NM3A 2GS7A 2HXQA 3BGPA 3LFQA 3RK7A 3BYUA 5BVKA 4AGCA 4F6UA 5JGBA 5DT3A 2WOTA 1RJBA 3FAAA 3H9OA 1JKLA 3KXHA 3G0FA 5E8VA 3ZUTA 4HVHA 4BIDA 2ZMCA 3PE1A 5HORA 3G9NA 5HTIA 5ANJA 4FSRA 1V0OA 3OT8A 2BDWA 1A48A 2GHMA 3EZVA 2PZ5A 3ID6C 3E93A 4UMUA 4L6QA 3DJ5A 4C37A 4AXAA 1CMKE 2XYUA 4L46A 3TNQB 3RAKA 2YA9A 4YBJA 3V5WA 4BHNA 3GU5A 1IR3A 2W1GA 5IZFA 1GIHA 1FOTA 2OIQA 1B39A 3TUCA 4QP9A 4U42A 3PSCA 5AR3A 5CQUA 5FLFA 2XCHA 4B8MA 1CSNA 4LRMA 4ACHA 3OP5A 1Q3DA 2XK9A 4OTRA 2O0UA 2WEVA 4U0IA 5EYMA 4DEGA 5KHWA 1H0VA 3OCBA 1BX6A 4XCUA 3RGFA 2CDZA 1JQHA 3QC9A 3QRKA 4D2SA 5IH5A 2QONA 4KIKB 2JDTA 3FI8A 2G1TA 4MD9E 3W2PA 4I0TA 5BVOA 5JRSA 2OO8X 4AFJA 2B53A 2P33A 4HNFA 3UQCA 3POOA 3R63A 5HO6A 4HVIA 2WMAA 5L6WL 2BMCA 5HCXA 1FGIA 3CGFA 1W83A 5FEDA 2EU9A 3FLWA 1PMUA 5I9XA 4FNZA 2RFEA 3BYMA 3TKHA 4CMTA 4EH3A 5L2SA 4CNHA 3MFRA 4UY9A 3V3VA 1U54A 3UODA 4WG3A 3R1QA 1STCE 5CAVA 2BRNA 3Q9YA 4QQ5A 4ZTRA 3DY7A 3IQ7A 3OBJA 4O0TA 4WNOA 3PRIA 3D94A 3QQJA 5DRDA 1ZOHA 2JIUA 2X2LA 2WU7A 4XEYA 5AADA 2GNFA 3VS6A 5J9YA 3R04A 4CFFA 3OTUA 1WBWA 5CVFA 3TACA 5BVEA 4BFMA 5TF9A 3UO5A 2VU3A 3E62A 3ORMA 4QP8A 4BCNA 4J8MA 4IX5A 5C27A 3RNYA 4O7WA 3CBLA 3MH1A 5D10A 4AG8A 4RC2A 2XF0A 2VGOA 2ZDUA 2C6LA 4JBPA 2BRMA 4A06A 2PYWA 3S00A 2DUVA 4YJTA 4BDAA 2OICA 2YZLA 5GHVA 4PPAA 3EJ1A 3B8QA 3IW5A 2OXDA 4NUSA 4A9SA 2PMNX 5J1VA 1UNGA 3QCYA 4YTCA 2H8HA 4CQGA 4BTJA 3C51A 4OTPA 3DFAA 3F7ZA 1SVEA 3MSSA 4FVRA 1GZKA 1WBTA 3LM0A 5LCKA 4D5HA 5DT0A 5J9ZA 2HZ0A 1PY5A 2C5VA 4KKGA 2WTKC 3DTCA 4IMYA 4L43A 4UZDA 4G2FA 3MJ1A 5ANGA 2J90A 3F69A 2J5EA 4QP1A 2HWOA 3E8DA 3NCZA 1OL5A 3P23A 5DIAA 3DS6A 2Z60A 4A9TA 1V1KA 4MX9A 5AIRA 2W9FB 5TO8A 3S1HA 2QLQA 4A4XA 3CEKA 2AYPA 1F5QA 3M42A 2GNGA 1YDRE 3CKWA 1WMKA 4FV0A 1R3CA 3IW4A 3A62A 3O51A 3G90X 5EW9A 4DGNA 3F5PA 4A7CA 3L9PA 1ZOEA 5BYYA 3A8WA 2IZSA 3R7GA 3VN9A 4EQMA 1ZWSA 1H01A 2WGJA 5LMBA 5ETAA 5I9YA 2HK5A 4FT5A 4FTTA 3ODYX 4L45A 3DXPA 5M4IA 3MESA 3BYSA 4ASZA 5LVPA 3LM5A 4FTAA 5JQ8A 3K54A 4HGLA 2CGWA 4ZTMA 3OY1A 3H0ZA 4P4CA 4DEIA 3D5WA 3D5UA 2B55A 1YHVA 2XKCA 4I22A 3DJ7A 2RGPA 3E5AA 3GENA 5IQGA 3W8QA 3L8VA 2XKEA 4RGJA 4GUBA 2J51A 3Q52A 3TNHA 5HBJA 5AFVA 2YERA 4FTQA 2E2BA 4K8AA 4QMZA 1WCCA 5A14A 2OZAB 3OUKA 4MXAA 3GT8A 4G3CA 4WKQA 3GFWA 5B2LA 2JDSA 5DFPA 2W1CA 1FVVA 2VO3A 3DKOA 2E9VA 4FG9A 1PW2A 4W9XA 2BCJA 3CKXA 4YTIA 4B8LA 3FLQA 3R7IA 4W4XA 2QOIA 2OGVA 4LOOA 4RIOA 4WIHA 4C38A 4RWIA 4LYNA 2X8IA 3R8ZA 5H3QA 3AD6A 2ERZE 4RWLA 1NY3A 2YIRA 3G51A 3ZM9A 2UZVA 3FMNA 3EKKA 4AN9A 1XH6A 3CTJA 3IW6A 3C1XA 4I21A 3LFCA 2DWBA 3ZH8A 2QI8A 4Z55A 5M55A 4RJ3A 4DH8A 4O7VA 5K0KA 3RINA 4MEDA 4DG0E 3OFMA 4S31A 1Q24A 3F9NA 4FV6A 5DBXA 3E8NA 4RJ4A 4PL4A 5J7BA 4TN6A 3LXNA 4C4HA 3LQ3A 1H0WA 1OUKA 3PTGA 4L7FA 4BCPA 3CQEA 4WBOA 3MH2A 4F6WA 3HDMA 4JAIA 4LV5A 5HIDA 1PXOA 3I0QA 4YSMA 4TWCA 4IXPA 3Q3BA 1E1XA 5FEQA 3NSZA 4B0GA 3BRBA 4EOSA 3L8XA 5E90A 3LFBA 4Q5EA 5EHOA 3GOPA 5ICPA 1H4LA 3E92A 2Y4PA 4IFGA 4LGDA 4FKJA 4CMUA 2R7IA 2WAJA 2WNTA 4OGRA 4ACGA 2YM8A 3SG8A 3IGGA 5DH3A 2BAQA 3QQFA 5IDNA 1YKRA 5E8ZA 4BTKA 4QP7A 4CKJA 5LCJA 4QTDA 4HYIA 5FXQA 4FUXA 4E4MA 5EQPA 2XVDA 2WMTA 3R7VA 4QP4A 2C69A 4KRDA 5L4QA 5M4UA 5HVYA 3FLSA 4O7SA 4O91A 3E7VA 3QZHA 2QHMA 5E8XA 4FIIA 2YM3A 4ZJJA 3T3UA 4CLIA 4CMOA 3N4VA 3QGYA 5LMKC 2CPKE 4UBAA 3V01A 1URWA 4QP3A 3EWHA 2B9HA 1BL7A 3RPSA 5CU3A 4NW6A 3FSFA 4BDDA 1CDKA 2X6EA 3LJ1A 4YZNA 3OCGA 4E1ZA 2R7BA 1WBSA 4X21A 1K2PA 5CVGA 3HNGA 3FC2A 3ZO1A 2YACA 4JQEA 4MBIA 4AW2A 3P78A 4M69B 1QPEA 4YLLA 4AQCA 4AX8A 3EFWA 5DR2A 1MUOA 5AAGA 5A4LA 4V0GB 4D2WA 5M4FA 4O83A 1E1VA 3I5NA 2GNJA 3MW1A 2PVYA 4EQCA 3CJGA 2F7XE 4IAFA 2JBPA 5HESA 1I44A 3Q60A 5ETFA 2EXEA 2O8YA 2VRXA 4EONA 1UWHA 4EOQA 1R1WA 5TKDA 4JBOA 4U7ZA 5AUYA 2JKKA 4UEUA 5T6KA 4ANSA 5FXSA 3RALA 4QMQA 5LVOA 5M44A 3NGAA 3BHVA 4FSZA 4CEGA 5BYLA 3FQHA 2WHBA 4IX4A 5AR5A 4KS7A 5D11A 4ASXA 5L2QA 4FSTA 5JH6A 3LFAA 5H8EA 5L3AA 2W1DA 3L9MA 3ZXTA 2X0GA 3O96A 4GT5A 3KY2A 3FY0A 1KUTA 2VWVA 3KL8A 4QMWA 2RG5A 3JY9A 1XHAA 3EFKA 4ZIMA 1Y8YA 5KHXA 2H34A 2RSVA 2JFMA 5EM5A 4C62A 4PY1A 3QQHA 4PL5A 5CNOA 4QMTA 3AC5A 3F2NA 4GEOA 3UIUA 2VO7A 4C3RA 3KC3A 3QCXA 5CAPA 4PPCA 3QX4A 3ZSIA 4DFUA 4FVQA 5FP5A 4DFXE 5L2WA 2B9FA 4FODA 4MQ2A 2G2HA 5HOAA 4BYIA 4JBQA 2W1FA 3C4FA 3EQBA 5AIKA 2X4ZA 4C2VA 5JZJA 3A7IA 3OHTA 4F64A 5C26A 3RBWA 2IVTA 2BAJA 3SDJA 4BCOA 4HYHA 3EB0A 3DZOA 4EK5A 1K3AA 3TL8A 3AMBA 5CSPA 3QWKA 1Q61A 4QNAA 4XYFA 4YO6A 2QO9A 4U6RA 4KS8A 3LE6A 4ZTLA 4FT3A 5HBHA 4CV9A 3QUDA 4IX6A 3PJ2A 1QPDA 3C5UA 4WNPA 4R3PA 3TM0A 4XG6A 2O63A 4PX6A 2IPXA 3OS3A 4FSMA 4JQ8A 1YXUA 2W7XA 2X7OA 1PXPA 1WVWA 3ACKA 4NW5A 3P1AA 3ZSHA 4E4NA 4D9TA 2REIA 3DBEA 4JNWA 4XP3A 4CKRA 3A4OX 4U43A 2W17A 4FT0A 1TQPA 2BRGA 2C6KA 2VX3A 4XP2A 4DEAA 3NNWA 5L6OA 1FPUA 2P2HA 4L67A 4RJ7A 2V22A 2YDJA 3EZRA 4O7TA 3V8SA 2JAVA 5B7VA 1J7UA 4AACA 1UNLA 5AP4A 5G6VA 3RHKA 2E9NA 2XIKA 3P7CA 3R21A 2BFXA 2X2MA 3DNEA 4LL0A 3MPAA 4KWPA 4MXOA 3VVHA 4GFMA 2C6DA 3BCEA 4GK3A 5E8TA 4S34A 5FBNC 2XJ0A 3NPCA 4QPMA 3DZQA 4O0WA 4K33A 4U3ZA 3QA0A 4ZK5A 2BPMA 5J9LA 3ACJA 2FB8A 4O0UA 3NUYA 3DDQA 4ID7A 4MBJA 3SXFA 3UNJA 1ND4A 1GZNA 2FSOX 3F2RA 1GAGA 2R3OA 1P4OA 4C2WA 2X4FA 2XJ1A 3PG1A 4TWOA 2NNWB 4QYYA 2YIXA 4O0SA 4DLIA 1U54B 3NS9A 2BKKA 3EFLA 5AA9A 5AP1A 5D7AA 1MRYA 2PU8A 2VV9A 4K1BA 4NU1A 5EI6A 3NUPA 4EKLA 4N6ZA 4OTIA 3VS1A 2QOBA 2DYLA 3PVWA 3PIZA 4WUAA 3RHXA 2XUUA 4MH7A 5B2KA 4NJDA 5HZNA 3OCSA 3UP2A 4JRNA 4FE2A 4OBPA 4C02A 3V8WA 3F3UA 3Q53A 4F0IA 5A4TA 4O1OA 1J7LA 5GJGA 4G6NA 4J99A 4IJPA 4BKYA 3ULIA 2DS1A 4FKTA 4G5PA 2XZSA 3QCQA 4RA4A 4YJVA 3HMMA 4QRCA 4ZLZA 3GCSA 3NUAA 2ITPA 4NFNA 4QYEA 5KBQA 4XX9A 2FUMA 4DH3A 4RJ5A 3DBCA 3RZBA 2G2IA 3Q9XA 3ZLSA 3FI3A 2XA4A 1UU3A 4PTCA 4QMYA 3RAHA 4Z7HA 1PXIA 2W1ZA 3P0MA 4U9AA 5EM6A 3BIZA 3MY1A 1YXSA 3EN4A 5IEVA 1FVRA 2R0IA 4MTAA 1H1PA 3O8UA 3LFSA 3M2WA 4R7HA 2PMIA 3ENHA 4QP6A 4C3FA 3IDCA 3ZONA 2Q83A 1G5SA 2UZUE 5DR6A 2PVLA 3ZCLA 1OZ1A 4BTFA 5BUJA 4NCTA 1BI8A 4ANLA 2C0TA 3LXPA 5EW8A 3UP7A 3R1YA 3ORTA 4CFWA 5IUHA 1Y8GA 2PHKA 2QKRA 4OBQA 1ZYSA 4EZ7A 3LAUA 5IA2A 2ESMA 4RVLA 5HNGA 2BHEA 2NO3A 3BWJA 3AGLA 3V5QA 3D7TA 4KUJA 2XNBA 3VNTA 2C6TA 2PE0A 2WTDA 3MI9A 4FSUA 4PDPA 5C1QB 1G8SA 4O7RA 3F2AA 3R83A 4IWPA 4X6QC 3ANQA 2ACXA 2HYYA 4YZDA 4I6BA 1XBAA 2UZEA 3OMVA 5CX9A 2WTJA 5ITAA 1NVSA 3BGZA 2JBOA 3ORLA 2Y0AA 3R00A 1OBDA 1SNXA 4D0WA 3LMIA 2O5KA 2XK7A 5AUWA 4F1MA 4CCBA 4BDHA 1YOLA 1Q8ZA 4E20A 5AAFA 5I4NA 3HMNA 1H25A 1U5RA 2HW6A 2VTNA 4XV3A 5KMNA 2W06A 4NKSA 3ROCA 3RTPA 3BGQA 3WOWA 3O7LB 4L42A 2O2UA 5H8BA 3JYAA 1FINA 3GXLA 3OT3A 1P4FA 4L00A 5HCZA 2OJGA 3BZ3A 4DGMA 1A9UA 1KSWA 4I94A 4UB7A 2ZB0A 2ZAZA 4LUEA 4D4SA 5DR9A 5CEQA 1PHKA 2FA2A 2BFYA 4M66A 4A4LA 3MDYA 3NEWA 3E8CA 3O50A 5AR7A 3BLRA 5A46A 4FZAB 3AGMA 2C3JA 2VTSA 1BUHA 3QA8A 3WF9A 3KREA 3VBVA 4YJNA 3UOJA 3G6GA 3NVKI 5LOHA 2I7QA 2G2FA 1U5QA 1Q5KA 5HEZA 4RC3A 4Y46A 4UWBA 2R2PA 5IH4A 4NT4A 4NM7A 4QPSA 3HV7A 4ZSEA 4ACDA 3QTXA 5L8KA 1KOAA 2W4OA 2ITVA 2R3HA 3R22A 3VBXA 4D1ZA 3BU5A 4IM2A 2YITA 4RX8A 4BWKA 4YU2A 5B2MA 5G1XA 2VWZA 3DLSA 2WMXA 3E3BX 2C6OA 4GFOA 4A9YA 1YXVA 4OT5A 5HHWA 4AFEA 3UQFA 2X8EA 3PPZA 4RFZA 4K11A 3VHEA 4UYNA 3ROYA 4FTNA 4CTCA 1BI7A 3LKMA 3BV3A 4Y72A 4I23A 4M0ZA 2R5TA 1G3NA 4J98A 3PY0A 4KKEA 5EOLA 1NW1A 3OOMA 2W05A 3L9NA 2HY0A 4FSYA 5HTBA 4X2KA 4LFIA 2WZJA 4ENXA 2C5YA 1O6KA 3W2SA 1CM8A 4G34A 4CG9A 2W1EA 4FV1A 2XRUA 5JFXA 4JIKA 2W99B 3SC1A 5CAOA 5DGZA 4EYJA 2XKDA 4IC8A 3NAXA 3V8TA 3LCKA 1LR4A 2YM6A 4LV8A 1CKPA 3UVPA 4AZFA 4TYIA 4AT4A 4ZY5A 1OMWA 4HCTA 1OIRA 2OJIA 2PK9A 3NRMA 3W2OA 4AZVA 2VAGA 3ZFMA 1PKDA 4E8AA 2C68A 4YPSA 3ZBXA 4EHEA 4QMSA 2UVZA 3IOPA 2AUHA 4PDOA 1LUFA 5C4LA 3PRFA 2ITZA 4FTCA 4TXCA 2Y6OA 4KRCA 3F3ZA 4PF4A 3HRBA 4Z7GA 5EW3A 4C7TA 1G8AA 5CF4A 3TZ7A 4ZS4A 4GIIA 1H28A 2F57A 4Y95A 3UPXA 1R78A 4TRLA 2VO0A 1L8TA 5I9ZA 1OIQA 4XH6A 4PRJA 2BROA 3TNPC 4DFZE 1FBNA 5M09A 1DS5A 2WMSA 4HVGA 3NNXA 3Q6WA 4FV8A 3FKNA 1IA9A 4FGBA 4JX7A 2ZV8A 3PLSA 4C61A 2P55A 4BB4A 2B54A 3MTFA 4QTAA 4Q9SA 4BIBA 5E9EA 2IZTA 2V0DA 1W7HA 2CCHA 3PXYA 4YNOA 3RAWA 1H00A 4I0RA 3GU4A 2E9OA 2R3MA 2C1AA 3COMA 3UDBA 3RWPA 1XH5A 1ZYCA 1GJOA 1PMEA 2WIPA 4GSBA 3A4PA 3QKMA 4FEWA 3LOKA 3EN5A 4N4SA 3ZFYA 3CJFA 5IA1A 3GVUA 5ACBC 3UG2A 5BMSA 1GIIA 4H3PA 1Z57A 2JDRA 3TCPA 5BYZA 3RKBA 3QD2B 4YR8A 4ZTQA 4EC9A 3F6XA 3KXXA 2V7OA 2X9FA 3ZYAA 4D28A 5CANA 4ZLOA 4O86A 4TZRA 5CS6A 2VTTA 3W16A 3GB2A 4FT9A 4PNIA 2HZNA 4TYHB 4YNEA 3UJGA 3QTUA 3QKKA 5KE0A 2V7AA 4ZSAA 3LJ0A 2R9SA 4JS8A 4UWCA 5EK7A 4DBNA 2PZYA 4QOXA 5AEPA 3I81A 4OBOA 3WBLA 3GI3A 2R3FA 3UBDA 4LM5A 4XJ0A 1YDSE 1F0QA 5CU6A 5AUZA 4E26A 4F9YA 1OKVA 5M51A 2F2UA 3ULZA 3VUDA 2C0IA 2YDIA 3VW6A 4XLIA 3ERKA 3SD0A 5E1EA 3VUHA 3GOKA 4PMPA 3RMFA 5L2TA 2W4JA 4GW8A 5IU2A 4FICA 2ZM1A 3GC8A 2CN5A 3V5TA 4F0FA 3UC4A 2E9UA 3OWKA 4W8DA 5B0XA 2OIBA 4JDHA 4JR3A 4MCVA 4RZWA 5CXHA 1XWSA 2CN8A 2X2KA 3DBFA 3FKLA 3C4ZA 4NTSA 4X3FA 2BALA 3HYHA 4CZTA 1TQMA 1XJDA 3QALE 1J3HA 3EKNA 2WEIA 5HCYA 4IB5A 2OIDA 4I4FA 5CSHA 4AAAA 3KCKA 4FYOA 3FMEA 4R7IA 5M53A 3IGOA 4FTKA 2YCFA 2ZVAA 4RLKA 5IA0A 2UW5A 5EYCA 3LXLA 5AV0A 4H3BA 4IM0A 4ORKA 2BTRA 4FYNA 2PWLA 5CEIA 4ZJVA 4JG6A 1OIUA 4CFXA 3SOCA 2R3PA 2LAVA 2HWPA 4BKJA 4WG4A 2X1NA 3TNIA 5EDPA 3DJ6A 2I0VA 3DB6A 3R30A 3CS9A 4QYHA 4L3JA 5IMEA 5I9VA 4S33A 5ANEA 3LMHA 2JEDA 4I5HA 4EBVA 3WILA 4YZCA 4EC8A 2YHVA 2A2AA 1GZ8A 2UZWE 5T68A 4E6DA 4IVDA 4CRLA 2BTSA 3MB6A 5KCVA 5DYJA 3BE9A 3TT0A 2F4JA 1V0PA 4QMPA 4FR4A 3ZO3A 3JUHA 3IW7A 5H8GA 2VWUA 2PZRA 3KRLA 1AQ1A 3MBLA 4BDFA 4OTFA 4V05A 4X7QA 5K0XA 4NZWB 3NWWA 5C03A 3UIBA 4C4EA 4AZEA 3KMWA 3A2CA 4EH2A 3FZSA 5HO8A 4C36A 4F99A 1JPAA 4ACCA 5IQCA 2JFLA 2Y8OA 4CCUA 1ATPE 2QODA 3F5GA 5FDXA 4I4EA 4U79A 1Q62A 2WQNA 3R0TA 4XP0A 4DT9A 2RFDA 2XK8A 5E4HA 4DEDA 3VS2A 3QD3A 4RA5A 5IPJA 3FLZA 3KEXA 2VZ6A 4EK3A 2BRHA 2XK6A 3GUBA 4HCVA 4HGEA 1YRPA 4BDEA 4EUTA 1WZYA 2RF9A 3JS2A 4H58A 4RBLA 5FTQA 5F20A 5CT0A 3G33A 3S0OA 4FNWA 4DTAA 1RQQA 2WTWA 4E7WA 3QYWA 4O6LA 3F82A 5M06A 4BL1A 3RJCA 3QQUA 1J91A 4MBLA 4WOVA 5TOZA 4AA5A 4AT3A 4WBBB 2ZMDA 5FTOA 3NW7A 2WIHA 3DNDA 4IVBA 4BIEA 4X2NA 4AZSA 2R3QA 3HP5A 5CASA 3LQ8A 2I0EA 3ALOA 3MFTA 4OTQA 5HX8A 5FRIA 3VS0A 3E8EA 4Z3VA 5HBEA 4J96A 4EK4A 2I40A 4BDKA 1IRKA 2A19B 5BPYA 3DCVA 3L1SA 2IN6A 1UNHA 5LARA 2FVDA 4RRVA 4FOBA 3DPKA 1TKIA 3O8PA 4L7SA 4PNKA 2HOGA 1OL7A 3CPCA 4I24A 4XRLA 4U3YA 4EJ7A 1YW2A 3HA8A 3MB7A 3K5UA 5DN3A 4G17A 4RX5A 2GQGA 5CEPA 3SG9A 2CGUA 2XIYA 4FTUA 4TWNA 4PWNA 5CSVA 4XNEA 3KXZA 3ZLXA 4B4LA 5HVJA 2OWBA 3F3WA 4GFGA 4OUCA 4IH8A 2WMWA 4AOTA 4AOIA 3WYXA 4RG0A 3WF8A 2YABA 3FI2A 3ZEWA 3A61A 5CU4A 4EOJA 4K9YA 3F88A 2OG8A 2X39A 2Z7LA 2W5HA 4I92A 4LOQA 3Q2JA 4EK8A 2EB2A 4O7LA 3DU8A 2BRBA 1YWRA 4ANBA 4XUFA 4EKKA 3FYJX 3MH0A 5CAUA 4FGRA 3UNZA 2EUFB 2R4BA 1FMOE 3O0GA 4USEA 2QQ7A 2C3KA 2R3IA 4M67A 1OL2A 4CKIA 1AD5A 4P5ZA 3DFCB 5IA5A 2V55A 3IDBA 3UOKA 1YI4A 2XBJA 4BI0A 4I5MA 3IDPA 1M7QA 5JGAA 2GFSA 4IAKA 4EH5A 5L2IA 2NRYA 5C8NA 4RFMA 5HGIA 5A54A 3AMAA 5K4JA 2ETRA 2WMVA 4D1XA 3UIMA 5EQYA 3QCSA 2F49A 4I5CA 2R3JA 3MWUA 4M7IA 4XG9A 5D41A 4ZS0A 4DG2E 4O27B 3QRUA 1ZARA 3OXIA 3PZEA 1VR2A 4RVTA 3O8TA 2PUIA 4GMYA 3RWQA 4FZ6A 2PSQA 3PA3A 2QU6A 1VYWA 2VUWA 4YO4A 5FDPA 5HNIX 2W9ZB 4F7NA 3R8UA 4CT1A 3BI6A 1PXJA 3KK8A 2CKQA 2CMWA 3NW6A 2R3LA 4D9UA 2WQMA 2BUJA 2W0JA 3LQ5A 4RZVA 2I0HA 4TYJA 4CTBA 3GGFA 4X2FA 2PMLX 2RIOA 4S30A 3H9FA 3R6XA 5CU0A 4CZUA 3A7FA 2OXXA 5L8JA 1ZRZA 2JGZA 2YIQA 4IJ9A 2C47A 3SXSA 3TKUA 3EQRA 5BVNA 3Q4TA 2UZOA 2FSLX 3DAKA 3JPVA 3R2YA 1ZMVA 2OBJA 4H1JA 2XEZA 5AP6A 3C9WA 4JDKA 5JN2A 1PXLA 1YOMA 4TL0A 4WUNA 3VIDA 4EH6A 4IWOA 4FKIA 3DGKA 5TE0A 3KXMA 4HVSA 3PY1A 1SZMA 4LOPA 4N57A 3AC2A 3AC8A 2F2CB 2IVVA 4FEQA 1OI9A 4IZYA 1P5EA 4JVGA 4NSTA 4RJ8A 4IZ5A 4YC8A 5J8IA 2WPAA 5LVLA 3SX9A 2GS6A 4FBXA 5HIEA 4A9RA 4IM3A 1EH4A 3C5IA 2UZLA 3GP0A 3QD0A 4HZSA 3ZOSA 3KULA 4ANOA 5E8UA 3N4UA 1MQ4A 2IZUA 2LGCA 4XBRA 3VWAA 5CWZA 4BDGA 3Q9ZA 4PPBA 4R8QA 1MQBA 3C13A 4YZ9A 3OW4A 4DEHA 3COHA 2UZNA 3PIXA 1MRVA 3LFNA 2VNWA 4XMOA 3R8LA 3ZRKA 4Y8DA 2NPQA 5EFQA 4E93A 2BDFA 1DI9A 2PPQA 3O71A 3Q96A 3UG1A 3OG7A 4U41A 4J8NA 4CT2A 4ONAA 1KE8A 3M1SA 3NYOA 2WQBA 4AW0A 3C50A 4JQ7A 3ZO4A 2YZAA 5DG5A 3R2BA 4GK4A 4FKPA 2J5FA 4FVPA 2GCDA 3HUBA 4F4PA 3E3PA 4WNKA 3KCFA 3U9NA 4G31A 4AZTA 3ZM4A 4WSYA 1B6CB 4TT7A 4PTGA 3BELA 4AW1A 1AGWA 5EI8A 1OPLA 4BZOA 4DH1A 4XG4A 2YM5A 4U97A 2HZIA 4S32A 4IAZA 2WMBA 3UE4A 4DAWA 1IEPA 4U5JA 3FY2A 4ERKA 3Q04A 3ZXZA 5AV4A 5FWKK 3GCPA 3CD3A 2O3PA 3QQGA 3TZMA 2VTLA 3OEFX 5LMAA 4C0TA 2W1HA 3ZUVA 4UYAA 3T9TA 4LGGA 1H1WA 2ZM4A 5TT7A 3VBYA 1KWPA 2A27A 4GYGA 4H1MA 4QD6A 4YHTA 1P2AA 3UZRA 4ZAUA 5AP3A 4YHFA 3RPYA 2GTNA 3LZBA 4FKRA 3CGOA 5EH0A 4BF2A 4F9AA 4EOIA 3FYKX 4MQ1A 2P0CA 1PYEA 2QURA 4YZBA 3ZMMA 3DDPA 3CC6A 4DFLA 5I3RA 3B2WA 2B0QA 3TJCA 2F7ZE 4DCAA 1XR1A 3NUSA 3D83A 3SW4A 4TY1A 4L68A 4F65A 4Y73A 1FQ1B 1REJA 2FYSA 1ZMUA 3QXOA 2XK4A 2KTYA 4KBCA 3TJDA 2QHNA 2X7GA 2BR1A 4AE9A 3CE3A 4O0RA 1SYKA 5LMKA 5J1WA 3A8XA 4JRVA 4IVAA 3PA5A 3JY0A 3BYOA 3CLYA 4FIGA 5E8WA 2XEYA 3ORKA 5EKNA 4G3GA 4GUEA 4IHPA 3PY3A 5IDPA 3UNKA 4UX9A 3I79A 3R7YA 4C35A 3TXOA 4RMZA 4D1SA 3ITZA 3DQWA 3MA6A 4EORA 2YJRA 1JKSA 2UW3A 5JSMA 3TTIA 4EH9A 1FGKA 1NXKA 4FX3A 4O0XA 3OOGA 4R3RA 3T8OA 4O82A 4F08A 3EOCA 4KB8A 1Q8WA 1SM2A 3VS4A 2UW4A 5M07A 5DA3A 1H26A 4O7ZA 4JR7A 3SV0A 5KMOA 3W1FA 4DE4A 5HVKA 5IISA 4AUAA 4FIEA 4Y5QA 4BCQA 3HGKA 2C1BA 2WTIA 2G01A 2P2IA 4RC4A 3D2IA 3EN6A 5GJDA 4CD0A 1ZYLA 4RIYA 3TEIA 3ZEPA 3KFAA 5AP7A 4CSVA 3GNIB 5IQHA 1RE8A 3IK3A 3FV8A 3Q32A 4U40A 3GBZA 3RNIA 2PUNA 3R7UA 1UA2A 4DEEA 3VUIA 4MD8E 3UYSA 4UV0A 4D4YA 1U59A 2CGXA 2GFCA 3IECA 2OW3A 4IC7A 3LPBA 4JAJA 4P5QA 4EEVA 3CXWA 4H3QA 4XOZA 3VUKA 4FOCA 4BI2A 1R0EA 4BWPA 3NVMB 1E9HA 3VS3A 2C0OA 3OD6X 1NVQA 4K77A 4RVKA 4C4JA 4XOYA 1YXTA 3E64A 2JIIA 4KIKA 4MWIA 2C5XA 3QTZA 4NTTA 3W33A 3BU3A 5E8SA 3FSKA 3TV7A 5DWRA 5FGKA 4L3PA 4YGAA 3ZDIA 4R1YA 2WB8A 3AC4A 3IG7A 1QL6A 4AS0A 4F0GA 3QRTA 4PDYA 2VX0A 2ONLC 4G16A 3ZUUA 4TW9A 5KO1A 3WZKA 3SA0A 1SNUA 4NCTC 5CYIA 2X7FA 5BMMA 3U54A 2GHLA 2XBAA 3QUPA 2OK1A 3C0HA 5CEMA 5GJFA 3AD5A 5FQDC 4CLJA 3UMXA 4EH4A 2VX1A 3I6UA 2B52A 2ITXA 2J0JA 3H0YA 2ETMA 4M84A 4JLCA 4FV3A 2ZDTA 3OWJA 5E7RA 3JR1A 5D9HA 5HICA 3FMKA 1WFCA 2C6IA 3C0IA 3SLSA 2OU7A 2FH9A 2UZDA 3II5A 4IDVA 2VTHA 2Y7JA 4PP9A 3IOKA 5CVHA 5AX9A 1RW8A 2YCSA 3I1AA 3RPOA 4BBEA 1LEWA 3EMGA 2ITWA 5HE2A 4FIJA 3ZRMA 3BKBA 4C34A 3W18A 4XHKB 2XJ2A 5CY3A 3UVQA 3PUPA 4AWIA 4ALWA 4FI1A 4FKVA 4IIRA 4F9WA 3G2FA 1JAMA 1BL6A 2G15A 2XMYA 5LWMA 4DFBA 4ITHA 4EZ5A 3DXQA 3EN9A 5HU9A 2XNOA 4F9BA 4RWKA 5HI2A 3EQPA 5JT2A 3PWYA 1OM1A 1YWVA 2R3GA 3HZTA 5EM8A 3GC7A 2OFVA 4G5JA 4JX3A 4P90A 2AC5A 3S4QA 4E6QA 2I1MA 4O2PA 3VBQA 4O6EA 1OUYA 1U46A 1ZMWA 2V5QA 1H8FA 3FJQE 4FV4A 3NZ0A 5ETCA 1OPJA 5KKRB 4ALUA 3HUCA 2BHHA 2QO7A 4BCJA 3H3CA 3ZDUA 3EIDA 5CF8A 3C4EA 2IVSA 4BDIA 5I9UA 3DTWA 4BDBA 4HZRA 5DNRA 2QOCA 4K6ZA 4XG3A 2RG6A 4EH8A 4QMXA 4EBWA 3A99A 3M11A 3QFVA 4USDA 5FEEA 4F63A 1CKIA 4MHAA 3VJOA 3GEQA 4PTEA 5JK3A 4WT6A 2W5AA 2YM4A 3I6WA 3WIGA 3DK6A 3L9LA 5HIBA 5KKRC 1H08A 2RL5A 1ERKA 5FD2A 3U51A 2B4SB 5A4EA 1JSTA 2JKQA 2VGPA 2VN9A 5EYKA 1Q4LA 3TG1A 4RWJA 1W82A 3TUDA 4IQ6A 1IASA 3GU8A 3A7HA 2FGIA 3LXKA 3OW3A 4V04A 3P86A 3D9VA 4HW7A 4AA4A 4AN3A 5KBRA 1GNGA 5EG3A 4L3LA 2C6EA 3U87A 3WE4A 5A4CA 1PMVA 2XNMA
chains in the Genus database with same CATH superfamily
2PZIA 4Z9LA 3FMDA 4R77A 4M13A 5DOSA 1XMMA 3BQRA 1GIJA 1KV2A 3I7BA 3PJ1A 2OFUA 3U4UA 4GK2A 2VWXA 3MIYA 1H24A 4E4XA 4AW5A 5IH6A 1UU9A 4DT8A 5ANOA 3NW5A 4A9UA 3D2KA 2CLQA 2XS0A 4IAYA 4WG5A 4BZDA 4CFMA 1V0BA 4J1RA 2AC3A 4ZY4A 2UW7A 5E8YA 3L8PA 1M7NA 4G1WA 3QXPA 2WOUA 3WZEA 2QVSE 3ZLWA 4AOJA 3WZJA 2PTKA 2XNGA 4BWXA 3HVCA 4DC2A 3IPHA 4MWHA 4CG8A 5AR4A 4PV0A 2BKZA 1ZZ2A 3HECA 3MYGA 3WZDA 4E6CA 4QMNA 5CZHA 5LJJA 2UZTA 1XQZA 4RQVA 4RX9A 1PXNA 3I7CA 4GS6A 3N4TA 2HCKA 2H96A 4I6QA 4DEBA 1NT2A 2VNYA 4LGHA 3VONA 3AMYA 1YDTE 3WARA 4C8BA 4FA2A 5HNBA 5M08A 2ITUA 2GQRA 4FT7A 3MVLA 4J97A 3VF8A 5FXRA 1JKKA 4CXAA 4D55A 4ALVA 2OH4A 4DTBA 4JG8A 2ITOA 3ZZWA 3PXKA 4EZ3A 1W8CA 1Q41A 2WD1A 1OL6A 3EYGA 4IE9A 4C59A 4GH2A 4X6RA 4W4WA 4II5A 4WD5A 2BZKB 2I6LA 4FKQA 2YIYA 4YUQA 2BIKB 3G0EA 4FKOA 3TKIA 3LVPA 1F3MC 4RQKA 1Y57A 3PJCA 2NRUA 2IVUA 2VD5A 2IW6A 4KABA 4KIQA 3EQDA 2HAKA 2PVNA 3GCUA 4OAVB 4D4VA 5AUUA 2FSMX 3OXTA 3PP0A 4P2KA 1WBOA 3MY0A 5BQ0A 4CVAA 5J7HA 3DQXA 5H9BA 4QMMA 5IUIA 4MNFA 2EXMA 3FE3A 3IONA 5E92A 3GFEA 4G3DA 3FI4A 3KULB 5AP5A 2C4GA 2IO6A 2ITYA 4MXZA 3PYYA 2IG7A 2ZM3A 3ORPA 2OF2A 3F7WA 1HOWA 3QTIA 2OJJA 5CSXA 5I5ZA 1T46A 2QOQA 4YLKA 5A6OA 1A06A 4LL5A 5JKGA 3COIA 1JKTA 2C3LA 4HYSA 1TZDA 3F5UA 3PFQA 4I41A 3ZLYA 4XV2A 2J7TA 1M2RA 4HGTA 4HPUE 1YI3A 3ETAA 4CYJA 5JGDA 5E1SA 2ZOQA 3KRWA 1GY3A 2HY81 1Q8YA 3KRRA 3KA0A 3OWLA 5CU2A 3AXWA 3EL7A 5A3XA 1YI6A 3DAJA 4Q9ZA 3R9NA 2BIYA 4W4VA 1VZOA 2QG5A 4JG7A 4Q5HA 4APCA 4BICA 2CKOA 3LHJA 4DBXA 3TWJA 5HG5A 4IB0A 4DGLC 3PPKA 1BMKA 2Z7RA 5AUVA 4LI5A 5DE2A 2C5OA 3VS5A 3UIXA 5J87A 3MVHA 3MH3A 2V62A 2B9JA 4K0YA 1S9JA 2VTMA 1W84A 4LMNA 4M69A 5DEWA 4E5BA 5AUTA 3QX2A 4RSSA 1XKKA 1O6YA 3R71A 5EDQA 4YURA 5AV1A 1SVGA 3KIOC 2QO2A 2CJMA 2XNEA 2QLUA 2WTCA 3T3VA 4V01A 4FIHA 2J50A 4J71A 4Y83A 3UOLA 2QU5A 3HMIA 3G9LX 3QLGA 4B6LA 2VTOA 3GCVA 4WRSA 4DTKA 3P7BA 5FTGA 2YWPA 4YJPA 5ETIA 1Y6AA 3FXWA 5TR6A 4E4LA 2XRWA 5AMNA 1KE5A 1SVHA 2YDKA 3DB8A 2Z7SA 4JIAA 4PL3A 4RJ6A 4RPVA 3KB7A 4D5KA 2B9IA 4IWQA 4BN1A 3D7ZA 1VYZA 3AD4A 3PP1A 4I20A 4QTCA 3G6HA 2XB7A 3FQEA 3Q9WA 4DCEA 3P7AA 3UC3A 2VWBA 3NDMA 3DBQA 2BAKA 1UU7A 4ZTHA 3TN8A 3ZS5A 1GOLA 3BE2A 3OTVA 4XV9A 2XKFA 4FV7A 4HJOA 4CFVA 4NJ3A 3LCTA 1W98A 4X3JA 3T9IA 3FZTA 3K5VA 4UXQA 4WRGA 2YLEA 3RPRA 4BRXA 4BCKA 3P08A 2PE2A 3REPA 5KMJA 5GIPE 5ANDA 2HENA 3HV5A 4FKWA 4UWYA 1NA7A 3NR9A 4C4FA 4DN5A 3FL4A 2BDJA 4IVCA 2XNNA 4O2ZA 3FQSA 2RFNA 3HDNA 4DINA 2O64A 3CIKA 4I0SA 3SG9A 3OUNB 4FZ7A 3RK9A 3UPZA 5FP6A 3BEAA 4I6HA 3JXWA 3PPJA 4G3FA 3TZ8A 1OPKA 2YAAA 2CSNA 4BGHA 5EQEA 2BZJA 4ZSJA 4DHJA 4BHZA 4ZTNA 4R78A 4GG5A 2JDOA 4JDJA 4QTBA 4EWQA 4AT5A 3PUFC 2R3KA 1WVYA 3D14A 4XS2A 2W96B 5AM7A 3NUXA 4D2PA 3FZRA 3WI6A 3FUPA 4RIYB 2CLXA 3E63A 4XG7A 4L01A 5AR2A 3DXNA 5BVDA 2W4KA 4OTDA 2EVAA 2RKUA 3RCJA 4BCMA 3CP9A 1Q8UA 3QC4A 2BZHB 3SW7A 1H1QA 1PXKA 4ZZNA 2PVKA 3ZBFA 5CQWA 4MUQA 3FWQA 2OH0E 3UYTA 5F95A 1T45A 4BC6A 4OTWA 3NUNA 3IS5A 1UU8A 3OY3A 2W1IA 2Y4IB 4BBFA 2YM7A 3SKCA 1OECA 3EFJA 4NFMA 3VRZA 4UXLA 4EJNA 2VWYA 3R7EA 4B99A 4BDCA 1L3RE 4GJ3A 3QL8A 3OBGA 3Q5IA 1Z9XA 4HGSA 5BUEA 2VO6A 2OKRA 1XH7A 2GMXA 1S9IA 4MNEA 4QQCA 3SXRA 4UN0C 2GTMA 5CF5A 1JBPE 3KXGA 2X8DA 3UMWA 4EL9A 4F09A 4DFNA 4L53A 3QRIA 4UMQA 2IW9A 4DHFA 5CI7A 3KMUA 4XV1A 4GU9A 3MGYA 4ZP5A 2HELA 5FM2A 3CTHA 4ZXTA 4D2TA 4D4RA 3AQVA 5LVNA 5ANKA 2PVJA 4FNXA 4GL9A 1JLUE 4FK6A 4DITA 2C5NA 3Q4CA 4YLJA 5CALA 4JXFA 1RDQE 2PVRA 4FSNA 1M14A 1TQIA 3RP9A 2X9EA 2OF4A 5DLSA 4GCJA 5DHJA 2J0LA 4GG7A 5LXMA 1OB3A 3KRXA 3H4JA 2UZBA 4KSQA 4M14A 4FV2A 4AZWA 5IG1A 4AE6A 4ZTSA 1WVXA 3EQGA 3SQQA 4R3CA 3RVGA 4F7JA 4QPAA 4FV5A 3MVJA 4IB3A 3BHHA 1ZY5A 4GIHA 1HCKA 3AT3A 4W8EA 4HPTE 5DEYA 5K5XA 3P5KA 4U45A 5KMIA 1H07A 4ZMFA 2GNIA 1M17A 3RCDA 3NNVA 4YTHA 3AT2A 3GC0A 4G9CA 4NKAA 3F3VA 1XH9A 4PQNA 1DAWA 4EOKA 5HLNA 3S2PA 4OR5A 4CZYB 1J1BA 5H2UA 1UKIA 3IO7A 3PZHA 2VTPA 3IW8A 3K3JA 3WF5A 4BGQA 3OF0A 3R1NA 4CV8A 1SMHA 3H9RA 3LLTA 4O84A 3SAYA 3QZGA 4ZY6A 3MTLA 4LRKA 4MK0A 1JOWB 3FZOA 3CY3A 3HP2A 1REKA 3CD8A 3H10A 4NH1A 4RIWA 4RX7A 3ANRA 3BWFA 3AT4A 4IB1A 4FSQA 4U80A 2ETKA 2YN8A 4GYIA 2FO0A 1YHWA 4FZFB 1APME 3D7TB 5CI6A 3PXRA 5IMXA 2UW8A 2CKEA 1OKWA 3HX4A 3VW8A 3V5PA 2XP2A 5F9EA 3TDWA 5HD4A 4OTGA 4N6YA 3I4BA 3R8VA 2BILB 2YCQA 3ATSA 1HCLA 3VRYA 4E6AA 3W32A 3HA6A 4ITJA 4YPDA 3ZHPC 4E73A 3Q2MA 3FXXA 5GIOE 3DK3A 4OLIA 3FBVA 4J7BA 2J0MB 2BVAA 2WQOA 4MXXA 1QPJA 3ET7A 4P7EA 4U8ZA 3VQUA 4IW0A 3R8PA 4N70A 5D12A 5CF6A 3G15A 2JAMA 3UQGA 1LEZA 2VTQA 4AGDA 3LCSA 4X0MA 5AAEA 4JMQA 3O17A 2UUEA 1QPCA 1PKGA 3KMMA 1IAJA 3RI1A 2WELA 3NYXA 4B9DA 3C4XA 3DKGA 5I9WA 4F1TA 5IUGA 2CNQA 3TNWA 5CT7A 4GT3A 5A4QA 1P14A 1ZZLA 4BCGA 5IQBA 3ZO2A 4FZDB 2G9XA 2W5BA 3O23A 3C0GA 4LQMA 3PLAE 2UW0A 5I0BA 2GS2A 3SHEA 3C7QA 1URCA 3TZ9A 4CGAA 1VJYA 4J53A 4M15A 3R9HA 2GDOA 2ZV2A 2YJSA 3WIKA 4DA5A 3U6JA 3U4WA 3TUBA 2GQSA 4FG7A 2PZPA 3HLLA 4PUZA 4ACMA 5KMMA 1ZOGA 4F1OA 1LPUA 3NUUA 3UTOA 3VC4A 1YOJA 4QT1A 4JL9A 5EKOA 3AC3A 1ZAOA 2WXVA 5HG9A 3VBWA 4M8TA 4DG3E 2J6MA 3LFEA 5JMSA 4U81A 4DGGA 4R5SA 3C4WA 3OROA 3W8LA 3PVGA 2CHLA 4B7TA 2ITNA 3QTRA 3BEGA 2A0CX 3UZTA 3VUMA 5A6NA 2DQ7X 3FMLA 2OJ9A 2YFXA 3MA3A 2KULA 3VAPA 3GQLA 5AA8A 3W2RA 1WAKA 2F9GA 4BCFA 2XM8A 3KKVA 2UVYA 5LVMA 1XH8A 4O0YA 3GC9A 4A07A 5AV2A 3MFUA 4RIXA 5CLPA 3KGAA 5AWMA 4BZNA 1PXMA 3SGCA 4CFNA 4BBMA 1M52A 5HE1A 4BCHA 3HAVA 5J79A 4MD7E 4FF8A 3DK7A 5JZNA 4O7YA 5EOBA 4IDTA 3W0RA 5IQEA 5KUPA 3TIZA 3U9CA 1Y6BA 3ELJA 3L8SA 4RT7A 2Q0BA 5AR8A 4C4IA 4KINA 4I1ZA 2ZB1A 1JWHA 3CTQA 4M3QA 3O7LD 4O4CA 4IEBA 4MF0A 1NVRA 3FLYA 2A1AB 3Q5ZA 4IAIA 5HQ0A 4Y5HA 2JKOA 5CXZA 1Q3WA 5GNKA 3QLFA 2WO6A 3MV5A 4KD1A 5FM3A 4AP7A 4IAAA 4IX3A 3PA4A 3LJ2A 4EHVA 3AOXA 1DM2A 4UZHA 3R02A 2VTRA 3E7OA 3FL5A 5GZ8A 5HO7A 3RK5A 4H05A 4LMUA 4R5YA 3DV3A 3EQFA 5AP2A 1FMKA 5KZIA 3V5LA 2YIWA 5IA4A 5IEYA 4L9IA 4L52A 3V51A 2CCIA 3Q4ZA 5EI2A 4QMOA 3NAYA 3N9XA 2XH5A 4FL3A 4L8MA 5CENA 5CEKA 5EHYA 2GNLA 3D0EA 1OIYA 1JNKA 3PIYA 4FMQA 4OW8A 3W55A 3TI1A 4AGWA 3DOGA 4GVJA 4DH7A 1R39A 3V6SA 5E91A 3CCNA 3SRVA 4CRSA 4E3CA 1KE9A 3F3TA 3IKAA 2EXCX 5J5SA 3FZPA 2Y9QA 3OXZA 5JEBA 4FTMA 4F70A 3G5DA 5HG8A 3KK9A 5DRBA 3MPMA 5LWNA 3R9OA 3D4QA 4KBKA 2E9PA 3MVMA 1PMNA 2QR7A 1Q8TA 4ASDA 4N0SA 1UVRA 3E87A 4KIOA 4NIFA 3FPMA 3FEGA 4MKCA 4IZAA 2X6DA 3S3IA 4XRJA 4I6LA 3PJ3A 5IQFA 3MS9A 3FPQA 2EB3A 2WU6A 1JVPP 3AG9A 3BLQA 4UMTA 4ZOGA 5HLPA 2P4IA 3RZFA 2X0OA 2ZYBA 5KMLA 4IACA 3U6HA 3F5XA 3R1SA 4F6SA 4AN2A 3HRCA 3LMGA 2ZV9A 4AGUA 3EHAA 3NX8A 2Y4IC 2GNHA 4TYHA 4DYMA 3D15A 2QOHA 2JKMA 2VTAA 2OJFE 4J52A 4O4EA 4ERWA 5K9IA 4K18A 2B7AA 1O6LA 4G6LA 4WHZA 4W9WA 1H1RA 3QRJA 3TTJA 3V6RA 3EL8A 3LLAA 2HIWA 3O2MA 4FSWA 4GRBA 4RVMA 3BHUA 3FDNA 4GU6A 3ORZA 4BVUA 3ENMA 3DLZA 3VS7A 3QBNA 4O7NA 1R0PA 4O4BB 2ZJWA 3UGCA 4USFA 1FVTA 4EOMA 4EUUA 4X3FB 5KMKA 4LRJA 1OKYA 4TNBA 3LFFA 3QYZA 4M68A 3VUTA 5HTCA 1QMZA 5HG7A 2JDVA 2FSTX 3ORIA 2X81A 5JQ5A 4O96A 2IWIA 1YWNA 3VBTA 4E5WA 4NL0A 4CFUA 5F4NA 5T3QA 1TVOA 1XH4A 2H6DA 3HMOA 4IWDA 3NIEA 5AM6A 5J95A 4C3PA 3BU6A 5DI1A 1YHSA 3KN6A 4AF3A 2XIRA 3BYVA 3RM7A 2ITQA 2PE1A 5CTPA 4C33A 3ATTA 3K2LA 4KA3A 3PVUA 3QHWA 3NNUA 5HX6A 2PVFA 5HLWA 3KQ7A 4GKHA 2JITA 1I09A 3VJNA 3KXNA 1YQJA 4RFYA 3W2CA 1ZYJA 4DGOA 4QQJA 3QQKA 4TKSA 2IJMA 2VWWA 4MXCA 4D2RA 2J4ZA 2Q0NA 3C4CA 4JJRA 2CKPA 3NYNA 3ZZEA 3HV3A 5EYDA 1WBVA 1ZY4A 4KBAA 3QUEA 4TNDA 5M4CA 1O9UA 4QMVA 2NP8A 1IG1A 4QP2A 4OAUC 3CSVA 4EHZA 1PRYA 4HOKA 3OCTA 4EHGA 2XIXA 1KE7A 1PJKA 4FKLA 4MYGA 1B38A 4RLLA 5FBOA 3ZSGA 5D7VA 1YXXA 5BV3A 4BGGA 4NEUA 4MNEB 3NCGA 2WKMA 3I60A 4HCUA 3QU0A 4QNYA 4DFYA 2IZRA 1IA8A 3BX5A 3D5XA 4YC6A 4YHJA 4L44A 4FKGA 1Y91A 2ERKA 4EK6A 3PXZA 5IQAA 2P3GX 5C8MA 3DBDA 3I5ZA 1BYGA 1UV5A 3MJ2A 2Z8CA 2C3IB 4QYFA 4S2ZA 1X8BA 3TV4A 4BR3A 3HRFA 4FK3A 4IZ7A 3DT1A 3V04A 2CNUA 3PG3A 4O0VA 2H9VA 2WMQA 5BVWA 1JSVA 1JSUA 5C4KA 3KRJA 3VO3A 3FMJA 3KF4A 2A4LA 4PMSA 5DPVA 2OLCA 4FEUA 2YISA 3MIAA 5I3OA 3PXFA 4FKUA 4YJQA 4TYEA 2XNPA 4AA0A 3LCDA 3DKCA 3P4KA 5JFSA 4H36A 3QTSA 2J2IB 3FLNC 3VULA 4G9RA 1ZLTA 2B1PA 4NK9A 3RPVA 4Y85A 3R8MA 4DF3A 4BKZA 5KNJA 4PMMA 4C4GA 3HV6A 4CYIA 1H1SA 4R1VA 3KN5A 4W4YA 1GZOA 5IF1A 3NFFB 4ZSLA 4EOLA 1CKJA 4QTEA 3RAIA 4TTHB 4AU8A 3QQLA 3QD4A 2C30A 4UMPA 4MVFA 2QOKA 3CQUA 3KF7A 3OZ6A 4GV1A 3LFDA 4KKHA 5IA3A 3QGWA 3E88A 4PP7A 4EYMA 2AQXA 5IEXA 2SRCA 3OVVA 2ITTA 3NIZA 4RIWB 4MAOA 4ZSGA 4ASEA 3GU6A 5AP0A 1XO2B 5AJQA 5GINE 3A60A 2CNVA 2ZFYA 3R01A 1MRUA 3ZTXA 3UO6A 3D5VA 3VHKA 4A4OA 3FMMA 3K3IA 4WA9A 5HU3A 4YSJA 2ONLA 5IQDA 2JC6A 4I5PA 4FTJA 3KU2A 4OTHA 2XALA 4GT4A 4YC3A 2F7EE 3WF7A 4ZZOA 1WBNA 2JD5A 4ZJIA 1OL1A 3QTQA 4DLJA 2QR8A 3MFSA 4APPA 5FG8A 2I0YA 2HW7A 3PXQA 4R6VA 4FTIA 2PUUA 2R3RA 4ANMA 3QWJA 2ZV7A 3WE8A 4JOAA 4FEVA 3R73A 4YJUA 3HAMA 2WTVA 1J1CA 2QD9A 4YBKA 2WMUA 4D2VA 4E5AX 5HKMA 2QOOA 5CEOA 1ZXEA 2XCKA 4X2GA 2WQEA 3WYYA 2OSCA 3TMOA 3DKFA 4KAOA 5CSWA 1Q99A 3S95A 4CQEA 4JT3A 3EQHA 1OVEA 3POZA 2Y6MA 2YCRA 4M97A 4BYJA 2GPHA 5M56A 3UVRA 4KIPA 4BI1A 1KV1A 5FUTA 4YZMA 3SOAA 3ORNA 1K9AA 3MY5A 4EH7A 2RFSA 4DH5A 3FMHA 3U8WA 3PJ8A 4YP8A 2UVXA 2QC6A 4TWPA 2OZAA 3BBWA 4MXYA 3DAEA 1LP4A 4Z16A 2GU8A 1WBPA 3CPBA 4HVDA 2XK3A 2PY3A 2QCSA 4YJRA 1MP8A 2WTKB 4M0YA 2UW6A 5ANIA 2PUPA 2PMOX 3NMUF 3BQCA 3RM6A 4WSQA 4LDTA 3NLBA 4U44A 3FC1X 3KVXA 4ZZMA 4FTOA 3B8RA 4FUYA 2JLDA 3TIYA 2PVMA 3ZC5A 4F9CA 2OZOA 3CR0A 4UALA 2PL0A 4NYEA 1UWJA 1BLXA 3QF9A 4FV9A 3Q4UA 5JRQA 4QYGA 3CY2A 3FHIA 3BLHA 3QZFA 4LG4A 3PVBA 3R7OA 2AEGA 3BHTA 4O1PA 4F7SA 3PDTA 4FNYA 1XBBA 3PSBA 4EI4A 3COKA 3TDVA 1OITA 3QHRA 4NWMA 5BX0A 3PWDA 3TV6A 3BHYA 4EOOA 4KSPA 3F66A 3N51A 5AV3A 4EQUA 5K3YA 3BPRA 3OEZA 1M2PA 4Q2AA 3UZPA 1PYXA 3HV4A 2CGVA 4I6FA 3FKOA 3GCQA 3ORXA 2VTJA 3R9RA 2Z02A 5DMZA 2JIVA 4XG8A 2QNJA 4XLVA 2IW8A 1VEBA 5F94A 3BV2A 4YMJA 2O65A 2QOLA 2R0UA 4YJOA 3DA6A 3B2TA 4H39A 4ZMEA 4FL1A 3PE2A 4YTFA 2QKWB 4RIXB 3ZFXA 3EQIA 3I0OA 4XBUA 4JI9A 5HD7A 2R3NA 2XIZA 3ODZX 5AX3A 5HE3A 3KVWA 4I93A 5IKWA 4ENYA 2VWIA 4FTLA 4QMUA 4HYUA 2OXYA 5ACKA 2J0KA 4QMLA 1OKZA 5LQFA 1IAHA 3HKOA 3WZUA 4C58A 5CZIA 2C6MA 1W0XC 3QAME 1Z5MA 5DT4A 5GZ9A 4C57A 4JDIA 2VTIA 3PSDA 3EQCA 3HEGA 4ZEGA 5DVRA 5L6PA 5K5NA 4FTRA 4PMTA 3LW0A 5EM7A 4R7BA 5CAQA 4GKIA 3R9DA 3FZ1A 3VQHA 1BKXA 4TYGA 4ANQA 4ARKA 1OGUA 2GSFA 3HL7A 4HNIA 3OC1A 4NM0A 5C01A 3FXZA 3P9JA 4IFCA 4M12A 5M57A 4I3ZA 1DAYA 2XYNA 1OBGA 4LUDA 4JBVA 2BZIB 3H30A 3UDTA 2UV2A 2PULA 4FEXA 3QZIA 3U6IA 2HZ4A 2Z7QA 2R64A 4FKSA 4G3EA 4BDJA 4X3FC 2EWAA 3MPTA 4KNBA 5EDRA 3R28A 3GU7A 5AUXA 3EH9A 4BTMA 5BNJA 3JVSA 5C9CA 3GQIA 4O21A 2J0IA 4YJSA 3VF9A 2PVHA 4UMRA 3W0SA 2UW9A 5K4IA 3SRVB 3UOHA 5JFWA 3A7JA 4FIFA 3FHRA 4V0GA 1QCFA 2HXLA 2WFYA 2Z2WA 4IANA 4IADA 5C8KA 3QTWA 4QO9A 4FL2A 4XG2A 4IBMA 5D1JA 2QG7A 3W2QA 4O22A 3OWPA 3EN7A 4GVAA 2YEXA 3LCOA 3ZRLA 5GZAA 2YWVA 4OT6A 4ANNA 4PDSA 2J9MA 4NIFB 2WMRA 4GJ2A 3ZU7A 5JFVA 2QOFA 4ITIA 1KE6A 3ALNA 4J95A 1KOBA 1M2QA 4EOPA 4QQTA 1PF8A 4ZLYA 5BVFA 4BCIA 3EYHA 1UKHA 4FG8A 1CTPE 1YVJA 5J5TA 1Q97A 3F61A 3AC1A 3QKLA 4BY9E 3Q6UA 1H27A 3MN3A 3U55A 3BBTB 3CQWA 4WO5A 3NYVA 1J7IA 3JVRA 2OI4X 4K2RA 3W10A 4EWHA 5IQIA 4D58A 5BUIA 3A7GA 5A9UA 5KX8A 4O81A 1ZYDA 4FC0A 2YLFA 1XBCA 3WF6A 3UO4A 4TPTA 3V5JA 2GHGA 2XM9A 3P79A 3LIJA 5CNNA 5EHLA 3THBA 3VUGA 4X2JA 5HE0A 4D0XA 3HMPA 2YAKA 4MF1A 5F1ZA 5KZ0A 1DI8A 4WNMA 4G6OA 5L8LA 1U4DA 4O38A 3SVVA 4NM5A 4F7LA 3ZC6A 4NM3A 2GS7A 2HXQA 3BGPA 3LFQA 3RK7A 3BYUA 5BVKA 4AGCA 4F6UA 5JGBA 5DT3A 2WOTA 1RJBA 3FAAA 3H9OA 1JKLA 3KXHA 3G0FA 5E8VA 3ZUTA 4HVHA 4BIDA 2ZMCA 3PE1A 5HORA 3G9NA 5HTIA 5ANJA 4FSRA 1V0OA 3OT8A 2BDWA 1A48A 2GHMA 3EZVA 2PZ5A 3ID6C 3E93A 4UMUA 4L6QA 3DJ5A 4C37A 4AXAA 1CMKE 2XYUA 4L46A 3TNQB 3RAKA 2YA9A 4YBJA 3V5WA 4BHNA 3GU5A 1IR3A 2W1GA 5IZFA 1GIHA 1FOTA 2OIQA 1B39A 3TUCA 4QP9A 4U42A 3PSCA 5AR3A 5CQUA 5FLFA 2XCHA 4B8MA 1CSNA 4LRMA 4ACHA 3OP5A 1Q3DA 2XK9A 4OTRA 2O0UA 2WEVA 4U0IA 5EYMA 4DEGA 2IEWA 5KHWA 2NYAA 3O5AA 1H0VA 3OCBA 1BX6A 4XCUA 3RGFA 2CDZA 1JQHA 3QC9A 3QRKA 4D2SA 5IH5A 2QONA 4KIKB 2JDTA 3FI8A 2G1TA 4MD9E 3W2PA 4I0TA 5BVOA 5JRSA 2OO8X 4AFJA 2B53A 2P33A 4HNFA 3UQCA 3POOA 3R63A 5HO6A 4HVIA 2WMAA 5L6WL 2BMCA 5HCXA 1FGIA 3CGFA 1W83A 5FEDA 2EU9A 3FLWA 1PMUA 5I9XA 4FNZA 2RFEA 3BYMA 3TKHA 4CMTA 4EH3A 5L2SA 4CNHA 3MFRA 4UY9A 4AXEA 3V3VA 1U54A 3UODA 4WG3A 3R1QA 1STCE 5CAVA 2BRNA 3Q9YA 4QQ5A 4ZTRA 3DY7A 3IQ7A 3OBJA 4O0TA 4WNOA 3PRIA 3W0NA 3D94A 3QQJA 5DRDA 1ZOHA 2JIUA 2X2LA 2WU7A 4XEYA 5AADA 2GNFA 3VS6A 5J9YA 3R04A 4CFFA 3OTUA 1WBWA 5CVFA 3TACA 5BVEA 4BFMA 5TF9A 3UO5A 2VU3A 3E62A 3ORMA 4QP8A 4BCNA 4J8MA 4IX5A 5C27A 3RNYA 4O7WA 3CBLA 3MH1A 5D10A 4AG8A 4RC2A 2XF0A 2VGOA 2ZDUA 2C6LA 4JBPA 2BRMA 4A06A 2PYWA 3S00A 2DUVA 4YJTA 4BDAA 2OICA 2YZLA 5GHVA 4PPAA 3EJ1A 3B8QA 3IW5A 2OXDA 4NUSA 4A9SA 2PMNX 5J1VA 1UNGA 3QCYA 4YTCA 2H8HA 4CQGA 4BTJA 3C51A 4OTPA 3DFAA 3F7ZA 1SVEA 3MSSA 4FVRA 1GZKA 1WBTA 3LM0A 5LCKA 4D5HA 5DT0A 5J9ZA 2HZ0A 1PY5A 2C5VA 4KKGA 2WTKC 3DTCA 4IMYA 4L43A 4UZDA 4G2FA 4QDEA 3MJ1A 5ANGA 2J90A 3F69A 2J5EA 4QP1A 2HWOA 3E8DA 3NCZA 1OL5A 3P23A 5DIAA 3DS6A 2Z60A 4A9TA 1V1KA 4MX9A 5AIRA 2W9FB 5TO8A 3S1HA 2QLQA 4A4XA 3CEKA 2AYPA 1F5QA 3M42A 2GNGA 1YDRE 3CKWA 1WMKA 4FV0A 1R3CA 3IW4A 3A62A 3O51A 3G90X 5EW9A 4DGNA 3F5PA 4A7CA 3L9PA 1ZOEA 5BYYA 3A8WA 2IZSA 3R7GA 3VN9A 4EQMA 1ZWSA 1H01A 2WGJA 5LMBA 5ETAA 5I9YA 2HK5A 4FT5A 4FTTA 3ODYX 4L45A 3DXPA 5M4IA 3MESA 3BYSA 4ASZA 5LVPA 3LM5A 4FTAA 5JQ8A 3K54A 4HGLA 2CGWA 4ZTMA 3OY1A 3H0ZA 4P4CA 4DEIA 3D5WA 3D5UA 2B55A 1YHVA 2XKCA 4I22A 3DJ7A 2RGPA 3E5AA 3GENA 5IQGA 3W8QA 3L8VA 2XKEA 4RGJA 4GUBA 2J51A 3Q52A 3TNHA 5HBJA 5AFVA 2YERA 4FTQA 2E2BA 4K8AA 4QMZA 1WCCA 4F78A 5A14A 2OZAB 3OUKA 4MXAA 3GT8A 4G3CA 4WKQA 3GFWA 5B2LA 4QDVA 2JDSA 5DFPA 2W1CA 1FVVA 2VO3A 3DKOA 3W0PA 2E9VA 4FG9A 1PW2A 4W9XA 2BCJA 3CKXA 4YTIA 4B8LA 3FLQA 3R7IA 4W4XA 2QOIA 2OGVA 4LOOA 4RIOA 4WIHA 4C38A 4RWIA