4L52A

Crystal structure of 1-(4-{4-[7-amino-2-(1,2,3-benzothiadiazol-7-yl)furo[2,3-c]pyridin-4-yl]-1h-pyrazol-1-yl}piperidin-1-yl)ethan-1-one bound to tak1-tab1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
307
structure length
295
Chain Sequence
GSLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 7, TGF-beta-a
publication title Discovery and optimization of 7-aminofuro[2,3-c]pyridine inhibitors of TAK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 295
sequence length 307
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4l52A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4l52A01
1GZOA 3LQ5A 3VRYA 3DV3A 3R2BA 4JX3A 2ZV9A 3QX4A 3KXGA 4IBMA 4O0VA 3FZPA 4L67A 2LAVA 4ALVA 5TT7A 3S4QA 4AN2A 5IQBA 2QLQA 4FVQA 2C5NA 3RINA 3RCJA 4DEAA 3FXZA 2R3KA 4Z3VA 1PRYA 2OO8X 4ZSJA 3UIMA 2IPXA 3H9FA 3NYVA 4EOMA 3GB2A 4TYIA 4UALA 4RMZA 3TKIA 3NMUF 2JDTA 3F7ZA 5BPYA 3UO5A 3QUPA 2WMSA 4Y5HA 4NEUA 4BI0A 2XK8A 4XRLA 4NFNA 3EN4A 3FLYA 3LZBA 3QTSA 3TIZA 5JQ5A 5LVNA 3Q2MA 2EVAA 2XJ0A 4UWCA 4AUAA 5FUTA 3JY9A 4ZS0A 2FVDA 4OBQA 4YURA 1YDTE 5D12A 3RVGA 3NR9A 3ZFYA 3V5JA 4BTMA 3R9OA 5C1QB 4U79A 3H3CA 2XNEA 3GP0A 2C3LA 1WBSA 1WFCA 4JIAA 2CHLA 3KMMA 1PMVA 2ITVA 3BZ3A 3QBNA 3OD6X 3GXLA 4O6LA 4BZDA 3ZC6A 1H1WA 4S32A 3HYHA 1YVJA 3PJ8A 5FDPA 4FZDB 3VBWA 5L8JA 4CSVA 1BI8A 3TZ7A 1KV2A 3LFSA 4Q5HA 4I23A 1PW2A 2X9FA 4CXAA 2WKMA 3QYZA 4BN1A 4C4JA 5AR2A 1H08A 3BBTB 1CTPE 3N4UA 4FTAA 1OKWA 5K3YA 2PWLA 2WOUA 3WILA 1HCKA 5BUEA 5BVEA 5J9LA 2FYSA 4QYFA 3BEGA 5AV3A 5CANA 2CN5A 3VC4A 5AIKA 4IB1A 4BDCA 4FSMA 1FGIA 3AQVA 3QRJA 3KN6A 4FK6A 3GENA 4RPVA 5HNGA 5HNIX 5J79A 4IWPA 4EKLA 4EYJA 2CKQA 5GINE 3EFWA 2GNIA 4FT5A 4N6YA 5HU9A 2X6DA 1H27A 4HW7A 4Z7GA 4FL2A 5FP5A 2VTQA 5AR5A 1P4OA 4PX6A 4GFMA 1XH7A 3DJ7A 3TACA 1ZYJA 4FZFB 2A0CX 5HG8A 4ANSA 1B6CB 3OBJA 4C62A 3SA0A 3HGKA 3VAPA 2YM8A 4IC8A 4YUQA 2GTNA 4M69B 4MCVA 4CRSA 2WU7A 2X1NA 4XP2A 3UP7A 5IA1A 4IVBA 3G33A 1KOBA 3OBGA 3LFEA 4IAIA 4MH7A 2QOQA 4EQUA 4QOXA 3FMMA 4ZSEA 3UG2A 4EK5A 3GU6A 3HDMA 3IW8A 4I3ZA 5M57A 4DFUA 3R8ZA 4K6ZA 1G8SA 3KU2A 3KKVA 4IZAA 4G3EA 2ZYBA 3BYVA 3NS9A 3RALA 4JQEA 3NVMB 1PXKA 3NW5A 4XS2A 4DEHA 2BALA 3GQLA 3Q9YA 3GCSA 4AW2A 4MK0A 1ZARA 2PULA 5EQYA 1VYWA 1PF8A 5DLSA 4FOBA 5EM7A 2OF4A 5CQUA 4DBXA 4BYJA 2OZOA 4FNZA 5HG5A 4QYGA 3ALNA 3HL7A 5LARA 2W0JA 2W9ZB 4OT5A 4BDGA 2XNMA 3K3IA 5HO8A 1BLXA 1CKIA 1JBPE 1Y6BA 3BHUA 4MF1A 3R1SA 3KRWA 3C13A 4FSTA 1FMOE 3E87A 3P7AA 2W1HA 3PSCA 4OTDA 3HUCA 4HOKA 5HHWA 4GJ2A 3S1HA 4M15A 2XP2A 2WIPA 3G6GA 4W9XA 4O7VA 2OK1A 5CSXA 4QMVA 5EDRA 4JIKA 3WF5A 4CYIA 2GS7A 3U54A 4MD8E 3TKHA 4FV8A 2UZTA 3PVUA 3SXFA 4BDEA 3NUSA 3GU8A 4QMUA 3UJGA 4M67A 3FHIA 3QTXA 4YGAA 3JYAA 3PUPA 1OB3A 4IZ7A 2J9MA 1W84A 2C0TA 2QHNA 1OGUA 3POOA 4I5CA 1B38A 2EUFB 3BYSA 4GJ3A 4NJ3A 4YBJA 3W2OA 5BVDA 4X2KA 1JWHA 1H26A 1OUKA 1UWJA 2HXQA 2VTAA 4GK4A 4L7FA 5HO7A 3PFQA 2XYUA 5CAQA 1Q62A 4XP3A 3FZTA 1PMEA 3PPJA 5KMMA 4F65A 2XK4A 4JS8A 1YWRA 4WSQA 4YJQA 4ZTQA 3UVQA 3Q2JA 2QODA 4RWJA 3MTLA 4ZXTA 5FP6A 1CSNA 3RK7A 1OBGA 1FQ1B 3DTCA 3FY2A 4IM0A 3ZXTA 3TNIA 2OI4X 2BTRA 4IAKA 4FIHA 3MY0A 3PYYA 1PJKA 2GNHA 4DFZE 1Z9XA 1UKIA 3ELJA 3WE8A 3TIYA 1P14A 3I6UA 2VWWA 4PDPA 4L44A 5EHOA 3NVKI 4WO5A 2CCIA 4FTQA 4RSSA 4FGBA 3PTGA 4DINA 4FEVA 5DT4A 4ENYA 4H58A 4EOIA 1CDKA 4G17A 2VWXA 4K1BA 4HNFA 5E91A 5CXHA 1XH6A 1BI7A 3CQEA 4JDHA 2XA4A 4EBWA 5CAUA 3E3PA 1J91A 5AMNA 3TUBA 2YEXA 2BUJA 5IMXA 5HE0A 2E2BA 2JIUA 2FGIA 5A3XA 3HMIA 2OICA 2J0MB 4DT8A 3QL8A 5KMNA 2XEYA 3BPRA 4CLIA 4KIKB 4LRJA 3ZLXA 5DT0A 3DAEA 4OTWA 4A06A 5A6NA 3DA6A 3E8DA 1MQBA 4DH3A 4LL0A 3MESA 3VS1A 4YHTA 3U6JA 2B54A 2ETRA 2C6LA 3JVSA 5E1SA 5I9ZA 4GFOA 4QRCA 2QO9A 4LMUA 3RHKA 4HZSA 4DLIA 5FTOA 2WXVA 5IUIA 2JAVA 3IONA 4O0UA 1V0BA 5G1XA 2HY81 4YPSA 2XKCA 4QP1A 2B52A 1REJA 1U5QA 4CFMA 1M2QA 4PP9A 3TN8A 3CSVA 2AYPA 2B9JA 3R02A 5CENA 3ZO1A 3SG9A 4JLCA 4FG9A 5CEKA 1XHAA 3OTVA 5F9EA 3U51A 3OROA 5B0XA 3VW6A 2OXDA 4AFJA 5FBNC 2UZOA 5DH3A 4L3PA 3ZRMA 4PRJA 5EM5A 3OZ6A 5IZFA 2Q83A 3P0MA 1ZXEA 2J2IB 4FNXA 2YLFA 5JGAA 5L2IA 4MAOA 3SX9A 3S0OA 3L8PA 2W1ZA 3GC0A 4CT2A 4AT4A 3HLLA 3ZRKA 5BYYA 4JDKA 1RJBA 2Z7QA 4EJ7A 5CNOA 3L9NA 3QZHA 4GKIA 4IQ6A 3VIDA 2ZMDA 5CEIA 5BYZA 4NTTA 4A9YA 2CGWA 3EMGA 3VS5A 3BHTA 5BMSA 3FSKA 4KABA 4AT3A 4EZ7A 4B6LA 3V8TA 2ERKA 3N4TA 4O1OA 4DCEA 4EUUA 2I1MA 2CKOA 4W4YA 4BCNA 4BDJA 2VTIA 2WGJA 1UU7A 3EQRA 2VGOA 3UIXA 2OFUA 1DS5A 3FLQA 3FKNA 2WTJA 5EI2A 2B9HA 1NW1A 3DK6A 3A4PA 3FMNA 3CKXA 2CNQA 2IW9A 5E4HA 4BI2A 3EQBA 4ANBA 4EWQA 2X4ZA 4JBPA 4ID7A 4WIHA 3R8PA 3BBWA 5B2LA 5CAPA 4BWKA 3QCSA 1U54A 1J3HA 4GL9A 3EQIA 4RIWA 2B53A 4UB7A 3V51A 5IQGA 2Q0BA 2YN8A 1XBAA 4MXXA 3P23A 4I24A 3RZBA 4XJ0A 5CF4A 4P4CA 2VTNA 4PDOA 1M7NA 4W4XA 2EU9A 3QCYA 3O96A 2XZSA 5DWRA 3BE9A 4OAVB 5DVRA 2E9UA 5FG8A 2IO6A 2CLQA 1H1SA 3RKBA 4R7BA 3G15A 2C6TA 1YI6A 2OJFE 3D7ZA 3Q5IA 3KK8A 2QOKA 2C69A 2G2HA 3M42A 4IAZA 4S34A 2PMIA 4JOAA 4D4YA 3MY5A 2HY0A 5H2UA 1OIYA 4ANLA 4E8AA 2BHHA 1YWNA 4B99A 3TZ9A 4DHFA 4O22A 5IA4A 1W82A 2LGCA 3QD0A 1XH4A 4DTBA 4NJDA 4F1TA 3FYKX 4F9AA 2OH0E 5FEEA 4LG4A 5LCJA 4FTLA 2A4LA 4AOTA 3F82A 5K4JA 4JX7A 4FSYA 4PMSA 4ZTNA 4MWHA 3QU0A 3WF6A 4AFEA 4EK4A 4F0FA 3C4ZA 1Q8TA 4F09A 4X2NA 1YXTA 2VO6A 3E62A 4ALWA 4XV3A 3FAAA 2GQSA 3E64A 4ZTLA 3DKCA 5CSPA 4CV9A 3WF7A 3LFFA 4I22A 2UZEA 4PTEA 4CNHA 4FTNA 4DH7A 5HEZA 4IX5A 3ERKA 3MPTA 1ZLTA 1TKIA 4NCTC 3VNTA 4QMWA 4ANQA 3GU7A 3UE4A 5FEDA 5G6VA 2PY3A 5FM3A 3PA3A 3RBWA 3RP9A 1GZ8A 2G2FA 2R3PA 3QQUA 3HP5A 3UPXA 4FIEA 4FT0A 3R22A 1J7LA 2O65A 5EDQA 3O71A 4H36A 3GVUA 3Q96A 4BBFA 4QMYA 1OL1A 4KBKA 3F3UA 4U9AA 3W2SA 2XNOA 3GCUA 2NP8A 4FTRA 3MGYA 3A99A 2W06A 5JSMA 3G0EA 3RPRA 2X7OA 4NSTA 3HMOA 4EOOA 2XIKA 4IDVA 4A4XA 4Q2AA 4U42A 3IKAA 1L8TA 2RL5A 3SV0A 4FICA 1TQMA 3JUHA 2V5QA 2FSTX 2WU6A 4GV1A 1GZKA 2NNWB 1OPKA 3KF7A 3QKKA 4XV2A 4JVGA 5DI1A 3TCPA 3TI1A 3HP2A 3VN9A 4CCBA 2Y8OA 4K77A 5AX3A 3TXOA 5EKNA 4FKPA 5IUGA 2HAKA 5FXSA 3S3IA 3K5VA 5AJQA 4RWKA 3CD3A 4XEYA 4TT7A 5DMZA 2GS6A 5DRBA 4DTKA 5ETIA 1F5QA 4FV0A 4DEGA 1GIJA 4AGUA 4ZIMA 3IECA 4NU1A 3NNWA 2OJGA 3K5UA 4HZRA 4MWIA 3BU5A 4M13A 4XBUA 3TG1A 4E26A 4EK6A 3EKNA 2IG7A 3LXLA 4ZAUA 4LV5A 5TO8A 1XWSA 3C5UA 4FODA 2X0GA 3L9LA 1P4FA 3QD3A 3VUKA 4DFYA 4EH2A 2HYYA 3SAYA 3F5GA 3DXQA 3NSZA 2OGVA 3DOGA 3MA3A 4MBJA 1VJYA 3KMUA 3SQQA 2QI8A 4HPTE 4ACGA 5FXRA 1M7QA 4NW5A 2Y7JA 3EHAA 3POZA 4KSPA 4DGGA 4IACA 2XM8A 4TNBA 3SW7A 2UW5A 4XUFA 5FLFA 3H4JA 4FTIA 4IAAA 3MB7A 3OTUA 2YLEA 3FKOA 1OMWA 1G8AA 2JKQA 4HGEA 3UNKA 3KGAA 4KSQA 5J8IA 4DG0E 3V8WA 2W1EA 3HKOA 3EOCA 4AS0A 2CSNA 3R6XA 4M69A 4U3ZA 3LFBA 4FUYA 2VWYA 4HCUA 2VUWA 2VWVA 2F7ZE 5D9HA 5E8ZA 2FUMA 3TV6A 5A9UA 3HVCA 2R3NA 5KKRC 3D15A 3Q4UA 3FI8A 3BYOA 5HICA 4L7SA 3ZM9A 5CF8A 5HIBA 1OL5A 4QT1A 4TW9A 2XIYA 5AR7A 3QTIA 4GEOA 3A60A 3R7YA 3LMHA 3E7VA 3GOKA 2BCJA 3LW0A 4Y85A 4D1ZA 4JI9A 4NK9A 4O21A 4EHGA 2XIRA 3EQHA 2VWIA 2R3GA 4FKSA 3AC4A 4EHEA 3BELA 1FVRA 4OTGA 4WOVA 2WMUA 4CTCA 3ZH8A 3BLQA 4CZYB 3PWYA 2IN6A 2PK9A 5FEQA 2WB8A 2YDJA 2ZM1A 4KBCA 1JSUA 4O7LA 3LCOA 4PV0A 2W1CA 2XRWA 3UO4A 4A9SA 5HIEA 4AN9A 3WOWA 3R04A 5J5TA 1H01A 5AADA 3R7OA 4EJNA 3W33A 3O8TA 4JAIA 2V7AA 5FM2A 3GT8A 1RE8A 2X2LA 3W16A 4C35A 1OKYA 1ERKA 4IX4A 4CG8A 4YZDA 3A7GA 2YDKA 4J97A 5CT0A 3VRZA 5C01A 3PDTA 5HTIA 2QOIA 5KCVA 3F5PA 1H28A 4QMMA 2ITWA 3E63A 5BUIA 3G0FA 4C0TA 3RMFA 3F3ZA 4GU9A 5E92A 4YSMA 2ONLA 3F69A 5L2QA 4J52A 5IQAA 4J71A 3DAKA 4FKQA 5C8NA 1JLUE 2RFNA 2WFYA 3QQFA 2JIVA 2ITTA 3QQHA 4L53A 4AZWA 5K0XA 3QQJA 2BZKB 4UXQA 4JNWA 3I5NA 3JVRA 4WNPA 2QOBA 3Q60A 5AP2A 3V5QA 4IAFA 2PVJA 2F2CB 2YAKA 2GPHA 5CU0A 5BNJA 3D14A 4JT3A 2XNBA 3LAUA 4MXCA 3UQGA 3W1FA 3IPHA 5E8WA 4PMTA 5KHXA 4I6HA 4II5A 4I4FA 4IVDA 4D0XA 1W8CA 3OCSA 3SVVA 4D1XA 4MQ1A 3SGCA 5EHLA 4LUEA 3A2CA 3Q9ZA 1JSVA 3CD8A 3ZBFA 2IZTA 4EWHA 3NUNA 3FJQE 4QPSA 4FKIA 5HQ0A 4UMQA 1OIUA 3BQCA 2C68A 2VGPA 3O7LD 3R9DA 3RM7A 4YJTA 2QOLA 5A46A 2QCSA 5ANEA 1STCE 3UOHA 5DIAA 4KBAA 2V55A 4GVAA 3V6RA 4N4SA 3ZEWA 1JKKA 2GSFA 4FSZA 3A61A 3EL8A 3THBA 3ZTXA 3Q32A 3LCTA 5M55A 3QC9A 1KWPA 2P33A 1WAKA 4IVAA 4GK2A 5JFVA 4FGRA 4GCJA 3WE4A 4A07A 4B8MA 4CD0A 5HIDA 4OTIA 2XB7A 4LM5A 3MVJA 2O5KA 2QR7A 4C2VA 2QVSE 3LOKA 2GNGA 3EQDA 3ORLA 1OVEA 3PXRA 4EOJA 5BVOA 3R30A 5HVJA 2XCKA 4RWLA 1Q61A 4F99A 5F4NA 3RK9A 5IDPA 3GC8A 3ORXA 4H3PA 3FQHA 2BDJA 4I20A 2OZAB 2HXLA 4LQMA 3RTPA 1GOLA 4PL3A 2OSCA 3WZUA 4ZZOA 3ORMA 4K33A 5KE0A 2CCHA 2VZ6A 4KD1A 4F08A 3KCKA 1WBTA 4UBAA 3KA0A 3RZFA 4CQGA 1H1RA 2BIKB 3DXNA 3UZRA 3NZ0A 1XBCA 4FTJA 5EHYA 2HW7A 4U6RA 1MQ4A 2OJ9A 2VD5A 3FUPA 5LVLA 4ZY5A 1YXSA 2YM5A 1IASA 5CT7A 5AV1A 3HA6A 4C36A 3QTZA 4KWPA 4PPBA 3COHA 3VO3A 5HG7A 4USFA 2BAQA 3BYMA 2IZRA 5M4UA 5AAEA 3ZDUA 4J95A 3OCTA 3UIUA 1GNGA 4W4WA 2PVNA 1XH8A 4E5WA 3FMHA 4IM3A 3KXNA 3NYXA 4RA5A 4DH5A 3FI3A 4W9WA 2ITYA 5EI8A 1E9HA 5HBHA 2DS1A 1U54B 3QCXA 4MBLA 3PG1A 5IKWA 4BL1A 3L8VA 4FYNA 4H3BA 5E8VA 5IH4A 3VF9A 2ZOQA 3KB7A 1ZMWA 4QYEA 4FV2A 4Q5EA 3UG1A 2CKEA 4GT3A 1I09A 4YHFA 3EN9A 4ANNA 3AGMA 4EH5A 4WT6A 4JBOA 3CQUA 4U43A 4C4EA 3L1SA 1Q8YA 2GTMA 3CPCA 4MNFA 4QD6A 3D9VA 3VVHA 1LR4A 3ZZWA 5GIPE 1L3RE 5HESA 4IHPA 3CQWA 5H8BA 1SM2A 3D7TA 4BKYA 3FZOA 1M2PA 3QTWA 3PJ3A 4E93A 4C7TA 3MFSA 3HV4A 3HEGA 5F1ZA 2UW4A 3OW3A 3NW7A 3R01A 3FZRA 4OR5A 5D1JA 4LYNA 4YJPA 3W8QA 4IB0A 2PTKA 4IM2A 5A4EA 4BCPA 1IAJA 3MY1A 5KMOA 3MI9A 4CLJA 3FL5A 2C4GA 3FMDA 5LJJA 4R6VA 3LVPA 3RK5A 5IMEA 4GT5A 1UU9A 4G5JA 3V04A 5IG1A 2RF9A 3UPZA 3PJ1A 4HNIA 3SKCA 1OECA 3VS7A 3PIZA 3HECA 2YIXA 3EL7A 3F2AA 3NUUA 3RNYA 3DLSA 5CU4A 3DBCA 5JMSA 5D10A 3L9PA 2GHLA 3QA0A 1Q8ZA 1PMUA 4ONAA 4XV9A 4Y95A 3WYXA 2I0VA 2EB2A 3U55A 5L8KA 4YP8A 3TNPC 3ORPA 2IW8A 2I40A 4RRVA 3QXOA 3H0YA 3OF0A 3R1QA 2OBJA 2WMTA 3GCVA 1V1KA 4DT9A 4F6UA 3RAHA 4AGWA 4F9YA 5HE3A 3D0EA 2Y4IC 3R8VA 5HBJA 4A9RA 4U81A 4ZEGA 1SMHA 3LCDA 4ZOGA 4GIIA 2OU7A 2CJMA 3I79A 4YO6A 4DEBA 4WKQA 3D5WA 2I0YA 3HUBA 4DFLA 3T3UA 4O2PA 3DFCB 5J7BA 4L42A 5L6OA 2BRHA 5TR6A 1Q97A 2YIQA 3MB6A 1OPLA 2XUUA 3FMKA 4D28A 4Q9SA 4MF0A 4DFNA 1Y6AA 3RAKA 3EN5A 5IH5A 1QPJA 4GT4A 5EW3A 3DB8A 3Q5ZA 3QF9A 2BRBA 3UQCA 1P5EA 4YLKA 4OGRA 3O7LB 3Q6WA 4XX9A 3CR0A 1SVEA 4I6FA 4B7TA 1JQHA 1PKGA 2FA2A 4M68A 1URCA 5E8UA 5DFPA 4E6AA 2RIOA 5CF6A 3GU5A 4DITA 1U5RA 4ZTHA 4BCJA 3KF4A 2ACXA 4GVJA 2UW7A 3NX8A 3VS2A 2BRGA 3EYHA 2UZUE 2HZIA 2QKRA 2PHKA 5M4FA 3CCNA 4C33A 5L2SA 5DEWA 3R63A 2PE1A 4D2RA 3F9NA 3SOAA 2W1IA 4C58A 4FX3A 1YDSE 2QONA 4IE9A 1G5SA 4KIQA 4ERWA 2WQBA 3A8XA 3CTHA 2J0KA 3OUKA 4EKKA 5M51A 5J1WA 4I0TA 4C4GA 4I0RA 3W18A 5EG3A 3LXKA 4AA0A 4U40A 4ASZA 4K2RA 3MDYA 3MFRA 4I4EA 4TZRA 3KCFA 1K2PA 4D58A 3W8LA 4R5YA 3RCDA 5JT2A 4EOPA 2GFCA 1J7UA 5D7AA 4ALUA 3P5KA 1DM2A 2WQNA 4XLIA 3MIAA 1XH5A 3E3BX 4O0WA 4PL4A 3O17A 4BIEA 4RVTA 2XNGA 2P2HA 3PVGA 4RC3A 3PLAE 2UZNA 2W7XA 4FKTA 4CZTA 5CYIA 4O86A 2R64A 4BTFA 4G6OA 4QMPA 3AD5A 3O8PA 5IEYA 4GH2A 4YC3A 1WMKA 5H8GA 4FT7A 3HV5A 5EW9A 4BR3A 3OFMA 3U6IA 1YI4A 4C3PA 1PXOA 2Z7SA 5DHJA 3ZSGA 2P0CA 3QRKA 5D7VA 3PY0A 3HDNA 4X3FC 1QMZA 3TUDA 2BTSA 3MIYA 2YABA 2W96B 3HV3A 3U9CA 2F7XE 3UZTA 2FH9A 4FZAB 2QLUA 3TUCA 1BYGA 5LMKC 3AG9A 4BDAA 2R9SA 5EI6A 3LXPA 2KULA 4DA5A 4G34A 4N0SA 5KMLA 3LPBA 5J95A 4V01A 3U9NA 4P90A 5EFQA 3CIKA 2Z7RA 4X0MA 3UIBA 1O9UA 4BICA 4FV9A 2WAJA 1QL6A 3PP0A 4OBPA 4ZMEA 1KSWA 2QU5A 5AR4A 3WF8A 4D4SA 2XRUA 3MPMA 4NKAA 1FBNA 2ERZE 2XIZA 3MTFA 4Z16A 2XJ2A 3EQGA 1ZWSA 4O84A 3ZCLA 5HCZA 2OH4A 2JGZA 4F64A 3DQXA 3RNIA 4IW0A 5EQPA 3KRJA 2JIIA 2X2KA 5IPJA 3ZS5A 2Z2WA 5A4CA 5IU2A 5IEVA 3UYTA 5IQHA 4W8EA 3C5IA 5JRSA 4R77A 5HE1A 5JN2A 4XG7A 1LEZA 3T3VA 2BZIB 3E93A 4L9IA 4UWBA 5FTQA 3TV4A 3UOKA 1K3AA 1KE7A 2JFLA 1FGKA 2YCQA 3Q3BA 4FBXA 3ODYX 5BVFA 3FEGA 2W4KA 3FPMA 4HYIA 5LOHA 3Q53A 1ZMVA 3KY2A 2X9EA 2YIYA 4AA5A 1NVSA 2HCKA 3W2CA 4R1VA 1WBOA 3TZ8A 3GQIA 2HZ0A 3K54A 2IZUA 4L3JA 4EZ5A 2EB3A 3FQEA 3VF8A 4DFXE 1TQIA 2ITNA 3RAIA 4TYEA 3BWFA 4V05A 3EFLA 4C4FA 4QNAA 3KXMA 1YW2A 4C8BA 5ANGA 2ESMA 1B39A 1IRKA 4XLVA 5AUWA 5KMJA 3TDWA 4D1SA 4G9CA 5HTBA 5LVMA 2ZJWA 2R3HA 3PA4A 5KBRA 3Q4ZA 4RC4A 1Z57A 4DEIA 4I5HA 4UYNA 3RWQA 4BC6A 4C61A 3QGWA 1KOAA 1OL6A 3LFDA 4JR3A 3ZXZA 1PMNA 1UKHA 2HIWA 2R0IA 3LKMA 3TNQB 2A2AA 2VU3A 5I9WA 1V0PA 5AP5A 4C59A 4TPTA 2AC3A 4BCMA 4RJ7A 4BFMA 2RFDA 1Y91A 3JPVA 4FEQA 4RFMA 3PVWA 3WZJA 2W1DA 2C1AA 3CS9A 3HMMA 4FSNA 1ZAOA 4IMYA 4XH6A 3Q9WA 4XBRA 2ITUA 2BAJA 3H9OA 3R0TA 3R2YA 5CSWA 4ACMA 4BIBA 5BQ0A 5K5NA 4IJPA 5M56A 5DT3A 2WTKC 3ZM4A 1PYEA 3EYGA 2BKZA 4DAWA 4F4PA 4IWDA 4Y73A 4AZSA 5M53A 4ZZMA 2IVSA 4QNYA 1TVOA 4F1OA 2PU8A 2WMRA 3W2QA 2RG6A 5AEPA 2W4JA 2R3MA 1Y57A 5GJDA 5A54A 5IA3A 3VS6A 4CMTA 4ANOA 2E9VA 4DF3A 2BHEA 3FKLA 2O0UA 2JDRA 4BWXA 5F94A 1WBVA 2PZRA 5D41A 2PUNA 5HU3A 3V6SA 4IWOA 3F66A 2XH5A 2C47A 1J1CA 4BWPA 3ZSHA 3E88A 4XYFA 3REPA 5DN3A 1RDQE 5CZIA 3TL8A 3ZLSA 3UGCA 3CY3A 2HOGA 3OEZA 1E1VA 2OZAA 3HMPA 5DPVA 3S00A 3AC5A 2OLCA 4C38A 3R7IA 3C4CA 1GAGA 4JDIA 5LMAA 3E5AA 4GUEA 5A14A 4ZTMA 5BVNA 5HCYA 1J1BA 2I0EA 4I1ZA 3TDVA 2I0HA 3NIZA 3SLSA 1BKXA 3MVHA 2WIHA 2CGUA 3C4FA 2R2PA 5DYJA 3D7TB 2UZBA 2BPMA 4FL1A 2YIRA 3PZEA 1PKDA 3DBDA 4G5PA 4R7HA 2XEZA 4IC7A 4FV5A 1VYZA 5DEYA 4D2TA 5CWZA 2JD5A 3EKKA 2X7GA 5HNBA 5E9EA 5AP1A 2QOHA 3G5DA 2W05A 4M14A 3AMYA 4ACHA 3Q6UA 5EK7A 4LRMA 4QP3A 4RJ6A 4D2PA 4D4VA 3MFUA 4KRDA 5BX0A 4QMOA 1OZ1A 4EH4A 3PIXA 2W9FB 4C4HA 3A7JA 4RC2A 2YM4A 2VTSA 3R7EA 1WZYA 2G01A 5FTGA 1GIIA 3BU6A 4B4LA 5HX8A 1OBDA 5HZNA 4OTQA 3Q52A 4IB3A 3ZO2A 4DBNA 3PLSA 2QURA 2PVYA 1JKTA 2R3LA 5I4NA 3QA8A 4AF3A 2X8DA 2OIBA 3CE3A 4PNKA 3PSDA 5IQIA 2G9XA 1ZOGA 2WMXA 2VWBA 4QYYA 2O8YA 3A7HA 3LQ3A 4YNEA 3FLZA 3UTOA 5EKOA 4ZLOA 4JR7A 4GRBA 5T68A 4ERKA 3U87A 5I9YA 3G6HA 4NCTA 1P2AA 5M09A 4BGHA 1Q8WA 5FXQA 5A6OA 2R3OA 5CALA 3ZDIA 2HZ4A 4EEVA 5GZ8A 3DAJA 3H0ZA 3EQCA 2KTYA 2WTDA 2OG8A 2ZDTA 2XIXA 3LLTA 4PTGA 5AAGA 2REIA 3NNXA 4E20A 2Y6OA 1BX6A 3QC4A 3FZ1A 3OT3A 4RZVA 1URWA 3WIGA 4GYGA 4IANA 3S95A 1I44A 4FTUA 2IWIA 4YTHA 4RX7A 3DK3A 4JQ8A 4KRCA 5L6PA 2IVTA 5TF9A 3QTUA 5TKDA 4ZK5A 3G90X 4I0SA 4YJUA 3FI4A 3MVMA 1AQ1A 1SVHA 3M1SA 3VUIA 3IS5A 4UEUA 3CBLA 5KX8A 3HAMA 4LGHA 3DTWA 5FBOA 3O23A 3D2KA 2P2IA 5B7VA 3ZRLA 4AW0A 4WRSA 4QP4A 3I6WA 4WHZA 4JJRA 3GCPA 4L52A 3FLWA 4FTMA 1KE6A 4E4LA 4ZJVA 2QC6A 4MXAA 4EHVA 2UZWE 2ETMA 2WOTA 3MFTA 3FPQA 3UMXA 4NIFA 2F57A 5F20A 2HENA 3DGKA 3QCQA 4MHAA 2A27A 1MRUA 2R5TA 3F3VA 3WF9A 4DC2A 4DYMA 4DCAA 1YXVA 4YJRA 3SW4A 1IA9A 2BDFA 3LM5A 4QP2A 5I9UA 3R7UA 4DE4A 2QHMA 3C4EA 5BYLA 2OJIA 3UOLA 3MH2A 4TYHB 5T3QA 4B0GA 1TQPA 2ZVAA 3I60A 5DBXA 5CEQA 2C3KA 3NEWA 3BIZA 3D4QA 2R3IA 2GMXA 3IK3A 5GZAA 4H05A 4EYMA 2PMNX 3OP5A 1U46A 3VJNA 2WTWA 2WHBA 5ANIA 1SZMA 4FKOA 4L45A 3GU4A 3UVRA 2XK6A 3KFAA 3NLBA 3ZHPC 1X8BA 3NUAA 4ACDA 4ASDA 4BB4A 2C5OA 4Y72A 2C5VA 2OFVA 4DG3E 3QLGA 3C0IA 3QQKA 4WG3A 3LMIA 2CMWA 3NUXA 2QG5A 2R3RA 1ND4A 4O96A 4PQNA 1OI9A 3ZSIA 4EC9A 4UZDA 3TNWA 2VTLA 1JKLA 3ORIA 3K2LA 3FDNA 3DS6A 5J7HA 3CGFA 3LFQA 2HELA 4YNOA 4GG7A 4GK3A 4Y8DA 2J0JA 2B55A 3VS0A 1ZRZA 4JG6A 5IQDA 3IOPA 4OTPA 1PXIA 5AP0A 4F6SA 3OOMA 5BMMA 1G3NA 5HGIA 3DBQA 1JPAA 5CAOA 4EH9A 1LP4A 3ALOA 3BV2A 1Z5MA 4YJNA 3DKGA 4AQCA 4CKIA 3EFKA 3VJOA 1V0OA 4WNOA 4AT5A 2YISA 3KQ7A 2Y4PA 4ENXA 2PVKA 2JC6A 3W32A 1U59A 3ZMMA 4NYEA 5JZJA 1H0WA 2R3QA 2ZV7A 5I3RA 4FIFA 1YXUA 3MH0A 4ZSLA 2QOOA 4AWIA 3QUDA 2XS0A 5CEOA 4NH1A 4HCVA 1FVVA 4IB5A 3AOXA 3LFCA 3R7GA 4MD9E 4QMZA 1YWVA 4XV1A 3Q04A 4FV1A 4AE9A 3OC1A 2YJRA 1Q8UA 2PZIA 1WCCA 3MVLA 4R8QA 4BCQA 1PHKA 1YHVA 3SOCA 1NA7A 4QTEA 4DH8A 4ZP5A 4WSYA 1UV5A 5CEMA 2GQRA 2VV9A 5H3QA 3OOGA 3DQWA 2J50A 3P7BA 1WVYA 3F2NA 3FV8A 3LJ2A 4KINA 4QMSA 4F63A 2O3PA 4YLLA 4AGCA 3QQLA 2PVFA 4TKSA 5ETFA 4U3YA 3SRVB 4F9CA 4FT3A 2CPKE 4FNYA 3EH9A 5DOSA 5AP3A 3LJ0A 4P5ZA 5BVKA 5IEXA 3RI1A 4E5BA 3BWJA 2GU8A 3DY7A 4G2FA 3OWLA 2WO6A 3FMJA 3ZONA 4BDKA 1OIRA 3ZZEA 4I21A 4GS6A 3DKOA 3QZIA 4L01A 1PXLA 5E8TA 5IF1A 4G9RA 4EK3A 4HVIA 4X7QA 1PXMA 3HA8A 3IW4A 2CGVA 1R39A 2FSOX 2VTRA 4EI4A 4TXCA 3B8QA 4QMQA 3SHEA 1YDRE 2V7OA 1FINA 2V62A 3PXQA 3OY3A 3Q4CA 4TY1A 5FQDC 4E7WA 3MH1A 3FZSA 5C27A 2VTTA 3V3VA 2YACA 4U45A 3RHXA 2XCHA 4USEA 5M44A 4L6QA 4AN3A 3EQPA 4EL9A 1SNXA 4FEUA 2VX1A 5J87A 4O7RA 3S2PA 4ASXA 3NWWA 1LUFA 4IH8A 3PY1A 5C03A 3DFAA 4J98A 2FSLX 3PIYA 3C9WA 3U8WA 2RG5A 3F5XA 5IA2A 3V01A 4D2SA 4O0YA 4RFYA 3KRLA 5FRIA 2BR1A 5HBEA 3ATTA 4AZVA 5GJFA 1SYKA 4L43A 4NM5A 1Q3WA 2IVUA 3LIJA 5CLPA 4MX9A 3COIA 3QRTA 5HE2A 5JKGA 4BCHA 3SG8A 1A9UA 1ZMUA 2HW6A 4FSUA 4OLIA 2YCFA 4PPCA 4PTCA 1H07A 3HV6A 4XP0A 5ANKA 3VBYA 4S2ZA 2V0DA 2C5YA 4BIDA 4G31A 4O91A 3CKWA 3DU8A 1W83A 2CLXA 3DPKA 3QHWA 4HYHA 3ET7A 4JDJA 3LMGA 4J99A 4YC8A 5EDPA 2H6DA 3U4WA 4CRLA 5IA0A 4CKJA 4RJ4A 1Q4LA 4OT6A 3ACKA 3QD4A 2C3JA 3RGFA 3JY0A 3OCGA 3VUHA 4FA2A 1QPCA 2Z8CA 1UWHA 3VBVA 3D5UA 2RFSA 1PY5A 4QP7A 3V5LA 4S30A 3R9NA 4BZNA 4WNMA 2YIWA 4PWNA 2UW3A 1OM1A 4CCUA 1IA8A 4JRNA 4NUSA 3ZLYA 3IQ7A 4X21A 3C1XA 2UW8A 4QQ5A 4O0SA 2JDSA 4AOJA 5HOAA 4DGNA 4BZOA 2XM9A 1S9JA 3BEAA 3L9MA 3C4WA 3T9IA 4LI5A 4QMLA 4O0TA 5CVGA 5AV4A 4IZ5A 4UMRA 3DCVA 3FHRA 4HCTA 5IISA 2O64A 3UBDA 3I81A 4YZBA 3UP2A 4BCKA 1ZYDA 4EUTA 5EOBA 5CZHA 2GNJA 4FC0A 4G6LA 4CKRA 4F7NA 4UMPA 3PXZA 4XNEA 3LJ1A 4YPDA 3OCBA 3LCSA 3QALE 5CU2A 3I7BA 4DLJA 3EZRA 1YI3A 3DZOA 4I6QA 5KBQA 4O0XA 1LPUA 3VQHA 3ZYAA 4EORA 5GJGA 4YZCA 4E73A 2UVYA 4FT9A 4Y46A 4HGLA 2PMLX 4KNBA 4XG4A 4LMNA 2JKMA 4O7SA 3MA6A 3CJGA 3PY3A 4ZSGA 3WZEA 4RQKA 4YC6A 2BFXA 4NM3A 1H1QA 4QP9A 2J0IA 3NCGA 5CASA 4O7WA 2JLDA 2J5FA 4I94A 2B7AA 4KUJA 2J51A 4BTKA 5C8MA 4R5SA 4KKGA 2C6IA 5EM6A 4K11A 3R00A 2BAKA 4GIHA 4O7ZA 4JRVA 1GY3A 3WI6A 3QZGA 2XNPA 3FC2A 2ZM3A 3R8LA 5DNRA 2YZLA 3AT3A 3FC1X 2PZPA 3GGFA 4KIOA 3BU3A 4FV3A 1OL7A 3SD0A 3UC4A 3IW5A 2YZAA 2YWVA 3C4XA 5L4QA 2E9PA 2Y0AA 1H8FA 1A06A 5HD7A 3W55A 4EHZA 2PYWA 5ACKA 4CGAA 5EYCA 5AA8A 4FG7A 2YJSA 2YCRA 4FG8A 4S33A 5EOLA 5FD2A 4WG4A 3AD6A 5CVFA 5AAFA 4D9UA 5LQFA 1ZZ2A 5FWKK 1PYXA 4MXOA 5JRQA 2YM6A 3F5UA 5AUVA 5K9IA 1QPEA 1UVRA 3ATSA 4ZS4A 1Q5KA 2VWZA 4BYIA 1YOJA 2H34A 2EXEA 2PVLA 2W5HA 4OTHA 4U41A 3F2RA 5CS6A 5I3OA 4RIOA 4LOPA 2WTCA 3BHVA 5KO1A 3E8EA 1ZYCA 2VO7A 2WMAA 3IO7A 2YERA 3KXXA 2R7BA 4G3GA 3KVWA 2EWAA 3MSSA 4QQCA 4FEXA 2JKKA 5JFSA 2H9VA 4TYGA 4I5MA 2X8IA 3PE2A 3VHEA 3AC3A 3V8SA 1ZOHA 1SNUA 2BMCA 1M2RA 4AACA 3WIKA 2B0QA 3C51A 3WZDA 3ENMA 4YMJA 1CM8A 4NIFB 3MYGA 5EM8A 4P5QA 4ZY6A 3OS3A 3LQ8A 3VBTA 2VO3A 5KMKA 3C0GA 4IVCA 4G3FA 4R7IA 3OUNB 3RPSA 3AD4A 2X2MA 1PXJA 4FTOA 5AP7A 4MNEB 2H8HA 3UYSA 1MP8A 1REKA 4QMXA 1NVQA 1CMKE 2UVZA 3QYWA 3QX2A 5E8XA 3W2RA 1A48A 3PRFA 3PWDA 2QO2A 1S9IA 3BYUA 3AMAA 3F3WA 4XRJA 5DA3A 3WARA 4F0GA 5M4CA 1E1XA 3FSFA 4FE2A 1H24A 2WQOA 5DE2A 5HX6A 3R9RA 4FSWA 4FSQA 2VTJA 4O0RA 5J5SA 4O7YA 5HLPA 3QKLA 4BHNA 1OUYA 2OXXA 3FXWA 3GEQA 3AC1A 3C50A 4RWIA 3UO6A 4E4XA 3VUTA 4I93A 3R9HA 3IW7A 4ZTRA 5KUPA 4ZJJA 4GSBA 4JG8A 4G16A 2HWOA 4XG3A 2VX3A 3LE6A 4M66A 4YJOA 3MS9A 2XK9A 4U7ZA 4WA9A 4Y5QA 3AC2A 2CDZA 2ZAZA 3O8UA 2WTIA 4W4VA 4FEWA 4MYGA 4I41A 4L00A 4QQJA 4E5AX 3ZU7A 2P3GX 2UVXA 4QTDA 4XG6A 2QQ7A 4J8NA 3H30A 1YKRA 5HI2A 3DNDA 4TYHA 2NRUA 2QR8A 3TKUA 4DEDA 1OPJA 4C57A 5CAVA 5KKRB 3CPBA 4YSJA 3GFWA 5AP6A 4C3FA 4NW6A 4F7LA 4U8ZA 2J90A 2G1TA 4YLJA 2XKEA 4TTHB 2X39A 5GIOE 1BUHA 1ZOEA 3KXZA 3ZC5A 4F7JA 3I1AA 2HWPA 2WMWA 4X3JA 5DRDA 3KN5A 4ZLZA 2OW3A 2X81A 2Y9QA 5JQ8A 4KS8A 4X2JA 2QO7A 4MEDA 4A4OA 3CEKA 3TV7A 2GFSA 3QD2B 4YTIA 4X3FA 4CV8A 3QGYA 4D5KA 4MQ2A 1H1PA 4QMTA 4WD5A 4RX9A 1YOLA 2H96A 2J4ZA 2WTVA 5LMKA 2OJJA 3UDBA 4EH3A 4JBVA 1UNHA 1KV1A 4KKEA 3OXTA 1YXXA 4C4IA 2OIDA 4QMNA 4WBOA 2J7TA 3PPZA 3KULA 2IW6A 4HPUE 2VNYA 3NW6A 4XHKB 4FKGA 2W1FA 2WQMA 3KL8A 1MRVA 3CP9A 4MVFA 4R1YA 4FVPA 2BROA 4F1MA 3RJCA 2WMBA 3PRIA 5A4TA 5L2TA 4BDBA 3ZFXA 2G15A 3UQFA 3EFJA 3P4KA 4QTAA 3BCEA 3LHJA 1BMKA 4Y83A 3LCKA 4C02A 4M3QA 5ETCA 3CY2A 1ZY5A 5C26A 5BVWA 5JH6A 1F3MC 2WMVA 4RT7A 1MRYA 2BFYA 4FKVA 4I5PA 3HAVA 2UZLA 3CJFA 2GHGA 2W17A 4UXLA 5E8SA 3R8UA 5K4IA 3NDMA 3CTJA 4M12A 4CMOA 3A8WA 4EH7A 4JG7A 5AR3A 5K5XA 2GS2A 1H0VA 2DUVA 2X8EA 3AT4A 3NYOA 4D2VA 4F6WA 3AT2A 1IEPA 3DZQA 3PE1A 4E6CA 3IDPA 5B2MA 3WBLA 4IIRA 4EOKA 5IQEA 4QQTA 1GZNA 3B8RA 2B4SB 2XBAA 4H39A 2WELA 4BKZA 3ACJA 5JGDA 3QHRA 5CNNA 3HV7A 2B9FA 4G3DA 2V22A 3PA5A 5KHWA 2R0UA 3A7FA 4FTCA 4U80A 4F0IA 4IDTA 4IX3A 3ROYA 3ULIA 3DJ5A 4KIPA 3GC7A 2BRNA 4YJVA 4XOYA 3IGGA 2CNVA 5LVOA 4AZFA 4PY1A 5ANJA 3P1AA 1DI9A 3OVVA 4CMUA 5CTPA 3SRVA 3TT0A 3FI2A 4FSRA 4U97A 2WEVA 1DAWA 4PNIA 1JKSA 3NIEA 4PMPA 2BZHB 5AP4A 3QFVA 3P08A 4RLLA 3BLHA 4G3CA 3DLZA 4R3PA 4DEEA 3IOKA 2XMYA 2BILB 1WVXA 4FV4A 4CFFA 4I6BA 1VR2A 4BCGA 4K18A 3TJDA 1O6YA 3MV5A 2RSVA 3G9NA 4K0YA 4DGMA 2PUUA 2RGPA 5KMIA 1R78A 4ACCA 2ZDUA 2XYNA 4YJSA 3BLRA 5EYMA 5AUUA 3D2IA 4C34A 2PL0A 4PMMA 4RJ5A 4KA3A 1NY3A 3QWJA 3BI6A 4APPA 1O6LA 3AC8A 3SXRA 2HZNA 2NO3A 4RJ8A 1IR3A 1Q3DA 3GUBA 2PPQA 3CXWA 4NM0A 5C9CA 5L6WL 3JXWA 2GQGA 4CFWA 4EH8A 3UODA 3NAYA 4YZ9A 4RLKA 3TWJA 2JFMA 4DGLC 3F6XA 1APME 4D0WA 4DG2E 3W2PA 3OY1A 5DR2A 3UZPA 4JL9A 4ARKA 4FMQA 3BHHA 3QZFA 3DDQA 4BBEA 2QOFA 4CVAA 1W98A 4CFNA 4LFIA 2Y6MA 1KE8A 3FY0A 4PP7A 3D83A 5KZ0A 4YBKA 2J6MA 5EYDA 4QP6A 4ZMFA 3ODZX 5IDNA 2PUPA 1H00A 5I9VA 4FZ7A 3ZBXA 2IVVA 2YDIA 3R1NA 4FI1A 5AV2A 3VBXA 4RIXA 5JEBA 2P55A 5E90A 2I6LA 1CKJA 4ZSAA 4NKSA 1QPDA 5HD4A 5JGBA 2RKUA 4H1MA 4RIYA 3UNZA 3LFNA 3F3TA 3W10A 2X6EA 3FMLA 4LV8A 4UMUA 5C8KA 2DWBA 3R73A 1H25A 4O1PA 2UV2A 3T8OA 1KE5A 3EJ1A 2WD1A 1ZYLA 3ANQA 3SXSA 4FKUA 5DGZA 5JFXA 4H1JA 5I0BA 5K0KA 3VUMA 3DJ6A 3DNEA 2AC5A 2BKKA 2C0OA 1XBBA 5A4QA 2WMQA 2W5BA 4AZEA 3NYNA 2GHMA 1R1WA 4BKJA 2B9IA 2E9NA 3FLSA 2BRMA 4GYIA 3FWQA 3KK9A 4ASEA 5AUXA 3V5TA 4TL0A 3QRIA 2VWUA 1CKPA 2C1BA 2PVMA 1XKKA 5CQWA 3PXYA 4QPMA 3P86A 3K3JA 4M97A 2JITA 4NL0A 5DR6A 4V0GA 5KZIA 4ZJIA 4MTAA 4O38A 4K8AA 1UU8A 3IGOA 4ZZNA 5B2KA 3MJ2A 1UA2A 4BDDA 3DXPA 4AP7A 1JOWB 1M17A 4FIJA 2Z02A 1WBNA 2C30A 3PP1A 4FTKA 2OWBA 3NNVA 4OTRA 1FMKA 3I5ZA 4QP8A 1YOMA 4UV0A 2XVDA 2YCSA 4JXFA 3GOPA 5I5ZA 4IXPA 2JBOA 3NCZA 2FB8A 4D2WA 5AV0A 4B9DA 3P78A 3ORNA 1ATPE 4AA4A 4CZUA 4EZ3A 2JEDA 5D11A 4CFXA 5J9YA 4LRKA 5T6KA 4J1RA 4O81A 4E3CA 2HK5A 4J96A 4X2FA 2Z7LA 4O7TA 4HYUA 4BY9E 3OXZA 2Y4IB 3V5WA 4B8LA 3HRBA 4O83A 2BVAA 4O7NA 3QQGA 1BL6A 4U5JA 2QD9A 3TNHA 4JBQA 4JQ7A 2QKWB 3ETAA 4N70A 5DR9A 4YZNA 3BQRA 4O2ZA 3CLYA 2ITOA 2EXMA 4M0YA 5HG9A 3V5PA 4AW1A 4GFGA 3ROCA 3ZEPA 5M08A 2ZB0A 3PPKA 4WG5A 2OKRA 2VTMA 1IAHA 3OEFX 4O82A 2ITZA 3EWHA 2J0LA 4IX6A 5E7RA 2F7EE 3C0HA 4MKCA 1GIHA 4AXAA 4PL5A 3FBVA 3KRXA 2UUEA 5E8YA 3MBLA 2O63A 3A7IA 1BL7A 4TYJA 5CI6A 1OITA 3DT1A 4ZLYA 5HTCA 3UOJA 2VRXA 3LLAA 2W4OA 3A62A 5ANDA 4BVUA 1OIQA 3ORTA 5AIRA 1WBPA 3EN7A 4E1ZA 4KKHA 1JSTA 3BV3A 4RX5A 3ZO3A 2JKOA 1AD5A 3FLNC 3OHTA 4CQEA 5HVKA 4R78A 2PVHA 4OBOA 1UU3A 2C3IB 4D55A 1W0XC 3HX4A 4R3RA 4TWOA 4D9TA 3I0OA 4X2GA 1GJOA 4RFZA 4BGGA 4GU6A 5LWNA 2QOCA 3BGQA 3OMVA 2RFEA 3D5XA 3RAWA 5HVYA 2ZV8A 2YAAA 5ACBC 3DDPA 4A9TA 4FF8A 5AWMA 3QLFA 4AX8A 3IDCA 4CFUA 4XG2A 2F9GA 3O0GA 5L3AA 3O2MA 2SRCA 3QAME 2G2IA 2F4JA 2VN9A 4HYSA 4TNDA 2A19B 4CT1A 5ICPA 3MH3A 3BGZA 4EOLA 3HRFA 3N4VA 2JAMA 1RW8A 1W7HA 5HLNA 4IEBA 3ZUUA 5ANOA 5HKMA 5CXZA 4MNEA 2C6DA 1FPUA 3BE2A 2C6MA 4FIGA 3PJCA 4EONA 3O50A 4WUAA 4BDHA 4AE6A 3MW1A 3R1YA 3OWKA 4NTSA 4FKRA 2YHVA 3FL4A 4M0ZA 3RPOA 4E6DA 2P4IA 5JK3A 2CN8A 3GNIB 4FVRA 1XR1A 3PXFA 4QPAA 5AX9A 3AXWA 3G51A 5HCXA 5LXMA 4IZYA 2DQ7X 3F7WA 4F7SA 4LGGA 1XJDA 2UZDA 4EH6A 2UW6A 3OWJA 1FOTA 3VQUA 3H9RA 4F9BA 2QU6A 4WBBB 2VO0A 3F88A 1YRPA 4Q9ZA 1KUTA 1K9AA 3CC6A 3I7CA 4LOOA 2X7FA 4S31A 3RWPA 2R7IA 3MJ1A 1NXKA 4X3FB 1M52A 2EXCX 3BGPA 4KAOA 2X4FA 1VZOA 3KXHA 4QTCA 1JAMA 4FK3A 1OKVA 4UMTA 2Q0NA 4LL5A 1Q41A 2A1AB 2ZM4A 5F95A 3DK7A 2CGXA 4L68A 4AGDA 3VW8A 5IUHA 2F2UA 4XCUA 4RVKA 2AUHA 4HVHA 2GCDA 4JAJA 3R8MA 5CVHA 1WVWA 1ZYSA 2GDOA 1YQJA 2VTOA 4EOQA 4BCIA 2PSQA 4YU2A 3KULB 3PXKA 5J9ZA 3TM0A 4EBVA 4TWNA 2JDVA 4IWQA 1PXNA 4AG8A 3DBEA 4BBMA 3QWKA 5KNJA 5LVPA 4NM7A 5IQFA 4CEGA 2YWPA 3NGAA 4U0IA 4J7BA 4FV7A 4RGJA 3GFEA 1J7IA 1XQZA 3N51A 4A9UA 3Q9XA 3COMA 4BGQA 4EK8A 3ZOSA 4FKLA 5CF5A 2WPAA 2R4BA 4RG0A 3HRCA 4XOZA 4X6QC 4E4MA 2UW9A 2BIYA 2XK7A 3D94A 4UWYA 2ETKA 2C0IA 2IZSA 3OG7A 3ZUVA 2XJ1A 3IW6A 3AGLA 4K9YA 3M11A 4TWCA 2B1PA 3P79A 4X6RA 4L8MA 5GHVA 3VULA 4GKHA 2VNWA 3E8NA 4A7CA 2GNLA 4YO4A 3CTQA 4AW5A 1XH9A 4WRGA 4N6ZA 5ITAA 2XKDA 3TEIA 4FOCA 4RQVA 2C6KA 3UMWA 3EN6A 2YM3A 2XKFA 3NUPA 3G9LX 3L8SA 4FYOA 4IADA 2OF2A 5H8EA 1R3CA 5IQCA 4EQCA 4CG9A 3RPVA 4YTFA 1U4DA 2O2UA 2PE2A 1AGWA 3NAXA 3R21A 4J53A 2W5AA 2WZJA 3Q4TA 5AA9A 3FE3A 3OXIA 2ZB1A 2JBPA 3P9JA 3CGOA 5L8LA 2ITQA 5C4KA 3SC1A 1HOWA 4TWPA 4FKJA 3VBQA 3E92A 4QYHA 3JR1A 3AMBA 4FUXA 3KEXA 2YITA 3ZFMA 4YTCA 2F49A 4Z9LA 4U44A 3BKBA 4MD7E 4C2WA 1UNGA 3E8CA 3ITZA 2UW0A 3GI3A 5CSHA 4LGDA 5AR8A 3TZMA 2DYLA 1DAYA 5CU6A 3ULZA 4M8TA 3RM6A 4O27B 2GNFA 2XF0A 2VX0A 1T46A 2XBJA 1R0EA 3FMEA 2I7QA 5LCKA 4TRLA 4Z55A 3DBFA 3KRRA 3ORKA 4IJ9A 1LEWA 3HZTA 4AAAA 5M07A 1UNLA 4RZWA 2YM7A 4AZTA 4BRXA 3COKA 2ZMCA 4L3LA 4NZWB 4BF2A 5C4LA 4NWMA 3EB0A 3EIDA 3WYYA 3U4UA 3ZLWA 4FKWA 1SVGA 5AM6A 2WTKB 3MWUA 4NT4A 4OAUC 1HCLA 5IH6A 4YZMA 3ANRA 1Q24A 2PVRA 4HVSA 4LOQA 4WNKA 4R3CA 4D5HA 1ZZLA 3PZHA 1XO2B 1JNKA 5FGKA 5M4IA 1YHWA 3OW4A 4UX9A 1RQQA 4FNWA 2ONLC 3BX5A 5H9BA 4E4NA 5E1EA 4HVDA 2WNTA 3N9XA 4YHJA 4FR4A 4GMYA 2VAGA 1F0QA 4RJ3A 3O51A 4EC8A 4NFMA 2W1GA 4TN6A 2OXYA 3VS3A 4ZY4A 2J5EA 4RIXB 3ORZA 1NT2A 5CEPA 2WQEA 3H10A 4HJOA 3GCQA 5AUTA 4RIYB 3PG3A 4FTTA 2QG7A 1PXPA 4RBLA 4OTFA 5FDXA 4PDSA 5HORA 2XK3A 3ZUTA 5DG5A 5ETAA 4ZTSA 4EQMA 3FXXA 4XG9A 2C6EA 5AFVA 4PF4A 4H3QA 3BRBA 3TJCA 1Y8YA 4C37A 3NNUA 4KS7A 5BUJA 1Y8GA 4IFGA 3WZKA 4BDFA 1MUOA 2VTHA 3PJ2A 5M06A 4DFBA 4RVLA 4LUDA 4N57A 3QTQA 4OUCA 2QNJA 1WBWA 1VEBA 4AOIA 2WEIA 3SDJA 4BCFA 4HGTA 4F70A 1T45A 2PZ5A 3R71A 3IDBA 3KVXA 3JS2A 4PUZA 3KREA 4O6EA 1YHSA 3C7QA 2CNUA 2PE0A 4XG8A 4DN5A 1O6KA 5I9XA 4DGOA 2VTPA 2R3FA 4J8MA 3R7VA 2Z60A 3EQFA 4BHZA 4D4RA 3F61A 4IFCA 5EQEA 4MBIA 4V0GB 5JFWA 4KIKA 4HVGA 3UC3A 5TE0A 5L2WA 3IG7A 4M84A 4M7IA 2C6OA 4FL3A 4HGSA 3I4BA 3B2TA 3NRMA 3VHKA 3VWAA 3QTRA 4RX8A 2R3JA 3QRUA 5IA5A 4DH1A 2CKPA 1ZY4A 3VUDA 2PZYA 4BCOA 4IAYA 3GC9A 1H4LA 5GNKA 4AU8A 4QO9A 4FV6A 4RA4A 3D5VA 3ENHA 1FVTA 3P7CA 2UZVA 5AM7A 5CY3A 1M14A 4PDYA 5JZNA 4EOSA 4E6QA 5CSVA 4XMOA 3A4OX 2PUIA 2XNNA 5HLWA 1JVPP 2FSMX 1KE9A 4ITIA 5CI7A 1R0PA 4V04A 5CU3A 4GG5A 4UY9A 4W8DA 4BTJA 4RVMA 5LMBA 3KMWA 2C5XA 3RPYA 4DTAA 2YA9A 4GUBA 4PPAA 1DI8A 4OW8A 3DKFA 4RIWB 5HO6A 5GZ9A 2YFXA 4L46A 3TTJA 3MPAA 2OIQA 3E7OA 3FQSA 3DB6A 3L8XA 3PVBA 4ANMA 4FIIA 3B2WA 4ITHA 4CYJA 2ZV2A 2PMOX 5AUYA 3M2WA 4ORKA 2JDOA 2BDWA 5TOZA 3LM0A 3T9TA 2ITPA 5AUZA 3VS4A 4APCA 4P2KA 4G6NA 3ZO4A 3QXPA 3OT8A 4GW8A 3LXNA 4YR8A 3OWPA 4UN0C 4QTBA 2ITXA 2IJMA 4G1WA 3VUGA 3ID6C 2E9OA 4CTBA 3QUEA 5LWMA 3HMNA 4I92A 2FO0A 4FZ6A 3UVPA 4CFVA 1NVRA 3PSBA 4F9WA 4ITJA 3II5A 3I0QA 5EW8A 3LFAA 2BZJA 4UYAA 3TTIA 4P7EA 5EH0A 3UNJA 3G2FA 1OL2A 3MN3A 3R28A 3HNGA 1Q99A 4BI1A 3GBZA 4A4LA 4Z7HA 4C3RA 1OKZA 4USDA 1IG1A 5J1VA 2NRYA 4UZHA 3R83A 4MXZA 4WUNA 1QCFA 4MXYA 3NUYA 3NPCA 5EYKA 2W99B 3U6HA 2NPQA 1EH4A 3FYJX 3EZVA 3KC3A 5CX9A 3QKMA 4KB8A 3BHYA 4BDIA 5A4LA
chains in the Genus database with same CATH superfamily
1GZOA 3LQ5A 3VRYA 3DV3A 3R2BA 4JX3A 2ZV9A 3QX4A 3KXGA 4IBMA 4O0VA 3FZPA 4L67A 2LAVA 4ALVA 5TT7A 3S4QA 4AN2A 5IQBA 2QLQA 4FVQA 2C5NA 3RINA 3RCJA 4DEAA 3FXZA 2R3KA 4Z3VA 1PRYA 2OO8X 4ZSJA 3UIMA 2IPXA 3H9FA 3NYVA 3W0QA 4EOMA 1G8KA 3GB2A 4TYIA 4UALA 4RMZA 3TKIA 3NMUF 2JDTA 3F7ZA 5BPYA 3UO5A 3QUPA 2WMSA 4Y5HA 4NEUA 4BI0A 2XK8A 4XRLA 4NFNA 3EN4A 3FLYA 3LZBA 3QTSA 3TIZA 5JQ5A 5LVNA 3Q2MA 1ST4A 2EVAA 2XJ0A 4UWCA 4AUAA 5FUTA 3JY9A 4ZS0A 2FVDA 4OBQA 4YURA 1YDTE 5D12A 3RVGA 3NR9A 3ZFYA 3V5JA 4BTMA 3R9OA 5C1QB 4U79A 3H3CA 2XNEA 3GP0A 2C3LA 1WBSA 1WFCA 4JIAA 2CHLA 3KMMA 1PMVA 2ITVA 3BZ3A 3QBNA 3OD6X 3GXLA 4O6LA 4BZDA 3ZC6A 1H1WA 4S32A 3HYHA 1YVJA 3PJ8A 5FDPA 4FZDB 3VBWA 5L8JA 4CSVA 1BI8A 3TZ7A 1KV2A 3LFSA 4Q5HA 4I23A 1PW2A 2X9FA 4CXAA 2WKMA 3QYZA 4BN1A 4C4JA 5AR2A 1H08A 3BBTB 1CTPE 3N4UA 4FTAA 1OKWA 5K3YA 2PWLA 2WOUA 3WILA 1HCKA 5BUEA 5BVEA 5J9LA 2FYSA 4QYFA 3BEGA 5AV3A 5CANA 2CN5A 3VC4A 5AIKA 2AEGA 4IB1A 4BJJB 4BDCA 4FSMA 1FGIA 3AQVA 3QRJA 3KN6A 4FK6A 3GENA 4RPVA 5HNGA 5HNIX 5J79A 4IWPA 4EKLA 4EYJA 2CKQA 5GINE 3EFWA 2GNIA 4FT5A 4N6YA 5HU9A 2X6DA 1H27A 4HW7A 4Z7GA 4FL2A 5FP5A 2VTQA 5AR5A 1P4OA 4PX6A 4GFMA 1XH7A 3DJ7A 3TACA 1ZYJA 4FZFB 2A0CX 5HG8A 4ANSA 1B6CB 3OBJA 4C62A 3SA0A 3HGKA 3VAPA 2YM8A 4IC8A 4YUQA 2GTNA 4M69B 4MCVA 4CRSA 2WU7A 2X1NA 4XP2A 3UP7A 5IA1A 4IVBA 3G33A 1KOBA 3OBGA 3LFEA 4IAIA 4MH7A 2QOQA 4EQUA 4QOXA 3FMMA 4ZSEA 3UG2A 4EK5A 3GU6A 3HDMA 3IW8A 4I3ZA 5M57A 4DFUA 3R8ZA 4K6ZA 1G8SA 3KU2A 3KKVA 4IZAA 4G3EA 2ZYBA 3BYVA 3NS9A 3RALA 4JQEA 3NVMB 1PXKA 3NW5A 3W0OA 4XS2A 4DEHA 2BALA 3GQLA 3Q9YA 3GCSA 4AW2A 4MK0A 1ZARA 2PULA 5EQYA 1VYWA 1PF8A 5DLSA 4FOBA 5EM7A 2OF4A 5CQUA 4DBXA 4BYJA 2OZOA 4FNZA 5HG5A 4QYGA 3ALNA 3HL7A 5LARA 2W0JA 2W9ZB 4OT5A 4BDGA 2XNMA 3K3IA 5HO8A 1BLXA 1CKIA 1JBPE 1Y6BA 3BHUA 4MF1A 3R1SA 3KRWA 3C13A 4FSTA 1FMOE 3E87A 3P7AA 2W1HA 3PSCA 4OTDA 3HUCA 4HOKA 5HHWA 4GJ2A 3S1HA 4M15A 2XP2A 2WIPA 3G6GA 4W9XA 4O7VA 2OK1A 5CSXA 4QMVA 5EDRA 4JIKA 3WF5A 4CYIA 2GS7A 4LDTA 3U54A 4MD8E 3TKHA 4FV8A 2UZTA 3PVUA 3SXFA 4BDEA 3NUSA 3GU8A 4QMUA 3UJGA 4M67A 3FHIA 3QTXA 4YGAA 3JYAA 3PUPA 1OB3A 4IZ7A 2J9MA 1W84A 2C0TA 2QHNA 1OGUA 3POOA 4I5CA 1B38A 2EUFB 3BYSA 4GJ3A 4NJ3A 4YBJA 3W2OA 5BVDA 4X2KA 1JWHA 1H26A 1OUKA 1UWJA 2HXQA 2VTAA 4GK4A 4L7FA 5HO7A 3PFQA 2XYUA 5CAQA 1Q62A 4XP3A 3FZTA 1PMEA 3PPJA 5KMMA 4F65A 2XK4A 4JS8A 1YWRA 4WSQA 4YJQA 4ZTQA 3UVQA 3Q2JA 2QODA 4RWJA 3MTLA 4ZXTA 5FP6A 1CSNA 3RK7A 1OBGA 1FQ1B 3DTCA 3FY2A 4O4DA 4AAYA 4IM0A 3ZXTA 3TNIA 2OI4X 2BTRA 4IAKA 4FIHA 3MY0A 3PYYA 5BV3A 1PJKA 1W2CA 2GNHA 4DFZE 1Z9XA 1UKIA 3VONA 3ELJA 3WE8A 3TIYA 1P14A 3I6UA 2VWWA 4PDPA 4L44A 5EHOA 3NVKI 4WO5A 2CCIA 4FTQA 4RSSA 4FGBA 3PTGA 4DINA 4FEVA 5DT4A 4ENYA 4H58A 4EOIA 1CDKA 4G17A 2VWXA 4K1BA 4HNFA 5E91A 5CXHA 1XH6A 1BI7A 3CQEA 4JDHA 2XA4A 4EBWA 5CAUA 3E3PA 1J91A 5AMNA 3TUBA 2YEXA 2BUJA 5IMXA 5HE0A 2E2BA 2JIUA 2FGIA 5A3XA 3HMIA 2OICA 2J0MB 4DT8A 3QL8A 5KMNA 2XEYA 3BPRA 4CLIA 4KIKB 4LRJA 3ZLXA 5DT0A 3DAEA 4OTWA 4A06A 5A6NA 3DA6A 3E8DA 1MQBA 4DH3A 4LL0A 3MESA 3VS1A 4YHTA 3U6JA 2B54A 2ETRA 2C6LA 3JVSA 5E1SA 5I9ZA 4GFOA 4QRCA 2QO9A 4LMUA 3RHKA 4HZSA 4DLIA 5FTOA 2WXVA 5IUIA 2JAVA 3IONA 4O0UA 1V0BA 5G1XA 2HY81 4YPSA 2XKCA 4QP1A 2B52A 1REJA 1U5QA 4CFMA 1M2QA 4PP9A 3TN8A 3CSVA 2AYPA 2B9JA 3R02A 5CENA 3ZO1A 3SG9A 4JLCA 4FG9A 5CEKA 1XHAA 3OTVA 5F9EA 3U51A 3OROA 5B0XA 3VW6A 2OXDA 4AFJA 5FBNC 2UZOA 5DH3A 4L3PA 3ZRMA 4PRJA 5EM5A 3OZ6A 5IZFA 2Q83A 3P0MA 1ZXEA 2J2IB 4FNXA 2YLFA 5JGAA 5L2IA 4MAOA 3SX9A 3S0OA 3L8PA 2W1ZA 3GC0A 4CT2A 4AT4A 3HLLA 3ZRKA 5BYYA 4JDKA 1RJBA 2Z7QA 4EJ7A 5CNOA 3L9NA 3QZHA 4GKIA 4IQ6A 3VIDA 2ZMDA 5CEIA 5BYZA 4NTTA 3W0NA 4A9YA 2CGWA 3EMGA 3VS5A 3BHTA 5BMSA 3FSKA 4KABA 4AT3A 4EZ7A 4B6LA 3V8TA 2ERKA 3N4TA 4O1OA 4DCEA 4EUUA 2I1MA 2CKOA 4W4YA 4BCNA 4BDJA 2VTIA 2WGJA 1UU7A 3EQRA 2VGOA 3UIXA 2OFUA 1DS5A 3FLQA 3FKNA 2WTJA 5EI2A 2B9HA 1NW1A 3DK6A 3A4PA 3FMNA 3CKXA 2CNQA 2IW9A 5E4HA 4BI2A 3EQBA 4ANBA 4EWQA 2X4ZA 4JBPA 4ID7A 4WIHA 3R8PA 3O5AA 3BBWA 2XALA 5B2LA 5CAPA 4BWKA 3QCSA 1U54A 1J3HA 4GL9A 3EQIA 4RIWA 2B53A 4UB7A 3V51A 5IQGA 2Q0BA 2YN8A 1XBAA 4MXXA 3P23A 4I24A 3RZBA 4XJ0A 5CF4A 4P4CA 2VTNA 4PDOA 1M7NA 4W4XA 2EU9A 3QCYA 3O96A 2XZSA 5DWRA 3BE9A 4OAVB 5DVRA 2E9UA 5FG8A 2IO6A 2CLQA 1H1SA 3RKBA 4R7BA 3W0MA 3G15A 2C6TA 1YI6A 2OJFE 3D7ZA 3Q5IA 3KK8A 2QOKA 2C69A 2G2HA 3M42A 4IAZA 4S34A 2PMIA 4JOAA 4D4YA 3MY5A 2HY0A 5H2UA 1OIYA 4ANLA 4E8AA 2BHHA 1YWNA 4B99A 3TZ9A 4DHFA 4O22A 5IA4A 1W82A 2LGCA 3QD0A 1XH4A 4DTBA 4NJDA 4F1TA 3FYKX 4F9AA 2OH0E 5FEEA 4LG4A 5LCJA 4FTLA 2A4LA 3W0PA 4AOTA 3F82A 5K4JA 4JX7A 4FSYA 4PMSA 4ZTNA 4MWHA 3QU0A 3WF6A 4AFEA 4EK4A 4F0FA 3C4ZA 1Q8TA 4F09A 4X2NA 1YXTA 2VO6A 3E62A 4ALWA 4XV3A 3FAAA 2GQSA 3E64A 4ZTLA 3DKCA 5CSPA 4CV9A 3WF7A 3LFFA 4I22A 2UZEA 4PTEA 4CNHA 4FTNA 4DH7A 5HEZA 4IX5A 3ERKA 3MPTA 1ZLTA 1TKIA 4NCTC 3VNTA 4QMWA 4ANQA 3GU7A 3UE4A 5FEDA 5G6VA 2PY3A 5FM3A 3PA3A 3RBWA 3RP9A 1GZ8A 2G2FA 2R3PA 3QQUA 3HP5A 3UPXA 4FIEA 4FT0A 3R22A 1J7LA 2O65A 5EDQA 3O71A 4H36A 3GVUA 3Q96A 4BBFA 4AQKA 4QMYA 1OL1A 4KBKA 3F3UA 4U9AA 3W2SA 2XNOA 3GCUA 2NP8A 4FTRA 3MGYA 3A99A 2W06A 5JSMA 3G0EA 3RPRA 2X7OA 4NSTA 3HMOA 4EOOA 2XIKA 4IDVA 4A4XA 4Q2AA 4U42A 3IKAA 1L8TA 2RL5A 3SV0A 4FICA 1TQMA 3JUHA 2V5QA 2FSTX 2WU6A 4GV1A 1GZKA 2NNWB 1OPKA 3KF7A 3QKKA 4XV2A 4JVGA 5DI1A 3TCPA 3TI1A 3HP2A 3VN9A 4CCBA 2Y8OA 4K77A 5AX3A 3TXOA 5EKNA 4FKPA 5IUGA 2HAKA 5FXSA 3S3IA 3K5VA 5AJQA 4RWKA 3CD3A 4XEYA 4TT7A 5DMZA 2GS6A 5DRBA 4DTKA 5ETIA 1F5QA 3AKKA 4FV0A 4DEGA 1GIJA 4AGUA 4DHIB 4ZIMA 3IECA 4NU1A 3NNWA 2OJGA 3K5UA 4HZRA 4MWIA 3BU5A 4M13A 4XBUA 3TG1A 4E26A 4EK6A 3EKNA 2IG7A 3LXLA 4ZAUA 4LV5A 5TO8A 1XWSA 3C5UA 4FODA 2X0GA 3L9LA 1P4FA 3QD3A 3VUKA 4DFYA 4O4FA 4EH2A 2HYYA 3SAYA 3F5GA 3DXQA 3NSZA 2OGVA 3DOGA 3MA3A 4MBJA 1VJYA 3KMUA 3SQQA 2QI8A 4HPTE 4ACGA 5FXRA 1M7QA 4NW5A 2Y7JA 3EHAA 3POZA 4KSPA 4DGGA 4IACA 2XM8A 4TNBA 3SW7A 2UW5A 4XUFA 5FLFA 3H4JA 4FTIA 4IAAA 3MB7A 3OTUA 2YLEA 3AKLA 3FKOA 1OMWA 1G8AA 2JKQA 4HGEA 3UNKA 3KGAA 4KSQA 5J8IA 4DG0E 3V8WA 2W1EA 3HKOA 3EOCA 4AS0A 2CSNA 3R6XA 4M69A 4U3ZA 3LFBA 4FUYA 2VWYA 4HCUA 2VUWA 2VWVA 2F7ZE 5D9HA 5E8ZA 2FUMA 3TV6A 3BLAA 5A9UA 3HVCA 2R3NA 5KKRC 3D15A 3Q4UA 3FI8A 3BYOA 5HICA 4L7SA 3ZM9A 5CF8A 5HIBA 1OL5A 4QT1A 4TW9A 2XIYA 5AR7A 3QTIA 4GEOA 3A60A 3R7YA 3LMHA 3E7VA 3GOKA 2BCJA 3LW0A 4Y85A 3TYKA 4D1ZA 4JI9A 4NK9A 4O21A 4EHGA 2XIRA 3EQHA 2VWIA 2R3GA 4FKSA 3AC4A 4EHEA 3BELA 1FVRA 4OTGA 4WOVA 2WMUA 4CTCA 3ZH8A 3BLQA 4CZYB 3PWYA 2IN6A 2PK9A 5FEQA 2WB8A 2YDJA 2ZM1A 4KBCA 1JSUA 4O7LA 3LCOA 4PV0A 2W1CA 2XRWA 3UO4A 4A9SA 5HIEA 4AN9A 3WOWA 3R04A 5J5TA 1H01A 5AADA 3R7OA 4EJNA 3W33A 3O8TA 4JAIA 2V7AA 5FM2A 3GT8A 1RE8A 2X2LA 3W16A 4C35A 1OKYA 1ERKA 4IX4A 4CG8A 4YZDA 3A7GA 2YDKA 4J97A 5CT0A 3VRZA 5C01A 3PDTA 5HTIA 2QOIA 5KCVA 3F5PA 1H28A 4QMMA 2ITWA 3E63A 5BUIA 3G0FA 4C0TA 3RMFA 3F3ZA 4GU9A 5E92A 4YSMA 2ONLA 3F69A 5L2QA 4J52A 5IQAA 4J71A 3DAKA 4FKQA 5C8NA 1JLUE 2RFNA 2WFYA 3QQFA 2JIVA 2ITTA 3QQHA 4L53A 4AZWA 5K0XA 3QQJA 2BZKB 4UXQA 4JNWA 3I5NA 3JVRA 4WNPA 2QOBA 3Q60A 5AP2A 3V5QA 4IAFA 2PVJA 2F2CB 2YAKA 2GPHA 5CU0A 5BNJA 3D14A 4JT3A 2XNBA 3LAUA 4MXCA 3UQGA 3W1FA 3IPHA 5E8WA 4PMTA 5KHXA 4I6HA 4II5A 4I4FA 4IVDA 4D0XA 1W8CA 3OCSA 3SVVA 4D1XA 4MQ1A 3SGCA 5EHLA 4LUEA 3A2CA 3Q9ZA 1JSVA 3CD8A 3ZBFA 2IZTA 4EWHA 3NUNA 3FJQE 4QPSA 4FKIA 5HQ0A 4UMQA 1OIUA 3BQCA 2C68A 2VGPA 3O7LD 3R9DA 3RM7A 4YJTA 2QOLA 5A46A 2QCSA 5ANEA 1STCE 3UOHA 5DIAA 4KBAA 2V55A 4GVAA 3V6RA 4N4SA 3ZEWA 1JKKA 2GSFA 4FSZA 3A61A 3EL8A 3THBA 3ZTXA 3Q32A 3LCTA 5M55A 3QC9A 1KWPA 2P33A 1WAKA 4IVAA 4GK2A 5JFVA 4FGRA 4GCJA 3WE4A 4A07A 4B8MA 4CD0A 5HIDA 4OTIA 2XB7A 4LM5A 3MVJA 2O5KA 2QR7A 4C2VA 2QVSE 3LOKA 2GNGA 3EQDA 3ORLA 1OVEA 3PXRA 4EOJA 5BVOA 3R30A 4DDIA 5HVJA 2XCKA 4RWLA 1Q61A 4F99A 5F4NA 3RK9A 5IDPA 3GC8A 3ORXA 4H3PA 3FQHA 2BDJA 4I20A 2OZAB 2HXLA 4LQMA 3RTPA 1GOLA 4PL3A 2OSCA 3WZUA 4ZZOA 3ORMA 4K33A 5KE0A 2CCHA 2VZ6A 4KD1A 4F08A 3KCKA 1WBTA 4UBAA 3KA0A 3RZFA 4CQGA 1H1RA 2BIKB 3DXNA 3UZRA 3NZ0A 1XBCA 4FTJA 5EHYA 2HW7A 4U6RA 1MQ4A 2OJ9A 2VD5A 3FUPA 5LVLA 4ZY5A 1YXSA 2YM5A 1IASA 5CT7A 5AV1A 3HA6A 4C36A 3QTZA 4KWPA 4PPBA 3COHA 3VO3A 5HG7A 4USFA 2BAQA 3BYMA 2IZRA 5M4UA 5AAEA 3ZDUA 4J95A 3OCTA 3UIUA 1GNGA 4W4WA 2PVNA 1XH8A 4E5WA 3FMHA 4IM3A 3KXNA 3NYXA 4RA5A 4DH5A 3FI3A 4W9WA 2ITYA 5EI8A 1E9HA 5HBHA 2DS1A 1U54B 3QCXA 4MBLA 3PG1A 5IKWA 4BL1A 3L8VA 4FYNA 4H3BA 3KIOC 5E8VA 5IH4A 3VF9A 2ZOQA 3KB7A 1ZMWA 4QYEA 4FV2A 4Q5EA 3UG1A 2CKEA 4GT3A 1I09A 4YHFA 3EN9A 3BL7A 4ANNA 3AGMA 4EH5A 4WT6A 4JBOA 3CQUA 4U43A 4C4EA 3L1SA 1Q8YA 2GTMA 3CPCA 4MNFA 4QD6A 3D9VA 3VVHA 1LR4A 3ZZWA 5GIPE 1L3RE 5HESA 4IHPA 3CQWA 5H8BA 1SM2A 3D7TA 4BKYA 3FZOA 1M2PA 1TZDA 3PJ3A 3QTWA 4E93A 4C7TA 3MFSA 3HV4A 3HEGA 5F1ZA 2UW4A 3OW3A 3NW7A 3R01A 3FZRA 4OR5A 5D1JA 4LYNA 4YJPA 3W8QA 4IB0A 2PTKA 4IM2A 5A4EA 4BCPA 1IAJA 3MY1A 5KMOA 3MI9A 4CLJA 3FL5A 2C4GA 3FMDA 5LJJA 4R6VA 3LVPA 3RK5A 5IMEA 4GT5A 1UU9A 4G5JA 3V04A 5IG1A 2RF9A 3UPZA 3PJ1A 4HNIA 3SKCA 1OECA 3VS7A 3PIZA 3HECA 2YIXA 3EL7A 3F2AA 3NUUA 3RNYA 3DLSA 5CU4A 3DBCA 5JMSA 5D10A 3L9PA 2GHLA 3QA0A 1Q8ZA 1PMUA 4ONAA 4XV9A 4Y95A 3WYXA 2I0VA 2EB2A 3U55A 5L8KA 4YP8A 3TNPC 3ORPA 2IW8A 4F78A 2I40A 4RRVA 3QXOA 3H0YA 3OF0A 3R1QA 2OBJA 2WMTA 3GCVA 1V1KA 4DT9A 4F6UA 3RAHA 4AGWA 4F9YA 5HE3A 3D0EA 2Y4IC 3R8VA 5HBJA 4A9RA 4U81A 4ZEGA 1SMHA 3LCDA 4ZOGA 4GIIA 2OU7A 2CJMA 3I79A 4YO6A 4DEBA 4WKQA 3D5WA 2I0YA 3HUBA 4DFLA 3T3UA 4O2PA 3DFCB 5J7BA 4L42A 5L6OA 2BRHA 5TR6A 1Q97A 2YIQA 3MB6A 1OPLA 2XUUA 3FMKA 4D28A 4Q9SA 4MF0A 4DFNA 1Y6AA 3RAKA 3EN5A 5IH5A 1QPJA 4GT4A 5EW3A 3DB8A 3Q5ZA 3QF9A 2BRBA 3UQCA 1P5EA 4YLKA 3W0RA 4OGRA 3O7LB 3Q6WA 4XX9A 3CR0A 1SVEA 4I6FA 4B7TA 1JQHA 1PKGA 2FA2A 4M68A 1URCA 5E8UA 5DFPA 4E6AA 2RIOA 5CF6A 3GU5A 4DITA 1U5RA 4ZTHA 4BCJA 3KF4A 2ACXA 4GVJA 2UW7A 3NX8A 3VS2A 2BRGA 3EYHA 2UZUE 2HZIA 2QKRA 2PHKA 5M4FA 3CCNA 4C33A 5L2SA 5DEWA 3R63A 2PE1A 4D2RA 3F9NA 3SOAA 2W1IA 4C58A 4FX3A 1YDSE 2QONA 4IE9A 1G5SA 4KIQA 4ERWA 2WQBA 3A8XA 3CTHA 2J0KA 3OUKA 4EKKA 5M51A 5J1WA 4I0TA 4C4GA 4I0RA 3W18A 5EG3A 3LXKA 4AA0A 4U40A 4ASZA 4K2RA 3MDYA 3MFRA 4I4EA 4TZRA 3KCFA 1K2PA 4D58A 3W8LA 4R5YA 3RCDA 5JT2A 4EOPA 2GFCA 1J7UA 5D7AA 4ALUA 3P5KA 1DM2A 2WQNA 4XLIA 3MIAA 1XH5A 3E3BX 4O0WA 4PL4A 3O17A 4BIEA 4RVTA 2XNGA 2P2HA 3PVGA 4RC3A 3PLAE 2UZNA 2W7XA 4FKTA 4CZTA 5CYIA 4O86A 2R64A 4BTFA 4G6OA 4QMPA 3AD5A 3O8PA 5IEYA 4GH2A 4YC3A 1WMKA 5H8GA 4FT7A 3HV5A 5EW9A 4BR3A 3OFMA 3U6IA 1YI4A 4C3PA 1PXOA 2Z7SA 5DHJA 3ZSGA 2P0CA 3QRKA 5D7VA 3PY0A 3HDNA 4X3FC 1QMZA 3TUDA 2BTSA 3MIYA 2YABA 2W96B 3HV3A 3U9CA 2F7XE 3UZTA 2FH9A 4FZAB 2QLUA 3TUCA 1BYGA 5LMKC 3AG9A 4BDAA 2R9SA 5EI6A 3LXPA 2KULA 4DA5A 4G34A 4N0SA 5KMLA 3LPBA 5J95A 4V01A 3U9NA 4P90A 5EFQA 3CIKA 2Z7RA 4X0MA 3UIBA 1O9UA 4BICA 4FV9A 2WAJA 1QL6A 3PP0A 4OBPA 4ZMEA 1KSWA 2QU5A 5AR4A 3WF8A 4D4SA 2XRUA 3MPMA 4NKAA 1FBNA 2ERZE 2XIZA 3MTFA 4Z16A 2XJ2A 3EQGA 1ZWSA 4O84A 3ZCLA 5HCZA 2OH4A 2JGZA 4F64A 3DQXA 3RNIA 4IW0A 4MUQA 3KRJA 2JIIA 5EQPA 2X2KA 5IPJA 3ZS5A 2Z2WA 5A4CA 5IU2A 5IEVA 3UYTA 5IQHA 4W8EA 3C5IA 5JRSA 4R77A 5HE1A 5JN2A 4XG7A 1LEZA 3T3VA 2BZIB 3E93A 4L9IA 4UWBA 5FTQA 3TV4A 3UOKA 1K3AA 1KE7A 2JFLA 1FGKA 2YCQA 3Q3BA 4FBXA 3ODYX 5BVFA 4O4EA 3FEGA 2W4KA 3FPMA 3W0SA 4HYIA 5LOHA 3Q53A 1ZMVA 3KY2A 2X9EA 2YIYA 4AA5A 1OGYA 1NVSA 2HCKA 3W2CA 4R1VA 1WBOA 3TZ8A 3GQIA 2HZ0A 3K54A 2IZUA 4L3JA 4EZ5A 2EB3A 3FQEA 3VF8A 4DFXE 1TQIA 2ITNA 3RAIA 4TYEA 3BWFA 4V05A 3EFLA 4C4FA 4QNAA 3KXMA 1YW2A 4C8BA 5ANGA 2ESMA 1B39A 1IRKA 4XLVA 5AUWA 5KMJA 3TDWA 4D1SA 4G9CA 5HTBA 5LVMA 2ZJWA 2R3HA 3PA4A 5KBRA 3Q4ZA 4RC4A 1Z57A 4DEIA 4I5HA 4UYNA 3RWQA 4BC6A 4C61A 3QGWA 1KOAA 1OL6A 3LFDA 4JR3A 3ZXZA 1PMNA 1UKHA 2HIWA 2R0IA 3LKMA 3TNQB 2A2AA 2VU3A 5I9WA 1V0PA 5AP5A 4C59A 4TPTA 2AC3A 4BCMA 4RJ7A 4BFMA 2RFDA 1Y91A 3JPVA 4FEQA 4RFMA 3PVWA 3WZJA 2W1DA 2C1AA 3CS9A 3HMMA 4FSNA 1ZAOA 4IMYA 4XH6A 2ZFYA 3Q9WA 4XBRA 2ITUA 2BAJA 3H9OA 3R0TA 3R2YA 5CSWA 4ACMA 4BIBA 5BQ0A 5K5NA 4IJPA 5M56A 5DT3A 2WTKC 3ZM4A 1PYEA 3EYGA 2BKZA 4DAWA 4F4PA 4IWDA 4Y73A 4AZSA 5M53A 4ZZMA 2IVSA 4QNYA 1TVOA 4F1OA 2PU8A 2WMRA 3W2QA 2RG6A 5AEPA 2W4JA 2R3MA 1Y57A 5GJDA 5A54A 5IA3A 3VS6A 4CMTA 4ANOA 2E9VA 4DF3A 2BHEA 3FKLA 2O0UA 2JDRA 4BWXA 5F94A 1WBVA 2PZRA 5D41A 2PUNA 5HU3A 3V6SA 4IWOA 3F66A 2XH5A 2C47A 1J1CA 4BWPA 3ZSHA 3E88A 4XYFA 3REPA 5DN3A 1RDQE 5CZIA 3TL8A 3ZLSA 3UGCA 3CY3A 2HOGA 2XAMA 3OEZA 1E1VA 2OZAA 3HMPA 5DPVA 3S00A 3AC5A 2OLCA 4C38A 3R7IA 3C4CA 1GAGA 4JDIA 5LMAA 3E5AA 4GUEA 5A14A 4ZTMA 5BVNA 5HCYA 1J1BA 2I0EA 4I1ZA 3TDVA 2I0HA 3NIZA 3SLSA 1BKXA 3MVHA 2WIHA 2CGUA 3C4FA 2R2PA 5DYJA 3D7TB 2UZBA 2BPMA 4FL1A 2YIRA 3PZEA 1PKDA 3DBDA 4G5PA 4R7HA 2XEZA 4IC7A 4FV5A 1VYZA 5DEYA 4D2TA 5CWZA 2JD5A 3EKKA 2X7GA 5HNBA 5E9EA 5AP1A 2QOHA 3G5DA 2W05A 4M14A 3AMYA 4ACHA 3Q6UA 5EK7A 4LRMA 4QP3A 4RJ6A 4D2PA 4D4VA 3MFUA 4KRDA 5BX0A 4QMOA 1OZ1A 4EH4A 3PIXA 2W9FB 4C4HA 3A7JA 4RC2A 2YM4A 2VTSA 3R7EA 1WZYA 2G01A 5FTGA 1GIIA 3BU6A 4B4LA 1VLRA 5HX8A 1OBDA 5HZNA 4OTQA 3Q52A 4IB3A 3ZO2A 4DBNA 3PLSA 2QURA 2PVYA 1JKTA 2R3LA 5I4NA 3QA8A 4AF3A 2X8DA 2OIBA 3CE3A 4PNKA 3PSDA 5IQIA 2G9XA 1ZOGA 2WMXA 2VWBA 4QYYA 2O8YA 3A7HA 3LQ3A 4YNEA 3FLZA 3UTOA 5EKOA 4ZLOA 4JR7A 4GRBA 5T68A 4ERKA 3U87A 5I9YA 3G6HA 4NCTA 1P2AA 5M09A 4BGHA 1Q8WA 5FXQA 5A6OA 2R3OA 5CALA 3ZDIA 2HZ4A 4EEVA 5GZ8A 3DAJA 3H0ZA 3EQCA 2KTYA 2WTDA 2OG8A 2ZDTA 2XIXA 3LLTA 4PTGA 5AAGA 2REIA 3TMOA 3NNXA 4E20A 2Y6OA 1BX6A 3QC4A 3FZ1A 3OT3A 4RZVA 1URWA 3WIGA 4GYGA 4IANA 3S95A 1I44A 4FTUA 2IWIA 4YTHA 4RX7A 3DK3A 4JQ8A 4KRCA 5L6PA 2IVTA 5TF9A 3QTUA 5TKDA 4ZK5A 3G90X 4I0SA 4YJUA 3FI4A 3MVMA 1AQ1A 1SVHA 3M1SA 3VUIA 3IS5A 4UEUA 3CBLA 5KX8A 3HAMA 4LGHA 3DTWA 5FBOA 3O23A 3D2KA 2P2IA 5B7VA 3ZRLA 4AW0A 4WRSA