2IN6A

Wee1 kinase complex with inhibitor pd311839
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
279
structure length
256
Chain Sequence
MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Wee1-like protein kinase
publication title Synthesis and structure-activity relationships of N-6 substituted analogues of 9-hydroxy-4-phenylpyrrolo[3,4-c]carbazole-1,3(2H,6H)-diones as inhibitors of Wee1 and Chk1 checkpoint kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 256
sequence length 279
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2in6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2in6A01
4B0GA 2UW0A 4Y95A 3PZEA 2HIWA 2IWIA 3EFLA 4B9DA 4RJ8A 1K2PA 3IW7A 4I5MA 4O82A 2UZTA 4L6QA 3GT8A 5JGAA 5KE0A 3HGKA 5CSPA 3D5UA 3S1HA 1XH5A 4U40A 3V51A 3WIGA 3OP5A 2F7XE 3PIXA 4G34A 1BI7A 4CFFA 3VRYA 1OKZA 4UZDA 3HUBA 5F9EA 3D7ZA 4I5PA 4QMQA 4FSMA 3ACJA 5HO6A 5KHWA 2CGXA 4N0SA 4XS2A 3DAJA 4YMJA 4O91A 3HDNA 4D4VA 2F49A 4OW8A 3TNWA 1H8FA 3WF5A 2BIYA 4KWPA 3FMHA 3DOGA 3MJ1A 4F65A 4TYGA 3L8VA 3Q9WA 4P4CA 4RA4A 3Q32A 4MXZA 3PSBA 2E9PA 4D2VA 2WPAA 2XF0A 4HZSA 4ENYA 4Y5QA 5CEIA 3L9MA 5CU4A 3UG1A 4IANA 5DNRA 3DBCA 4EZ3A 4AXAA 5IA0A 3FZOA 3EN4A 4TTHB 5J9ZA 4W8EA 2YWPA 1CM8A 3Q4ZA 1Q8TA 3CIKA 3QTZA 1PMVA 3HKOA 3DB8A 2CPKE 4IDTA 2OZOA 2GMXA 3CPCA 1ZYJA 2WMQA 4NZWB 5C27A 4YSJA 1GOLA 4BBFA 5BVKA 5GINE 4G3CA 3C5UA 4I41A 4D9UA 2CGWA 3T9TA 2JBPA 2C47A 4IX5A 4FSQA 4L67A 2BALA 4TKSA 5B2KA 3E88A 2WMBA 5E1SA 2VTJA 5JGDA 3FEGA 1H0VA 5L6OA 3BYSA 1FMKA 2X7GA 4ACMA 4PP9A 3ZUUA 2Z7RA 3MBLA 4U97A 2DS1A 4GV1A 4WD5A 3T8OA 3WF8A 5IQAA 5CY3A 4XBUA 2IVVA 2W1CA 4DEEA 3RBWA 2QLQA 3OTVA 2Q0NA 4V05A 5FEQA 4NM5A 4ERWA 5TT7A 1OL2A 3EB0A 2KTYA 3DAEA 2OXXA 1YWVA 3NUNA 3QTQA 4RFMA 3TNQB 4ARKA 4EQUA 5DA3A 2BDJA 2WEIA 4E4MA 4PPAA 2BAQA 1TQPA 2WMTA 2R7BA 4IADA 4WUNA 5HKMA 3JY9A 1REKA 2BHEA 4F64A 3D15A 3G9LX 4FVPA 4DBNA 2JDOA 1U46A 5AEPA 3P0MA 1XH9A 5IPJA 1WMKA 4UMPA 2RG6A 3Q4TA 4BI1A 3D2IA 4PNIA 4ZMFA 5DE2A 3HRFA 4ZK5A 3R01A 2A19B 2VGPA 5T68A 3ETAA 4LGGA 2C6OA 3MW1A 2X2KA 3GGFA 4FV6A 3R9RA 3TG1A 4NT4A 4APPA 1W98A 2VTRA 3GCPA 4CQEA 3NNWA 4A9YA 1W83A 2VRXA 3BHVA 5CI6A 2I0HA 5AR8A 3H9RA 3SX9A 1WFCA 2UW6A 3RNYA 3HMOA 3PXFA 1XHAA 2C1AA 4FTAA 4X6RA 2YM6A 4JOAA 2PU8A 4EKKA 4E6AA 4U80A 1QPEA 2J50A 3R8VA 2J0LA 3RPRA 1RJBA 5EG3A 2UVYA 3QQKA 3U55A 2XA4A 4HGSA 3R8MA 5HU3A 3PRIA 2W96B 2RFDA 1H07A 5FD2A 4EH4A 1WBPA 3UPXA 4F70A 3TTIA 3FHIA 4I6QA 5HIBA 5I5ZA 4DCAA 2ITWA 4V04A 3L9LA 2B53A 3ZLSA 5BVOA 5HESA 4UB7A 3BI6A 4FTKA 2Y4IC 2YCRA 4WRSA 3T3VA 3PXZA 1BL7A 3NW5A 3KVXA 5I4NA 3BWFA 4E93A 4CSVA 3NYVA 2A27A 2JIVA 3AT2A 4KRCA 4D0XA 4DEBA 5JSMA 4RFZA 3AC4A 3BV2A 4DGOA 2FSTX 4KBAA 4XMOA 3A4OX 3W2OA 4O96A 4BWPA 4PDPA 3AMAA 3GQIA 5AR4A 2X9FA 5AUXA 2XNBA 3VUHA 2G2FA 4FGRA 5CEQA 1UU3A 1BMKA 3O7LB 5A4QA 2WQBA 3DY7A 4CG8A 4IM3A 5ITAA 4DYMA 5DIAA 5M4IA 2ZM4A 3SW4A 3WE8A 1PKDA 4EOJA 4RVLA 1Y91A 4E4NA 4JBPA 5J7BA 3ZZWA 2ESMA 2BFXA 2PVRA 4BWKA 3AGMA 2YCSA 3HDMA 4KIOA 4C3RA 3R22A 3BELA 4H05A 3WF9A 4D1ZA 4K9YA 1SMHA 3EZRA 3KK9A 4II5A 4MNEB 4Y73A 3PE1A 1DM2A 3KVWA 3OXTA 2NRYA 4F08A 3R7OA 4FTNA 4DH7A 3MH3A 4WNPA 3CGOA 4PV0A 4K18A 1ZY5A 2RF9A 5CU6A 3TNIA 4IZYA 3W8LA 4QRCA 3KN6A 2B9FA 3LZBA 3ZS5A 3COKA 2DUVA 5AJQA 5HICA 5D7AA 2JLDA 4PF4A 5HO8A 1B38A 2Y9QA 3BGZA 1R39A 2SRCA 4PDSA 4BTJA 4EBWA 4F6UA 2OJJA 5BVEA 3Q4UA 4TRLA 5EHYA 4U8ZA 3NGAA 2IN6A 3VS5A 4KA3A 3A7GA 3PRFA 4PQNA 5IEXA 2PPQA 1PRYA 1H1RA 4CFVA 4BCKA 3R2YA 2GHGA 4AT5A 4NIFB 4BDIA 2XK8A 1R3CA 4U9AA 4YUQA 3BWJA 4P5ZA 3AOXA 3LJ1A 3A99A 4KD1A 1MRYA 4XP0A 3QRTA 2YA9A 5HBJA 4I22A 5FP6A 2YIYA 5ANIA 4MXYA 3FPQA 1UNGA 3EZVA 4FTCA 4YJSA 3EMGA 5DMZA 3HA8A 5A6OA 1XBBA 2H96A 2WMWA 3PWYA 4UBAA 3D2KA 4LGHA 3PPJA 5CX9A 5EK7A 5D41A 3V01A 2Y6MA 2QURA 3FC1X 2AUHA 1V0BA 2A1AB 4NM7A 3AT4A 2JDVA 4UY9A 3WYXA 3NAXA 2VTQA 3ORPA 4O0UA 3VHEA 5T3QA 3FLSA 3QC4A 2J0JA 3WYYA 1JKTA 1GJOA 2VWVA 1GNGA 2QCSA 4AZEA 2B9JA 2WQOA 1PHKA 4BFMA 3TJDA 4BVUA 1IA9A 1Q41A 2ZJWA 1GIHA 3ZXZA 1Y8GA 3KXXA 5FLFA 5CEPA 3BRBA 2YEXA 2BZIB 3RJCA 3DK6A 4ZTLA 4FTRA 4HOKA 1TKIA 4IM2A 4RJ4A 4EC8A 3D5XA 5I3RA 2OH0E 3RMFA 1XH6A 2X7FA 3ANRA 4IQ6A 5C9CA 4IXPA 1YHVA 4E73A 2XCKA 4JG7A 5DPVA 3MVHA 5JZNA 3WI6A 4CV8A 1XQZA 3IK3A 3PFQA 5EYCA 3Q96A 3S95A 4J98A 1OL7A 4NK9A 3ZEPA 4QD6A 2XYNA 4LM5A 4I92A 2ZB0A 3KMWA 3RK9A 3BYUA 3PXYA 3OFMA 3PZHA 2ZVAA 2PVYA 3QD4A 5FDXA 3HP2A 1OGUA 4ZS4A 3ZTXA 2XK7A 3UIBA 1JAMA 3EQHA 5FM3A 3I7BA 4YZCA 4BDFA 4FICA 4TWNA 3JPVA 2J5EA 3AG9A 4HGLA 4KAOA 5ETAA 4AAAA 3POOA 2P0CA 5M4CA 4K1BA 2HAKA 5E92A 4O7TA 4RZVA 3D4QA 3AD6A 4L44A 2J51A 1E1VA 3QKLA 1IR3A 3HNGA 2OK1A 4FSUA 4S30A 4XP2A 4U81A 2IO6A 4FTTA 4PMSA 4YNOA 2AC5A 3C4ZA 3F5PA 3QCSA 3ZRMA 4I20A 3GU7A 4DCEA 4KUJA 4TYJA 3OCGA 4YTIA 2WNTA 1FVTA 3GI3A 2C3IB 1Q5KA 4CKRA 5D10A 3II5A 4XG3A 1SVGA 4D2SA 1H28A 5A4EA 4IB3A 1JSUA 1W7HA 5ETIA 4YTHA 3WF7A 3Q5IA 1VZOA 3UIMA 1UNHA 3DDQA 3BE9A 5LWNA 1WZYA 3NUYA 4QMTA 4YZNA 1KE6A 2ERKA 3V8WA 3CQUA 4TWCA 3JXWA 2ZMDA 5HD4A 2YDIA 2IZUA 5AP7A 4TXCA 3BYVA 3KKVA 2EUFB 2Z2WA 3PJ3A 1QPDA 3HMIA 3QRJA 4MH7A 3DTWA 2GNFA 3H10A 5CSVA 3MY0A 3NIZA 4U3YA 2UZWE 4HCTA 4W9WA 3E7VA 5DBXA 2QONA 2ITPA 2JKMA 2VTTA 1SVEA 3S00A 1JSTA 2JBOA 2PULA 4YJQA 3A7HA 3EJ1A 3LKMA 5C01A 3VBQA 5E1EA 4D28A 5BUJA 3LE6A 4HYSA 4RJ5A 4CEGA 4QMXA 4EZ5A 4ZLYA 2FYSA 3PA4A 5F95A 3EFJA 3F82A 4C57A 1E1XA 4EUTA 4ANNA 1IAHA 5FGKA 3CS9A 4A7CA 2GSFA 3IDPA 4AACA 1WBTA 2C3JA 2UW8A 5EOBA 4CFUA 4CCBA 4RIXB 3MPTA 4E20A 2UUEA 2BIKB 4QTAA 3VUTA 2YWVA 5LVPA 3FLNC 2WD1A 5FRIA 2XJ1A 5L8JA 3F3WA 2BTRA 2R3KA 3D5VA 4J96A 3G15A 5E9EA 4EEVA 4JDIA 2OFUA 3F5GA 4ZTRA 3WOWA 2W1GA 3TV7A 4E4XA 2ACXA 3V3VA 1FVVA 3NYOA 2XNPA 4FVRA 5C8NA 3MIYA 4W4VA 4OT5A 5IQGA 3BIZA 1W0XC 4EK3A 4PMMA 3FKLA 2YLFA 3E64A 3CCNA 4R8QA 4C3FA 2O0UA 3MJ2A 4QOXA 2ONLA 1G3NA 2X6DA 4I5CA 4ZJVA 5CF4A 5HQ0A 2XVDA 3VW8A 4FV2A 5A9UA 4X3JA 2C3LA 4DE4A 2CCIA 1OPKA 2VTNA 2YDKA 4FSYA 2IW8A 5CF5A 1NVSA 2PZYA 5IEYA 4FL2A 3CBLA 2HZ4A 3IPHA 3MSSA 4M0ZA 2QR7A 4NCTA 4QPSA 4X2JA 1EH4A 5AA9A 2OG8A 2ZM3A 4AT4A 4BCFA 2OWBA 2W5BA 3OBJA 4FX3A 3UVPA 2GPHA 3OY3A 5CU0A 3OUNB 1OPJA 2W9FB 5AM6A 1FGKA 5CXZA 2UZBA 3PXQA 2OSCA 4IAKA 4JXFA 3ZFYA 1APME 3HVCA 4IB5A 2V0DA 2VZ6A 4YTFA 4U45A 1SVHA 2YITA 4GFOA 3HV5A 4C58A 3RVGA 4Z7HA 3A4PA 3R63A 3QUPA 2OFVA 2XJ2A 4KRDA 3DZOA 4PPBA 5F4NA 1NVRA 2C30A 2JFMA 4TYHB 2GS6A 1SNUA 4QYHA 4YP8A 3RALA 4AG8A 1ZMWA 2UZNA 2WTCA 3DFCB 5HE1A 2X8EA 2XKEA 4IMYA 5B2LA 2QO2A 4U7ZA 3MH2A 4MF1A 3DBDA 1Q3WA 4QQ5A 4HGTA 4JRNA 4BIEA 1QCFA 3H4JA 2Y4IB 3KQ7A 3WZKA 4BF2A 4DH3A 1ZLTA 2PMLX 3LFNA 4I94A 3U9NA 4E6QA 3LCDA 2Z7SA 3FMDA 5D12A 5AMNA 1YRPA 3ALNA 3QRUA 4MXCA 5B7VA 5HU9A 5BVFA 3PLAE 4H58A 2ITTA 1RE8A 2HENA 4CQGA 3LJ2A 3D83A 4RPVA 2VO7A 2VTSA 3ZCLA 5IA2A 2JDSA 2WMUA 4MD7E 4UYAA 3QLGA 4JLCA 5CZIA 4CG9A 3F66A 3R04A 5JFWA 2R64A 2VWIA 5IA1A 2W5AA 5IZFA 2CGVA 5EHOA 1JNKA 1OECA 3FKOA 4GJ3A 4RX7A 3R71A 4AZVA 4B4LA 4EL9A 4M69A 1YXTA 4B8MA 2YCQA 3QBNA 5GZ8A 1F3MC 4FMQA 1MP8A 2FUMA 3GNIB 4XV1A 3EH9A 2IW9A 3ZBFA 4YZDA 4I23A 5DVRA 3TIYA 1YVJA 3F5XA 1G8AA 2QO7A 4XV3A 1FVRA 3CTHA 3ZFXA 4J99A 5E8UA 4USFA 2XKFA 3FXXA 4XLVA 4Y8DA 3G6GA 3VO3A 3DS6A 5IQCA 1MQBA 2E9UA 3JYAA 4K2RA 4CXAA 4CKJA 4YLLA 3I81A 5HE0A 3JS2A 4JT3A 4ASXA 1J3HA 2H6DA 1OIQA 1UU8A 2EWAA 1XJDA 3UO6A 3ANQA 4C36A 2QKRA 4E6CA 5A4TA 1BKXA 1PKGA 3EQPA 3FL5A 4FKJA 4G3FA 1ZYCA 5GZ9A 3VRZA 3RP9A 4C59A 3UC4A 4BR3A 4CKIA 4GMYA 3CC6A 3ACKA 1H1WA 1YXSA 3VUIA 5M44A 5AR2A 1T46A 4D9TA 3UMXA 3REPA 2W5HA 2CLQA 4LYNA 3O23A 3DKCA 2GFSA 4USDA 2FSOX 5IDNA 2XK4A 2GNGA 3W8QA 5DRBA 4MHAA 3RZFA 5JMSA 4UWYA 2OICA 4FKGA 3ZSHA 2ITOA 2OIBA 4KABA 3LAUA 4U5JA 2QG5A 2EXEA 3UNZA 2R3OA 4PWNA 2BMCA 2ZAZA 5LCJA 4EH6A 4L52A 5I9WA 2ZDUA 2EB3A 5EQYA 4TL0A 4GKHA 3N4UA 5CNNA 1U59A 3NYNA 4N70A 4A4XA 4ZY4A 3ZH8A 2R3NA 3KXZA 2C0IA 3Q2JA 2EB2A 4FZ7A 4DF3A 4UWBA 4JBVA 2R5TA 5H8EA 5AP0A 4UWCA 1YQJA 2WGJA 2GHLA 3ZM4A 2Z02A 4HGEA 5CU3A 5TOZA 4ACCA 4FVQA 2OJ9A 3VS2A 3RWQA 3DB6A 3OUKA 3UQGA 3HRCA 1Q99A 3CR0A 5HD7A 4FEXA 4UN0C 1URWA 4L7FA 2CLXA 3EN9A 1BUHA 4ALUA 4JAIA 3JR1A 4EK5A 4O0RA 4OTHA 3ENHA 3G9NA 2R9SA 2RIOA 5AP1A 2Z7LA 4F1OA 4ZZNA 4X2NA 2PVFA 4YJNA 3LQ8A 1REJA 4FSNA 3COMA 3U9CA 2R3LA 2YERA 3ET7A 4NKAA 4QP9A 2E9VA 2PZPA 1IASA 3ZDIA 2VO6A 1WCCA 4JJRA 3GBZA 4EK4A 2VGOA 2R2PA 4JI9A 3UYTA 3TUBA 4DG3E 3MH1A 5AP2A 3PJ1A 4FV8A 2WTIA 2G9XA 3TV6A 4AU8A 4BZDA 3DNEA 4GK3A 5HG5A 4FZAB 4Z7GA 3KULB 4PTGA 3ZO4A 1KE5A 1PJKA 3UMWA 4C4EA 2XIKA 3O17A 5D9HA 4D5KA 4E3CA 5EW3A 4Z3VA 3R0TA 5BYYA 5LJJA 1M52A 2OZAB 4NWMA 3TZ9A 4PNKA 4R3PA 2PVLA 1I09A 2ZOQA 4YO6A 1TQMA 3R7EA 3U6JA 4FTOA 3LLAA 5LMKA 5L2TA 5DLSA 2A2AA 4I0SA 3WBLA 4DTAA 1B6CB 1FQ1B 4XRJA 4O7NA 4N6YA 4L3PA 3H30A 3NYXA 5LVMA 2ZB1A 4H1MA 5CVFA 5I9YA 3KL8A 3UGCA 4DLIA 2XNNA 1UKHA 1R0EA 5A6NA 1MRUA 3NUAA 3QTSA 4BB4A 4LOPA 3LCKA 5HZNA 4GS6A 4FNXA 5AUUA 1QMZA 3MIAA 3VF9A 4O0VA 4I6FA 3T3UA 3C0IA 4QTBA 5L8LA 2OBJA 3LMGA 3OWJA 3K2LA 3SQQA 4C4IA 3E92A 1PY5A 3BE2A 5HCXA 5IISA 4N6ZA 4QMMA 3UDBA 3HMMA 2O8YA 2UW9A 3W2RA 5FEEA 4FYOA 4O7WA 4DBXA 4G9CA 4FTUA 4NKSA 4NH1A 3G2FA 4XG9A 3C1XA 2XNGA 4RJ3A 1CTPE 5I9VA 3HECA 4BDKA 5GJDA 5LMBA 3IGGA 3EWHA 3M11A 3Q04A 2WHBA 3BHTA 3C4WA 5HG7A 2UVZA 5E4HA 4YC3A 3V5PA 2Q0BA 3NCZA 4CFWA 2BRMA 5DT4A 1KE9A 3MN3A 4ZLZA 1O6KA 3R6XA 4MXAA 3F2RA 4O1PA 2CN8A 3OXZA 2CKEA 3AT3A 2C6KA 2RFSA 4H36A 2WAJA 5KZ0A 2J0KA 3Q6WA 5E91A 4BDCA 4CLIA 4LGDA 4DH1A 3EQFA 3FMEA 5IH4A 4LQMA 5J1VA 4IM0A 3KU2A 2XK9A 4FIFA 4EH7A 4O7VA 5ANEA 4FKTA 3SVVA 1DAWA 4KIKB 3MY1A 1PMNA 4ACHA 4MCVA 4GYIA 5K5NA 4JS8A 5FM2A 3VS7A 2PWLA 3BHHA 2WXVA 1YWNA 2JD5A 4UMTA 2PMNX 3QA8A 3LXKA 4OUCA 5LVLA 4GU9A 4DFYA 2OJGA 1PYXA 2GHMA 5AA8A 5H8BA 5KMLA 2P2IA 3PVWA 3ERKA 5E8WA 4C62A 2QHMA 4JG6A 3O50A 3CJGA 3OD6X 4X7QA 4IBMA 4U44A 5BVWA 2JKOA 3QUDA 3E93A 2CNVA 5ACKA 3BBWA 1CSNA 3R7IA 2UZVA 4RIWA 1NVQA 5ETFA 5M06A 3PJCA 4C02A 1Y8YA 2VX0A 3VC4A 3F2AA 4GFMA 1YDRE 4GT3A 4FKOA 1HCLA 3F3UA 4CMTA 4M67A 1BI8A 3T9IA 1JLUE 5DFPA 1NY3A 3LW0A 5KZIA 3KRXA 3TTJA 3O96A 4IX3A 3UOLA 3TZMA 4FL3A 3OC1A 3MVJA 5HTBA 2G1TA 3QAME 4FKPA 3MB7A 3VBVA 3N4VA 4DEIA 2PVNA 5JEBA 3E87A 4FV9A 4OTFA 3C4CA 3MPMA 3BEGA 4IE9A 3WZUA 5L2SA 5AUYA 2R3HA 3VW6A 3SG8A 2XUUA 1P2AA 3OOMA 2E9OA 2FVDA 3I79A 4RIYB 3TACA 4BIBA 2CSNA 3EFWA 2E2BA 3W1FA 3ORIA 3AC3A 3F2NA 3W10A 4AS0A 3R9NA 3BGQA 2XB7A 3VVHA 4D58A 5IQIA 3RCDA 2YIXA 4CYIA 2Z8CA 1Y57A 2R3IA 4YTCA 1NA7A 4ANLA 1WBVA 3F61A 4ZTSA 3DQWA 4RLKA 3W2PA 4FE2A 1VEBA 4YPDA 3ROYA 4WBBB 1U4DA 3OCSA 1JVPP 5AR3A 4UMQA 2XK3A 4NTSA 5HOAA 3FXZA 5HNIX 1MQ4A 4GG5A 5CF6A 4I5HA 3O7LD 4O0SA 3FLZA 2HELA 4V01A 4G6LA 4OR5A 4OAVB 4QTCA 3P5KA 4BGHA 1IG1A 2CKOA 2CGUA 3GP0A 3OMVA 4GT4A 5FTOA 4O7ZA 4R5YA 3P86A 5JQ8A 2QVSE 3E62A 3FPMA 5JZJA 4L7SA 3ALOA 2J6MA 2DYLA 2Z60A 3MYGA 3VS6A 5EW8A 3WE4A 4CTCA 5J1WA 3C5IA 3I0QA 4GFGA 3E7OA 3HEGA 2F9GA 3L1SA 3KRLA 3I4BA 2XKCA 4O21A 5LARA 4EH8A 3MA6A 3TKHA 3DLSA 5E8VA 5IQFA 1GZKA 1W84A 5IG1A 2VWZA 4QP2A 4KKHA 5L6WL 1OUKA 4PTEA 1T45A 4V0GA 4F4PA 3FMKA 3KC3A 2QOLA 4LV8A 3Q9ZA 3VF8A 4DGLC 4EKLA 3LPBA 1Q8ZA 2OI4X 2QOHA 2ZV9A 5C26A 4UXLA 4M0YA 3RPOA 5JGBA 5ANOA 3NX8A 3UO4A 4EOMA 4JDKA 2IVUA 5IQEA 1U54B 2J0IA 2VTOA 4F9WA 4BCGA 5HTCA 3FE3A 4RWIA 2NNWB 3RHKA 4FIEA 4ZSJA 4CZTA 2GQSA 4HNIA 2UZUE 5M55A 3SHEA 3VNTA 3ZSGA 2VV9A 3Q53A 2VO0A 2WTVA 3CTJA 3VAPA 2B9HA 2WTJA 3NNVA 2QLUA 3IDCA 4YNEA 4MQ2A 3FWQA 4FV1A 3QGYA 4J71A 5IA4A 2PY3A 2PUUA 4XBRA 4D5HA 2W9ZB 5EM8A 5HLWA 5FBOA 5CZHA 2ITZA 4O7YA 3Q2MA 2R3QA 1ZYLA 3FY0A 3OEZA 3R00A 4IB0A 4CRLA 4DN5A 4F9AA 5EM6A 4GKIA 3UC3A 1K9AA 3BPRA 2V7OA 5FQDC 3K3JA 5CVHA 4WG3A 4DC2A 2W7XA 5AUZA 4QYYA 3DCVA 4K8AA 3R9DA 5HHWA 2IW6A 4EC9A 3UZPA 4R77A 2ZV2A 5DRDA 2PMOX 2PK9A 2YM7A 3LFEA 4EJ7A 3TDWA 4ANSA 1LP4A 5BNJA 2R4BA 3EYHA 3GVUA 3NVKI 2GS2A 3UE4A 2IVSA 4GU6A 3AMYA 3DKGA 4MK0A 3ZUTA 3LMIA 4JR7A 4QP3A 4KNBA 5EKOA 4FIIA 3KF4A 3PSDA 5HEZA 4FUYA 4H3QA 3BU3A 3P4KA 3B2TA 5DYJA 5G6VA 2W1IA 4RWKA 3FZ1A 1YXUA 4BICA 2VNWA 2HWOA 3KA0A 1Q61A 3MY5A 3B8RA 4FT7A 1PXOA 2XRUA 3A7FA 4RVKA 4CZYB 4KSPA 2HXLA 4I93A 4AP7A 2XIYA 4G3GA 4A4OA 3A7JA 5HG9A 3QL8A 4QMWA 4C4GA 3IS5A 3EN6A 3QZGA 3FY2A 4C7TA 4FKRA 4F0IA 4IAYA 3KEXA 3CD3A 1L3RE 2XKDA 4DFLA 3QCQA 4APCA 1IA8A 5EI2A 3EL7A 4R78A 1J1BA 5I9UA 4ACGA 4F7NA 1IAJA 3RINA 3H9FA 3IW4A 4FZDB 1FPUA 2QG7A 3GB2A 1UKIA 1W82A 3CSVA 3UO5A 3GUBA 4OTDA 5DI1A 2PHKA 4W4XA 4U79A 4M3QA 4F63A 3EIDA 3LLTA 4DFUA 3G0EA 4O86A 3EQGA 3QZIA 5L3AA 3AD4A 3ZO3A 3G90X 4QP6A 4WSYA 1OIRA 2ITUA 5E8ZA 4ITIA 4UYNA 2G2HA 4TT7A 5EH0A 3HL7A 2X4ZA 4I24A 3LIJA 3OWLA 4PDOA 4CCUA 4ID7A 3DU8A 3LQ5A 3R2BA 4QNYA 5CEOA 4F1TA 2X2MA 4H3PA 5AUVA 2C5VA 3DGKA 4CZUA 3UQFA 3I7CA 5HVYA 4TW9A 2QC6A 3W2CA 2QU6A 3D94A 2BCJA 2HWPA 2JGZA 5A46A 1J7LA 2XH5A 2CNQA 3R73A 3QD0A 3QRKA 3VS4A 4JL9A 1YI3A 4DG2E 2GQRA 5CYIA 2LAVA 4CT1A 3M42A 3G5DA 2PMIA 4ITJA 1UV5A 3IONA 3R28A 2QD9A 3OCTA 4N4SA 2PZRA 3C50A 5CANA 3FQHA 4AT3A 1ZY4A 3DXPA 1R0PA 1W8CA 4PY1A 4C0TA 4KS7A 2RKUA 3MFRA 3ZONA 2YM3A 2O2UA 3UPZA 1FOTA 3O8TA 2YJSA 4RA5A 3OS3A 4EH2A 3UP7A 3KRJA 4HVGA 4J95A 3CXWA 5HX8A 1OL6A 2BILB 5IEVA 1PXNA 2RFNA 4UMRA 4QPMA 4IWOA 3FV8A 3PP1A 2CMWA 4YJTA 2ETRA 3V5QA 1WVWA 4FTQA 2H9VA 1XKKA 1OBDA 4WO5A 4ZEGA 2X6EA 4WRGA 2OO8X 3V5TA 4MX9A 3W2SA 4E5BA 3QYZA 3GCQA 3R1YA 2XBJA 3LFBA 2A4LA 5IA3A 4BDGA 3E63A 4LL0A 4M14A 3QQHA 4P2KA 4TY1A 5ANDA 2HY81 5LCKA 3FBVA 3SOCA 5KBRA 2QOFA 3KXHA 4FTMA 3RAKA 5C4KA 5IQHA 5K4IA 2X8IA 2J2IB 4AN3A 3ULIA 1UA2A 3LJ0A 4I4EA 1JSVA 3DJ6A 2JIIA 4OAUC 4RC3A 3K3IA 5GIPE 3F88A 4FK6A 4FV5A 5KBQA 3DK3A 2WMXA 3V5JA 5K9IA 1L8TA 2FSLX 3CY2A 3KXNA 4RVTA 3QQFA 4FODA 4DTKA 1OI9A 4JNWA 4W9XA 4XUFA 4F9BA 3HMNA 1CKIA 1XO2B 1J7IA 3GC7A 3LFCA 1OM1A 3ZO2A 1KOBA 1XH4A 2HXQA 5C8MA 4AZWA 4R5SA 4ZLOA 4WHZA 5CS6A 3OCBA 2W4OA 2VTAA 4QNAA 2GS7A 1WBWA 1P4OA 3BLRA 3IQ7A 1RW8A 1Z5MA 4C4JA 4G2FA 3AC5A 4ENXA 4MQ1A 5I9ZA 3QKKA 4GUBA 2UZEA 4BCJA 3HAVA 3C0GA 3HV6A 4ACDA 2XNMA 4WNMA 3VUMA 4AOIA 5BVNA 1UVRA 3SW7A 5G1XA 2CNUA 4Y83A 4UEUA 3RKBA 4HW7A 3DJ7A 1UWJA 3BLQA 1PXLA 4WG5A 5M4FA 1SYKA 5HGIA 3ORMA 4AQCA 2QQ7A 3TI1A 2UW5A 1YI4A 4IAFA 4MXOA 4E7WA 2WU7A 3AC2A 4Q5HA 2I0YA 3BHYA 4AA5A 2LGCA 3L9PA 4MNFA 3VBTA 5FTGA 3OF0A 1M14A 3SV0A 3L8SA 3G33A 3ORKA 4OTQA 1Q4LA 4WT6A 3PJ8A 1A9UA 5HG8A 2P33A 3R8UA 3TDVA 3FC2A 3GC0A 3SRVB 3FMNA 4P7EA 4FUXA 5HE3A 3ELJA 5FBNC 4ZTNA 3NWWA 4QMNA 1NXKA 4ASEA 2GNHA 2EXCX 5FWKK 4AWIA 4BN1A 5C4LA 3PPKA 1GY3A 2HW6A 4FV4A 3JUHA 1PMUA 3IDBA 1KWPA 1QPJA 1H00A 2ZYBA 3EN7A 3Q5ZA 5E90A 3QFVA 3R7VA 3I6WA 4IH8A 5ETCA 3G0FA 1YOJA 2GNIA 2KULA 4FT3A 3DBQA 3SOAA 4EOOA 4G3DA 4TNBA 3ZEWA 2WO6A 3MA3A 1O6LA 1OL1A 4KSQA 3EQDA 2IZSA 2B52A 2O65A 3V6RA 3ZU7A 4CNHA 3ZLWA 4FEWA 3IKAA 3DZQA 1Q8UA 4FIGA 4ZY5A 3GEQA 4CYJA 2BKKA 3SD0A 4R7IA 4X3FA 5C8KA 2QO9A 4J7BA 2VAGA 1YOLA 3Q9XA 3MTFA 4FR4A 3U4UA 3A7IA 3V8TA 3O8UA 4L68A 4YC8A 3NR9A 3WARA 3ZOSA 3R8ZA 2V55A 2WU6A 3MS9A 3E8EA 4IHPA 5EM5A 5F20A 2OLCA 4AW0A 4EI4A 2QODA 3M2WA 2XM9A 5E8YA 2OF4A 2F57A 4RQKA 3RNIA 4AOTA 3E8CA 3F7WA 3MB6A 4KBKA 2WFYA 3FQSA 3H0YA 4HVHA 5B2MA 5I9XA 2XJ0A 4MNEA 3DXQA 3O2MA 3QD3A 4IZ7A 4PMTA 1LR4A 4C35A 3KB7A 4FIHA 2WKMA 4MXXA 5L2WA 4I4FA 3G6HA 4NFNA 1NW1A 5CAQA 4GT5A 4HVDA 5JK3A 5IF1A 3BKBA 3GFWA 3NZ0A 3LHJA 1ZOHA 1KE7A 3RAHA 4NTTA 4E1ZA 4ZTQA 2Y7JA 4MBJA 3GCSA 3UJGA 3F3TA 3TV4A 1KSWA 3NUSA 5IKWA 2Q83A 3FSKA 3BGPA 4O0YA 4D55A 2WELA 4NUSA 1GAGA 4I0RA 3RI1A 1PXKA 1J91A 2OGVA 4AE6A 5TKDA 3FL4A 3DKOA 3UTOA 1VYZA 2HZ0A 4DFBA 2EVAA 2QOIA 3VUKA 2VN9A 2G15A 2ITXA 4CLJA 5BYZA 3DLZA 4LRMA 3AC8A 5I0BA 2ZV8A 3R1SA 4IACA 4O0XA 3LQ3A 2WMSA 3TT0A 5AUTA 5IU2A 2WZJA 4MF0A 5H2UA 4YR8A 1Q62A 3A8XA 4YZBA 5HI2A 2BDFA 3PA3A 3LFDA 4FGBA 4KKGA 2C4GA 3TIZA 2NPQA 3OROA 1GZ8A 3QHRA 3HV7A 2VD5A 5A54A 4MD8E 3TEIA 3Q6UA 3GENA 4R7HA 4X2FA 5CQWA 4DEGA 1MRVA 4EWHA 5J7HA 5AV1A 1ZARA 4IZAA 4UXQA 3HLLA 3EOCA 4I0TA 4J97A 5CVGA 5CTPA 3ZYAA 4EZ7A 2FB8A 5GZAA 1KE8A 2JKKA 5CNOA 4RJ6A 4L45A 2YHVA 5FDPA 4GL9A 1Z9XA 3RPVA 4JRVA 2GFCA 1DI9A 3ZDUA 2IG7A 1OIUA 1M2PA 4DA5A 3BX5A 3BYOA 4O27B 4BKJA 2W1HA 4USEA 2PVKA 3RAIA 3FMLA 2QOKA 1JWHA 2X39A 3KF7A 5DGZA 4ALWA 4FSRA 1QPCA 5AP6A 5T6KA 5JKGA 3EHAA 5DT3A 2OU7A 4BCMA 2P3GX 5AAFA 2J0MB 3ZFMA 3QTIA 2C5XA 1LEZA 4IWPA 1H1PA 4XV9A 3VJOA 3OT3A 2OJIA 3COIA 5A4LA 4DT8A 3QQJA 2CCHA 4JVGA 1R78A 2C6LA 4IFCA 3KRRA 1RDQE 5ACBC 3W55A 4AOJA 4U3ZA 4YZMA 3PIYA 4D4YA 4AGWA 4KKEA 2HOGA 1M2QA 2YM5A 3BQCA 2ONLC 2WOUA 3KFAA 3PYYA 4NW5A 3CEKA 4J8NA 3C4EA 4YJUA 3ZC6A 4EOIA 4D1XA 2Z7QA 4Q2AA 4BCPA 3OBGA 4RWJA 1IEPA 4F9CA 1XH7A 3PLSA 3FQEA 4G5PA 4ZXTA 3PPZA 4D4RA 4NL0A 3AXWA 2P2HA 5HX6A 3U4WA 3MH0A 2XZSA 4NCTC 5GIOE 3D14A 3NCGA 4LUEA 4X2KA 4HJOA 2VX3A 4HNFA 4BC6A 2PVMA 3R9OA 1CKPA 2B0QA 4C3PA 4S33A 3TZ7A 3KMMA 5JN2A 2QR8A 3L8PA 2VTHA 4QMOA 4M7IA 4S2ZA 4BDHA 5LVNA 1JBPE 2VWXA 4JX3A 4L53A 2PUIA 4Y46A 5LMAA 4G17A 5BYLA 2YABA 4QMYA 4YLKA 2WB8A 3LCTA 3CD8A 3OHTA 3TKIA 1H1SA 1PXJA 3B8QA 4BZOA 4LI5A 2XBAA 1OMWA 2IVTA 5CSHA 1ZYDA 4O0TA 3GOKA 3VS1A 3CLYA 3QX2A 3R30A 3A60A 4GRBA 3QXOA 5DOSA 4MD9E 3F6XA 3ZC5A 3QUEA 2ETMA 2ITVA 2ZM1A 3EKNA 4YBJA 4PP7A 3UOKA 3MTLA 4IB1A 1STCE 4G5JA 4CRSA 1M2RA 2R3PA 3G51A 5FXQA 3VQHA 4A9UA 5JQ5A 2C6IA 4ASDA 4UX9A 2RSVA 2EU9A 4QMLA 2C6TA 5DR2A 3LFFA 3RGFA 4C38A 4MBLA 4BDBA 3D9VA 3FYKX 5TE0A 3DNDA 5IH5A 2RL5A 5GJGA 3ZBXA 2REIA 4QTDA 5L6PA 2C68A 4EYJA 3DAKA 2YACA 4EBVA 3LOKA 3TL8A 5CT7A 4BZNA 5AP4A 3KRWA 2BAKA 2XEYA 5JFVA 4IX4A 4JBQA 5KKRC 3VQUA 5AIRA 5JRQA 5DR9A 1FMOE 3MVMA 4LUDA 3E3BX 3VWAA 4ZZMA 2BRHA 3DBEA 4RWLA 2R3JA 4RQVA 4AN2A 5CT0A 2XIXA 2GTMA 2R0IA 5FXRA 4RIXA 4FOCA 4NM0A 4FTIA 4YJRA 4QTEA 2RG5A 3OW4A 3HV3A 3QWKA 2UVXA 4A06A 4AZSA 3E5AA 3ZRKA 1V1KA 2ITNA 4L8MA 3LFQA 4ALVA 2X8DA 1ZZ2A 1JPAA 3F69A 4I6HA 3ODYX 4QP1A 3ZLYA 4PMPA 3R7GA 4XEYA 3ULZA 1MUOA 4OBPA 3NUUA 1E9HA 4D2WA 3IOKA 4QYFA 2YIWA 3OWKA 4L00A 3RZBA 1IRKA 3I5NA 2F2CB 3PVGA 5CAUA 4DTBA 5AV3A 3P7BA 4X2GA 2C6DA 4DITA 4O1OA 4KS8A 3AMBA 1U5QA 1PF8A 3FI8A 2J7TA 2PE2A 3GQLA 4ORKA 2BRBA 3U6IA 4OLIA 3R21A 5FXSA 5E8TA 4MWHA 3LVPA 3PIZA 4O2ZA 3TZ8A 3ZUVA 5AR5A 2PZIA 4I1ZA 4KINA 4O6LA 4EYMA 3PG1A 4RIOA 1Q97A 5AUWA 4K0YA 2JDRA 2FO0A 4ANMA 5DEYA 3GU6A 4QO9A 3P08A 4RVMA 4HCUA 4ZSLA 3DK7A 2QOBA 2VWYA 5DN3A 5AX3A 2ITYA 3VJNA 1DI8A 3E3PA 3SA0A 3RM6A 4DH5A 1CMKE 4O7LA 4O22A 3BYMA 1M7QA 3OEFX 4H39A 4IDVA 1Z57A 4LMUA 3ZZEA 4BDAA 4IX6A 1I44A 4IC8A 4A4LA 4G16A 2QI8A 3FZPA 3KK8A 5D1JA 4D2TA 5CLPA 2GNLA 5M56A 1GIJA 3GC9A 3S3IA 1ZZLA 2X81A 1H26A 3KGAA 5M57A 3ZM9A 5EQPA 5HNGA 2ITQA 4RGJA 4WUAA 4FSWA 3FLYA 4TYHA 4Z16A 3UNKA 2I7QA 4XG2A 4BKZA 2HZIA 1G8SA 2C69A 4DG0E 2QNJA 2UW3A 2YAAA 2VWUA 3ORTA 3PP0A 1H1QA 1WAKA 5CAPA 4EHEA 3GU4A 4JAJA 5CENA 4YO4A 2CJMA 4FG8A 2P4IA 3NRMA 1A06A 4E5WA 3R02A 2WTKC 4PDYA 4QT1A 3BLHA 4BTMA 4QYGA 2G01A 3R8LA 3DBFA 3RAWA 2BRNA 2XRWA 4XYFA 3SDJA 2YCFA 1U5RA 5EI8A 4EK8A 3NLBA 1YDTE 3CKWA 4MVFA 3DV3A 4NEUA 4DFZE 2BHHA 2BZHB 2R3FA 3I6UA 3MFSA 3PY3A 4I6BA 1VJYA 3BU5A 3D5WA 2UV2A 3TJCA 4A9TA 2BTSA 5KO1A 3QD2B 3MFTA 2ERZE 5EFQA 2RGPA 4IAZA 3UIUA 4EH5A 2X0GA 5M08A 1OBGA 5J95A 5HORA 1ZAOA 2JKQA 3CQEA 4IEBA 4BRXA 4AE9A 3Q60A 4GYGA 1YHSA 4MYGA 4F09A 4RC4A 1ZRZA 3V6SA 3OTUA 3GCUA 3RHXA 1V0OA 2B1PA 2WTWA 4YJOA 4ZTMA 5DT0A 2W4KA 3TNHA 5CF8A 4BYIA 4NYEA 5FEDA 2V7AA 4XJ0A 4E26A 3EFKA 3N9XA 3VULA 4MAOA 1YKRA 4BDDA 3QZHA 2YISA 4TWOA 4EUUA 2GU8A 4ZY6A 4LL5A 2A0CX 4E5AX 2OF2A 5JFSA 3EQRA 4RRVA 3EKKA 1OZ1A 5LMKC 3DJ5A 2W05A 4C33A 4NM3A 4DT9A 3ROCA 3CE3A 3EL8A 4AW2A 5J87A 1Q8WA 4TPTA 2OJFE 4FT9A 4BTFA 2PSQA 2WQEA 3HX4A 2YN8A 4ANBA 2V22A 4HYIA 3QWJA 3IG7A 4S32A 3VBWA 4NU1A 3QA0A 2FH9A 3CPBA 4WNOA 1HOWA 4NW6A 5EW9A 5F1ZA 4AW5A 4BDJA 4Z55A 3EN5A 1H24A 1YHWA 5AM7A 4W4WA 4ZZOA 3FMJA 3QQGA 5L2QA 4GG7A 4CV9A 4U42A 1ZMVA 4BIDA 3IO7A 3TUCA 3BCEA 4FNZA 4JG8A 1SNXA 1BLXA 5I3OA 4IAAA 4FG9A 4G9RA 4AUAA 1OVEA 5CSXA 4IW0A 2ZMCA 2JAVA 1ZOEA 2J9MA 4X6QC 5DH3A 4BBEA 3NW6A 1V0PA 4EJNA 2F2UA 4XNEA 4C4HA 4U41A 4JQEA 5K4JA 5CAOA 4BY9E 2VWWA 4GK4A 1KOAA 2WIHA 5FG8A 3D7TA 2JFLA 3QLFA 3RM7A 2XEZA 1Q24A 4XP3A 2GTNA 3DXNA 3HP5A 2YLEA 3HV4A 3OVVA 1X8BA 4OTWA 1LEWA 3F3ZA 3DA6A 2H34A 4FBXA 1JKLA 2WMAA 1UWHA 4RSSA 2VO3A 3K5UA 1GIIA 3PSCA 4FKIA 4DHFA 3H0ZA 4YHFA 1PYEA 3LM5A 5K0XA 4AA0A 4MTAA 5FUTA 3MFUA 4MKCA 3PDTA 3NMUF 4FOBA 1UU9A 4L3JA 1URCA 1ZYSA 2IZRA 2FGIA 4WOVA 5J8IA 3W33A 2CHLA 4JR3A 3RTPA 2O64A 4NSTA 4OBQA 3FKNA 1B39A 4GIIA 4QQCA 4TNDA 2XMYA 4O7RA 2I40A 2PL0A 4HPTE 3VS0A 1FBNA 4GUEA 2X9EA 2VTIA 3L8XA 3QGWA 3THBA 2AYPA 5J5SA 4AGCA 2OIQA 4GH2A 4UALA 3V04A 3TN8A 3POZA 4BCQA 3WF6A 1S9JA 4H1JA 5ANGA 5KNJA 3WZDA 4BGGA 2YAKA 3ZXTA 4W8DA 1F0QA 4L01A 3KULA 4JIKA 3HUCA 4X3FB 4AGUA 4C61A 4KIPA 4L46A 5BMMA 3QYWA 5HIDA 2OZAA 2UW7A 5A3XA 3EQCA 2B4SB 2BPMA 3P79A 4RJ7A 4GIHA 4IVBA 4L42A 3FYJX 4QPAA 3ID6C 1BYGA 3PXRA 4RBLA 4D4SA 5KHXA 3NEWA 3P7AA 5FP5A 3ZMMA 3H3CA 3KMUA 1F5QA 2BFYA 3QU0A 2PTKA 3FAAA 4P5QA 5HVJA 1XWSA 2Y8OA 3V8SA 4FNWA 3TKUA 5IDPA 2XK6A 4GK2A 1BL6A 1CDKA 5CAVA 2VU3A 4FK3A 4DEDA 4AN9A 4IVDA 3ZRLA 2Y4PA 1WBSA 3PXKA 4JBOA 5JT2A 2AC3A 5A4CA 2BVAA 3ZHPC 2PUPA 4O6EA 2YM4A 2YM8A 4YHJA 5KMMA 4IWQA 4R1VA 3FZRA 3TWJA 2XIRA 2YZLA 4FSTA 3R9HA 4BCHA 2G2IA 4X0MA 4ZP5A 4CMUA 3P9JA 4O0WA 3W16A 4AW1A 4UZHA 5EQEA 4G6OA 3OXIA 4QQJA 3AC1A 4QMZA 4XG6A 4XV2A 5LOHA 5JH6A 4R1YA 3IW8A 3O71A 3SXFA 4KB8A 3UYSA 3DT1A 3O8PA 3QCYA 4PX6A 1OKYA 3BBTB 3K5VA 3KY2A 5H8GA 3S0OA 2VNYA 3U8WA 3QX4A 4PL3A 5AP3A 5KKRB 2JC6A 3BU6A 1SM2A 4A07A 3ITZA 4HYUA 3SXSA 4FL1A 5ANJA 4FNYA 2NP8A 2UZLA 5C1QB 4Y5HA 4YBKA 2C0OA 2JEDA 2J90A 2C3KA 4CTBA 4I3ZA 2BRGA 4KIKA 5ANKA 3U51A 3VBXA 3IOPA 3Q3BA 3FDNA 4IC7A 3RPYA 2W1FA 4I21A 3NS9A 3OT8A 2QOQA 3QTUA 3PJ2A 5CEKA 4XG8A 3UG2A 4C2WA 4M69B 4BI0A 2XCHA 2F7ZE 3I5ZA 2PVHA 5KMIA 5KMOA 3PUPA 3RCJA 3QF9A 1KV2A 4AZTA 4FI1A 3R8PA 3N4TA 2HYYA 4OT6A 2R0UA 3WZEA 3RWPA 1VR2A 1XBAA 1VYWA 3MDYA 4FKUA 4L3LA 4M8TA 2WEVA 5K3YA 4GCJA 5BX0A 4D0WA 2PUNA 4EHZA 2BKZA 2GNJA 2JAMA 4EOLA 3A8WA 4D2RA 2XYUA 4RMZA 2GDOA 3PG3A 5JFXA 3LXNA 4GSBA 4TWPA 5J5TA 4DGMA 4AX8A 4F1MA 5AAEA 3FI3A 5E7RA 4A9SA 1AGWA 4C2VA 4B8LA 4LOOA 4F0GA 2J5FA 4RFYA 4FT0A 3CJFA 1FGIA 4CFNA 3AQVA 1ZWSA 4EOQA 3HRBA 4FEUA 4HYHA 2V5QA 4EOPA 1J1CA 1PXPA 4FTLA 2HZNA 1OB3A 2ZV7A 4LRKA 4QMVA 5CI7A 5K0KA 3SLSA 1FINA 4FZ6A 4BTKA 2QOOA 1P14A 3GU5A 2FSMX 3FJQE 2RFEA 4EONA 4FC0A 3QQUA 1JQHA 4FV0A 1O6YA 4YURA 1DS5A 2DWBA 3D0EA 4WA9A 3UVQA 1DAYA 3VUGA 4BWXA 2YJRA 1OIYA 2H8HA 4R7BA 2X1NA 4RIYA 4GJ2A 5HBEA 5BQ0A 2Y6OA 3LFSA 4YHTA 4BYJA 3SXRA 5E8SA 5BUIA 1RQQA 2HW7A 4LV5A 2WOTA 5BPYA 1JKKA 3WZJA 2X7OA 3ATTA 3ODZX 3W2QA 3RPSA 3DPKA 4ZOGA 3Q4CA 1ZMUA 2CKQA 3CY3A 4R3CA 5HNBA 2C5OA 2YDJA 3M1SA 4IWDA 4MEDA 4F6SA 2Y0AA 3VS3A 3ORZA 3CGFA 4BHZA 4EQMA 3BV3A 2HK5A 1WVYA 3QTRA 4H3BA 4RT7A 4ZS0A 2C6EA 5EDRA 4WBOA 5IUIA 5EHLA 5HCZA 4RX5A 2YIQA 5M51A 4O81A 4AGDA 3BEAA 2WTKB 4AA4A 3UODA 3C4FA 4Y85A 3U6HA 3SC1A 4OTGA 5HVKA 2IZTA 3A61A 2I6LA 4HZRA 3EQBA 3MV5A 2W0JA 5D11A 2JIUA 5CU2A 4B6LA 5IQBA 1M17A 3S2PA 3VHKA 1OKWA 2PE0A 2O3PA 3MESA 3EQIA 4FTJA 4ANOA 4BGQA 4EORA 2PE1A 3GOPA 3ORNA 4GVAA 3K54A 3ZSIA 4DINA 5KX8A 3PY1A 2IJMA 2FA2A 2I1MA 2W17A 5H3QA 1OITA 4M68A 5DG5A 4YZ9A 1YXVA 3R1QA 3HAMA 2C5YA 4F6WA 3QRIA 5EOLA 4Y72A 3SKCA 4J52A 4DFNA 2HCKA 5CXHA 2WQMA 1Q3DA 2OIDA 2HY0A 2XS0A 3FMMA 3MGYA 4G31A 4NJDA 3NDMA 3E8NA 4TYEA 1PXIA 4D1SA 3ZLXA 3UQCA 4HCVA 4BL1A 3OG7A 3UOJA 3E8DA 2V62A 3PTGA 4C37A 2J4ZA 4RX8A 3I60A 3TCPA 1LPUA 4E6DA 4CFMA 1U54A 4OTPA 4FSZA 5IH6A 4QYEA 4RZWA 3PWDA 5CEMA 5EI6A 5HE2A 5KMKA 2X4FA 2GCDA 2GQGA 4BI2A 4FKWA 4EH3A 1HCKA 2WIPA 3HZTA 3LM0A 5AX9A 3UIXA 4A9RA 2X2LA 4O7SA 2W1ZA 4C4FA 1H25A 5AV0A 1O9UA 3UZRA 3OOGA 3B2WA 5KUPA 4OGRA 3KXMA 3QTWA 2NO3A 3UOHA 4AZFA 4TN6A 3ZO1A 4CVAA 2OXDA 2R3RA 4K77A 5LXMA 5J9LA 3C0HA 3NUPA 4PRJA 4F7LA 1P4FA 1TVOA 5H9BA 1YOMA 4LFIA 2JITA 3F7ZA 5HCYA 4CT2A 3SGCA 4FF8A 4BBMA 1OL5A 5IMXA 3JVSA 3F3VA 5GJFA 4ZSEA 4HPUE 4XG4A 3DKFA 4U0IA 4ONAA 4EHVA 2WMRA 3QC9A 5L4QA 1A48A 5M07A 4NJ3A 2OH4A 4XCUA 2P55A 4XLIA 4UMUA 4WIHA 4G3EA 4IJ9A 2XNOA 3NVMB 3WIKA 2O63A 5BVDA 5LQFA 2E9NA 4L43A 4DH8A 5ICPA 4WSQA 3NW7A 4EOSA 3IW5A 2QOCA 4J8MA 5KCVA 1PMEA 4WKQA 3PY0A 5D7VA 5EDQA 1UU7A 3COHA 4R3RA 4B7TA 2CN5A 2W06A 4FKVA 4GW8A 4FA2A 1TQIA 4CMOA 4K11A 3W32A 4ITHA 1AD5A 1M7NA 2YFXA 3QCXA 4TZRA 3DTCA 4RC2A 2XM8A 3PVUA 2YZAA 1KV1A 4MBIA 1Q8YA 2O5KA 2JDTA 5CSWA 4Q5EA 3SG9A 1ZOGA 2C5NA 2BROA 5DWRA 1UNLA 2ZDTA 4ZIMA 4EOKA 2I0EA 3BHUA 3OZ6A 4K6ZA 4BCIA 4ERKA 1OUYA 1P5EA 5TO8A 4KBCA 3Q52A 1H4LA 3QQLA 3GXLA 4JIAA 4ZSAA 4IAIA 4QMUA 3CTQA 4NIFA 4XHKB 4ZJIA 4PUZA 5HBHA 4LOQA 5L8KA 5M53A 1ND4A 3BQRA 3C13A 3OWPA 2F7EE 2BZKB 4ZTHA 1XH8A 5FTQA 2BR1A 4U43A 4CD0A 5LVOA 3Q9YA 4CFXA 3V5LA 3VN9A 2QKWB 3KREA 5AFVA 3C4XA 1R1WA 3MVLA 5IUHA 3R83A 5J79A 4QP7A 4D2PA 4E8AA 4PPCA 5BUEA 4RIWB 5C03A 3PA5A 2QHNA 4EK6A 1KUTA 3EYGA 3QXPA 1H08A 4AF3A 3NIEA 2I0VA 3NUXA 4IJPA 1GZOA 1YWRA 4F9YA 2W1DA 3MWUA 4BKYA 4DEHA 4XX9A 3I0OA 4FKSA 4X21A 4JDHA 4U6RA 4XRLA 2WTDA 4Q9SA 5AV2A 4Q9ZA 3ORLA 3GU8A 3TM0A 5HTIA 4W4YA 2B54A 3LXLA 3CQWA 2PVJA 3HMPA 5AIKA 2NRUA 5B0XA 4LG4A 4HVIA 4O2PA 4FZFB 1OPLA 2B55A 3NAYA 5AR7A 1SZMA 4N57A 3GCVA 3FUPA 4QP8A 5J9YA 3L9NA 3IECA 4K33A 4YLJA 5CALA 2B9IA 1BX6A 4YPSA 4FKQA 2XNEA 5F94A 1Y6BA 1YXXA 1LUFA 4YJVA 3KN5A 4QP4A 4EHGA 3O0GA 2BDWA 4M13A 3IW6A 4EQCA 4GEOA 5K5XA 3GFEA 4ANQA 4BHNA 1H0WA 1J7UA 3NPCA 3BZ3A 3DFAA 4FV7A 3RK5A 4YGAA 3UBDA 4G6NA 1NT2A 4DAWA 5EYKA 5A14A 3JY0A 3LCOA 4XOYA 4JX7A 3MI9A 1G5SA 4ZJJA 4BCOA 4DLJA 1S9IA 1JOWB 3C51A 2YIRA 3CKXA 3QHWA 1XBCA 3RK7A 1YDSE 4WNKA 3TXOA 2C6MA 3R7UA 2OW3A 4F7SA 3A62A 4BDEA 4DGGA 3C9WA 4JDJA 4FKLA 3P7CA 3KCFA 2BAJA 4X3FC 5CQUA 5TF9A 4PL4A 1ZXEA 4XH6A 3R7YA 3IGOA 3FI4A 3C7QA 4J1RA 5EYMA 3VUDA 1WBNA 3DQXA 5AADA 2WMVA 3P78A 5AAGA 3UZTA 3LMHA 1XR1A 4B99A 1CKJA 3A2CA 3KCKA 3AD5A 4IVAA 3P1AA 3OY1A 4QQTA 1GZNA 4EH9A 5AV4A 4OTIA 4HVSA 3QTXA 4O38A 5M09A 5CWZA 4WG4A 2OXYA 5BMSA 4IVCA 4M12A 1WBOA 3ORXA 2VX1A 4FYNA 1Y6AA 5HO7A 3N51A 5EDPA 3LCSA 4S31A 5M4UA 2QU5A 3JVRA 3CP9A 4FEVA 4XG7A 4L9IA 3HA6A 4MWIA 3U54A 3GC8A 4YJPA 5HIEA 4V0GB 2CKPA 4O83A 5L2IA 2VTLA 4YU2A 3WILA 4F0FA 2EXMA 2IPXA 4GVJA 5DHJA 3SAYA 5JRSA 5AWMA 3U87A 2DQ7X 4M97A 1K3AA 2C0TA 3TUDA 3QKMA 2R7IA 1JKSA 3PVBA 2PZ5A 3D7TB 4UV0A 4C34A 5HLNA 4BCNA 2R3MA 4RG0A 4PTCA 5IA5A 4IZ5A 4ZMEA 5GHVA 2C1BA 3MPAA 3UVRA 4DGNA 2B7AA 5EM7A 3PE2A 2UZOA 1YI6A 3VBYA 5LWMA 4JQ8A 2R3GA 3W18A 5EKNA 3LXPA 3KXGA 4LRJA 1QL6A 2UW4A 1H01A 3F5UA 3HYHA 4J53A 5EYDA 3P23A 3FI2A 2UZDA 2BZJA 2VTPA 4NFMA 4F7JA 3R1NA 4EWQA 4M84A 4RX9A 5IUGA 4FG7A 3NNUA 4FT5A 3F9NA 1WVXA 3FLWA 4OBOA 4FEQA 3NNXA 4YC6A 3OW3A 4DFXE 4YSMA 5DEWA 2W99B 3NSZA 3S4QA 5KMNA 2WQNA 4S34A 3SRVA 5CASA 1PW2A 3DDPA 1YW2A 3QALE 3UNJA 2VUWA 4E4LA 2ETKA 5AP5A 1AQ1A 4ASZA 4JQ7A 4M66A 3FZTA 4F99A 5E8XA 1H27A 3FHRA 3FZSA 3ENMA 2CDZA 4QMPA 3QZFA 4RLLA 2XIZA 4QMSA 4FIJA 2VWBA 4DEAA 4ZAUA 4R6VA 4AFJA 2XP2A 3I1AA 4LMNA 5GNKA 2BUJA 4M15A 1OKVA 3H9OA 4OTRA 5DR6A 3LFAA 4PL5A 1ERKA 3V5WA 3VIDA 4XOZA 2PYWA 4O84A 3FLQA 3TNPC 5HLPA 4P90A 5TR6A 4IIRA 5KMJA 2W1EA 4TYIA 4ZSGA 1ATPE 4Z9LA 4CGAA 5IQDA 4FV3A 2W4JA 1PXMA 4AFEA 3UP2A 3FXWA 3AGLA 4IFGA 3O51A 4G1WA 2OKRA 2VTMA 4KIQA 2F4JA 3ATSA 4C8BA 5IMEA 3FSFA
chains in the Genus database with same CATH superfamily
4B0GA 2UW0A 4Y95A 3PZEA 2HIWA 2IWIA 3EFLA 4B9DA 4RJ8A 1K2PA 3IW7A 4I5MA 4O82A 2UZTA 4L6QA 3GT8A 5JGAA 5KE0A 3HGKA 5CSPA 3D5UA 3S1HA 1XH5A 4U40A 3V51A 3WIGA 3OP5A 2F7XE 3PIXA 4G34A 1BI7A 4CFFA 3VRYA 1OKZA 4UZDA 3HUBA 5F9EA 3D7ZA 4I5PA 4QMQA 4QEBA 4FSMA 3ACJA 5HO6A 5KHWA 2CGXA 4N0SA 4XS2A 3DAJA 4YMJA 4O91A 3HDNA 4D4VA 2F49A 4OW8A 3TNWA 1H8FA 3WF5A 2BIYA 4KWPA 3FMHA 3DOGA 3MJ1A 4F65A 4TYGA 3L8VA 3Q9WA 4P4CA 4RA4A 3Q32A 4MXZA 3PSBA 2E9PA 4D2VA 2WPAA 2XF0A 4HZSA 4ENYA 4Y5QA 5CEIA 3L9MA 5CU4A 3UG1A 4IANA 5DNRA 3DBCA 4EZ3A 4AXAA 5IA0A 3FZOA 3EN4A 4TTHB 5J9ZA 4W8EA 2YWPA 1CM8A 3Q4ZA 1Q8TA 3CIKA 3QTZA 1PMVA 3HKOA 3DB8A 2CPKE 4IDTA 2OZOA 2GMXA 3CPCA 1ZYJA 2WMQA 4NZWB 5C27A 4YSJA 1GOLA 4BBFA 4FJVA 5BVKA 4AQKA 5GINE 4G3CA 3C5UA 4I41A 4D9UA 2CGWA 3T9TA 2JBPA 2C47A 4IX5A 4FSQA 4L67A 2BALA 4TKSA 5B2KA 3E88A 2WMBA 5E1SA 2VTJA 5JGDA 3FEGA 1H0VA 5L6OA 3BYSA 1FMKA 2X7GA 4ACMA 4PP9A 2XARA 3ZUUA 2Z7RA 3MBLA 4U97A 2DS1A 4GV1A 4WD5A 3T8OA 3WF8A 5IQAA 5CY3A 4XBUA 2IVVA 2W1CA 4DEEA 3RBWA 2QLQA 3OTVA 2Q0NA 4V05A 5FEQA 4NM5A 4ERWA 5TT7A 1OL2A 3EB0A 2KTYA 3DAEA 2OXXA 1YWVA 3NUNA 3QTQA 4RFMA 3TNQB 4ARKA 4EQUA 5DA3A 2BDJA 2WEIA 4E4MA 4PPAA 2BAQA 1TQPA 2WMTA 2R7BA 4IADA 4WUNA 3W0RA 5HKMA 3JY9A 1REKA 2BHEA 4F64A 3D15A 3G9LX 4FVPA 4DBNA 2JDOA 1U46A 5AEPA 3P0MA 1XH9A 5IPJA 1WMKA 4UMPA 2RG6A 3Q4TA 4BI1A 3D2IA 4PNIA 4ZMFA 5DE2A 3HRFA 4ZK5A 3R01A 2A19B 2VGPA 5T68A 3ETAA 4LGGA 2C6OA 3MW1A 2X2KA 3GGFA 4FV6A 3R9RA 3TG1A 4NT4A 4APPA 1W98A 2VTRA 3GCPA 4CQEA 3NNWA 4A9YA 1W83A 2VRXA 3BHVA 5CI6A 2I0HA 5AR8A 3H9RA 3SX9A 1WFCA 2UW6A 3RNYA 3HMOA 3PXFA 1XHAA 2C1AA 4FTAA 4X6RA 2YM6A 4JOAA 2PU8A 4EKKA 4E6AA 4U80A 1QPEA 2J50A 3R8VA 2J0LA 3RPRA 1RJBA 5EG3A 2UVYA 3QQKA 3U55A 2XA4A 4HGSA 3R8MA 5HU3A 3PRIA 2W96B 2RFDA 1H07A 5FD2A 4EH4A 1WBPA 3UPXA 4F70A 3TTIA 3FHIA 4I6QA 5HIBA 5I5ZA 4DCAA 2ITWA 4V04A 3L9LA 2B53A 3ZLSA 5BVOA 5HESA 4UB7A 3BI6A 4FTKA 2Y4IC 2YCRA 4WRSA 3T3VA 3PXZA 1BL7A 3NW5A 3KVXA 5I4NA 3BWFA 4E93A 4CSVA 3NYVA 3UDSA 2A27A 2JIVA 3AT2A 4KRCA 4D0XA 4DEBA 5JSMA 4RFZA 3AC4A 3BV2A 4DGOA 2FSTX 4KBAA 4XMOA 3A4OX 3W2OA 4O96A 4BWPA 4PDPA 3AMAA 3GQIA 5AR4A 2X9FA 5AUXA 2XNBA 3VUHA 2G2FA 4FGRA 5CEQA 1UU3A 1BMKA 3O7LB 5A4QA 2WQBA 3DY7A 4CG8A 4IM3A 5ITAA 4DYMA 5DIAA 5M4IA 2ZM4A 3SW4A 3WE8A 1PKDA 4EOJA 4RVLA 1Y91A 4E4NA 4JBPA 5J7BA 3ZZWA 2ESMA 2BFXA 2PVRA 4BWKA 3AGMA 2YCSA 4JMQA 3HDMA 4KIOA 4C3RA 3R22A 3BELA 4H05A 3WF9A 4D1ZA 4K9YA 1SMHA 3EZRA 3KK9A 4II5A 4MNEB 4Y73A 3PE1A 1DM2A 3KVWA 3OXTA 2NRYA 4F08A 3R7OA 4FTNA 4DH7A 3MH3A 4WNPA 3CGOA 4PV0A 4DDIA 4K18A 1ZY5A 2RF9A 5CU6A 3TNIA 4IZYA 3W8LA 4QRCA 3KN6A 2B9FA 3LZBA 3ZS5A 3COKA 2DUVA 5AJQA 5HICA 5D7AA 2JLDA 2AQXA 4PF4A 1B38A 5HO8A 2Y9QA 3BGZA 1R39A 2SRCA 4PDSA 4BTJA 4EBWA 4F6UA 3UDZA 2OJJA 5BVEA 3Q4UA 4TRLA 5EHYA 4U8ZA 3NGAA 2IN6A 3VS5A 4KA3A 3A7GA 3PRFA 4PQNA 5IEXA 2PPQA 1PRYA 1H1RA 4CFVA 4BCKA 3R2YA 2GHGA 4AT5A 4NIFB 4BDIA 2XK8A 1R3CA 4U9AA 4YUQA 3BWJA 4P5ZA 3AOXA 3LJ1A 3A99A 4KD1A 1MRYA 4XP0A 3QRTA 2YA9A 5HBJA 4I22A 5FP6A 2YIYA 5ANIA 4MXYA 3FPQA 1UNGA 3EZVA 4FTCA 4YJSA 3EMGA 5DMZA 3HA8A 5A6OA 1XBBA 2H96A 2WMWA 3PWYA 4UBAA 3D2KA 4LGHA 3PPJA 5CX9A 5EK7A 5D41A 3V01A 2Y6MA 2QURA 3FC1X 2AUHA 1V0BA 2A1AB 4NM7A 3AT4A 2JDVA 4UY9A 3WYXA 3NAXA 2VTQA 3ORPA 4O0UA 3VHEA 5T3QA 3FLSA 3QC4A 2J0JA 3WYYA 1JKTA 1GJOA 2VWVA 1GNGA 2QCSA 4AZEA 2B9JA 2WQOA 1PHKA 4BFMA 3TJDA 4BVUA 1IA9A 1Q41A 2ZJWA 1GIHA 3ZXZA 1Y8GA 3KXXA 5FLFA 3TYKA 5CEPA 3BRBA 2YEXA 2BZIB 3RJCA 3DK6A 4ZTLA 4FTRA 4HOKA 1TKIA 4IM2A 4RJ4A 4EC8A 3D5XA 5I3RA 2OH0E 3RMFA 1XH6A 2X7FA 3ANRA 4IQ6A 5C9CA 4IXPA 1YHVA 4O4EA 2XCKA 4E73A 4JG7A 5DPVA 3MVHA 5JZNA 3WI6A 4CV8A 1XQZA 3IK3A 3PFQA 5EYCA 3Q96A 3S95A 4J98A 1OL7A 4NK9A 3ZEPA 4QD6A 2XYNA 4LM5A 4I92A 2ZB0A 3KMWA 3RK9A 3BYUA 3PXYA 3OFMA 3PZHA 2ZVAA 2PVYA 1W2DA 3QD4A 5FDXA 3HP2A 1OGUA 4ZS4A 3ZTXA 2XK7A 3UIBA 1JAMA 3EQHA 5FM3A 3I7BA 4YZCA 4BDFA 4FICA 4TWNA 3P5JC 3JPVA 2J5EA 3AG9A 4HGLA 4KAOA 5ETAA 4AAAA 3POOA 2P0CA 5M4CA 4K1BA 2HAKA 5E92A 4O7TA 4RZVA 3D4QA 3AD6A 4L44A 2J51A 1E1VA 3QKLA 1IR3A 3HNGA 2OK1A 4FSUA 4S30A 4XP2A 4U81A 2IO6A 4FTTA 4PMSA 4YNOA 2AC5A 3C4ZA 3F5PA 3QCSA 3ZRMA 4I20A 3GU7A 4DCEA 4KUJA 4TYJA 3OCGA 4YTIA 2WNTA 1FVTA 3GI3A 2C3IB 1Q5KA 4CKRA 5D10A 3II5A 4XG3A 1SVGA 4D2SA 1H28A 5A4EA 4IB3A 1JSUA 1W7HA 5ETIA 4YTHA 3WF7A 3Q5IA 1VZOA 3UIMA 1UNHA 3DDQA 3BE9A 5LWNA 1WZYA 3NUYA 4QMTA 4YZNA 1KE6A 2ERKA 3V8WA 3CQUA 4TWCA 3JXWA 2ZMDA 5HD4A 2YDIA 2IZUA 5AP7A 4TXCA 3BYVA 3KKVA 2EUFB 2Z2WA 3PJ3A 1QPDA 3HMIA 3QRJA 4MH7A 3DTWA 2GNFA 3H10A 5CSVA 3MY0A 3NIZA 4U3YA 2UZWE 4HCTA 4W9WA 3E7VA 5DBXA 2QONA 2ITPA 2JKMA 2VTTA 1SVEA 3S00A 1JSTA 2JBOA 2PULA 4YJQA 3A7HA 3EJ1A 3LKMA 5C01A 3VBQA 5E1EA 4D28A 5BUJA 3LE6A 4HYSA 4RJ5A 4CEGA 4QMXA 4EZ5A 4ZLYA 2FYSA 3PA4A 5F95A 3EFJA 3F82A 4C57A 1E1XA 4EUTA 4ANNA 1IAHA 5FGKA 3CS9A 4A7CA 2GSFA 3IDPA 4AACA 1WBTA 2C3JA 2UW8A 5EOBA 4CFUA 4CCBA 4RIXB 3MPTA 4E20A 2UUEA 2BIKB 4QTAA 3VUTA 2YWVA 5LVPA 3FLNC 2WD1A 5FRIA 2XJ1A 5L8JA 3F3WA 2BTRA 2R3KA 3D5VA 4J96A 3G15A 5E9EA 4EEVA 4JDIA 2OFUA 3F5GA 4ZTRA 3WOWA 2W1GA 3TV7A 4E4XA 2ACXA 3V3VA 1FVVA 3NYOA 2XNPA 4FVRA 5C8NA 3MIYA 4W4VA 4OT5A 5IQGA 3BIZA 1W0XC 4EK3A 4PMMA 3FKLA 2YLFA 3E64A 3CCNA 4R8QA 4C3FA 2O0UA 3MJ2A 4QOXA 2ONLA 1G3NA 2X6DA 4I5CA 4ZJVA 5CF4A 5HQ0A 2XVDA 3VW8A 4FV2A 5A9UA 4X3JA 2C3LA 4DE4A 2CCIA 1OPKA 2VTNA 2YDKA 4FSYA 2IW8A 5CF5A 1NVSA 2PZYA 5IEYA 4FL2A 3CBLA 2HZ4A 3IPHA 3MSSA 4M0ZA 2QR7A 4NCTA 4QPSA 4X2JA 1EH4A 5AA9A 2OG8A 2ZM3A 4AT4A 4BCFA 2OWBA 2W5BA 3OBJA 4FX3A 3UVPA 2GPHA 3OY3A 5CU0A 3OUNB 1OPJA 2W9FB 5AM6A 1FGKA 5CXZA 4AXEA 2UZBA 3PXQA 2OSCA 4IAKA 4JXFA 3ZFYA 1APME 3HVCA 4IB5A 2V0DA 2VZ6A 4YTFA 4U45A 1SVHA 2YITA 4GFOA 3HV5A 4C58A 3RVGA 4Z7HA 3A4PA 3R63A 3QUPA 2OFVA 2XJ2A 4KRDA 3DZOA 4PPBA 5F4NA 1NVRA 2C30A 2JFMA 4TYHB 2GS6A 1SNUA 4QYHA 4YP8A 3RALA 4AG8A 1ZMWA 2UZNA 2WTCA 3DFCB 5HE1A 2X8EA 2XKEA 4IMYA 5B2LA 2QO2A 4U7ZA 3MH2A 4MF1A 3DBDA 1Q3WA 4QQ5A 4HGTA 4JRNA 4BIEA 1QCFA 3H4JA 2Y4IB 3KQ7A 3WZKA 4BF2A 4DH3A 1ZLTA 2PMLX 3LFNA 4I94A 3U9NA 4E6QA 3LCDA 2Z7SA 3FMDA 5D12A 5AMNA 2A98A 1YRPA 3ALNA 3QRUA 4MXCA 5B7VA 5HU9A 5BVFA 3PLAE 4H58A 2ITTA 1RE8A 2HENA 4CQGA 3LJ2A 3D83A 4RPVA 2VO7A 2VTSA 3ZCLA 5IA2A 2JDSA 2WMUA 4MD7E 4UYAA 3QLGA 4JLCA 5CZIA 4CG9A 3W0MA 3F66A 3R04A 5JFWA 2R64A 2VWIA 5IA1A 2W5AA 5IZFA 2CGVA 5EHOA 1JNKA 1OECA 3FKOA 4GJ3A 4RX7A 3R71A 4AZVA 4B4LA 4EL9A 4M69A 1YXTA 4B8MA 2YCQA 3QBNA 5GZ8A 1F3MC 4FMQA 1MP8A 2FUMA 3GNIB 4XV1A 3EH9A 2IW9A 3ZBFA 4YZDA 4I23A 5DVRA 3TIYA 1YVJA 3F5XA 1G8AA 2QO7A 4XV3A 1FVRA 3CTHA 3ZFXA 4J99A 5E8UA 4USFA 2XKFA 3FXXA 4XLVA 4Y8DA 3G6GA 3VO3A 3DS6A 5IQCA 1MQBA 2E9UA 3JYAA 4K2RA 4CXAA 4CKJA 4YLLA 3I81A 5HE0A 3JS2A 4JT3A 4ASXA 1J3HA 2H6DA 1OIQA 1UU8A 2EWAA 1XJDA 3UO6A 3ANQA 4C36A 2QKRA 4E6CA 5A4TA 1BKXA 1PKGA 3EQPA 3FL5A 4FKJA 4G3FA 1ZYCA 5GZ9A 3VRZA 3RP9A 4C59A 3UC4A 4BR3A 4CKIA 4GMYA 3CC6A 3ACKA 1H1WA 1YXSA 3VUIA 5M44A 5AR2A 1T46A 4D9TA 3UMXA 3REPA 2W5HA 2CLQA 4LYNA 3O23A 3DKCA 2GFSA 4USDA 2FSOX 5IDNA 2XK4A 2GNGA 3W8QA 5DRBA 4MHAA 3RZFA 5JMSA 4UWYA 2OICA 4FKGA 3ZSHA 2ITOA 2OIBA 4KABA 3LAUA 4U5JA 2QG5A 2EXEA 2IEWA 3UNZA 2R3OA 4PWNA 2BMCA 2ZAZA 5LCJA 4EH6A 4L52A 5I9WA 2XAMA 2ZDUA 2EB3A 5EQYA 4TL0A 4GKHA 3N4UA 5CNNA 1U59A 3NYNA 4N70A 4A4XA 4ZY4A 3ZH8A 2R3NA 3KXZA 2C0IA 3Q2JA 2EB2A 4FZ7A 4DF3A 4UWBA 4JBVA 2R5TA 5H8EA 5AP0A 4UWCA 1YQJA 2WGJA 2GHLA 3ZM4A 2Z02A 4HGEA 5CU3A 5TOZA 4ACCA 4FVQA 2OJ9A 3VS2A 3RWQA 3DB6A 3OUKA 3UQGA 3HRCA 1Q99A 3CR0A 5HD7A 4FEXA 4UN0C 1URWA 4L7FA 2CLXA 3EN9A 1BUHA 4ALUA 4JAIA 3JR1A 4EK5A 4O0RA 4OTHA 3ENHA 3G9NA 2R9SA 2RIOA 5AP1A 2Z7LA 4F1OA 4ZZNA 4X2NA 2PVFA 4YJNA 3LQ8A 1REJA 4FSNA 3COMA 3U9CA 2NYAA 2R3LA 2YERA 3ET7A 4O4CA 4NKAA 4QP9A 2E9VA 2PZPA 1IASA 3ZDIA 2VO6A 1WCCA 4JJRA 3GBZA 4EK4A 2VGOA 2R2PA 4JI9A 3UYTA 3TUBA 4DG3E 3MH1A 5AP2A 3PJ1A 4FV8A 2WTIA 2G9XA 4AXDA 3TV6A 4AU8A 4BZDA 3DNEA 4GK3A 5HG5A 4FZAB 4Z7GA 3KULB 4PTGA 3ZO4A 1KE5A 1PJKA 3UMWA 4C4EA 2XIKA 3O17A 5D9HA 4D5KA 4E3CA 5EW3A 4Z3VA 3R0TA 5BYYA 5LJJA 1M52A 2OZAB 4NWMA 3TZ9A 4PNKA 4R3PA 2PVLA 1I09A 2ZOQA 4YO6A 1TQMA 3R7EA 3U6JA 4FTOA 3LLAA 5LMKA 5L2TA 5DLSA 2A2AA 4I0SA 3WBLA 4DTAA 1B6CB 1FQ1B 4XRJA 4O7NA 4N6YA 4L3PA 4QDVA 3H30A 3NYXA 5LVMA 3O5AA 2ZB1A 4H1MA 5CVFA 5I9YA 3KL8A 3UGCA 4DLIA 2XNNA 1UKHA 1R0EA 5A6NA 1MRUA 3NUAA 3QTSA 4BB4A 4LOPA 3LCKA 5HZNA 4GS6A 4FNXA 5AUUA 1QMZA 3MIAA 3VF9A 4O0VA 4I6FA 3T3UA 3C0IA 4QTBA 5L8LA 2OBJA 3LMGA 3OWJA 3K2LA 3SQQA 4C4IA 3E92A 1PY5A 3BE2A 5HCXA 1ST0A 5IISA 4N6ZA 4QMMA 3UDBA 3HMMA 2O8YA 2UW9A 3W2RA 5FEEA 4FYOA 4O7WA 4DBXA 4G9CA 4FTUA 4NKSA 4NH1A 3G2FA 4XG9A 3C1XA 2XNGA 4RJ3A 1CTPE 5I9VA 3HECA 4BDKA 5GJDA 5LMBA 3IGGA 3EWHA 3M11A 3Q04A 2WHBA 3BHTA 3C4WA 5HG7A 2UVZA 5E4HA 4YC3A 3V5PA 1W2CA 2Q0BA 3NCZA 4CFWA 2BRMA 5DT4A 1KE9A 3MN3A 4ZLZA 1O6KA 3R6XA 4MXAA 3F2RA 4O1PA 2CN8A 3OXZA 2CKEA 3AT3A 2C6KA 2RFSA 4H36A 2WAJA 5KZ0A 2J0KA 3Q6WA 5E91A 4BDCA 4CLIA 4LGDA 4DH1A 3EQFA 3FMEA 5IH4A 4DDGA 4LQMA 5J1VA 4IM0A 3KU2A 2XK9A 4FIFA 4EH7A 4O7VA 5ANEA 4FKTA 3SVVA 1DAWA 4KIKB 3MY1A 1PMNA 4ACHA 4MCVA 4GYIA 5K5NA 4JS8A 5FM2A 3VS7A 2PWLA 3BHHA 2WXVA 1YWNA 2JD5A 4UMTA 2PMNX 3QA8A 3LXKA 4OUCA 5LVLA 4GU9A 4DFYA 2OJGA 1PYXA 2GHMA 5AA8A 5H8BA 5KMLA 2P2IA 3PVWA 3ERKA 5E8WA 4C62A 2QHMA 4JG6A 3O50A 3CJGA 3OD6X 4X7QA 4IBMA 4U44A 5BVWA 2JKOA 3QUDA 3E93A 2CNVA 5ACKA 3BBWA 5BV3A 1CSNA 3R7IA 2UZVA 4RIWA 1NVQA 5ETFA 5M06A 3PJCA 4C02A 1Y8YA 2VX0A 3VC4A 3F2AA 4GFMA 1YDRE 4GT3A 4FKOA 1HCLA 3F3UA 4CMTA 4M67A 1BI8A 3T9IA 1JLUE 5DFPA 1NY3A 3LW0A 5KZIA 3KRXA 3TTJA 3O96A 4IX3A 3UOLA 3TZMA 4FL3A 2AEGA 3OC1A 3MVJA 5HTBA 2G1TA 3QAME 4FKPA 3MB7A 3VBVA 3N4VA 4DEIA 2PVNA 5JEBA 3E87A 4FV9A 4OTFA 3C4CA 3MPMA 3BEGA 4IE9A 3WZUA 5L2SA 5AUYA 2R3HA 3VW6A 3SG8A 2XUUA 1P2AA 3OOMA 2E9OA 2FVDA 3I79A 4RIYB 3TACA 4BIBA 2CSNA 3EFWA 2E2BA 3W1FA 3ORIA 3AC3A 3F2NA 3W10A 4AS0A 3R9NA 3BGQA 3W0QA 2XB7A 3VVHA 4D58A 5IQIA 3RCDA 2YIXA 4CYIA 2Z8CA 1Y57A 2R3IA 4YTCA 1NA7A 4ANLA 1WBVA 3F61A 4ZTSA 3DQWA 4RLKA 4LV7A 3W2PA 4FE2A 1VEBA 4YPDA 3ROYA 4WBBB 1U4DA 3OCSA 1JVPP 5AR3A 4UMQA 2XK3A 4NTSA 5HOAA 3FXZA 5HNIX 1MQ4A 4GG5A 5CF6A 4I5HA 3O7LD 4O0SA 3FLZA 2HELA 4V01A 4G6LA 4OR5A 4OAVB 4QTCA 3P5KA 4BGHA 1IG1A 2CKOA 2CGUA 3GP0A 3OMVA 4GT4A 5FTOA 4O7ZA 4R5YA 3P86A 5JQ8A 2QVSE 3E62A 3FPMA 5JZJA 4L7SA 3ALOA 2J6MA 2DYLA 2Z60A 3MYGA 3VS6A 5EW8A 3WE4A 4CTCA 5J1WA 3C5IA 3W0NA 2X0QA 3I0QA 4GFGA 3E7OA 3HEGA 2F9GA 3L1SA 3KRLA 3I4BA 2XKCA 4O21A 5LARA 4EH8A 3MA6A 3TKHA 3DLSA 5E8VA 5IQFA 1GZKA 1W84A 5IG1A 2VWZA 4QP2A 4KKHA 5L6WL 1OUKA 4PTEA 1T45A 4V0GA 4F4PA 3FMKA 3KC3A 2QOLA 4LV8A 3Q9ZA 3VF8A 4DGLC 4EKLA 3LPBA 1Q8ZA 2OI4X 2QOHA 2ZV9A 5C26A 4UXLA 4M0YA 3RPOA 5JGBA 5ANOA 3NX8A 3UO4A 1W2FA 4EOMA 4JDKA 2IVUA 5IQEA 1U54B 2J0IA 2VTOA 4F9WA 4BCGA 5HTCA 3FE3A 4RWIA 2NNWB 3RHKA 4FIEA 4ZSJA 4CZTA 2GQSA 4HNIA 2UZUE 5M55A 3SHEA 3VNTA 3ZSGA 2VV9A 3Q53A 2VO0A 2WTVA 3CTJA 3VAPA 2B9HA 2WTJA 3NNVA 2QLUA 3IDCA 3KIOC 4YNEA 4MQ2A 3FWQA 4FV1A 3QGYA 4J71A 5IA4A 2PY3A 2PUUA 4XBRA 4D5HA 2W9ZB 5EM8A 5HLWA 5FBOA 5CZHA 2ITZA 4O7YA 3Q2MA 2R3QA 1ZYLA 3FY0A 3OEZA 3R00A 4IB0A 4CRLA 4DN5A 4F9AA 5EM6A 4GKIA 3UC3A 1K9AA 3BPRA 2V7OA 5FQDC 3K3JA 5CVHA 4WG3A 4DC2A 2W7XA 5AUZA 4QYYA 3DCVA 4K8AA 3R9DA 5HHWA 2IW6A 4EC9A 3UZPA 4R77A 2ZV2A 5DRDA 2PMOX 2PK9A 2YM7A 3LFEA 4EJ7A 3TDWA 4ANSA 1LP4A 5BNJA 2R4BA 3EYHA 3GVUA 3NVKI 2GS2A 3UE4A 3UDTA 2IVSA 4GU6A 3AMYA 3DKGA 4MK0A 3ZUTA 3LMIA 4JR7A 4QP3A 4KNBA 5EKOA 4FIIA 3KF4A 3PSDA 5HEZA 4FUYA 4H3QA 3BU3A 3P4KA 3B2TA 5DYJA 5G6VA 2W1IA 4RWKA 2ZFYA 3FZ1A 1YXUA 3W0SA 4BICA 2VNWA 2HWOA 3KA0A 1Q61A 3MY5A 3B8RA 4FT7A 1PXOA 2XRUA 3A7FA 4RVKA 4CZYB 4KSPA 2HXLA 4I93A 4AP7A 2XIYA 4G3GA 4A4OA 3A7JA 5HG9A 3QL8A 4QMWA 4C4GA 3IS5A 3EN6A 3QZGA 3FY2A 4C7TA 4FKRA 4F0IA 4IAYA 3KEXA 3CD3A 1L3RE 2XKDA 4DFLA 3QCQA 4APCA 1IA8A 5EI2A 3EL7A 4R78A 1J1BA 5I9UA 4ACGA 4F7NA 1IAJA 3RINA 3H9FA 3IW4A 4FZDB 1FPUA 2QG7A 3GB2A 1UKIA 1W82A 3CSVA 3UO5A 3GUBA 4OTDA 5DI1A 2PHKA 4W4XA 4U79A 4M3QA 4F63A 3EIDA 3LLTA 4DFUA 3G0EA 4O86A 3EQGA 3QZIA 5L3AA 3AD4A 3ZO3A 3G90X 4QP6A 4WSYA 1OIRA 2ITUA 5E8ZA 4ITIA 4UYNA 2G2HA 4TT7A 5EH0A 3HL7A 2X4ZA 4I24A 4AAYA 3LIJA 3OWLA 4PDOA 4CCUA 4ID7A 3DU8A 3LQ5A 3R2BA 4QNYA 5CEOA 4F1TA 2X2MA 4H3PA 5AUVA 2C5VA 3DGKA 4CZUA 3UQFA 3I7CA 5HVYA 4TW9A 2QC6A 3W2CA 2QU6A 3D94A 2BCJA 2HWPA 2JGZA 5A46A 1J7LA 2XH5A 2CNQA 3R73A 3QD0A 3QRKA 3VS4A 4JL9A 1YI3A 4DG2E 2GQRA 5CYIA 2LAVA 4CT1A 3M42A 3G5DA 2PMIA 4ITJA 1UV5A 3IONA 3R28A 2QD9A 3OCTA 4N4SA 2PZRA 3C50A 5CANA 3FQHA 4AT3A 1ZY4A 3DXPA 1R0PA 1W8CA 4PY1A 4C0TA 4KS7A 2RKUA 3MFRA 3ZONA 2YM3A 2O2UA 2XAOA 3UPZA 1FOTA 3O8TA 2YJSA 4RA5A 3OS3A 4EH2A 3UP7A 3KRJA 4HVGA 4J95A 3CXWA 5HX8A 1OL6A 2BILB 5IEVA 1PXNA 2RFNA 4UMRA 4QPMA 4IWOA 3FV8A 3PP1A 2CMWA 4YJTA 2ETRA 3V5QA 1WVWA 4FTQA 2H9VA 1XKKA 4BJJB 1OBDA 4WO5A 4ZEGA 2X6EA 4WRGA 2OO8X 3V5TA 4MX9A 3W2SA 4E5BA 3QYZA 3GCQA 3R1YA 2XBJA 3LFBA 2A4LA 5IA3A 4BDGA 3E63A 4LL0A 4M14A 3QQHA 4P2KA 4TY1A 5ANDA 2HY81 5LCKA 3FBVA 3SOCA 5KBRA 2QOFA 3KXHA 4FTMA 3RAKA 5C4KA 5IQHA 5K4IA 2X8IA 1ST4A 2J2IB 4AN3A 3ULIA 1UA2A 3LJ0A 4I4EA 1JSVA 3DJ6A 2JIIA 4OAUC 4RC3A 2X0PA 3K3IA 5GIPE 3F88A 4FK6A 4FV5A 5KBQA 3DK3A 2WMXA 3V5JA 5K9IA 1L8TA 2FSLX 3CY2A 3KXNA 4RVTA 3QQFA 4FODA 4DTKA 1OI9A 4JNWA 4W9XA 4XUFA 4F9BA 3HMNA 1CKIA 1XO2B 1J7IA 3GC7A 3LFCA 1OM1A 3ZO2A 1KOBA 1XH4A 2HXQA 5C8MA 4AZWA 4R5SA 4ZLOA 4WHZA 5CS6A 1G8JA 3OCBA 2W4OA 2VTAA 4QNAA 1VLRA 2GS7A 1WBWA 1P4OA 3BLRA 3IQ7A 1RW8A 1Z5MA 4C4JA 4G2FA 3AC5A 4ENXA 4MQ1A 5I9ZA 3QKKA 4GUBA 2UZEA 4BCJA 3HAVA 3C0GA 3HV6A 4ACDA 2XNMA 4WNMA 3VUMA 4AOIA 5BVNA 1UVRA 3SW7A 5G1XA 2CNUA 4Y83A 4UEUA 3RKBA 4HW7A 3DJ7A 1UWJA 3BLQA 1PXLA 4WG5A 5M4FA 1SYKA 5HGIA 3ORMA 4AQCA 2QQ7A 3TI1A 2UW5A 1YI4A 4IAFA 4MXOA 4E7WA 2WU7A 3AC2A 4Q5HA 2I0YA 3BHYA 4AA5A 2LGCA 3L9PA 4MNFA 3VBTA 5FTGA 3OF0A 1M14A 3SV0A 3L8SA