4L52A

Crystal structure of 1-(4-{4-[7-amino-2-(1,2,3-benzothiadiazol-7-yl)furo[2,3-c]pyridin-4-yl]-1h-pyrazol-1-yl}piperidin-1-yl)ethan-1-one bound to tak1-tab1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
307
structure length
295
Chain Sequence
GSLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase 7, TGF-beta-a
publication title Discovery and optimization of 7-aminofuro[2,3-c]pyridine inhibitors of TAK1.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 295
sequence length 307
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4l52A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4l52A01
4FT0A 4YHFA 4RJ6A 3ZXTA 3MPTA 1ZYSA 3ENMA 2YISA 2R5TA 4YBJA 4WRGA 3CJFA 2W17A 4NW6A 4Z7HA 3BBWA 5CEPA 4QNYA 5CAVA 4DN5A 4CLJA 3EFKA 3IW7A 4JDHA 4RJ5A 4Y72A 3TIYA 3ITZA 4FL2A 3PG3A 1W82A 3BQCA 5CWZA 3QRUA 2O0UA 4TT7A 5IQIA 4C36A 3UC3A 1PMNA 4MD9E 5D12A 4ZSGA 1YWVA 3HMPA 4FSUA 1V0PA 3ZFYA 1J1BA 3PZHA 2YA9A 2CGXA 3FXWA 2REIA 5LMAA 4TWOA 4I24A 4YJTA 4M69B 5JT2A 4WNPA 3R9DA 4X3JA 4E4NA 2BAJA 4C38A 4C61A 2R3LA 5HBEA 4IAYA 5EM5A 4Y8DA 1IAHA 4PPCA 4QRCA 3UIMA 3DQXA 4MNEB 2C5XA 5EYMA 5DI1A 3GC0A 5M4CA 5HBHA 1H1SA 4EI4A 5A46A 4G9CA 4BDFA 4HNFA 3VBQA 5L2WA 2HW7A 4PY1A 2YDJA 3F3ZA 4J97A 4BI0A 2CKEA 5FBOA 4LI5A 5AP0A 3HP2A 2OWBA 3OY3A 4UMRA 4M69A 2BRHA 1WFCA 1G3NA 2WMBA 3A61A 2WFYA 2ZB0A 2WO6A 4RMZA 1GOLA 3DPKA 5L2QA 3PJ8A 3AMAA 5FXRA 3IGOA 3AXWA 3G9NA 4MNEA 1H1PA 1CKPA 2V7OA 3C13A 4FBXA 3V5QA 3W18A 4RFYA 4NCTC 4R6VA 2C6IA 3KRJA 5CENA 5AUVA 1VR2A 4G5JA 4RVMA 3FAAA 2UZWE 4YR8A 3QD3A 4B99A 4KBAA 3DK7A 3KCFA 3ZYAA 3E7OA 3R22A 3UNKA 3LM5A 4FV1A 4AFJA 2ZAZA 2IW8A 1WBSA 3QA0A 5AUWA 3U4WA 5ETCA 3VUTA 2ZDUA 2QCSA 4FSQA 3ZBXA 4D4YA 4WSYA 3P7AA 4KB8A 3QHRA 3VW8A 4E6DA 3P5KA 4BF2A 4MBLA 5A6NA 4E26A 3KRRA 3MVHA 2B9IA 2X6DA 2P2IA 3PE2A 4JG7A 5KZIA 4CVAA 5IMXA 3IECA 2W4KA 5H9BA 5JH6A 3DXPA 4BCMA 4MTAA 3WI6A 5HIEA 2GMXA 3PG1A 3UNZA 4ERKA 5HO7A 2W1DA 4JR7A 2NRYA 4IJPA 1S9IA 4FUYA 4B6LA 4YURA 5K5XA 4XV2A 3NYNA 3MBLA 4ITIA 2OFVA 2ACXA 2YLFA 3EYHA 3FMMA 4DFLA 1H0VA 2VTMA 5LMKC 3Q2MA 4BDEA 3AMYA 4IDTA 2YIRA 3MFTA 3RK9A 4YZNA 4CYJA 2BMCA 5DLSA 3FZ1A 3ZONA 4C0TA 5BNJA 4TN6A 2XIRA 2BRNA 4JAIA 4KD1A 4FZ7A 4U41A 5M4IA 4FMQA 4AZWA 2BRBA 5C8NA 2PE1A 3MPMA 4YJVA 2OLCA 4AZVA 3TNHA 3LFFA 1GIIA 4ASXA 4HVHA 2QOIA 4A9SA 4ORKA 3MY0A 1OKZA 2NNWB 4OTWA 3FL4A 4GIIA 3FJQE 4TL0A 3ZSHA 4U3ZA 2PY3A 3RAHA 4AX8A 4FVPA 4YGAA 2I0HA 3TDVA 1FGIA 3K3JA 4ZSJA 3RK7A 3RPSA 2W9FB 4BCKA 3BU6A 4C34A 3MFRA 4QMPA 4EYMA 2GS6A 3NIZA 2OJJA 2VTJA 4XP2A 2W99B 4QMVA 3TJCA 1ZWSA 3FLYA 3QTWA 4GH2A 3TKHA 3QCYA 4F7LA 1TKIA 4EOSA 2ERKA 5HI2A 1RDQE 3UO4A 4FEUA 4QTBA 2OW3A 3VW6A 2JFMA 2FH9A 2BRMA 4OTGA 4O2ZA 4U44A 1JKTA 1J7LA 1UKHA 2F7XE 4XJ0A 5ACBC 4BKYA 2OXYA 3GQLA 4JG6A 4M13A 3H0YA 1OM1A 2BHHA 3JY9A 1Q3WA 3NRMA 2R3FA 4Y5HA 5LWNA 4EJ7A 1GIJA 2NRUA 3RCDA 3FMHA 4F1TA 2XK9A 2VTLA 2ZDTA 4O0RA 2PMIA 3KY2A 1O6LA 3CTJA 3QTSA 2PE0A 3D14A 4PMPA 5C1QB 4F1MA 4JX3A 3PVUA 2FSMX 2X7FA 1KE7A 4FZAB 4FG8A 1V0OA 2PWLA 1NA7A 2HZIA 2QD9A 5E8SA 3AC8A 3QTUA 1OECA 4HPTE 1GY3A 4JDKA 3HL7A 3ORLA 2C3KA 2QOLA 3NGAA 4JOAA 5BMSA 4FTKA 4RX7A 4WD5A 5LVMA 3WILA 5EYDA 2Y6OA 3CPBA 3M2WA 3ZFMA 3ATTA 1XH7A 2OJIA 4RX8A 3MH1A 3RWQA 4AN9A 1M7NA 5LVOA 3CY2A 3TKIA 5KX8A 3R2YA 2Y7JA 2VWXA 3F7ZA 3R8LA 4AZFA 4QTDA 5GINE 2X7GA 2JKKA 4QYHA 1B38A 1Z5MA 4FTAA 4UWYA 2B52A 4E4XA 1H1RA 4BGGA 5EI6A 4BTKA 2XJ1A 2VTAA 3AC2A 1QPJA 4EWQA 4FIIA 4LM5A 4GRBA 3PDTA 3FZPA 3TACA 4FL1A 4CEGA 5FTGA 4ALWA 3W1FA 3BWJA 4W8DA 1GZOA 1DM2A 1ZRZA 1WZYA 3ORPA 5DEYA 4EHVA 3OROA 1BMKA 1WBOA 4FT7A 2ZVAA 5L2TA 2WQNA 3MA6A 5CVGA 2W1FA 4TYJA 2CDZA 3QCXA 1F5QA 1FINA 4YPDA 5EH0A 3FMLA 5HCZA 4LOOA 2WMWA 4JRNA 4YJPA 3PJ2A 2JAMA 2VTIA 5HX8A 4TNDA 2ERZE 2UW9A 4NFNA 3UQGA 3NZ0A 3FZRA 4OLIA 4NEUA 4PL4A 5CEOA 1K9AA 4DEIA 3RVGA 3E8CA 4FNYA 4NH1A 4WUAA 3ZEPA 2GFSA 5ETFA 2V5QA 4Q9ZA 4DF3A 2BZHB 4FVRA 2CGUA 4C4JA 3UMWA 2X8IA 3LQ5A 3UTOA 2XRUA 4I0RA 4TYIA 4I5PA 1PXPA 3ANQA 3E92A 3W32A 1U5QA 4W4WA 5J5TA 3K3IA 4LQMA 3I0QA 3UYSA 2BILB 4RGJA 1H07A 3FY0A 2UVXA 3BYVA 2OO8X 1ATPE 3MSSA 4KRCA 4QP9A 3OTUA 4QPSA 5DH3A 5AR7A 3T9IA 4OT5A 5LCJA 3DLZA 2VTRA 3BBTB 2VNYA 3SG9A 4U40A 4Y85A 4E4LA 2O63A 4O7LA 2GNFA 2NP8A 5GNKA 3Q4UA 4S31A 3FPQA 5CF5A 2CJMA 2QI8A 5IZFA 4EZ5A 4E93A 2V55A 1JNKA 5I9UA 1P14A 4D4SA 4ZP5A 1AQ1A 3UG2A 5BYYA 5HG9A 4D58A 1GZ8A 3I7CA 5AR3A 1Z9XA 3QA8A 2PVHA 2WGJA 4X7QA 3WZJA 4EH8A 5H8BA 2FSTX 4YJUA 4YZDA 3RPOA 4HGSA 4RZVA 2PUUA 5JN2A 3TTIA 4DEAA 1K2PA 2C6EA 3TNWA 5CSVA 2C5OA 4EH3A 2PL0A 4FICA 2RFSA 3HKOA 5C4KA 3QXOA 5EG3A 3UVRA 3LCSA 4JXFA 3ZU7A 1EH4A 3O8PA 4FG9A 1JSTA 4M0YA 2H34A 4AOIA 1SVEA 2YM8A 4FSRA 3R9NA 4E7WA 4E8AA 5HTIA 1XH9A 3PFQA 3N51A 4FODA 1GAGA 3NUPA 4RPVA 3OT8A 4APPA 4I1ZA 2QU6A 3LFEA 3R8VA 5CANA 4E20A 2KULA 3I0OA 3C5IA 4ACCA 4DH1A 3PXKA 1ERKA 5KMMA 5BMMA 4F9BA 4NK9A 3Q5ZA 4AF3A 1G5SA 3KF7A 5F1ZA 5FEDA 4YC8A 1IR3A 2UZUE 5I9XA 2C6DA 2XUUA 4LYNA 3QHWA 5M55A 3GT8A 4BCOA 1LP4A 4H39A 4D5KA 2YIQA 5DR2A 4GFMA 5LJJA 3EKNA 3PLSA 4CMOA 5IKWA 4EOIA 3GC9A 4CNHA 2NPQA 4V0GB 3I5ZA 3C51A 3OUNB 2X4ZA 2I0EA 4MD8E 2E2BA 2P33A 2QOQA 4DG3E 2UZTA 4C57A 3BHTA 3QYWA 1WMKA 2VTPA 4FTUA 1YOJA 2X7OA 3BEAA 3N9XA 3HAVA 1WBPA 3KCKA 2QNJA 4IB3A 5FM2A 3HA6A 1YDTE 4DTBA 5A4CA 3C4CA 3JVRA 3LLTA 4DBNA 3LAUA 2R3MA 3GQIA 4FV0A 5L2SA 5J9LA 4D55A 5C8KA 3LKMA 2ITZA 3ZZEA 4LRMA 2JIVA 5EM7A 5JQ8A 1IA8A 4O2PA 3FE3A 5FXQA 2B9FA 1LEWA 3MTFA 4H3PA 3U6JA 2XEZA 3MJ1A 4V0GA 5CQWA 3F69A 3HMMA 4C4HA 4CFNA 3FV8A 3E8NA 1W83A 4KABA 3W55A 4FOCA 4OTPA 5C4LA 4FEVA 2C69A 4YC6A 4DG0E 4Q5HA 3QAME 4BKJA 2QVSE 5FTQA 4EL9A 2W1ZA 4CMUA 1ZMVA 2BR1A 4TYHA 5DYJA 5BVNA 1JSUA 5AP4A 3EZRA 3U6HA 1T45A 1XJDA 3MVMA 1H25A 3ORXA 4MCVA 5AV3A 3V5LA 2X4FA 3CS9A 4CZUA 4IJ9A 3LMIA 5BVEA 4L67A 5I9ZA 3OCGA 2Y8OA 1UNHA 3F9NA 3GI3A 2GNIA 2Y4IC 2AC3A 4ENYA 1CKJA 2OK1A 3D2IA 2CLQA 2F4JA 2XM8A 4FTOA 4N0SA 3S3IA 4E73A 1V1KA 5HTBA 2GQSA 4DTAA 4UBAA 4AG8A 3F3WA 3ZO3A 5EQPA 4CRLA 3WZEA 2J90A 3DZOA 3ELJA 4GK2A 4RC4A 4F7JA 3OWJA 4LUDA 5EW3A 3AT4A 3R7EA 3JPVA 1BL6A 4D2RA 3NMUF 2A0CX 3AD5A 3ANRA 4FSYA 3BQRA 3PUPA 4FTJA 3F3TA 3CJGA 4ZSLA 3BLQA 3F2NA 3GU6A 4M3QA 2X8EA 4XV3A 5DNRA 4HVSA 3OF0A 1OPLA 3EQHA 1H08A 4BHZA 1IASA 2YM7A 4U81A 4BCHA 2IVSA 5KO1A 3L8SA 2CGWA 2OH0E 4CYIA 4F1OA 3VQUA 3QTQA 4BHNA 4ZJJA 4FEWA 2JC6A 4DFXE 5CAPA 3G6HA 2EB2A 1URCA 5CSPA 5HHWA 3UO5A 4FT3A 3EYGA 4WKQA 3GU7A 3PIYA 4I6HA 4X6RA 4HZRA 3LXLA 4YLKA 1QPEA 3FLZA 3LFBA 4I6QA 4LV8A 4ZY4A 5B7VA 3QRKA 2XK7A 4NL0A 2FB8A 1O6YA 3P23A 4FTTA 4I5MA 3UDBA 3P79A 2RL5A 2YLEA 2OXDA 4NTTA 3IW4A 4ONAA 3HDMA 5IA2A 2BROA 2AUHA 3CTHA 3OD6X 3KREA 3QZHA 2X0GA 3HVCA 1H0WA 5C01A 4UMUA 5ANKA 5ETIA 2UZDA 4CG8A 3BYMA 3OBGA 3E63A 4IM3A 4OW8A 1MUOA 4OT6A 2CCHA 3UZRA 5E90A 3ZFXA 4AW0A 2VWWA 1LPUA 4PWNA 1UNLA 4GL9A 4JS8A 4RJ7A 4FKUA 5AR2A 4XOYA 3WYYA 3QGWA 3HZTA 2XK3A 4JDIA 4FK6A 4XCUA 5LOHA 5DWRA 3OXZA 3WF8A 3K2LA 4UB7A 3EQFA 5EI8A 3WF7A 2OFUA 5EDRA 4K2RA 2YCSA 3RAKA 4IM2A 4BDJA 1M14A 1YWNA 3POZA 4P2KA 4NU1A 3ALOA 3VUDA 3FPMA 3ZUUA 3R83A 5G6VA 3UIUA 5KKRB 4AA5A 4AUAA 3U6IA 4F70A 2C6LA 1OL6A 1YQJA 2IW6A 2UZNA 5DN3A 3R9OA 5J8IA 1J91A 2PVFA 4XP0A 4YZ9A 4QO9A 3ALNA 3NYXA 3WF6A 4DYMA 4BCFA 2VGOA 4X6QC 5KMOA 4XG2A 4H1JA 3VN9A 1ZMUA 1ZMWA 4MXOA 2Y6MA 1NT2A 4G16A 3TM0A 2WZJA 3F5GA 2W1HA 3FUPA 2WTDA 1TQIA 4O38A 1NW1A 3DKGA 4RIYB 4YPSA 4YSMA 3CLYA 3MVJA 1QL6A 3R7IA 2H6DA 3QC4A 2F7ZE 3KKVA 3QQUA 4HGLA 4JLCA 4PNIA 4C4FA 4UV0A 5HNIX 5E8YA 4W4YA 4EOPA 4J53A 5FUTA 2VWYA 5EHYA 3PJ1A 3W2CA 4L3LA 3MESA 3QUDA 4PF4A 2W9ZB 2YERA 3PY0A 5TO8A 1UU8A 3RPYA 4FTLA 4L7FA 3S95A 2YDKA 4D2PA 3K5VA 2WOUA 3OOGA 3R8PA 3FI2A 3TNIA 1DS5A 4F4PA 2BALA 1XQZA 4FX3A 2WU6A 4CZTA 2YHVA 3SD0A 4FVQA 5HNBA 2B1PA 4BCNA 3W8QA 4O6EA 4XV9A 2YIWA 5IPJA 1IG1A 2BAQA 2C5VA 3BHVA 3R28A 3VF9A 3D5XA 3CGFA 3D7ZA 3L9LA 2VO6A 3OC1A 5F94A 1SMHA 4QMWA 4W8EA 4I94A 2R7IA 3BGZA 4K77A 4EUUA 2PUIA 1BI8A 4FT5A 3QQKA 3ORIA 4NM5A 4ALUA 5HTCA 4WIHA 4ZSAA 1BX6A 4QMZA 5ICPA 3MIAA 3FYKX 4Y73A 1PXOA 4ANMA 2UZOA 3IPHA 5GZAA 1OKVA 1NVSA 4JNWA 3LJ1A 2ZV2A 4PMMA 2J51A 2ITXA 3CKXA 4D0XA 5J79A 2WTKC 3TJDA 2OF2A 2CHLA 2BHEA 3C50A 2C6OA 2BVAA 3RM6A 2QLQA 4YTIA 1Q8YA 3MH2A 4V01A 2JKQA 4C59A 4OAVB 4FTQA 5IQFA 5JFVA 5KE0A 5BVKA 3HA8A 4JQ8A 3DXQA 4RIXA 2A2AA 4FSMA 1LUFA 2ZYBA 3NUYA 4MF1A 4N70A 3VBVA 5B2MA 2PSQA 4USEA 5JFXA 1OIQA 2BDJA 2V0DA 5L4QA 5F9EA 1JOWB 3H9OA 3I6UA 4ACHA 4DH8A 5ANGA 4AT4A 4AE6A 2WKMA 2JBOA 3R01A 5DGZA 2FYSA 1JPAA 2HWOA 3C0GA 4TWCA 4B8MA 5A4LA 3TEIA 4UMPA 4YTFA 5L6OA 5E92A 4O6LA 5AR4A 4O82A 4L44A 3SAYA 3CD8A 1PXLA 4K0YA 4RSSA 1KV1A 4EQCA 4K18A 5EK7A 4EK4A 4AZEA 4D2SA 4RA5A 4BIBA 4ZLYA 3PJ3A 4DBXA 1OUKA 3A4PA 1CSNA 3D5UA 3T9TA 3NYVA 1UU3A 4FGRA 3RNIA 4P7EA 3HGKA 4CT2A 3IONA 3DDQA 4QTCA 2EXMA 4C7TA 3Q5IA 5IA0A 2WHBA 4AN3A 4AU8A 3LQ3A 2UVZA 4LGDA 4Q5EA 3FHIA 1YI6A 4BGQA 4FTCA 1Y57A 1M52A 3DGKA 4LUEA 4FEXA 3H30A 5FXSA 5BUEA 4FV2A 2VTNA 2ONLA 4AT5A 1H24A 2GNJA 4OTHA 1Q61A 4G3EA 3KMWA 3TWJA 3VIDA 3VS5A 4EORA 4Z55A 5IQGA 1YXVA 4D9UA 3BZ3A 3IDCA 1PXKA 4PP9A 3NUNA 2WQOA 1YHWA 3IDBA 3AOXA 4X2KA 5DRBA 2HK5A 3CQEA 3ERKA 4C37A 4DGOA 3R9RA 4WUNA 2BFXA 2VD5A 3EQGA 4ID7A 3CE3A 2XZSA 2GS2A 3ZO2A 2QU5A 4KUJA 1B39A 1XKKA 5JGBA 4GUBA 3MGYA 4R5SA 2CKOA 3OHTA 3OW3A 1A48A 4ZZMA 3ZUVA 1XBAA 4FTRA 3ZDIA 2XKCA 3F61A 2HYYA 4M68A 3DBCA 3KF4A 4XRLA 4L00A 4GG5A 2GHGA 1O9UA 5M09A 3F3UA 4TYEA 4G3FA 1W0XC 3FHRA 4L8MA 5AUXA 4MBIA 3ENHA 3I1AA 4MF0A 3ZBFA 1O6KA 1UWJA 1YOMA 4XYFA 1ZZLA 4YP8A 5HO6A 3K5UA 2W06A 2BTRA 4CMTA 3IW6A 4ASEA 4TW9A 3PRIA 3RNYA 4N57A 3HMIA 5JK3A 3NUXA 3R7UA 4G3CA 4NYEA 2PMLX 3Q4TA 1OMWA 3RINA 4AGWA 3KEXA 3QX4A 3VQHA 4CLIA 4D9TA 5BUIA 3SA0A 3GCSA 3QQJA 4I23A 3FDNA 3KU2A 4BKZA 4BB4A 3VULA 3B2WA 2YCQA 5G1XA 2HZNA 3SX9A 2IZRA 3LFAA 5AJQA 2B4SB 2XKDA 3ZO4A 4MWHA 3HUBA 4PMTA 2WMTA 2EB3A 5FEEA 4BDAA 5M07A 5ANIA 3GC7A 4EQUA 3TT0A 3FWQA 2YZLA 2GQGA 2QOCA 1PYEA 5AAFA 4KKHA 3R1NA 3FLSA 4KNBA 4BCIA 4X2NA 5K0KA 5I4NA 3S4QA 4O0YA 5JGAA 5AP1A 3R71A 4DGLC 2KTYA 2W1IA 3GEQA 3TIZA 1ZYLA 3PIXA 4I93A 1OUYA 3FKNA 4RWLA 5F95A 2WQBA 2JDRA 3QX2A 3W33A 4ANOA 4YJOA 4FE2A 1UKIA 5HOAA 1XBCA 3O8UA 3BU3A 3ZTXA 5JQ5A 4I21A 4R7IA 1VEBA 1Y91A 4FV9A 3ZO1A 2YACA 3PA3A 1KE6A 3CQUA 3O71A 1OL2A 3TXOA 1FOTA 3ETAA 5M56A 4EH4A 4FK3A 1FPUA 2C1AA 3FLQA 4TKSA 4E5BA 4ZS0A 4ZJIA 3PRFA 5JMSA 4RWIA 4OTQA 4XH6A 3HV3A 3VHEA 4YJRA 4NT4A 2H96A 2IG7A 2CCIA 1JAMA 1XWSA 2J0KA 3FKOA 3SW4A 2XF0A 2OIDA 3CKWA 4QP2A 4QYGA 2DQ7X 4FV7A 4RWJA 2WTJA 3TZMA 4CFMA 4DGMA 1H26A 4BDGA 4IX6A 3QF9A 4D2TA 3TUBA 2OICA 2VWZA 3O23A 1XR1A 2HY81 2CNVA 4ZMFA 4CCBA 1OL5A 3UO6A 3SGCA 4CRSA 1QPDA 4D5HA 4R5YA 2WB8A 5HE2A 1CMKE 5DIAA 3F66A 4IADA 4FSZA 3WBLA 2P3GX 3C4WA 4EONA 1AD5A 3QWJA 1H8FA 2QR7A 4HCVA 2CMWA 4OTDA 4BN1A 2IWIA 3FSKA 3A7FA 2VNWA 3UG1A 1OGUA 3ZLYA 3CQWA 2UW6A 1M17A 5KBQA 1OIYA 1R0PA 3EJ1A 2PYWA 4FKPA 2OJ9A 3VS1A 4YHTA 4F0GA 5LQFA 4QMOA 4EH5A 3VNTA 4WNKA 3DAJA 4PX6A 4FC0A 4RX9A 2JDTA 3OEZA 3UIXA 4BBMA 3AC1A 4XV1A 3FMEA 4D1SA 2UW5A 4I5HA 3MW1A 2ITTA 3BHUA 4IHPA 3CD3A 4IIRA 5DRDA 3UOLA 3VS4A 4AOTA 4BDBA 2PPQA 3DK3A 1OKYA 1YWRA 5CZHA 3V51A 4YO4A 1PXJA 5E8ZA 4FKOA 3QUEA 4N6YA 1BYGA 4I4EA 5CYIA 4H1MA 2WIHA 5FEQA 1PMUA 4GVAA 2UW3A 3FMNA 3KXHA 4D0WA 2ITVA 4R1VA 2XIKA 4CFXA 2QR8A 4MAOA 3I60A 3OOMA 2YIXA 5LXMA 2PMNX 4ZY5A 3ZDUA 5HLNA 4PQNA 3RGFA 3HUCA 5JRQA 4J8NA 2FVDA 2XB7A 4XMOA 1NY3A 4YBKA 1U4DA 4FT9A 2OI4X 4YC3A 4CZYB 2C4GA 2R3IA 4KKGA 3QL8A 1FVTA 4BZNA 2PTKA 2C5NA 2Z7RA 4WOVA 5IDPA 5ACKA 4IC7A 4IACA 5D10A 5FGKA 3V04A 5EDPA 3E8DA 4D28A 5K4JA 4LMUA 3JR1A 4PNKA 2JKMA 3ACKA 2A1AB 4CFUA 4MH7A 2OJGA 2WEVA 4QP1A 4F6UA 4HVGA 5CAUA 4EK5A 4YLLA 2IZSA 4DFNA 2PZYA 1MP8A 3HV4A 2J0JA 2Y4PA 3LW0A 3O7LD 2YDIA 3ACJA 4B0GA 3KC3A 4ASZA 4I6BA 2W1CA 4V05A 2G9XA 1VZOA 1ZYJA 2QHNA 4DLJA 1PKGA 3CEKA 2G01A 4FZFB 3SOCA 3ET7A 4RVTA 1OL1A 2C1BA 3BRBA 3A4OX 3HYHA 4E6QA 1ZOHA 3ODYX 4G6NA 4JBOA 4MKCA 4NM3A 1HCLA 1PF8A 3Q4CA 5BVFA 4OTRA 4HYUA 3EL8A 3LMGA 4HCUA 3B8RA 2LAVA 2W0JA 2YABA 4EK8A 4CD0A 4O7VA 2VTHA 5AR8A 1SM2A 4U97A 5AP6A 4CQEA 3V8WA 1UV5A 3EL7A 3QYZA 5CI6A 5T68A 3UODA 3GP0A 3IOKA 3C9WA 2C6MA 2WMAA 4EC9A 3TZ9A 3TUCA 1V0BA 3CY3A 4BYIA 4G3DA 3FL5A 2WMQA 3NNXA 4PDOA 4TXCA 5DHJA 3QTRA 3GFWA 4HGEA 5K3YA 4RX5A 4OUCA 1Q62A 3QBNA 4P5QA 4U9AA 5CF6A 4LGHA 3ROCA 3DLSA 4EC8A 3KA0A 3NUAA 4WT6A 2IJMA 5FTOA 1QPCA 2XKFA 4OR5A 5ANOA 4GCJA 5CI7A 5HIBA 5LVPA 4AXAA 5JKGA 4QT1A 5CLPA 3LXKA 5K5NA 3DKCA 4YJQA 2JDVA 2G2FA 4M0ZA 5JGDA 3EQIA 4RA4A 5E8VA 1G8AA 2CNUA 5L3AA 3E62A 3H4JA 3EH9A 3QZFA 4UWCA 5D1JA 4R78A 3N4VA 1FMKA 1NVRA 5HCXA 1PW2A 3RAIA 4PRJA 3FXZA 2R2PA 4LL0A 1F3MC 3NNUA 5CVHA 5EHOA 5IG1A 2ZMDA 3RK5A 3TV7A 1PJKA 3COKA 4D4VA 4ZLOA 4JT3A 2OKRA 5IEXA 1A9UA 4FF8A 1PXMA 2R0IA 4IC8A 2QOFA 5J9YA 4YLJA 1IRKA 3L8PA 4ACDA 4C2WA 1OIUA 3FZSA 2XBJA 2UW7A 4FG7A 3FYJX 4Z7GA 3OWPA 3MI9A 1TQPA 1KE9A 3UQCA 3H9FA 4MQ2A 1P2AA 1H01A 3UVPA 4XG7A 3QU0A 4L7SA 5EKOA 4MWIA 4R1YA 2Z60A 4JRVA 1E1VA 3A7IA 2A19B 3ULZA 5JSMA 3FLWA 1E9HA 3V5JA 1MQ4A 4DINA 1YI3A 3VUGA 2R3OA 2YWVA 4BCGA 5M57A 3QRJA 3EN9A 4MVFA 3ZRMA 3MH3A 3W2RA 1GJOA 3W10A 3R1SA 3R30A 4O0SA 3TL8A 5IUHA 2GPHA 4BGHA 4G1WA 1DI9A 1PHKA 2F2UA 3P0MA 5DPVA 3LFQA 2GTMA 3BX5A 2X1NA 4RQVA 4EOJA 3R7YA 4BRXA 4IVBA 4UXLA 4P5ZA 4PTCA 4D4RA 2P55A 5JFWA 3PXRA 5CS6A 2OZAA 3ZC5A 3L9MA 5M4UA 2WMUA 2XK6A 2JBPA 4F63A 2RF9A 2JD5A 3COIA 5AUUA 3E3BX 2XH5A 4M66A 2VRXA 2F9GA 4XS2A 2O5KA 5JZNA 5CSHA 5TKDA 3DJ7A 3PVWA 4WBBB 5J95A 4EKKA 3FI8A 3BPRA 3KB7A 3Q2JA 4IZAA 4IWPA 4O0VA 3RALA 3G9LX 2ITYA 3U51A 2Z02A 1T46A 3QCQA 2EVAA 1WCCA 1LR4A 3D94A 2FUMA 2GNLA 4G2FA 4DEGA 4E3CA 1JSVA 2P2HA 3TN8A 4ZZOA 3NIEA 2A4LA 5EQEA 3KXXA 1TVOA 2B53A 4DAWA 3I4BA 2O2UA 3N4TA 3UQFA 4C3FA 3QGYA 4FSNA 4EK3A 5BVOA 3R1YA 2QO9A 5HG8A 5CAOA 5E8TA 3PY3A 4X3FB 4BZDA 4IAKA 2E9OA 3R8MA 4M14A 2ZB1A 3SHEA 4D2VA 4GYIA 2WMVA 3DAKA 2XA4A 4XG6A 3GOKA 4QTEA 1IA9A 4IAIA 3UOHA 2ETKA 4CKJA 2J4ZA 5IA4A 4UZDA 3ZM9A 5T6KA 4RLLA 3DA6A 2XNPA 3AC5A 5DOSA 3RPVA 3IW5A 4IX5A 5EYCA 2PMOX 3D4QA 5A9UA 1MRYA 2IVVA 4ZTRA 4MYGA 2YZAA 3ROYA 4TYHB 3LCOA 3QQFA 5IA1A 4PL3A 1ZAOA 4O0TA 3SV0A 4E5AX 4JDJA 4TZRA 4IQ6A 4KBKA 4RFMA 3TCPA 3UC4A 2AYPA 2JEDA 2JDSA 4HYSA 4YNEA 4EBWA 3PP1A 5ITAA 3TV6A 2RKUA 2VWBA 2Y9QA 2IPXA 2WU7A 3MFUA 4X3FA 3F7WA 2UZEA 4ZSEA 2F2CB 4W9WA 1ZYCA 4I0SA 4QMYA 2YM3A 3VJNA 4QQTA 3PSBA 4RRVA 2RIOA 2J50A 3V6SA 4LRJA 4EOLA 3EWHA 3MA3A 4FZ6A 4JVGA 1JWHA 1ZXEA 3OS3A 5IH6A 1YOLA 2IN6A 3O2MA 4IBMA 4QP8A 5L6WL 4AZSA 1SZMA 3CXWA 3OCBA 3FZTA 4D1ZA 4F09A 4GW8A 2ZM1A 3LVPA 3G90X 4GS6A 1Q41A 2BDWA 2VO0A 2DYLA 2PVYA 5D9HA 3QRIA 4L01A 5LVLA 2HZ0A 4A4XA 2YEXA 4FIEA 2VTSA 3DV3A 2HCKA 4TWNA 3B8QA 3R8UA 5HE1A 4O7ZA 4W9XA 4DT8A 3I79A 3ZS5A 4UX9A 2YJSA 5A4TA 3NDMA 1YXTA 3G6GA 2BIKB 4BDDA 4NW5A 1R0EA 1URWA 3E87A 2F49A 4U7ZA 5M4FA 5DMZA 5CSXA 4PMSA 4XLVA 5BX0A 3GFEA 3EQDA 3RBWA 3KK8A 3MY5A 5FRIA 5JZJA 4KAOA 4CFVA 4IWDA 4EZ7A 2C6TA 5TF9A 3RAWA 5E7RA 4IH8A 5LARA 1JBPE 2OU7A 3DZQA 4NWMA 4PTEA 3BGPA 3RMFA 4C02A 4IDVA 3VS7A 4O86A 3EOCA 3LFDA 4H36A 4BTFA 4U79A 3RP9A 2GTNA 4EJNA 1RW8A 5HU9A 2C3JA 5AAEA 1YVJA 3DKOA 3MB7A 3IQ7A 3PJCA 2AC5A 3OP5A 4J71A 3WOWA 3BV3A 4PDSA 4B7TA 3N4UA 4GU9A 4J99A 3SXRA 3AT2A 4JAJA 3MVLA 2W5HA 5DVRA 2OZOA 5IISA 3NS9A 3DNDA 3NW5A 4O7NA 1UVRA 4JBQA 4GVJA 2X39A 3D15A 4RJ4A 4GU6A 4FNXA 4S30A 2JLDA 1Y6BA 1W7HA 5AWMA 3Q9WA 1KE5A 4USFA 5CTPA 2LGCA 4FEQA 3CR0A 3HECA 1VYZA 3IO7A 3KGAA 3LJ2A 2XNOA 3OCTA 4M12A 4LV5A 4YJSA 3VC4A 4DHFA 4GG7A 3SDJA 4G5PA 3UPXA 3ZCLA 1XO2B 2WQEA 3FXXA 3MY1A 3F6XA 4DEDA 4U0IA 2J0LA 3KVWA 3KMUA 3L1SA 2GS7A 2PZRA 2ZV9A 3BHHA 3O50A 4K33A 4RLKA 1XH6A 5KMLA 3FZOA 3LFSA 4IANA 1DAWA 4PL5A 2HWPA 4N4SA 3VHKA 1ZZ2A 3DJ5A 2GQRA 5HD7A 4EK6A 4UMTA 4DFUA 4K6ZA 4MXYA 4ERWA 4IVCA 4KIKB 3R04A 3AC3A 3FKLA 4HOKA 2XK8A 5AUZA 3SC1A 5J7BA 3V3VA 3EQRA 3SXSA 1W98A 3UNJA 2E9PA 4JBPA 3ZEWA 5M44A 3F88A 2VN9A 3V8TA 5DA3A 3ATSA 2PK9A 3F82A 4DH3A 1SVGA 1M2QA 2R3KA 4A9TA 1J1CA 4O22A 1YXUA 1ZLTA 5BPYA 2HAKA 3TZ8A 4ZS4A 4R7HA 2HXQA 5CT7A 2QC6A 3UJGA 4K11A 3DFAA 2XNBA 4GIHA 4GT5A 3ZLSA 1CKIA 4DTKA 5K9IA 2VV9A 4RBLA 5B2KA 4PUZA 5KKRC 5E9EA 3DY7A 4CTCA 5HEZA 3DNEA 4KIKA 4GEOA 2P4IA 5J5SA 4OTIA 3PXQA 4JX7A 4MBJA 2OIQA 3FY2A 3V01A 3MPAA 1WBNA 3C1XA 5FP6A 4BCQA 3CGOA 2VAGA 3LCDA 3FMKA 3R7GA 3Q60A 3Q53A 4U80A 3PP0A 5HVYA 1G8SA 2SRCA 3E7VA 2J9MA 2QHMA 3QXPA 3TUDA 5GIPE 1JKLA 1Q97A 3Q9ZA 4ZZNA 4QP4A 1WVYA 3D9VA 1REKA 2YFXA 3LIJA 3LFCA 3P86A 1TQMA 4F6SA 3HRBA 3BE2A 5EM6A 5A54A 1OPJA 3D0EA 3IOPA 1JKSA 4NSTA 1KOAA 1GNGA 4DH5A 3EN6A 4IE9A 4NZWB 1WVWA 4XUFA 3QUPA 3ZH8A 5J1VA 3PLAE 3PA5A 2VUWA 5KMIA 3S1HA 3TKUA 5AUYA 3BV2A 1MRUA 4XG9A 4XBUA 5CF4A 4G17A 1AGWA 4MXCA 3FQEA 2BTSA 2XRWA 1PXIA 3G0EA 2BZJA 2W4OA 3G0FA 3UE4A 3NSZA 3PXYA 1YXSA 2CNQA 4YSJA 2Q83A 3R21A 5IU2A 3GCQA 4L3PA 4BBEA 4FKGA 4RIXB 3AD4A 4DCEA 2UUEA 3R00A 1YHVA 4C3PA 1B6CB 2BAKA 4M8TA 4QMXA 3SVVA 4HPUE 2O8YA 2R7BA 3L9PA 4JL9A 3LFNA 3P7CA 4G9RA 3AQVA 3C4XA 1L3RE 3QRTA 5AV0A 3K54A 4GJ2A 5DT4A 1PMVA 3G51A 3E5AA 4B9DA 4QMNA 3D83A 4ITJA 2WTVA 4BWKA 3KXZA 2CKQA 5IQDA 4ZIMA 2QODA 2BIYA 2XEYA 2ITWA 2R3HA 2DS1A 2DUVA 3DOGA 4AW1A 2XYUA 3UGCA 4DFYA 4XEYA 4H3QA 2B9HA 4IAFA 4WNOA 4BI2A 3M11A 5L2IA 2X81A 4NTSA 5FP5A 4FKLA 2V7AA 3JS2A 4FZDB 5FBNC 5J9ZA 4HNIA 4DGGA 3R7VA 4F99A 5CU6A 4FV8A 2VO7A 4BTMA 5AP3A 4P4CA 4FKSA 1UA2A 2YITA 2CN8A 3IK3A 3QD0A 3QZGA 4Y95A 5AV2A 5E4HA 3AT3A 2ETMA 2GCDA 4DH7A 2GSFA 4BDHA 3KN6A 5EHLA 4EWHA 2ONLC 4IB0A 4TPTA 1GIHA 1P4OA 4X2GA 4ZY6A 3KFAA 3NR9A 2W5BA 3ZRLA 3LMHA 4O7TA 2J7TA 3HDNA 3W2PA 4HVDA 5HU3A 1BLXA 3SW7A 3QD2B 3DAEA 1BKXA 3UOJA 4FI1A 5J7HA 3LLAA 2X9FA 3HLLA 3DJ6A 5HE3A 4O1PA 4U8ZA 4IZYA 4AOJA 3HEGA 4IFGA 1QCFA 3MIYA 4U5JA 3U55A 2VX1A 2W4JA 4L68A 5I3OA 5I9VA 2Z8CA 4FIJA 4U6RA 3NUUA 4BZOA 2XJ2A 4QMUA 1UWHA 3FC1X 4AA4A 5AV1A 4LMNA 2PVMA 3EQPA 3ZLWA 2FSLX 5E8UA 5AR5A 4O7RA 2WMRA 4BDCA 4CT1A 2BFYA 4KIQA 4IXPA 4FKJA 4YUQA 5GIOE 4XLIA 3IG7A 3OT3A 1L8TA 3GB2A 4QMSA 4AACA 4BDIA 4C35A 4APCA 4FIFA 4LRKA 2Z7SA 3H9RA 1OI9A 4NIFA 3AMBA 2B54A 4NM7A 3VBXA 3P1AA 3PE1A 3IGGA 3V6RA 4BCJA 5CU3A 2YAAA 2YIYA 3AD6A 3EHAA 4PTGA 3PVBA 4O7WA 4YHJA 3TTJA 3L8VA 3REPA 2X2MA 2EU9A 5IUGA 3ZHPC 1FQ1B 4A9RA 3I81A 4MHAA 2YAKA 1M2PA 5C03A 4O7SA 5A4EA 2WQMA 2YM6A 4H3BA 3JYAA 2BZKB 3QQHA 2B55A 2CN5A 4OBPA 3ULIA 3G33A 4O91A 4ZOGA 3L8XA 4O83A 5AP5A 2P0CA 3ZXZA 4ANLA 3VBWA 5IH5A 3DCVA 4BWPA 3BE9A 2QG7A 5EFQA 4H58A 5CF8A 5LWMA 2OG8A 3NCGA 1KE8A 4RZWA 2ITOA 3FLNC 3H0ZA 4QYEA 1XBBA 4YZCA 4GKIA 4R77A 5GZ8A 4IAZA 1KOBA 1SNUA 2ESMA 4YNOA 4QPMA 4IX3A 3NAYA 4FYOA 4CTBA 2F7EE 1SNXA 3QC9A 4F9CA 2JITA 1OKWA 2X2KA 2XIYA 4WG5A 2FSOX 4J96A 3EFJA 3H10A 4LGGA 4ZTNA 3NNVA 3E3PA 1P4FA 3IS5A 4U3YA 2E9VA 4FUXA 2PUPA 2DWBA 3HX4A 4ZTLA 1HOWA 1WBWA 3HV6A 4KSPA 4EOQA 2B9JA 3CP9A 3V5TA 3VRZA 1OL7A 4P90A 2V22A 4J95A 4A7CA 5AM7A 5JFSA 4XNEA 3TNQB 1J3HA 3ORMA 4M97A 4XBRA 4C4EA 4D1XA 3MTLA 4TWPA 3BLRA 1RJBA 5ANEA 4AT3A 2QONA 3P7BA 4FKVA 4II5A 3W8LA 2WD1A 4RJ3A 2XCKA 3QLFA 4FTIA 1RE8A 1PRYA 3VBYA 2R9SA 1OITA 3DBQA 4DCAA 1JQHA 5L8KA 4C62A 1PY5A 4GV1A 3OVVA 4A9UA 5IH4A 4WBOA 5KHXA 2XYNA 3CC6A 3TI1A 2VZ6A 4F9YA 2I0YA 4J8MA 2ITNA 3AGMA 3Q9XA 4EKLA 2W5AA 1H28A 3E88A 2RFDA 4G6OA 2I7QA 1JKKA 2G15A 3C4FA 4CFWA 3VF8A 4PV0A 3DS6A 4R3RA 1UU7A 3Q6UA 4RC3A 3OCSA 4DC2A 4DFZE 4QMQA 4DITA 5KCVA 4JQEA 5T3QA 3BHYA 5EW9A 3VBTA 4YU2A 3OW4A 4M7IA 2WTIA 3MS9A 5IA3A 3BEGA 5DBXA 4W4XA 3CSVA 1Y8YA 2R64A 5CT0A 4CV8A 4RWKA 1M7QA 4K9YA 3C0IA 5KZ0A 2WOTA 3Q9YA 2HXLA 3ID6C 3R7OA 2O65A 3RCJA 2WMSA 4O1OA 3WE4A 3S2PA 4IB1A 2E9UA 3A7HA 3OMVA 3CPCA 1REJA 3GC8A 3WE8A 2XIXA 3A8XA 3RWPA 2RG6A 3M42A 4WRSA 4GFOA 3ZZWA 1FBNA 5CQUA 3PPKA 3RHKA 4LL5A 3AC4A 3R0TA 1GZNA 2J2IB 4BCPA 3O8TA 3PXFA 3KQ7A 5L8JA 1R39A 4FV6A 3VVHA 4WNMA 2X6EA 3BCEA 3SG8A 2Z7QA 2W1GA 3RI1A 3WZDA 5HVKA 4KKEA 4ZTMA 3KK9A 4NCTA 4IB5A 2WAJA 3ZSGA 4BI1A 5FDPA 2B7AA 4XP3A 1DI8A 2XCHA 4OGRA 3UZTA 5JRSA 1OVEA 4L52A 5BYLA 2C0OA 2BDFA 3KXNA 3QKMA 4QMMA 3BELA 3NX8A 3S00A 4Q9SA 5AAGA 2Y0AA 1U46A 4M67A 4EOMA 5HLWA 3R63A 5D7AA 2GFCA 4ANBA 4L53A 4HZSA 5TOZA 4EHGA 2C30A 4ZTSA 2H8HA 3P78A 4UXQA 2ITQA 5AA9A 4OBOA 2ZM3A 4X2FA 2PULA 4Z9LA 3OZ6A 3ORNA 4XX9A 3DBFA 4DLIA 5HORA 1DAYA 2J6MA 2PVJA 2H9VA 2WMXA 2BUJA 3H3CA 4K1BA 4KWPA 5DG5A 4C3RA 4EH2A 5DEWA 3EIDA 5M53A 2OXXA 1YRPA 3I7BA 4IWOA 5AFVA 4DE4A 4ZK5A 1FMOE 2BKZA 2R3NA 3NW7A 5I9YA 5IQBA 1Q3DA 3ZM4A 2Q0NA 2RGPA 4NJDA 1WBVA 5CALA 4CSVA 4EH7A 4ACGA 2ITUA 3FI4A 3GXLA 4F65A 3KULB 2JFLA 5KMJA 4UY9A 1FVVA 2HIWA 3UYTA 2C3IB 3VRYA 5F20A 2IO6A 4IVDA 3EFLA 3U87A 3WIKA 4YTHA 2UW8A 4OBQA 3RPRA 5LMKA 1YDRE 5C27A 3VS6A 3ZUTA 3FBVA 2PVRA 1ZOGA 4QQJA 4HW7A 3GNIB 5FD2A 3G2FA 4FTNA 2XP2A 5CAQA 2GHLA 2YM4A 5AMNA 3VS3A 1YI4A 2A27A 1Q5KA 4MXAA 4CGAA 4E1ZA 3EQBA 4PPAA 3VUKA 1UNGA 2I1MA 4Y5QA 4EOKA 3NCZA 2GDOA 2J0MB 3PYYA 5E8XA 3R73A 3KRLA 2QOHA 4Q2AA 4G3GA 3KULA 3W2SA 3LE6A 4R3CA 3ZC6A 4W4VA 3PY1A 5K0XA 2J0IA 3THBA 4EHZA 4FIHA 4BDKA 2QOKA 4PDYA 3PWYA 2XMYA 2UZLA 5CY3A 5JEBA 2ZV7A 4K8AA 4DEHA 4BYJA 4FOBA 5BVWA 1R3CA 4S34A 3VUIA 3II5A 4IMYA 4JIKA 4JR3A 5EQYA 2C68A 2OF4A 4JI9A 4KS7A 4IZ5A 3SXFA 3IW8A 1W8CA 3T8OA 5A3XA 4JG8A 1Y6AA 3BYOA 2PE2A 5HX6A 3KRXA 3FQSA 2G1TA 1GZKA 4FTMA 4Z3VA 2FGIA 3DXNA 5KMNA 2VU3A 4GJ3A 4UMQA 3D2KA 4YMJA 3QZIA 1PMEA 2XJ0A 3RZFA 5CEMA 4I3ZA 3R1QA 3DKFA 3Q04A 4FV3A 2O3PA 1Q8ZA 1SYKA 2RFNA 1Q8UA 4HGTA 2HY0A 4YO6A 5D11A 3TNPC 4AS0A 4H05A 5EOLA 3VUMA 3DFCB 2HW6A 4EH9A 4AZTA 3OBJA 4YTCA 4X21A 2QO2A 4AFEA 4BIEA 2WELA 2YM5A 5AP7A 3G5DA 3RHXA 5CEKA 4RFZA 4RIWB 5E91A 5DT3A 1ZY5A 3QQGA 2J5FA 5J1WA 4QD6A 1I44A 4FKQA 3O17A 3R6XA 3GCVA 3P08A 2W05A 4DFBA 2NO3A 1LEZA 4IX4A 4U42A 2QKRA 3GU4A 5CXZA 4L3JA 2X2LA 4EZ3A 4PPBA 4QP6A 3OG7A 4WG4A 3PPZA 4AGDA 3U9NA 1OIRA 4X2JA 3IKAA 3RTPA 1S9JA 1XHAA 4FGBA 3B2TA 4I5CA 4OAUC 4MX9A 2OZAB 1R78A 5HICA 4BL1A 2G2HA 3FMDA 1HCKA 4A06A 3SOAA 3E93A 1U5RA 5AIKA 2ZV8A 3NEWA 5FM3A 4B4LA 4ZJVA 4RIWA 3A99A 3Q52A 4WHZA 5DE2A 4J1RA 5H8GA 2OSCA 4XHKB 5HLPA 2PVLA 3GBZA 3PZEA 4EUTA 3JUHA 5EI2A 5IA5A 5BUJA 3LM0A 4GKHA 1VJYA 5K4IA 2FO0A 5DR6A 3U9CA 4EH6A 5HD4A 4BC6A 3PPJA 4ZTHA 5GHVA 5CEIA 3UZPA 4ZAUA 4J7BA 3MDYA 3DTWA 3QKKA 3BYUA 1JVPP 4F0FA 2GHMA 4FSWA 5A14A 1PYXA 3NVMB 5C9CA 2PUNA 3UOKA 1PXNA 5AIRA 2VO3A 3DU8A 5AV4A 3JY0A 3F2RA 3QQLA 4KSQA 3ZOSA 1OPKA 4AN2A 1VYWA 3F5PA 2UVYA 4DG2E 1WBTA 2EWAA 1KUTA 2PVNA 2YCRA 4BBFA 3LJ0A 4CKIA 3UBDA 3U8WA 4AAAA 4FV4A 1BI7A 4TNBA 4WO5A 3PWDA 4MXXA 4QNAA 3BKBA 1YKRA 4GT3A 2W7XA 3GVUA 2UW0A 3BU5A 4RVLA 2YWPA 3P4KA 4XG4A 4FR4A 5H8EA 4NFMA 3DBDA 3UIBA 3QFVA 4YZMA 4CV9A 3BYSA 5TR6A 2EXCX 2GNHA 4R3PA 3TV4A 4D2WA 2R3QA 5HZNA 3MJ2A 3NWWA 4WG3A 3FQHA 3QLGA 4BTJA 1IEPA 3F5UA 4FA2A 5M08A 4FIGA 5CSWA 3DTCA 2C3LA 3GCPA 2JKOA 3UPZA 4JQ7A 5HO8A 4FV5A 2VX3A 3WF5A 4O0UA 3PTGA 2QO7A 4JJRA 4R8QA 4QPAA 1BUHA 5IQHA 2X8DA 2C47A 1XH5A 1KV2A 4X3FC 5CU4A 4F9WA 2R3GA 3O96A 4ITHA 3QWKA 2ZOQA 1NVQA 4CXAA 4ZEGA 4TTHB 4AP7A 3R02A 5HKMA 5BVDA 3KMMA 1WVXA 3F2AA 5HCYA 2HENA 3KVXA 4KRDA 3HAMA 5IQCA 4FKRA 5E1EA 1Q99A 3CTQA 4A4LA 3TG1A 4XRJA 4DEEA 3A60A 5CX9A 4E6AA 4ASDA 4J98A 1RQQA 2JGZA 2PU8A 1MRVA 1F0QA 4F9AA 3OEFX 1BL7A 3HMNA 3CCNA 4O0XA 4F7NA 2QQ7A 4ARKA 4FNZA 3UVQA 1Q8TA 3DB8A 5M51A 1CDKA 2BZIB 2PZPA 3EN7A 3HV5A 4I6FA 1Q4LA 1H4LA 1I09A 3A2CA 3SRVB 2PVKA 4DEBA 5E8WA 1STCE 1A06A 4KBCA 3T3UA 3KXMA 2BRGA 4C8BA 3A7JA 4FNWA 4QQ5A 2VTTA 4BWXA 3PSDA 2XNGA 4L43A 5GJGA 2HOGA 2CGVA 5FQDC 4F6WA 4DT9A 1Z57A 2C5YA 2I40A 3C0HA 4RC2A 4NUSA 2Z7LA 5D7VA 4O0WA 4QYFA 2UV2A 4RVKA 2C0IA 5GJFA 1H1QA 5CASA 2VWIA 4S32A 4AW2A 4G31A 2C6KA 3W2OA 4ZLZA 3SRVA 4EEVA 1OZ1A 5A6OA 3V8SA 2QURA 5HE0A 1ND4A 2B0QA 5HVJA 5IQAA 3EB0A 2R3PA 5I3RA 4QP3A 2Y4IB 3GOPA 4GUEA 4R7BA 2PZ5A 5AA8A 2V62A 5IEYA 2XIZA 1XH8A 4O27B 2R0UA 4MEDA 1E1XA 1Q8WA 2GNGA 4FKWA 3R2BA 5IMEA 3NPCA 4G6LA 2X9EA 2Q0BA 3Q3BA 1CM8A 4BFMA 4TYGA 3EN5A 2XNMA 1OBDA 1H1WA 3FMJA 3OXIA 3SLSA 4V04A 1ZYDA 3COHA 5BQ0A 4HYHA 2UZBA 4RJ8A 3NNWA 4FSTA 3T3VA 5AP2A 4AWIA 5HQ0A 5CVFA 4HYIA 4IAAA 3AGLA 4TY1A 3TZ7A 2OIBA 5CNOA 1FGKA 4JIAA 2I0VA 3U4UA 3NYOA 4AGCA 1CTPE 3LXNA 4CG9A 4MD7E 2WPAA 3DB6A 3MN3A 4O7YA 5I0BA 4I20A 3F5XA 3RM7A 4O81A 4BY9E 5ETAA 5LCKA 3COMA 3I6WA 4YZBA 3S0OA 3TDWA 3PA4A 3SKCA 4RIOA 2HELA 4FKIA 3QTXA 3WIGA 1U59A 5EM8A 4QOXA 4O84A 2HZ4A 2JIIA 4WA9A 3DT1A 3O0GA 4XOZA 4C4IA 2IZUA 3G15A 2XK4A 3I5NA 2YCFA 3FC2A 4GFGA 3D5VA 1PKDA 2IVUA 4L9IA 5IUIA 2XNNA 3GU8A 3MV5A 2OJFE 3UP7A 4F0IA 3LXPA 5HESA 3RKBA 3L9NA 1Q24A 3NW6A 2WIPA 5ANDA 4PP7A 2G2IA 3KN5A 3MYGA 4KS8A 3UP2A 2W96B 4IWQA 4A9YA 5DT0A 3QTIA 4ALVA 5BYZA 4CKRA 3FEGA 3POOA 3QD4A 3KXGA 5TT7A 5TE0A 4KIOA 2PHKA 1OB3A 1U54B 1J7IA 4AE9A 3HRFA 3HRCA 3ZLXA 4GMYA 4NKAA 3C4ZA 4A4OA 5AX3A 3LQ8A 4QYYA 4RQKA 3ZRKA 2UZVA 3Q96A 2EUFB 2XM9A 4UZHA 3VUHA 2QOOA 5DR9A 3ORZA 3VO3A 3E64A 3DDPA 3O51A 4I92A 2QOBA 1OBGA 3EQCA 5KMKA 3OTVA 4MNFA 4DGNA 1ZOEA 5B0XA 4F7SA 4Y83A 5CXHA 4ANSA 2WTWA 3C5UA 3V5WA 5L8LA 2RFEA 5C8MA 3F3VA 4O21A 4EQMA 5KUPA 3HP5A 1YXXA 3CIKA 3WARA 1U54A 2IW9A 5LMBA 3EMGA 2WTCA 2VX0A 3ORKA 3D7TB 5CU0A 4UYNA 3NVKI 2W1EA 3D5WA 4GSBA 3ZMMA 2VGPA 3GCUA 3LPBA 5M06A 2RG5A 4F08A 3VS2A 3RJCA 4ANQA 4N6ZA 3QCSA 4I41A 2XNEA 2VTQA 5LVNA 1J7UA 4AQCA 1APME 1R1WA 4FKTA 2J5EA 1W84A 2I6LA 4ZTQA 4E5WA 5IEVA 1IAJA 3NAXA 4MQ1A 1YDSE 4NM0A 3WYXA 4B8LA 4BIDA 2VTOA 3M1SA 4XG8A 5HIDA 4Z16A 5H3QA 4A07A 4O96A 2CLXA 5KNJA 3WF9A 4S33A 3BLHA 4QP7A 2R3RA 2WNTA 4UWBA 4GYGA 3IDPA 2XS0A 1XH4A 3EZVA 3BI6A 3Q6WA 3D7TA 5ANJA 2OGVA 4KINA 4S2ZA 2BKKA 4RG0A 4QMTA 4QMLA 4BR3A 3A8WA 4UYAA 4E6CA 5I5ZA 5EW8A 3GGFA 2ZMCA 4HCTA 3OWKA 3Q32A 4RIYA 3ZSIA 4KA3A 4DA5A 3LZBA 5B2LA 4GK4A 2QLUA 5IDNA 5FLFA 4AA0A 4ZXTA 3JXWA 3C7QA 3VAPA 5EYKA 3VWAA 3VS0A 3R9HA 5AM6A 2IZTA 2WXVA 3PXZA 1NXKA 2XVDA 2C0TA 5J87A 4G34A 2BCJA 3W2QA 3LOKA 4GT4A 1UU9A 2WTKB 4MXZA 4I22A 4BICA 5CNNA 3BIZA 3DBEA 4FYNA 2FA2A 3BWFA 4CQGA 3W16A 5EKNA 2JAVA 5HNGA 4EYJA 4BVUA 2Z2WA 3U54A 4LOPA 2QKWB 4UALA 4USDA 1QMZA 3ODZX 4C4GA 1WAKA 4KIPA 3OY1A 3DQWA 3RZBA 4ACMA 2ETRA 1X8BA 2R3JA 3NLBA 4LG4A 3HMOA 3LCTA 3C4EA 2O64A 3GUBA 5I9WA 4C33A 4F64A 4IVAA 3UMXA 3KL8A 3QTZA 2CPKE 2ZM4A 3ORTA 4M15A 4YJNA 3WZKA 1ZY4A 5AEPA 1KWPA 4ZMEA 2PZIA 4UN0C 3BGQA 3QALE 1YHSA 3O7LB 4NIFB 5EOBA 3JVSA 3MFSA 3EFWA 3AG9A 3E8EA 4L6QA 5E1SA 2YN8A 2F57A 4ENXA 4AW5A 4EOOA 3GU5A 2ZJWA 3SQQA 1H27A 4IZ7A 3MH0A 4PDPA 4C58A 4L46A 4M84A 2EXEA 2XBAA 5FDXA 1P5EA 4UEUA 2OH4A 4NJ3A 4HVIA 4Y46A 1K3AA 4IW0A 4CCUA 2QG5A 3PIZA 3HNGA 5F4NA 3NUSA 3VJOA 1FVRA 3OWLA 3EN4A 4LOQA 3DK6A 4AGUA 1SVHA 3LHJA 4GK3A 5C26A 3MWUA 3P9JA 1ZARA 4U45A 2WEIA 3FSFA 5AX9A 5HBJA 4WSQA 2CKPA 3QKLA 5IQEA 3MB6A 4J52A 2R4BA 2RSVA 5D41A 4XG3A 1Y8GA 5H2UA 3EKKA 3WZUA 2E9NA 1M2RA 4HJOA 4CFFA 4L45A 3V5PA 5AUTA 2XKEA 3LCKA 5L6PA 4MK0A 2JIUA 3GENA 3Q4ZA 4IFCA 3OUKA 5GJDA 1JLUE 3KRWA 2VWUA 4QTAA 3FI3A 5KBRA 3OXTA 4I4FA 3CBLA 1YW2A 2VWVA 3HV7A 3PVGA 4X0MA 2IVTA 4E4MA 3PSCA 5EDQA 5AADA 2OBJA 3A62A 5IF1A 5GZ9A 5HGIA 2CSNA 3A7GA 4FL3A 4RT7A 1MQBA 5A4QA 4C2VA 2ITPA 5KHWA 4EBVA 1H00A 4LFIA 2BPMA 4IM0A 2YJRA 5CEQA 4TRLA 4QQCA 4IEBA 3R8ZA 1KSWA 4U43A 5FG8A 4EHEA 4NKSA 5CU2A 4L42A 4OTFA 5CZIA 5FWKK 2JDOA 4I0TA 4JBVA 2UW4A 5HG5A 4ANNA 3OFMA 5HG7A 2GU8A 5DFPA
chains in the Genus database with same CATH superfamily
4FT0A 4YHFA 4RJ6A 3ZXTA 3MPTA 1ZYSA 3ENMA 2YISA 2R5TA 4YBJA 4WRGA 3CJFA 2W17A 4NW6A 4Z7HA 3BBWA 5CEPA 4QNYA 5CAVA 4DN5A 4CLJA 3EFKA 3IW7A 4JDHA 4RJ5A 4Y72A 3TIYA 3ITZA 4FL2A 3PG3A 1W82A 3BQCA 5CWZA 3QRUA 2O0UA 4TT7A 5IQIA 4C36A 3UC3A 1PMNA 4MD9E 5D12A 4ZSGA 1YWVA 3HMPA 4FSUA 1V0PA 3ZFYA 1J1BA 3PZHA 2YA9A 2CGXA 3FXWA 2REIA 5LMAA 4TWOA 4I24A 4YJTA 4M69B 5JT2A 4WNPA 3R9DA 4X3JA 4E4NA 2BAJA 4C38A 4C61A 2R3LA 5HBEA 4IAYA 5EM5A 4Y8DA 1IAHA 4PPCA 4QRCA 3UIMA 3DQXA 4MNEB 2C5XA 5EYMA 5DI1A 3GC0A 5M4CA 5HBHA 1H1SA 4EI4A 5A46A 4G9CA 4BDFA 4HNFA 3VBQA 5L2WA 2HW7A 4PY1A 2YDJA 3F3ZA 4J97A 4BI0A 2CKEA 5FBOA 4LI5A 5AP0A 3HP2A 2OWBA 3OY3A 4UMRA 4M69A 2BRHA 1WFCA 1G3NA 2WMBA 3A61A 2WFYA 2ZB0A 2WO6A 4RMZA 1GOLA 3DPKA 5L2QA 3PJ8A 3AMAA 3ML1A 5FXRA 3IGOA 3AXWA 3G9NA 4MNEA 1H1PA 1CKPA 2V7OA 3C13A 4FBXA 3V5QA 3W18A 4RFYA 4NCTC 4R6VA 2C6IA 3KRJA 5CENA 5AUVA 1VR2A 4G5JA 4RVMA 3FAAA 2UZWE 4YR8A 3QD3A 4B99A 4KBAA 3DK7A 3KCFA 3ZYAA 3E7OA 3R22A 3UNKA 3LM5A 4FV1A 4AFJA 2ZAZA 2IW8A 1WBSA 3QA0A 5AUWA 3U4WA 5ETCA 3VUTA 2ZDUA 2QCSA 4FSQA 3ZBXA 4D4YA 4WSYA 3P7AA 4KB8A 3QHRA 3VW8A 4E6DA 3P5KA 4BF2A 3W0SA 4MBLA 5A6NA 4E26A 3KRRA 3MVHA 2B9IA 2X6DA 2P2IA 3PE2A 4JG7A 5KZIA 4CVAA 5IMXA 3IECA 2W4KA 5H9BA 5JH6A 3DXPA 4BCMA 4MTAA 3WI6A 5HIEA 2GMXA 3PG1A 3UNZA 4ERKA 5HO7A 2W1DA 4JR7A 2NRYA 4IJPA 1S9IA 4FUYA 4B6LA 4YURA 5K5XA 4XV2A 3NYNA 3MBLA 4ITIA 2OFVA 2ACXA 2YLFA 3EYHA 3FMMA 4DFLA 1H0VA 2VTMA 5LMKC 3Q2MA 4BDEA 3AMYA 4IDTA 2YIRA 3MFTA 3RK9A 4YZNA 4CYJA 2BMCA 5DLSA 3FZ1A 3ZONA 4C0TA 5BNJA 4TN6A 2XIRA 2BRNA 4JAIA 4KD1A 4FZ7A 4U41A 5M4IA 4FMQA 4AZWA 2BRBA 5C8NA 2PE1A 3MPMA 4YJVA 2OLCA 4AZVA 4O4BB 3TNHA 3LFFA 1GIIA 4ASXA 4HVHA 2QOIA 4A9SA 4ORKA 3MY0A 1OKZA 2NNWB 4OTWA 3FL4A 4GIIA 3FJQE 4TL0A 3ZSHA 4U3ZA 2PY3A 3RAHA 4AX8A 4FVPA 4YGAA 2I0HA 3TDVA 1FGIA 3K3JA 4ZSJA 3RK7A 3RPSA 2W9FB 4BCKA 3BU6A 4C34A 3MFRA 4QMPA 4EYMA 2GS6A 3NIZA 2OJJA 2VTJA 4XP2A 2W99B 4QMVA 3TJCA 1ZWSA 3FLYA 3QTWA 4GH2A 3TKHA 4FRFA 3QCYA 4F7LA 1TKIA 4EOSA 2ERKA 5HI2A 1RDQE 3UO4A 4FEUA 4QTBA 2OW3A 3VW6A 2JFMA 4O4CA 2FH9A 2BRMA 4OTGA 4O2ZA 4U44A 1JKTA 1J7LA 1UKHA 2F7XE 4XJ0A 5ACBC 4BKYA 2OXYA 3GQLA 4JG6A 4M13A 3H0YA 1OM1A 2BHHA 3JY9A 1Q3WA 3NRMA 2R3FA 4Y5HA 5LWNA 4EJ7A 1GIJA 2NRUA 3RCDA 3FMHA 4F1TA 2XK9A 2VTLA 2ZDTA 4O0RA 2PMIA 3KY2A 1O6LA 3CTJA 3QTSA 2PE0A 3D14A 4PMPA 5C1QB 4F1MA 4JX3A 3PVUA 2FSMX 2X7FA 1KE7A 4FZAB 4FG8A 1V0OA 2PWLA 1NA7A 2HZIA 2QD9A 5E8SA 3AC8A 3QTUA 1OECA 4HPTE 1GY3A 4JDKA 3HL7A 3ORLA 2C3KA 2QOLA 3NGAA 4JOAA 5BMSA 5BV3A 4BJJB 4FTKA 4RX7A 4WD5A 5LVMA 3WILA 5EYDA 2Y6OA 3CPBA 3M2WA 3ZFMA 3ATTA 1XH7A 2OJIA 4RX8A 3MH1A 3RWQA 4AN9A 1M7NA 5LVOA 3CY2A 3TKIA 4F78A 5KX8A 3R2YA 2Y7JA 2VWXA 3F7ZA 3R8LA 4AZFA 4QTDA 5GINE 2X7GA 2JKKA 4QYHA 1B38A 1Z5MA 4FTAA 4UWYA 2B52A 4E4XA 1H1RA 4BGGA 5EI6A 4BTKA 2XJ1A 2VTAA 3AC2A 1QPJA 4EWQA 4FIIA 4LM5A 4GRBA 3PDTA 3FZPA 3TACA 4FL1A 4CEGA 5FTGA 4ALWA 3W1FA 3BWJA 4W8DA 1GZOA 1DM2A 1ZRZA 1WZYA 3ORPA 5DEYA 4EHVA 3OROA 1BMKA 4BJJA 1WBOA 4FT7A 2ZVAA 5L2TA 2WQNA 3MA6A 5CVGA 2W1FA 4TYJA 2CDZA 3QCXA 1F5QA 1FINA 4YPDA 5EH0A 3FMLA 5HCZA 4LOOA 2WMWA 4JRNA 4YJPA 2AEGA 3PJ2A 2JAMA 2VTIA 5HX8A 4TNDA 2ERZE 2UW9A 4NFNA 3UQGA 3NZ0A 3FZRA 4OLIA 4NEUA 4PL4A 5CEOA 1K9AA 4DEIA 3RVGA 3E8CA 4FNYA 4NH1A 4WUAA 3ZEPA 2GFSA 5ETFA 2V5QA 4Q9ZA 4DF3A 2BZHB 4FVRA 2CGUA 4C4JA 3UMWA 2X8IA 3LQ5A 3UTOA 2XRUA 4I0RA 4TYIA 4I5PA 1PXPA 3ANQA 3E92A 3W32A 1U5QA 4W4WA 5J5TA 3K3IA 4LQMA 3I0QA 3UYSA 2BILB 4RGJA 1H07A 3FY0A 2UVXA 3BYVA 2OO8X 1ATPE 1W2DA 3MSSA 4KRCA 3OTUA 4QP9A 4QPSA 5DH3A 5AR7A 3T9IA 4OT5A 5LCJA 3DLZA 2VTRA 3BBTB 2VNYA 3SG9A 4U40A 4Y85A 4E4LA 2O63A 4O7LA 2GNFA 2NP8A 5GNKA 3Q4UA 4S31A 4QDEA 3FPQA 1VLRA 5CF5A 2CJMA 2QI8A 5IZFA 4EZ5A 4E93A 2V55A 1JNKA 5I9UA 1P14A 4D4SA 4ZP5A 1AQ1A 4FJVA 3UG2A 5BYYA 5HG9A 4D58A 1GZ8A 2ZFYA 3I7CA 5AR3A 1Z9XA 3QA8A 2PVHA 2WGJA 4X7QA 3WZJA 4EH8A 5H8BA 2FSTX 4YJUA 4YZDA 3RPOA 4HGSA 4RZVA 2PUUA 5JN2A 3TTIA 4DEAA 1K2PA 2C6EA 2NYAA 3TNWA 5CSVA 2C5OA 4EH3A 2PL0A 4FICA 2RFSA 3HKOA 5C4KA 3QXOA 5EG3A 3UVRA 3LCSA 4JXFA 3ZU7A 1EH4A 3O8PA 4FG9A 1JSTA 4M0YA 2H34A 4AOIA 1SVEA 2YM8A 4FSRA 3R9NA 4E7WA 4E8AA 5HTIA 1XH9A 3PFQA 3N51A 4FODA 1GAGA 3NUPA 4RPVA 3OT8A 4APPA 4I1ZA 2QU6A 3LFEA 3R8VA 5CANA 4E20A 2KULA 3I0OA 3C5IA 4ACCA 4DH1A 3PXKA 1ERKA 5KMMA 5BMMA 4F9BA 4NK9A 3Q5ZA 4AF3A 1G5SA 3KF7A 5F1ZA 5FEDA 4YC8A 1IR3A 2UZUE 5I9XA 2C6DA 2XUUA 4LYNA 1W2CA 3QHWA 5M55A 3GT8A 4BCOA 1LP4A 4H39A 4D5KA 2YIQA 5DR2A 4GFMA 5LJJA 3EKNA 3PLSA 4CMOA 2IF8A 5IKWA 4EOIA 3GC9A 4CNHA 2NPQA 4V0GB 3I5ZA 3C51A 3OUNB 2X4ZA 2I0EA 4MD8E 2E2BA 2P33A 2QOQA 4DG3E 2UZTA 4C57A 3BHTA 3QYWA 1WMKA 2VTPA 4FTUA 1YOJA 2X7OA 3BEAA 3N9XA 3HAVA 1WBPA 3KCKA 2QNJA 4IB3A 5FM2A 3HA6A 1YDTE 4DTBA 5A4CA 3C4CA 3JVRA 3LLTA 4DBNA 3LAUA 2R3MA 3GQIA 4FV0A 5L2SA 3BLAA 5J9LA 4D55A 5C8KA 3LKMA 2ITZA 3ZZEA 4LRMA 2JIVA 5EM7A 5JQ8A 1IA8A 4O2PA 3FE3A 5FXQA 2B9FA 1LEWA 3MTFA 4H3PA 3U6JA 2XEZA 3MJ1A 4V0GA 5CQWA 3F69A 3HMMA 4C4HA 4CFNA 3FV8A 3E8NA 1W83A 4KABA 3W55A 4FOCA 4OTPA 5C4LA 4FEVA 2C69A 4YC6A 4DG0E 4Q5HA 3QAME 4BKJA 2QVSE 5FTQA 4EL9A 2W1ZA 4CMUA 1ZMVA 2BR1A 4TYHA 5DYJA 5BVNA 1JSUA 5AP4A 3EZRA 3U6HA 1T45A 1XJDA 3MVMA 1H25A 3ORXA 4MCVA 1TZDA 5AV3A 2X4FA 3CS9A 3V5LA 4IJ9A 4CZUA 5BVEA 4L67A 5I9ZA 3OCGA 2Y8OA 1UNHA 3F9NA 3GI3A 2GNIA 2Y4IC 2AC3A 4ENYA 1CKJA 2OK1A 3D2IA 2CLQA 2F4JA 2XM8A 4FTOA 4N0SA 3S3IA 4E73A 1V1KA 5HTBA 2GQSA 4DTAA 4UBAA 4AG8A 3F3WA 3ZO3A 5EQPA 4CRLA 3WZEA 2J90A 3DZOA 3ELJA 4GK2A 2IEWA 4RC4A 4F7JA 3OWJA 4LUDA 5EW3A 3AT4A 3R7EA 3JPVA 1BL6A 4D2RA 3NMUF 2A0CX 3AD5A 3ANRA 4FSYA 3BQRA 3PUPA 4FTJA 3F3TA 3CJGA 4ZSLA 3BLQA 3F2NA 3GU6A 4M3QA 2X8EA 4XV3A 5DNRA 4HVSA 3OF0A 1OPLA 3EQHA 1H08A 4BHZA 1IASA 2YM7A 4U81A 4BCHA 2IVSA 5KO1A 3L8SA 2CGWA 2OH0E 4CYIA 4F1OA 3VQUA 4O4EA 3QTQA 4BHNA 4ZJJA 4FEWA 2JC6A 4DFXE 5CAPA 3G6HA 2EB2A 1URCA 5CSPA 5HHWA 3UO5A 4FT3A 3EYGA 4WKQA 3GU7A 3PIYA 4I6HA 4X6RA 4HZRA 3LXLA 4YLKA 1QPEA 3FLZA 3LFBA 4I6QA 4LV8A 4ZY4A 5B7VA 3QRKA 2XK7A 4NL0A 2FB8A 1O6YA 3P23A 4FTTA 4I5MA 3UDBA 3P79A 2RL5A 2YLEA 2OXDA 4NTTA 3AKJA 3IW4A 4ONAA 3HDMA 5IA2A 2BROA 2AUHA 3CTHA 3OD6X 3KREA 3QZHA 2X0GA 3HVCA 1H0WA 5C01A 4UMUA 5ANKA 5ETIA 2UZDA 4CG8A 3BYMA 3OBGA 3E63A 4IM3A 4OW8A 1MUOA 4OT6A 2CCHA 3UZRA 5E90A 3ZFXA 4AW0A 2VWWA 1LPUA 4PWNA 1UNLA 4GL9A 4JS8A 4RJ7A 4FKUA 5AR2A 4XOYA 3WYYA 3QGWA 3HZTA 2XK3A 4JDIA 4FK6A 4XCUA 5LOHA 5DWRA 3OXZA 3WF8A 3K2LA 4UB7A 3EQFA 5EI8A 3W0OA 3WF7A 2OFUA 5EDRA 4K2RA 2YCSA 3RAKA 4IM2A 4BDJA 1M14A 1YWNA 2AQXA 3POZA 4P2KA 4NU1A 3ALOA 3VUDA 3FPMA 3ZUUA 3VONA 3R83A 5G6VA 3UIUA 5KKRB 4AA5A 4AUAA 3U6IA 4F70A 2C6LA 1OL6A 1YQJA 2IW6A 2UZNA 5DN3A 3R9OA 5J8IA 1J91A 2PVFA 4XP0A 4YZ9A 4QO9A 3ALNA 3NYXA 3WF6A 4DYMA 4BCFA 2VGOA 4X6QC 5KMOA 4XG2A 4H1JA 3VN9A 1ZMUA 1ZMWA 2XANA 4MXOA 2Y6MA 1NT2A 4G16A 3TM0A 2WZJA 3F5GA 2W1HA 3FUPA 2WTDA 1TQIA 4O38A 1NW1A 3DKGA 4RIYB 4YPSA 4YSMA 3CLYA 3MVJA 1QL6A 2A98A 3R7IA 2H6DA 3QC4A 2F7ZE 3KKVA 3QQUA 4HGLA 4JLCA 4PNIA 4C4FA 4UV0A 5HNIX 5E8YA 4W4YA 4EOPA 4J53A 5FUTA 2VWYA 5EHYA 3PJ1A 3W2CA 4L3LA 3MESA 3QUDA 4PF4A 2W9ZB 2YERA 3PY0A 5TO8A 1UU8A 3RPYA 4FTLA 4L7FA 3S95A 2YDKA 4D2PA 3K5VA 2WOUA 3OOGA 3R8PA 3FI2A 3TNIA 1DS5A 4F4PA 2BALA 1XQZA 4FX3A 2WU6A 4CZTA 2YHVA 3SD0A 4FVQA 5HNBA 2B1PA 4BCNA 3W8QA 4O6EA 4XV9A 2YIWA 5IPJA 1IG1A 2BAQA 2C5VA 3BHVA 3R28A 3VF9A 3D5XA 3CGFA 3D7ZA 3L9LA 1XMMA 1OGYA 2VO6A 3OC1A 5F94A 1SMHA 4QMWA 4W8EA 4I94A 2R7IA 3BGZA 4K77A 4EUUA 2PUIA 1BI8A 4FT5A 3QQKA 3ORIA 4NM5A 4ALUA 5HTCA 4WIHA 4ZSAA 1BX6A 4QMZA 5ICPA 3MIAA 3FYKX 4Y73A 1PXOA 4ANMA 2UZOA 3IPHA 5GZAA 1OKVA 1NVSA 4JNWA 3P5JC 3LJ1A 2ZV2A 4PMMA 2J51A 2ITXA 3CKXA 4D0XA 5J79A 2WTKC 3TJDA 2OF2A 2CHLA 2BHEA 3C50A 2C6OA 2BVAA 3RM6A 2QLQA 4YTIA 1Q8YA 3MH2A 4V01A 2JKQA 3TYKA 4C59A 4OAVB 4FTQA 5IQFA 5JFVA 5KE0A 5BVKA 3HA8A 4JQ8A 3DXQA 4RIXA 2A2AA 4FSMA 1LUFA 2ZYBA 3NUYA 4MF1A 4N70A 3VBVA 5B2MA 2PSQA 4USEA 5JFXA 1OIQA 2BDJA 2V0DA 5L4QA 5F9EA 1JOWB 3H9OA 3I6UA 4ACHA 4DH8A 5ANGA 4AT4A 4AE6A 2WKMA 3BL7A 2JBOA 3R01A 5DGZA 2FYSA 1JPAA 2HWOA 3C0GA 4TWCA 4B8MA 5A4LA 3TEIA 4UMPA 4YTFA 5L6OA 5E92A 4O6LA 5AR4A 4O82A 4L44A 3SAYA 3CD8A 1PXLA 4K0YA 4RSSA 1KV1A 4EQCA 4K18A 5EK7A 4EK4A 4AZEA 4D2SA 4RA5A 4BIBA 4ZLYA 3PJ3A 4DBXA 1OUKA 3A4PA 1CSNA 3D5UA 3T9TA 3NYVA 1UU3A 4FGRA 3RNIA 4P7EA 3HGKA 4CT2A 3IONA 3DDQA 4QTCA 2EXMA 4C7TA 3Q5IA 5IA0A 2WHBA 4AN3A 4AU8A 3LQ3A 2UVZA 4LGDA 4Q5EA 3FHIA 1YI6A 4BGQA 4FTCA 1Y57A 1M52A 3DGKA 4LUEA 4FEXA 3H30A 5FXSA 4O4FA 5BUEA 4FV2A 2VTNA 2ONLA 4AT5A 1H24A 2GNJA 4OTHA 1Q61A 4G3EA 3KMWA 3TWJA 3VIDA 3VS5A 4EORA 4Z55A 5IQGA 1YXVA 4D9UA 3BZ3A 3IDCA 1PXKA 4PP9A 3NUNA 2WQOA 3W0MA 1YHWA 3IDBA 3AOXA 4X2KA 5DRBA 2HK5A 3CQEA 3ERKA 4C37A 4DGOA 3R9RA 4WUNA 2BFXA 2VD5A 3EQGA 4ID7A 3CE3A 2XZSA 2GS2A 3ZO2A 2QU5A 4KUJA 1B39A 1XKKA 5JGBA 4GUBA 3MGYA 4R5SA 2CKOA 3OHTA 3OW3A 1A48A 4ZZMA 3ZUVA 1XBAA 4FTRA 3ZDIA 2XKCA 3F61A 2HYYA 4M68A 3DBCA 3KF4A 4XRLA 4L00A 4GG5A 2GHGA 1O9UA 5M09A 3F3UA 4TYEA 4G3FA 1W0XC 3FHRA 4L8MA 5AUXA 4MBIA 3ENHA 3I1AA 4MF0A 3ZBFA 1O6KA 1UWJA 1YOMA 4XYFA 1ZZLA 4YP8A 5HO6A 3K5UA 2W06A 2BTRA 4CMTA 3IW6A 4ASEA 4TW9A 3PRIA 3RNYA 4N57A 3HMIA 5JK3A 3NUXA 3R7UA 4G3CA 4NYEA 2PMLX 3Q4TA 1OMWA 3RINA 4AGWA 3KEXA 3QX4A 3VQHA 4CLIA 4D9TA 5BUIA 3SA0A 3GCSA 3QQJA 4I23A 3FDNA 3KU2A 4BKZA 4BB4A 3VULA 3B2WA 2YCQA 5G1XA 2HZNA 3SX9A 2IZRA 3LFAA 5AJQA 2B4SB 2XKDA 3ZO4A 4MWHA 3HUBA 4PMTA 2WMTA 2EB3A 5FEEA 4BDAA 5M07A 5ANIA 3GC7A 4EQUA 3TT0A 3FWQA 2YZLA 2GQGA 2QOCA 1PYEA 5AAFA 4KKHA 3R1NA 3FLSA 4KNBA 4BCIA 4X2NA 5K0KA 5I4NA 3S4QA 4O0YA 5JGAA 5AP1A 3R71A 4DGLC 2KTYA 2W1IA 3GEQA 3TIZA 1ZYLA 3PIXA 4I93A 1OUYA 3FKNA 4RWLA 5F95A 2WQBA 2JDRA 3QX2A 3W33A 4ANOA 4YJOA 4FE2A 1UKIA 5HOAA 1XBCA 3O8UA 3BU3A 3ZTXA 5JQ5A 4I21A 4R7IA 1VEBA 1Y91A 4FV9A 3ZO1A 2YACA 3PA3A 1KE6A 3PUFC 3CQUA 3O71A 1OL2A 3TXOA 1FOTA 3ETAA 5M56A 4EH4A 4FK3A 1FPUA 2C1AA 3FLQA 4TKSA 4E5BA 4ZS0A 4ZJIA 3PRFA 5JMSA 4RWIA 4OTQA 4XH6A 3HV3A 3VHEA 4YJRA 4NT4A 2H96A 2IG7A 2CCIA 1JAMA 1XWSA 2J0KA 3FKOA 3SW4A 2XF0A 2OIDA 3CKWA 4QP2A 4QYGA 2DQ7X 4FV7A 4RWJA 2WTJA 3TZMA 4CFMA 4DGMA 1H26A 4BDGA 4IX6A 3QF9A 4D2TA 3TUBA 2OICA 2VWZA 3O23A 1XR1A 2HY81 2CNVA 4ZMFA 4CCBA 1OL5A 3UO6A 3SGCA 4CRSA 1QPDA 4D5HA 4R5YA 2WB8A 5HE2A 1CMKE 5DIAA 3F66A 4IADA 4FSZA 3WBLA 2P3GX 3C4WA 4EONA 1AD5A 3QWJA 1H8FA 2QR7A 4HCVA 2CMWA 4OTDA 4BN1A 2IWIA 3FSKA 3A7FA 2VNWA 3UG1A 1OGUA 3ZLYA 3CQWA 2UW6A 1M17A 5KBQA 1OIYA 1R0PA 3EJ1A 2PYWA 4FKPA 2OJ9A 3VS1A 4YHTA 4F0GA 5LQFA 4QMOA 4EH5A 3VNTA 4WNKA 3DAJA 4PX6A 4FC0A 4RX9A 2JDTA 3OEZA 3UIXA 4BBMA 3AC1A 4XV1A 3FMEA 4D1SA 2UW5A 4I5HA 3MW1A 2ITTA 3BHUA 4IHPA 3CD3A 4IIRA 5DRDA 3UOLA 3VS4A 4AOTA 4BDBA 2PPQA 3DK3A 1OKYA 1YWRA 5CZHA 3V51A 4YO4A 1PXJA 5E8ZA 4FKOA 3QUEA 4N6YA 1BYGA 4I4EA 5CYIA 4H1MA 2WIHA 5FEQA 1PMUA 2X0QA 4GVAA 2UW3A 3FMNA 3KXHA 4D0WA 2ITVA 4R1VA 2XIKA 4CFXA 2QR8A 4MAOA 3I60A 3OOMA 2YIXA 5LXMA 2PMNX 4ZY5A 3ZDUA 5HLNA 4PQNA 3RGFA 3HUCA 5JRQA 4J8NA 2FVDA 2XB7A 4XMOA 1NY3A 4YBKA 1U4DA 4FT9A 2OI4X 4YC3A 4CZYB 2C4GA 2R3IA 4KKGA 3QL8A 1FVTA 4BZNA 2PTKA 2C5NA 2Z7RA 4WOVA 5IDPA 5ACKA 4IC7A 4IACA 5D10A 5FGKA 3V04A 5EDPA 3E8DA 4D28A 5K4JA 4LMUA 3JR1A 4PNKA 2JKMA 3ACKA 2A1AB 4CFUA 4MH7A 2OJGA 2WEVA 4QP1A 4F6UA 4HVGA 5CAUA 4EK5A 4YLLA 2IZSA 4DFNA 2PZYA 1MP8A 3HV4A 2J0JA 2Y4PA 3LW0A 3O7LD 2YDIA 3ACJA 4B0GA 3KC3A 4ASZA 4I6BA 2W1CA 4V05A 2G9XA 1VZOA 1ZYJA 2QHNA 4LV7A 4DLJA 1PKGA 3CEKA 2G01A 4FZFB 3SOCA 3ET7A 4RVTA 1OL1A 2C1BA 3BRBA 3A4OX 3HYHA 4E6QA 1ZOHA 3ODYX 4G6NA 4JBOA 4MKCA 4NM3A 1HCLA 1PF8A 3Q4CA 5BVFA 4OTRA 4HYUA 4QEBA 3EL8A 3LMGA 4HCUA 3NFFB 3B8RA 2LAVA 2W0JA 2YABA 4EK8A 4CD0A 4O7VA 2VTHA 5AR8A 1SM2A 4U97A 5AP6A 4CQEA 3V8WA 1UV5A 3EL7A 3QYZA 5CI6A 5T68A 3UODA 3GP0A 3IOKA 3C9WA 2C6MA 2WMAA 4EC9A 3TZ9A 3TUCA 1V0BA 3CY3A 4BYIA 4G3DA 3FL5A 2WMQA 3NNXA 4PDOA 4TXCA 5DHJA 3QTRA 3GFWA 4HGEA 5K3YA 4RX5A 4OUCA 1Q62A 3QBNA 4P5QA 4U9AA 5CF6A 4LGHA 3ROCA 3DLSA 4EC8A 3KA0A 3NUAA 4WT6A 2IJMA 5FTOA 1QPCA 2XKFA 4OR5A 5ANOA 4GCJA 5CI7A 5HIBA 5LVPA 4AXAA 5JKGA 4QT1A 5CLPA 3LXKA 5K5NA 3DKCA 4YJQA 2JDVA 2G2FA 4M0ZA 5JGDA 3EQIA 4RA4A 5E8VA 1G8AA 2CNUA 5L3AA 3E62A 3H4JA 3EH9A 3QZFA 4UWCA 5D1JA 4R78A 3N4VA 1FMKA 1NVRA 5HCXA 1PW2A 3RAIA 4PRJA 3FXZA 1ST4A 2R2PA 4LL0A 1F3MC 3NNUA 5CVHA 5EHOA 5IG1A 2ZMDA 3RK5A 3TV7A 1PJKA 3COKA 4D4VA 4ZLOA 4JT3A 2OKRA 5IEXA 1A9UA 4FF8A 1PXMA 2R0IA 4IC8A 1XMLA 2QOFA 5J9YA 4YLJA 1IRKA 3L8PA 4ACDA 4C2WA 1OIUA 3FZSA 2XBJA 2UW7A 4FG7A 3FYJX 4Z7GA 3OWPA 3MI9A 1TQPA 1KE9A 3UQCA 3H9FA 4MQ2A 1P2AA 1H01A 3UVPA 4XG7A 3QU0A 4L7SA 5EKOA 4MWIA 4JMQA 4R1YA 2Z60A 4JRVA 1E1VA 3A7IA 2A19B 3ULZA 5JSMA 3FLWA 1E9HA 3V5JA 1MQ4A 4DINA 1YI3A 3VUGA 2R3OA 2YWVA 4BCGA 5M57A 3QRJA 3EN9A 4MVFA 3ZRMA 3MH3A 3W2RA 1GJOA 3W10A 3R1SA 3R30A 4O0SA 3AKKA 3TL8A 5IUHA 2GPHA 4BGHA 4G1WA 1DI9A 1PHKA 2F2UA 3P0MA 5DPVA 3LFQA 2GTMA 3BX5A 2X1NA 4RQVA 4EOJA 3R7YA 4BRXA 4IVBA 4UXLA 4P5ZA 4PTCA 4D4RA 2P55A 5JFWA 3PXRA 5CS6A 2OZAA 3ZC5A 3L9MA 5M4UA 2WMUA 2XK6A 2JBPA 4F63A 2RF9A 2JD5A 3COIA 5AUUA 2XAOA 3E3BX 2XH5A 4M66A 2VRXA 2F9GA 4XS2A 2O5KA 5JZNA 5CSHA 5TKDA 3DJ7A 3PVWA 4WBBB 5J95A 4EKKA 3FI8A 3BPRA 3KB7A 3Q2JA 4IZAA 4IWPA 4O0VA 3RALA 3G9LX 2ITYA 3U51A 2Z02A 1T46A 3QCQA 2EVAA 1WCCA 1LR4A 3D94A 2FUMA 2GNLA 4G2FA 4DEGA 4E3CA 1JSVA 2P2HA 3TN8A 4ZZOA 3NIEA 2A4LA 5EQEA 3KXXA 1TVOA 2B53A 4DAWA 3I4BA 2O2UA 3N4TA 3UQFA 4C3FA 3QGYA 4FSNA 4EK3A 5BVOA 3R1YA 2QO9A 5HG8A 5CAOA 5E8TA 3PY3A 4X3FB 4BZDA 4IAKA 2E9OA 3R8MA 4M14A 2ZB1A 3SHEA 4D2VA 4GYIA 2WMVA 3DAKA 2XA4A 4XG6A 3GOKA 4QTEA 1IA9A 4IAIA 3UOHA 2ETKA 4CKJA 4AAYA 2J4ZA 5IA4A 4UZDA 3ZM9A 5T6KA 4RLLA 3DA6A 2XNPA 3AC5A 5DOSA 3RPVA 3IW5A 4IX5A 5EYCA 2PMOX 3D4QA 5A9UA 1MRYA 2IVVA 4ZTRA 4MYGA 2YZAA 3ROYA 4TYHB 3LCOA 3QQFA 5IA1A 4AXDA 4PL3A 1ZAOA