4L52A

Crystal structure of 1-(4-{4-[7-amino-2-(1,2,3-benzothiadiazol-7-yl)furo[2,3-c]pyridin-4-yl]-1h-pyrazol-1-yl}piperidin-1-yl)ethan-1-one bound to tak1-tab1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
307
structure length
295
Chain Sequence
GSLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 7, TGF-beta-a
publication title Discovery and optimization of 7-aminofuro[2,3-c]pyridine inhibitors of TAK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 295
sequence length 307
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4l52A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4l52A01
3AT2A 4EH5A 3AC2A 3ZTXA 3L8VA 3ZO3A 1OPKA 1OMWA 2WTKB 3H9FA 5ANDA 2VD5A 3VF9A 2JAMA 4PMSA 4BZOA 2XNGA 4CV8A 5KKRC 4O86A 4PPBA 3MI9A 5A4QA 4FK3A 2X7GA 4PTGA 4FTJA 4QMVA 3WZUA 1R3CA 1ZLTA 3MJ2A 4BBEA 5BVOA 2P55A 4Y73A 1PKGA 2G2FA 3DB8A 5BVKA 3EQBA 3D5VA 4FT9A 2W1GA 4Z55A 2W99B 4GL9A 3B2TA 4MAOA 3U4WA 1FMOE 5HHWA 4FX3A 2WMAA 1XH5A 4RPVA 3DK3A 3QC4A 4GRBA 5H2UA 3FWQA 2YWPA 4O96A 1JAMA 3RK9A 4AA4A 4CCBA 2JBPA 3HMOA 1JLUE 3DT1A 2FVDA 3PVWA 4D58A 2JKMA 4YC3A 3CPBA 3PPJA 4EJNA 3MIAA 2YM3A 5JFWA 5L2SA 3A7JA 3AGMA 4EBVA 3GT8A 5JRQA 5I5ZA 3R7OA 2HYYA 5AX9A 2OJIA 3N9XA 4EKLA 4NL0A 4LGHA 4NH1A 4QYGA 5AP5A 3R9NA 3GCSA 3CLYA 4HGSA 4EWHA 5BYZA 1Z5MA 4MYGA 4U42A 5L8LA 2UZOA 4AQCA 3RK5A 3LCTA 1JSUA 3C4EA 4OAVB 4M69A 3TCPA 3QZFA 4YHFA 5FUTA 5HNGA 4ERWA 4D1SA 2CCHA 2PPQA 3OEZA 3ZDIA 3EFKA 3RVGA 5M44A 5GJDA 2O8YA 3MJ1A 4ZSGA 3R6XA 4FKLA 2J6MA 5CT0A 3VVHA 1ZXEA 4U9AA 4WNOA 5ICPA 2E9NA 3H4JA 4TYHB 3IG7A 4ANOA 1GIHA 4FEUA 2P0CA 4KD1A 3Q6UA 4F4PA 4E26A 4L3LA 5KO1A 4BKZA 5DI1A 2ZB1A 5CT7A 5L2WA 5AUTA 2WTDA 4IX3A 3GQLA 3DV3A 3ZEPA 4QTBA 2VX1A 2ZMCA 5CQUA 3MVHA 3RI1A 5EYCA 3LFNA 4YJSA 5HIEA 4ALWA 2R0UA 3PRIA 4E6QA 1FGIA 3HECA 2W1IA 4FEQA 5E8VA 3VRZA 3VWAA 3ZLYA 3M2WA 3CGFA 4O0RA 2F57A 4GFOA 3TKUA 3HV7A 4X0MA 3RINA 3ODYX 3QLGA 1VZOA 2I7QA 4OTDA 4DCEA 3UIBA 2ZV7A 3UBDA 3F5XA 3KGAA 5T6KA 3NS9A 1SZMA 3DK6A 2QONA 4BZNA 4R5YA 5DT3A 3DNDA 4E1ZA 5HI2A 3AMYA 4XG7A 5LMAA 4G31A 4UN0C 1UNHA 3ZRKA 4ZY4A 4V04A 3IKAA 1Q41A 2XNBA 2OIDA 3R7YA 4BDIA 4CZYB 4YO4A 5KMOA 4M3QA 3D4QA 4ACGA 2QOLA 5KZ0A 2X9EA 2AUHA 3VS6A 4MQ2A 3O7LB 4I6BA 4MTAA 1WBOA 3LJ0A 2O64A 4BWPA 5CEOA 4JLCA 2C6EA 3IPHA 4EH2A 4O1OA 1GZOA 2BDFA 2XJ1A 3PA4A 2VTRA 2WTVA 1PJKA 1W82A 3G33A 5HBJA 3R1QA 4Y85A 4L67A 3LZBA 2PVJA 4NZWB 3MTFA 4RA4A 4L9IA 1ZYJA 1ZOEA 3SG9A 1XH6A 2I6LA 4NM0A 4P2KA 3LM0A 1G5SA 2BHEA 5IQCA 3CQUA 4UWYA 2XZSA 3FL5A 1YOMA 5EHLA 5FG8A 2FSLX 3MA6A 2OKRA 3QQGA 1HOWA 3BU5A 4P7EA 4IZ5A 4QO9A 5L8JA 2PZPA 2RFDA 4BCHA 4DT8A 5C4KA 4FSRA 3R83A 3VULA 2J0KA 2HY0A 5EM5A 5LVPA 3U87A 3KRXA 3F2AA 3F7WA 3AC5A 3KVWA 4XCUA 3TTIA 4EH9A 2B52A 5IQAA 4Y83A 2J0IA 4CYJA 4ZAUA 2I0VA 5C26A 2YDJA 3P4KA 3ZRLA 5K5NA 3UNKA 3DS6A 3BLRA 2HXLA 2YIYA 2KTYA 4HYIA 3T9IA 4LL5A 3O23A 4AOTA 2JDRA 3GC9A 3ZLSA 1G8AA 1E9HA 3LOKA 4YJVA 4YURA 2QCSA 4Y5HA 1KWPA 4A9RA 5HTIA 2EB2A 1H1WA 2EXMA 4PUZA 4IJPA 3DKCA 1IA8A 4ANBA 3SD0A 4M13A 3N4TA 2O63A 3PSDA 1XBCA 2OZOA 3F3ZA 4O0XA 4AW5A 3NCGA 3OUKA 2GNHA 4RX7A 5AA9A 4CXAA 4PDSA 2FSOX 1Q3DA 1W8CA 5F94A 3HUCA 4ZTHA 4NYEA 4ZS4A 3DBQA 3HX4A 1SVEA 1XH7A 3FMHA 4LOOA 3F66A 3HMNA 5J7HA 1SMHA 3FMDA 1WBVA 4Y5QA 3DKFA 2ONLC 5EKNA 3G9LX 3SVVA 4QYYA 3QHRA 4FKSA 4NIFA 4Q5EA 4R8QA 4ALUA 3AQVA 3HKOA 5HO7A 4IJ9A 4MF0A 4IIRA 1KE9A 4G5JA 4NEUA 4BI0A 4LGGA 4FSMA 4GVJA 3FMJA 4OTWA 4BN1A 4FIFA 2Y4PA 5IQGA 4X21A 4FTTA 5HTCA 4QOXA 3D5WA 2QO9A 2EB3A 3ZEWA 2PMNX 2R3QA 4XOYA 4ZS0A 3QA8A 4TWOA 5B0XA 3W18A 5F9EA 4F64A 2VTMA 1H08A 4QMPA 1ZMWA 2Y8OA 3Q60A 5TE0A 3W2PA 4N70A 4RLLA 3EQIA 3R28A 1H07A 4LMUA 2VTNA 3V5LA 2IVSA 4MQ1A 4F6UA 3VS0A 4NJ3A 4DH7A 4OT5A 1R78A 2HENA 1WVYA 4G34A 4RWLA 4ORKA 3F3VA 3NRMA 1IAHA 3EZVA 1IRKA 2C6KA 4RGJA 3VBVA 2UZLA 1JKSA 4FKIA 3CP9A 4LGDA 4U81A 5JGDA 3ATTA 3MIYA 5EFQA 4A07A 5KHXA 1XH8A 2W9FB 3H30A 3R7EA 2UVXA 1FQ1B 2HY81 4XRJA 4WA9A 1YXUA 3Q4ZA 3PSBA 5BMMA 3ORIA 3U6JA 4F7JA 3NIZA 3E8DA 5I9WA 3SAYA 2R4BA 5DEWA 4TYJA 2W1HA 2JDTA 2WMWA 3M11A 4FVRA 3MSSA 3LKMA 5IQDA 4KSPA 4G3GA 3TNWA 2XNMA 2JDSA 3IW4A 4FV1A 4RBLA 4XJ0A 1GIIA 3C4ZA 1E1VA 4EUUA 5FP5A 4ZOGA 2OF2A 3FY2A 4W4VA 4JIAA 3BEAA 4L52A 2JKQA 3TEIA 3DPKA 3RTPA 3WF6A 5FXRA 4APCA 1PXLA 2JIUA 3UOLA 2CGVA 3MH0A 3OEFX 3LFSA 3C5IA 5EM8A 3PJ2A 3BX5A 4MD9E 4ONAA 1F0QA 3FV8A 2XCKA 1S9IA 4EUTA 3R9RA 3HRCA 5KKRB 3BHTA 4WBOA 4KIKB 4RX5A 1IA9A 2E2BA 4DGMA 5HLPA 3WZKA 2X2LA 1U54B 2HCKA 1WVXA 2QI8A 1MRUA 4MXYA 5TF9A 4EQCA 4ERKA 5IU2A 1JBPE 1J1CA 2E9VA 1O6LA 4EHEA 4TWCA 2GS7A 2NRYA 2WEVA 3EN4A 3IO7A 3LXPA 3RGFA 3ZBFA 1T46A 3ZXTA 4ACMA 4CT1A 4DH8A 3SLSA 3VS1A 5EM7A 4EK6A 1K9AA 1R1WA 2FH9A 3FMNA 3E93A 4FUYA 5G1XA 3CE3A 3D94A 1Q3WA 3CR0A 4F0GA 5M07A 2HZ0A 3PJ3A 4IZ7A 5AAFA 2ITZA 2R0IA 3LXKA 3Q2MA 4O22A 1XBAA 2X9FA 3QZIA 2KULA 3POOA 5E4HA 4F63A 3BE2A 3NUNA 4U45A 3W8QA 4B9DA 5LJJA 1UKIA 4N0SA 2UZNA 2BTRA 3O2MA 2G1TA 4YJTA 2VNYA 4C61A 3FXXA 3FLWA 3R9HA 1Y8GA 3LM5A 5B2MA 2GHMA 3V5TA 5DIAA 3ZZEA 4AE9A 3VF8A 2PUUA 2OH4A 3DZOA 3FL4A 3NDMA 2C0IA 1NT2A 3OWLA 3V8TA 4YBJA 3D5UA 1H25A 3A62A 3EOCA 4JBOA 3O50A 3UGCA 3VBXA 4ALVA 3KN6A 2VO0A 5AR2A 2OJJA 5KMLA 5HZNA 4FG7A 5DLSA 2UZVA 4ITIA 4JQEA 3V51A 5KBQA 3GC7A 4W8EA 1WCCA 3EQGA 3MY5A 2H9VA 2W1EA 3I5ZA 4NFNA 4FV3A 2O65A 3RJCA 2GNJA 4EK4A 3ANQA 2PYWA 4MX9A 2IW8A 5IA3A 2B55A 3I6WA 4V01A 3O8UA 3UQCA 2PZYA 4R7BA 3DXPA 4AXAA 5BNJA 1NVQA 3NW6A 4C02A 3COKA 3DBEA 4AOJA 3QU0A 3DFCB 2VTTA 4M67A 4YLLA 2XRWA 5FBNC 1X8BA 5A9UA 4RIYB 3G0FA 1WBWA 3GXLA 4IE9A 2QKRA 2YCRA 5LQFA 4IWPA 3KK9A 5DT4A 3BELA 4WG4A 3QUEA 4BIDA 4QP2A 4C4IA 3FMKA 3G51A 4NCTC 3QTXA 4K8AA 5DE2A 1J7UA 2IN6A 3R7IA 1NVRA 2WIPA 1DM2A 3MH1A 5AP4A 2QODA 5FWKK 4I41A 4DEAA 4RVMA 4YJRA 3PY1A 5E90A 3TXOA 3QKKA 5J9YA 2ZAZA 4I1ZA 1YHWA 2XK9A 4IAYA 4V05A 4JR3A 4I5CA 5AJQA 3NUSA 4O83A 4A4OA 3AD5A 5JZNA 3OCGA 3PXRA 4J53A 5CI6A 3VBQA 2OXXA 3E64A 4I92A 4L00A 5AIKA 4XG2A 4EI4A 3IGGA 4FTAA 1PKDA 5C8KA 3L9PA 2XA4A 2VGOA 5HQ0A 3E92A 5BVNA 4MVFA 2ZMDA 3QTIA 1FPUA 2C68A 2XKDA 3D2KA 3AXWA 4BDJA 2C3KA 2ZM3A 1RE8A 3OCSA 4LRJA 5CWZA 2OZAA 2C5YA 3LFBA 3R8VA 4FR4A 4O7TA 1ZMVA 4UXQA 3UDBA 2VWVA 5EQEA 3ZXZA 5ETIA 3WBLA 3UO6A 1Q8ZA 3FMMA 4K33A 3ZS5A 5I9VA 4OTIA 3DLSA 4LOQA 4NKSA 3WIKA 2IJMA 3NNXA 3VQUA 4XUFA 2GQRA 2IW9A 5DHJA 2I0YA 4EOJA 4DAWA 3P7CA 3V01A 5DWRA 3E5AA 1P2AA 1SYKA 4ENXA 4XS2A 2EVAA 5HCYA 4N6ZA 3E3PA 4DFZE 1Y57A 4HNIA 3E8CA 1G8SA 2QQ7A 5BUEA 4FKVA 3N4UA 1W83A 4A7CA 2RL5A 4JJRA 4KBCA 2V22A 2YLEA 3FQHA 5AP3A 5H8GA 4A4LA 4FIIA 2H8HA 4AZVA 3DFAA 3AD4A 4G9RA 4O0VA 4R1YA 4QMNA 2WMBA 3NNWA 4TL0A 2JD5A 4U79A 4X3FA 5IEYA 3BLHA 4YLJA 3TT0A 5AV1A 4Q2AA 3R7UA 4BGHA 5J5TA 1OECA 1XH9A 4CCUA 4Z3VA 2HZ4A 3PP0A 2PMIA 5HEZA 5CAQA 4FYNA 4FT0A 3ZONA 4J99A 2P33A 3WE4A 2BAQA 3T8OA 2BZJA 2X2KA 3F88A 4AWIA 4E5AX 2XEYA 4XG4A 5HO8A 3LJ1A 3UQGA 1OL7A 3F5UA 4QMLA 2VN9A 1YDRE 5M08A 1VEBA 4BDDA 2VTOA 5T3QA 1WBPA 2WGJA 4LRMA 4M66A 4QP7A 5BYYA 2YM5A 4YPDA 3UC3A 4IZYA 2UW6A 2Y4IC 3OS3A 4GKHA 3KL8A 5A4TA 1JVPP 3HEGA 1GZ8A 3RHKA 3MDYA 5AX3A 1MQBA 5EOBA 3UIUA 4FBXA 1PXPA 1ZYCA 3UO4A 5HU9A 4FKGA 5HOAA 3GGFA 2XIYA 3ELJA 4U0IA 4HGLA 3DBFA 2JBOA 4AFEA 2Q0NA 5KZIA 3LE6A 1PMVA 5IQEA 4E93A 1P4FA 2VO7A 2QOQA 3W32A 3PVBA 1IASA 1ZARA 1O6KA 3MW1A 4H3PA 2PVRA 5K4JA 2ZB0A 2VTLA 4J7BA 3NUPA 4C7TA 2B7AA 2DQ7X 4FSWA 4X2JA 2V55A 4YO6A 4V0GB 5EW9A 1Q97A 2OW3A 3GUBA 4LI5A 4EOQA 1PXJA 2GNGA 3R7VA 2R3RA 4F08A 3LMGA 4YUQA 2B53A 3QTRA 3KREA 2ESMA 4C33A 5LVMA 1AD5A 2BRBA 3LFFA 3O7LD 4R1VA 3UZPA 4QT1A 4BCPA 3Q5IA 5D9HA 4EWQA 2ZDUA 2JGZA 4NT4A 4QMWA 4QQJA 5DFPA 5CVFA 2PVKA 2X81A 2WMRA 2VGPA 1KE5A 3C0HA 5D11A 1ZYLA 1WBTA 3MN3A 4ZSEA 1OIQA 3L9NA 5AR3A 4CZUA 2OIQA 3D7TB 4OW8A 3UOJA 2BKZA 3JVRA 3CKXA 3OFMA 3SRVB 3TZ8A 2ZYBA 2RKUA 1W98A 2J90A 3R8PA 3HMMA 3KULA 2IZUA 3ALOA 3QL8A 4TKSA 3A99A 1YI6A 2C5XA 4NJDA 5CLPA 3ULZA 4BF2A 4C4GA 4K6ZA 1Q5KA 2XK3A 3K3IA 3ZSHA 2G15A 4IQ6A 3UP7A 2WZJA 4EYMA 3QCYA 4XBUA 2XIZA 4EOLA 3C4WA 2NO3A 3R1SA 4LV8A 4PX6A 3VUTA 4DLJA 5K0XA 1ZAOA 2J5FA 3MGYA 1YHVA 4WUNA 4C4FA 3FLZA 5I4NA 3KMUA 4IAIA 5HCXA 1U46A 2CGXA 5CU0A 1SNUA 1OITA 2WMSA 4UMRA 3FMLA 1WBNA 2VTQA 4C57A 3I7CA 4CVAA 2WTWA 5AIRA 4IHPA 4IWQA 2J5EA 3FQSA 2J0JA 4R3PA 2OXDA 4M97A 5BVWA 4DN5A 4CFVA 4UWCA 4F09A 2OICA 4ACCA 3ZFXA 3BEGA 4C2WA 2CNQA 2Z2WA 4PPCA 5IEVA 4E6DA 3FSFA 3HMPA 3OHTA 4I6QA 3GC8A 3GOPA 5E8XA 4R5SA 4JRNA 4O7RA 3CQEA 4G3CA 5H9BA 2REIA 3KXMA 3Q32A 4I5HA 3BYMA 3R2BA 4IZAA 3HLLA 2QR8A 4IB3A 4M15A 4MNEA 4U3YA 2FUMA 3MFSA 3VHKA 1OKZA 3KF7A 1Q61A 3DAKA 4LQMA 3CBLA 3IONA 2AC5A 2X8DA 3Q4CA 4FTOA 3FKNA 3UVPA 2CDZA 3BE9A 4IC8A 3FAAA 4FKQA 5DN3A 4AX8A 5A6NA 1J3HA 4D5HA 4G9CA 4FC0A 5M4FA 3EQHA 4X2FA 3F69A 4IX4A 2A4LA 2PMLX 3QCSA 4J8MA 4TXCA 5D41A 3FI2A 3ZU7A 3MVLA 4Y95A 3ZC6A 2QHNA 4QQ5A 2A27A 2AYPA 3NNUA 4R78A 4IC7A 4UMTA 4O6EA 3B8QA 4O81A 4EH8A 2QKWB 3UOHA 3VS5A 1QCFA 5ETCA 3SX9A 3L1SA 3ZSGA 1Q4LA 5D7VA 4D9UA 3JR1A 3NUYA 2QG5A 5EK7A 1U4DA 1RQQA 4J52A 4CFMA 4C3FA 5LVOA 4P5QA 3VQHA 3E87A 4USFA 4XLVA 2XM9A 2E9PA 3KXXA 2YDIA 4NTTA 4F9BA 4WT6A 2ETRA 2R9SA 4E5WA 4ZTMA 5AUXA 2R7BA 3KY2A 3QD3A 4FKUA 3F61A 1Q8WA 2PSQA 3QCXA 5KNJA 4KIOA 4X2GA 2FO0A 4GS6A 3G6HA 4O0YA 1BYGA 5LVLA 2C6OA 2C6MA 4F99A 2BDJA 2YM7A 3E63A 3HUBA 5I9UA 5GINE 4BY9E 4PTEA 3P0MA 4ANSA 3LLAA 3BWFA 2VU3A 3I5NA 3A7IA 5F4NA 5EYKA 3KMWA 4FNXA 4XYFA 5AUUA 2BUJA 2I1MA 2FA2A 5EHYA 5HNBA 1J7LA 5IA2A 3SC1A 3I60A 1XHAA 4APPA 2W1CA 3NSZA 4M84A 4MXZA 4BHNA 3GU6A 1H00A 4W4YA 4FV0A 4EC9A 1KOAA 2QOIA 1CSNA 4MXOA 4YP8A 4D4RA 4WG3A 2C0TA 1M52A 2EU9A 3NZ0A 4QMTA 3A2CA 2XP2A 4MEDA 5IH5A 2NRUA 2XKFA 5AV0A 2XH5A 2HWPA 5DRDA 5HG5A 3DU8A 3P7BA 4HW7A 5EDPA 4DFLA 4X2NA 1OB3A 5IUHA 4BBMA 3F2NA 4KINA 5DH3A 2C5NA 5HU3A 2C3JA 2OSCA 3BQCA 3PE2A 4DT9A 4M0YA 4BDKA 3NW7A 3DXQA 3I7BA 3CD8A 4FIEA 2UVZA 3BI6A 2PWLA 3LLTA 3TL8A 1YI4A 5F95A 4NTSA 4QP6A 5M56A 3OC1A 4NW5A 1QMZA 5DOSA 4A9YA 4XBRA 5ITAA 4F6WA 3GCPA 3IW5A 2V0DA 1V0OA 2DYLA 2WQMA 5HD7A 1MP8A 2IZTA 1DS5A 2GMXA 2UUEA 3A60A 3PSCA 4M12A 4E7WA 4M7IA 2IZRA 4X3JA 3MH3A 5BVDA 2BRHA 5LCKA 4LL0A 2W96B 5M4CA 4O1PA 4AF3A 3HRBA 3NLBA 3QUDA 3BGQA 3PA3A 4FOCA 3U6HA 2B0QA 4DGNA 3W55A 5ANIA 3BHUA 4FKRA 1R0EA 3ZO2A 2W06A 3A4PA 3PPZA 4C37A 1DAYA 5FD2A 3NVKI 2R3HA 2VTSA 4RFYA 5EM6A 5HG8A 3I1AA 3FXWA 5ANEA 3VUKA 2CKEA 1CMKE 3ZC5A 4ASZA 2RG5A 5BYLA 5LARA 2FSTX 4TPTA 4F65A 5M4UA 2W5AA 3PVGA 1SVGA 2IVVA 3IW6A 3KMMA 1FINA 1UWHA 4USDA 3A7GA 4B8MA 3HA6A 2ITPA 3KRWA 1PXOA 4AFJA 2BVAA 2UW7A 3ERKA 1R39A 4MH7A 4BDAA 5EI6A 4CEGA 3VRYA 4ZEGA 3OWJA 4RIWB 3TIZA 4AT5A 4CKJA 4YSMA 3L8XA 4YJQA 4OUCA 5GJGA 4D2WA 4G3FA 3TACA 2WMQA 1VYWA 4DF3A 3JS2A 1H1SA 5CZIA 2R64A 4OTFA 5LOHA 1I44A 3MYGA 3V8WA 3QGWA 5AM6A 3MB7A 5E1EA 4BRXA 4AGCA 4TNDA 4BKJA 3GU5A 2JLDA 4EJ7A 4ZY6A 3UMWA 3ENMA 2GSFA 3ETAA 3KB7A 4WO5A 2BDWA 4RJ5A 4EZ5A 1UVRA 2OU7A 3EZRA 4FTQA 4P4CA 4G5PA 3KC3A 1JNKA 4S31A 3HP5A 1Y6BA 2G9XA 3V5WA 3AMBA 2IO6A 2QLUA 4HCUA 4O6LA 3UVRA 3IDCA 3FC1X 5IA4A 3JVSA 5M57A 3WILA 4XG6A 5IH6A 4FI1A 3GQIA 5F1ZA 1OGUA 3VO3A 3LMHA 4XMOA 4AZEA 3KRJA 5AAEA 2W7XA 5L3AA 4FEWA 4WHZA 3Q5ZA 4CZTA 4FA2A 5JT2A 2YHVA 2PE1A 5AUYA 2ZM4A 1LP4A 1PXIA 4FKOA 1TQPA 5AP0A 2X6DA 4AE6A 4HVSA 4AA0A 3H9RA 4JS8A 4NK9A 1YKRA 2C1BA 4AS0A 2VX0A 1BLXA 4YC6A 4EH7A 4ITHA 4IB0A 4A9TA 4AZSA 5FXSA 2O0UA 4C3RA 5CNNA 4G1WA 2GHLA 4O0SA 4FZFB 4HVGA 3RNIA 3RALA 2QHMA 4E4NA 4DEHA 4JXFA 5IUIA 3OTVA 4R6VA 1YXTA 3NGAA 2WO6A 3C9WA 3HVCA 2VRXA 4F0FA 3DBDA 3V5QA 2WFYA 4I4EA 3LXNA 1K2PA 5CI7A 3I0QA 2JC6A 4CV9A 5KMMA 4LM5A 4J71A 1OIYA 3UP2A 3CKWA 4S30A 3AT4A 3TNPC 3EL8A 4O7SA 2X6EA 3QX2A 3S95A 3ZBXA 3QXPA 1NVSA 3EN5A 2WMXA 5B2KA 4QNYA 5DRBA 3L9MA 2PVNA 1QL6A 1XBBA 4E8AA 2JFLA 5CALA 5FXQA 3PIZA 3P23A 1I09A 4CLIA 3BGPA 4WNPA 3ZM9A 2HELA 1GZKA 4AGWA 4EONA 4USEA 3I0OA 3O8PA 3B8RA 3BU3A 3TJCA 1OPLA 4GIIA 4RWJA 3BPRA 4JQ7A 3PLSA 4GVAA 3BZ3A 3DA6A 4X2KA 3PWYA 4FT7A 4E4LA 4F7SA 2VAGA 2GCDA 4GUEA 4X6RA 3RHXA 4FSYA 2VO6A 4EK5A 4QP3A 1FVTA 4XG3A 4IVBA 2ITXA 1H26A 3SKCA 5FBOA 1OL5A 4RSSA 4B8LA 1URWA 4BCGA 1HCLA 4RWKA 5GIOE 1H1QA 1P14A 3ZRMA 1U59A 5LWNA 4FSTA 3T3UA 2PULA 3Q4UA 5CU2A 3HAVA 4ANNA 4L7SA 3OROA 3ODZX 3BBTB 2ZV2A 2J7TA 3IDPA 3QC9A 4IW0A 3ZCLA 4ACDA 2PVYA 3GOKA 4BCFA 2F2UA 2ZJWA 4RZWA 5KCVA 2BCJA 3S0OA 1GAGA 2QVSE 3KRRA 5HESA 4RFMA 4H1MA 3L9LA 3MV5A 1PYEA 4MXCA 3GU8A 3WYYA 1CKIA 5HBEA 4I4FA 1PY5A 1RDQE 4ARKA 2G2IA 4AZTA 4ZLOA 4DFBA 2LGCA 3COMA 5BUIA 4HOKA 5T68A 4X3FC 4BIEA 4E4MA 2XNOA 5TR6A 3DLZA 4EK8A 5TT7A 4WG5A 3OTUA 3ZM4A 4YPSA 3PXZA 4TW9A 3O96A 4KIKA 2CPKE 2X2MA 4BB4A 2QU6A 2IVTA 3SQQA 3QAME 1V0BA 1JSTA 4PF4A 4AT3A 3RBWA 3TZMA 2PZRA 4GYIA 3QD4A 2IVUA 3ZUVA 5JFVA 4GKIA 2R3LA 1LUFA 4DH5A 1BUHA 2HK5A 5EHOA 5KE0A 3U8WA 4AT4A 4E6AA 2QD9A 2BRMA 2VTIA 3RM6A 1YW2A 4A9SA 4JBQA 4FTRA 4Y46A 2W4JA 4F7LA 2UV2A 4F9AA 5GZ9A 2VX3A 3TG1A 4L46A 2GFCA 3VUMA 3NCZA 3C4XA 3II5A 4ZXTA 5A14A 4MWIA 2W5BA 4D55A 5AP2A 1YWNA 3GI3A 3NAYA 4F70A 4ZLZA 5GHVA 3GC0A 4AACA 5CF8A 5FEEA 5CSXA 5A4LA 4DTAA 3TIYA 5E8UA 2YZAA 4WRSA 3V04A 5IA0A 4HPTE 4FSZA 4GSBA 2CKOA 2C3IB 2P4IA 3CJFA 1JKTA 1L3RE 2FSMX 3W2CA 5CEPA 5FDPA 2WEIA 5G6VA 3Q9XA 2R3PA 4RJ8A 3RAWA 4J97A 5E91A 2H96A 3MFUA 4RC2A 2X0GA 2VTJA 5JGBA 3I79A 2WTCA 4GU6A 4J1RA 3RM7A 4QD6A 4RWIA 2ZM1A 3WZEA 4D9TA 3LQ3A 2UZEA 1QPDA 4KABA 3ORZA 5EQPA 5FTOA 4TWPA 3RAIA 5AFVA 2VWXA 3P86A 5HORA 5EOLA 3LVPA 4QMZA 5CSWA 3D9VA 3FHIA 3VUIA 4DINA 2F49A 4YMJA 3CCNA 1A06A 2VWIA 3DBCA 4JDJA 2J2IB 3DTWA 3SXRA 5IPJA 3P78A 4IACA 3RMFA 3GFWA 3TKHA 2YZLA 3ID6C 2YM4A 5DBXA 3ZLWA 3OCBA 1U5QA 2AC3A 4YC8A 3AG9A 3BYSA 3R21A 5EI8A 1AQ1A 3RKBA 3FY0A 3BYOA 2VO3A 4S32A 3AOXA 4FV2A 5C8MA 4CTCA 3JXWA 3MY0A 1H01A 3LHJA 5IDPA 2R7IA 1Q8YA 2R3OA 3KFAA 3PG3A 4YU2A 4FE2A 4O7LA 2XK4A 2JIVA 2UW5A 4FV5A 5TOZA 4YJNA 2PVMA 5CTPA 2PU8A 2PVHA 2PUPA 3HGKA 3IW8A 2Q83A 4FIHA 2OGVA 3O17A 5DGZA 3HV4A 2OH0E 3TNQB 4EOOA 2ZV9A 5LMKA 3HV3A 2Z02A 3TZ9A 3EFJA 3OBGA 3CTJA 2XBJA 3OXZA 4AW1A 5JKGA 3RCDA 5EYDA 4KB8A 2YIWA 4UEUA 4WKQA 4XEYA 4BTFA 2JEDA 3BGZA 4BHZA 5CNOA 1F3MC 4JAJA 3DQXA 4FZ7A 4W9XA 4FL2A 5H8BA 3TWJA 4F6SA 3U6IA 2XUUA 2W5HA 1PW2A 3K2LA 5FM2A 3RPOA 2W0JA 3CS9A 4GMYA 4L45A 4B6LA 4C62A 4ZJVA 4DBXA 5CSHA 4KIPA 5J7BA 5I3RA 3Q2JA 5EH0A 2XKEA 3DJ6A 3IOPA 4JT3A 4I5MA 4PPAA 4RIXA 4KUJA 2CHLA 3UYSA 4R3RA 4GFGA 5AEPA 5DYJA 2Z7QA 4IDTA 2GNLA 5CASA 5CF5A 2HZNA 1PMUA 3G0EA 1Q99A 3OWPA 4KS8A 4J96A 3QGYA 4HZRA 2WKMA 3DDPA 3GCUA 2X7FA 4W4XA 5E8ZA 1V0PA 3QRKA 4IVAA 4PNKA 5IQIA 3FZ1A 4IBMA 5AV3A 2Z60A 4QMQA 1IEPA 4AN3A 3R8UA 2OFUA 1OBDA 4B99A 4DGOA 3NYNA 3LFQA 4DC2A 2WELA 4U97A 3S2PA 3Q52A 3JY0A 2BALA 1M17A 3FI3A 4OBQA 2ITTA 4OTQA 3C5UA 4JAIA 4DGGA 4XV3A 3AC4A 3QTQA 5HCZA 5J95A 1LPUA 3UJGA 3R0TA 4AW2A 3V3VA 4CNHA 3HAMA 2JFMA 4NM3A 3ZO1A 5KUPA 4EHGA 4TYIA 4QPAA 2WNTA 1F5QA 4F1TA 4UALA 2ZVAA 5D7AA 2VTHA 4Z7HA 5BX0A 5GIPE 3QF9A 4UWBA 1Y8YA 3GCQA 4CYIA 5A6OA 5EG3A 1YRPA 2ITWA 5CEKA 3FI4A 4QYEA 3RNYA 4BI2A 5JN2A 4BCNA 3R04A 3ET7A 2CNVA 2WTKC 3BQRA 2YAAA 3ZSIA 3NYOA 2CKQA 5EYMA 5DT0A 3NAXA 4IDVA 3EKKA 4KNBA 2QLQA 4YZCA 3K5UA 4I0SA 3DGKA 5FDXA 2YABA 3KKVA 4FT3A 2V7OA 4JX3A 3DQWA 3SG8A 2C4GA 4HPUE 4OTGA 4ZIMA 3U55A 4F9CA 1GNGA 5ANGA 4U7ZA 4CRSA 4CTBA 4YHTA 4UY9A 1WFCA 5E1SA 5A4EA 5BQ0A 3IOKA 3MA3A 3DNEA 4UMQA 5CVGA 5TO8A 3PXQA 3MY1A 4QP9A 5CEQA 1YWRA 5DVRA 2WD1A 4I0TA 5B2LA 3RWPA 4D4YA 5AUWA 3FPQA 3G6GA 2BFXA 4CG9A 1M7NA 3RPVA 2XNPA 3CGOA 2RSVA 3SOCA 4CKRA 4BL1A 5JZJA 3VIDA 1B39A 1UA2A 2ITUA 1IAJA 3EYHA 4FEXA 1OIUA 4I22A 3IK3A 3TV4A 3FLQA 4RQKA 5CAVA 4G6OA 4LFIA 2RFEA 5DR9A 3UIXA 2JDOA 3F6XA 4IB1A 3LCSA 3OF0A 3MH2A 2C1AA 3QKLA 5ANOA 2GS2A 1GZNA 1OL6A 4NU1A 1WBSA 5GNKA 2SRCA 2CCIA 3CTHA 3TKIA 2XK8A 1PXKA 2OJ9A 5C1QB 1VJYA 4GCJA 4S33A 3D7TA 3NMUF 4H1JA 3FZTA 5HIDA 4IVDA 5EDQA 3SRVA 4E5BA 4BTJA 3F82A 5JSMA 2YCFA 3KVXA 5AWMA 4C4EA 5A4CA 3FZSA 5E9EA 3ANRA 3VNTA 4OTRA 1OKWA 3MPAA 4BTKA 4UMPA 2G2HA 2HIWA 3MPTA 4RT7A 4YNEA 4RLKA 3RPRA 5KMJA 3PZHA 2OI4X 3ORNA 1REJA 4ZJJA 3Q9WA 2DUVA 2XK6A 3PIYA 5C01A 3L8PA 4KA3A 3JPVA 1H27A 4FODA 3KA0A 4DEEA 5HX8A 4ZTRA 4OBOA 2X4ZA 2GQGA 2WPAA 4NKAA 3OW4A 3KN5A 1ZOHA 3IECA 3PXFA 4Q9ZA 5BVFA 4DFUA 4C38A 3F3UA 4L68A 4ZSLA 3W2SA 1ZWSA 3FHRA 2HXQA 4AN2A 2W17A 4O38A 3OP5A 3QHWA 3G90X 4OR5A 2BZKB 2QNJA 4AZFA 1DI9A 1ZZLA 5CSPA 1XH4A 2JKKA 3MTLA 5KMKA 2QOKA 3PFQA 4EBWA 3P08A 2VTAA 3QCQA 3JUHA 3VJOA 3H10A 4FNYA 3A8XA 3TJDA 2IW6A 3LMIA 3KCKA 3CC6A 1BL6A 3ZLXA 5ACKA 3ACKA 2WXVA 5M06A 1ZRZA 4L3PA 4GT5A 1Y6AA 3HV5A 4RJ6A 4U43A 3R8ZA 3S4QA 3PG1A 3R02A 3LXLA 3AC1A 5IQBA 4IWDA 4J8NA 1YQJA 2BRNA 2GQSA 4UX9A 4FVPA 3AT3A 5J9LA 1GIJA 2R3MA 3QYWA 2R3IA 2XIKA 2CJMA 4I20A 4UYNA 3LAUA 2VV9A 2Y6OA 3C4CA 2OIBA 2A19B 1JOWB 4D0WA 4CG8A 4R77A 3FZOA 4G6NA 3KF4A 2E9UA 4UB7A 4CMTA 3BHHA 2BFYA 3KCFA 4HYUA 3QRTA 2J0MB 1BI7A 3G5DA 4KAOA 3RP9A 3QQFA 1PHKA 2V5QA 4XOZA 2QOCA 4D2VA 3LQ8A 4QTAA 1EH4A 2ETKA 3UVQA 2X39A 4MK0A 5D1JA 4QTDA 3ZFYA 3DDQA 3PXYA 2J4ZA 5C9CA 1QPCA 4O82A 5HIBA 1PMEA 2E9OA 2UW0A 4R7IA 5AV2A 4IEBA 2B9FA 1Z9XA 3KULB 1IR3A 5E8TA 4DE4A 5IA5A 4PQNA 3FYKX 2BKKA 2YCQA 2C6DA 4BWKA 1PYXA 1M2PA 1SNXA 4RJ3A 3UZTA 3PTGA 2X8IA 3BYVA 4DLIA 5IZFA 3R1YA 4I93A 3GNIB 4MXAA 4QNAA 2IZSA 1JSVA 5EI2A 3OY3A 5AR7A 2BZHB 4HGEA 2WAJA 4JL9A 4HZSA 3RK7A 5HE0A 3VS3A 3LFAA 4UMUA 5L4QA 4PL3A 4BDHA 3WZJA 2JKOA 3QTZA 4DG3E 4CGAA 3U9NA 3GFEA 3F7ZA 2R3FA 5DNRA 2QG7A 3TDWA 5BMSA 4RVTA 3UE4A 3VUDA 3WI6A 4C36A 2R3NA 5C27A 4RX9A 1W7HA 4O91A 4YJUA 2PE0A 4S34A 1JPAA 2WOUA 3C0IA 4DA5A 4KWPA 2VUWA 4FVQA 2CLXA 4XH6A 2HWOA 3W1FA 4C0TA 4G3DA 2CSNA 4KKGA 3HYHA 1W84A 4PDYA 4EL9A 5AR5A 4RRVA 4GH2A 1BL7A 2YM8A 4DG2E 2VWUA 4BR3A 4E3CA 4Z16A 2CGWA 3JYAA 4LG4A 4QRCA 1ZY5A 4GK2A 3M1SA 4U41A 4E4XA 4DTBA 3QWJA 4C59A 2YIRA 3HV6A 1OL1A 2YISA 5AMNA 4RJ7A 5BUJA 4YHJA 1K3AA 2EXEA 3QUPA 3QX4A 3VUGA 4CFWA 3NVMB 3A7FA 2XMYA 4FF8A 3KU2A 4NM5A 3FKOA 4FV7A 4I23A 4F9YA 4K18A 4O2PA 3QQLA 5CANA 4FEVA 2F7ZE 4ACHA 3P7AA 4YNOA 4PMTA 3OCTA 3QKMA 2QOFA 5IQHA 4MBIA 3POZA 4EHVA 2VZ6A 1PXNA 3A7HA 3HMIA 1YI3A 2PTKA 1Q62A 2PHKA 4ZTSA 3TN8A 3TDVA 3HP2A 5HG9A 3D14A 4MKCA 3WF7A 2QOBA 3H9OA 3CY2A 4L3JA 1H4LA 4K77A 4F9WA 3EWHA 2WB8A 3NR9A 4FK6A 4ZJIA 3RAHA 3GU7A 4DEDA 3FYJX 4PP9A 3H0ZA 1KV1A 1H1PA 4RFZA 1WVWA 5CEIA 4E6CA 4OT6A 4MXXA 5JH6A 4FKWA 2WTJA 4E20A 1CDKA 3Q4TA 1NXKA 5CEMA 1YOLA 3EFWA 3ORXA 2BR1A 4LOPA 5IQFA 2VWZA 5KBRA 2WMVA 1NW1A 3PY3A 4O7NA 2Y9QA 2ZV8A 5HD4A 3QRUA 3C13A 3F2RA 5E8YA 4LUEA 4IMYA 3LFDA 4LRKA 4ANLA 4EYJA 4EHZA 3THBA 2A0CX 4DH1A 3NEWA 3VW8A 2WOTA 4HJOA 3MPMA 3EB0A 4IH8A 4K1BA 3PJ8A 3TUBA 3LCDA 3IQ7A 3ZO4A 3FEGA 5L2QA 4R7HA 4TYHA 5FRIA 4X6QC 4RIWA 5HVYA 4D5KA 4MNFA 1VYZA 2C69A 4BTMA 3HA8A 3ZH8A 3QTSA 4FNWA 2X8EA 3OT8A 2YITA 4FV6A 4FZDB 1M2QA 3OOMA 4HNFA 4W9WA 5D12A 3UTOA 1J1BA 4GV1A 2B9JA 3MB6A 3ZHPC 3C50A 3F5GA 3DKOA 4CSVA 3ZDUA 2C5OA 2CKPA 2XCHA 2EWAA 1NY3A 1H28A 3QQUA 4WNKA 4DEGA 4IFCA 2X1NA 4FTCA 5EKOA 5IUGA 3PPKA 2HW7A 4DHFA 3W10A 3F5PA 4O7YA 2YCSA 5K9IA 1T45A 3LCKA 4UYAA 2F2CB 5DMZA 3NUAA 5EQYA 3V8SA 4YZNA 3RAKA 1FOTA 1URCA 5CXHA 4NFMA 4QYHA 3C4FA 3QQHA 5J1VA 1ATPE 2RIOA 3ZUTA 1UNLA 4RMZA 3SV0A 3COIA 1UU9A 2BZIB 2W1ZA 1UU3A 4JQ8A 2BTSA 4O27B 4MD7E 4TYEA 2WU7A 4XHKB 2PVLA 2Y4IB 4TRLA 2OG8A 5BVEA 5IG1A 1OIRA 4DH3A 4LUDA 1KOBA 2PK9A 4YLKA 3PRFA 3REPA 3QRIA 2QU5A 3FE3A 2YWVA 3ORLA 4YTIA 3E88A 3TV6A 1LR4A 2PZ5A 2ACXA 3EYGA 3P5KA 3U54A 3ORPA 3JY9A 4U80A 1GOLA 3EJ1A 4IM3A 4B4LA 4ZZNA 5GZAA 5L2IA 4I3ZA 4NUSA 4BCQA 1SM2A 3ACJA 3OXIA 3E62A 2WQNA 2ITQA 4KRCA 4PNIA 1HCKA 2XIRA 4WNMA 2W4OA 2Y7JA 3W2QA 4I0RA 3QFVA 3V6RA 4GG5A 5JQ5A 4BC6A 4CMUA 4II5A 1O6YA 3DJ7A 3VC4A 4QMXA 3QD2B 1BI8A 2DS1A 2R2PA 3KK8A 3F9NA 3S3IA 3D83A 2XVDA 4I24A 1KE8A 4M69B 4RIOA 4IAFA 5DEYA 5JGAA 1KUTA 2QOOA 5M51A 5I3OA 4FNZA 2O3PA 4NW6A 4PRJA 4EOIA 1FVRA 3E7VA 2YACA 4FYOA 3EQPA 2BAJA 3PVUA 2YLFA 3UIMA 2UW4A 4BDEA 3PUPA 4U44A 4GYGA 4RA5A 4IWOA 5M4IA 2A1AB 3COHA 3KXZA 3OG7A 2HW6A 4FKJA 4JX7A 4CQEA 3FKLA 5KX8A 3W2OA 4DGLC 3CQWA 4IAKA 1SVHA 3FUPA 4K11A 4AUAA 2FGIA 3UQFA 1OUYA 4RZVA 4FTKA 4BI1A 4DFNA 5DG5A 3UPXA 1H0VA 2BAKA 5ETFA 1ZMUA 3V5JA 5LMKC 2BHHA 4WSYA 3V5PA 3M42A 3AC3A 2CGUA 2RGPA 3IGOA 3MVMA 4C4HA 2F9GA 5J5SA 5JK3A 5E8WA 4ZP5A 4QTEA 4L6QA 3QTUA 3NYXA 2O2UA 5CF6A 1Z57A 4FL3A 4ZK5A 4ZMFA 3QLFA 2QURA 3RZFA 4FV9A 3QZHA 1OPJA 2WMTA 4GK4A 5J9ZA 3UZRA 4DEBA 1FBNA 2J51A 4J95A 1ND4A 2XKCA 3K3JA 5FLFA 1STCE 3V6SA 3LPBA 1W0XC 2PL0A 3OD6X 2UZTA 3DY7A 4FV4A 3FLNC 3R00A 5K4IA 2BIKB 2EUFB 3BBWA 3ZFMA 4IX6A 1G3NA 4PMMA 3WF8A 2JAVA 4WIHA 3EMGA 1XO2B 5JEBA 4BYIA 3ORKA 5LCJA 2XNEA 4RG0A 2R5TA 3D0EA 3O51A 4G17A 3TUDA 4O84A 1JKKA 4H58A 2OLCA 1DI8A 4RC4A 4D28A 1WMKA 5IISA 3OWKA 2UW9A 3GB2A 2XEZA 3EKNA 3WYXA 2XYUA 4IANA 3R9OA 4ANQA 4JDHA 4EOPA 5CXZA 4GW8A 2QO7A 4EZ3A 4ZSAA 4QP4A 3FZPA 4L01A 4XP3A 3VBYA 2R3JA 4RJ4A 4BDGA 2HAKA 5HVJA 3NIEA 4ASEA 3IS5A 3R2YA 4BIBA 4CRLA 5CF4A 4HVDA 4U5JA 4D4SA 4MBJA 1ZOGA 2C30A 3WF9A 5HGIA 1OM1A 1XWSA 4PL5A 4NM7A 4XG9A 4EQMA 3CIKA 5HE1A 4XRLA 3ZUUA 2ETMA 5I9ZA 5AP1A 3WIGA 1YXVA 3P1AA 4JG6A 5L6OA 3C1XA 1P5EA 4Z7GA 1ZY4A 4H36A 3N51A 3QD0A 3R9DA 4ZTQA 3D5XA 3DJ5A 2Q0BA 4W8DA 3OUNB 4ASDA 5HLWA 4IXPA 1DAWA 4MCVA 4C35A 3ZOSA 4H3BA 4L53A 1IG1A 2XIXA 3NWWA 4YTHA 4N6YA 3HRFA 3CSVA 4C34A 4OTHA 4D2PA 3I4BA 1UKHA 3NYVA 5CU6A 3GBZA 1OVEA 3AMAA 1Q24A 4GG7A 5DR6A 3OMVA 5HICA 3TNHA 5JMSA 1PF8A 2ITYA 3QBNA 3IW7A 1UWJA 3UYTA 3S00A 1M2RA 2V62A 4AW0A 1KE6A 4U6RA 4L8MA 5HE2A 3PP1A 2WIHA 4MBLA 4UBAA 2Z7RA 2EXCX 2P3GX 4QMSA 5L2TA 5M09A 2Z7LA 4FG8A 3FMEA 1U54A 3ZYAA 1OUKA 5M53A 2YEXA 3DAJA 2UVYA 3EHAA 4L42A 4MHAA 4NIFB 3S1HA 2BPMA 2V7AA 3DOGA 4UXLA 5CX9A 4FIJA 3NNVA 3Q9YA 3NPCA 1ZZ2A 5E7RA 4QQTA 4B0GA 5CQWA 3FBVA 5BPYA 5K5XA 2CNUA 2VWBA 4C3PA 5J1WA 4KIQA 2FB8A 3EN9A 3BHVA 2PUIA 1CM8A 5IDNA 2OJFE 4TYGA 4CMOA 2RG6A 3EN6A 3PWDA 4G2FA 5CVHA 4FV8A 4YSJA 3FSKA 3VJNA 4BFMA 4M14A 5B7VA 4LMNA 4RX8A 5HLNA 4PDOA 4ZMEA 5IKWA 2RFNA 1BMKA 1WZYA 3BKBA 4XP2A 4OBPA 1Q8TA 4K2RA 3A61A 4IAAA 5HVKA 5AM7A 4E73A 2GU8A 4U8ZA 3F3TA 3FLYA 4FTUA 1Q8UA 3VBTA 3KEXA 1JQHA 4Q9SA 4QMYA 3TUCA 1GJOA 3GU4A 5FP6A 4PMPA 3GEQA 1QPJA 2G01A 2WQEA 4H39A 2ERZE 3Q6WA 4BCMA 4YZDA 2RFSA 2B9HA 5DPVA 3WZDA 1BX6A 1XQZA 1YXSA 2YN8A 3KXGA 4YZBA 5IMXA 4GU9A 1BKXA 5FEDA 5AUZA 4I94A 4LYNA 4S2ZA 4X7QA 3VHEA 2OK1A 4QP1A 2RF9A 3RCJA 5KMNA 4FKPA 4XLIA 4W4WA 4TY1A 4OLIA 4DYMA 3HNGA 5JRSA 4M68A 3U51A 4R3CA 3Q04A 1YWVA 2OFVA 4O7WA 3OBJA 4AN9A 4ZY5A 4BDFA 3ROCA 2YIXA 3FPMA 2PY3A 4XNEA 1LEWA 5J8IA 4P90A 4O7VA 3R7GA 4EC8A 2GS6A 3ROYA 3UG1A 4EKKA 3BV3A 5AA8A 3OW3A 5AV4A 2OWBA 3D2IA 4RIYA 4HVIA 4C4JA 2Z7SA 4EOSA 3SA0A 4I6HA 4O2ZA 4QTCA 2BILB 3CJGA 3WOWA 3UO5A 5L6PA 2VWWA 4AA5A 4FSQA 4YR8A 2QO2A 1B6CB 4FZAB 4BCKA 5ETAA 2WQBA 4BKYA 4ZZOA 3G2FA 5CYIA 1H0WA 4JBVA 4IX5A 4YGAA 5FTGA 2VNWA 2VWYA 4JBPA 2Y0AA 3R8LA 2XJ2A 4FGBA 4Z9LA 5EDRA 2NPQA 4J98A 2C0OA 4GUBA 4IM2A 4CFUA 2ZDTA 3EH9A 3P9JA 2B9IA 2NP8A 3TTJA 3ENHA 4EK3A 1PXMA 3PZEA 4PTCA 2XRUA 3BLQA 2ZOQA 3UOKA 1GY3A 1TQIA 1JKLA 3Q53A 4FMQA 3LQ5A 3SGCA 2NNWB 2I0EA 3SOAA 3ZZWA 2YAKA 4ITJA 2PE2A 5A3XA 4G16A 2OO8X 4HYHA 2BROA 1KSWA 5LWMA 5GJFA 3DTCA 2LAVA 4EH6A 4P5ZA 5C4LA 4FT5A 4B7TA 4CFXA 2PUNA 2B1PA 2CMWA 4DG0E 2GHGA 3W2RA 5IMEA 1Y91A 3MWUA 3QALE 2YERA 4EQUA 1CKPA 4TZRA 3IDBA 4F1OA 4JNWA 4EH4A 2JDVA 3H3CA 5F20A 3PJCA 3TI1A 2GNFA 3O0GA 3QYZA 4AG8A 3R22A 5IA1A 5AR8A 3ALNA 4RVKA 4QMUA 4JIKA 2OF4A 3L8SA 1ZYSA 4KKHA 4EOMA 3D7ZA 1TKIA 4GEOA 1P4OA 2W1FA 4PP7A 4OTPA 4WOVA 4TT7A 1UV5A 1APME 2WMUA 2WU6A 4Y8DA 3DB6A 1MQ4A 5HG7A 3G15A 1A9UA 2GPHA 4BGGA 5HE3A 5CAPA 3PY0A 4G6LA 2W05A 4F0IA 4D2TA 2QC6A 3OZ6A 4CFNA 3FLSA 1NA7A 4JG8A 3R71A 2C5VA 1OBGA 3BV2A 1LEZA 4Y72A 4WD5A 5JFSA 4KSQA 1UU8A 4C2VA 2F7EE 4ZZMA 3TNIA 2XK7A 4JDKA 1QPEA 3O8TA 4GT3A 4O0WA 4EEVA 1TQMA 3MS9A 4GT4A 2WTIA 4EORA 4FGRA 5FTQA 1YVJA 2OBJA 3OT3A 4AZWA 1U5RA 4XV9A 5CU4A 2PVFA 3C7QA 3HZTA 5H3QA 4CT2A 2ONLA 3PE1A 3Q3BA 3QTWA 3GVUA 1FVVA 2BMCA 2XYNA 1YDTE 3W16A 2IPXA 4RIXB 5I9YA 1PRYA 4RC3A 4CLJA 4ENYA 3CD3A 4KS7A 2XNNA 5LVNA 4FOBA 2J0LA 3A4OX 3PXKA 4PY1A 3BHYA 4PL4A 1PMNA 5CY3A 2ITOA 2YIQA 3GP0A 4JDIA 3W33A 4IM0A 4FL1A 3DCVA 3TZ7A 1XJDA 5HO6A 3N4VA 3MFRA 4UZHA 1S9JA 4O7ZA 3E3BX 2X4FA 4ID7A 4XV2A 3LIJA 3OXTA 3U9CA 3PLAE 4HCTA 1CKJA 4BDBA 3BIZA 4FG9A 4A4XA 2H34A 4BICA 3ATSA 3BCEA 3RZBA 3R01A 2J50A 2XB7A 2CN8A 3WF5A 4UV0A 3TV7A 4V0GA 2GTMA 4YZ9A 5C8NA 2OJGA 2OZAB 4GK3A 2J9MA 2XM8A 2W9ZB 5AR4A 3GENA 1H1RA 1YXXA 3EQDA 1B38A 5K0KA 4HGTA 3SHEA 4ANMA 5CAOA 1V1KA 4OAUC 5J87A 4FUXA 3DK7A 4FSUA 1AGWA 3G9NA 3R63A 5FGKA 5HBHA 3FC2A 5CAUA 5EW3A 4K0YA 3R8MA 5CSVA 3PIXA 4FZ6A 4H3QA 5IH4A 4EZ7A 3PDTA 5AAGA 3VW6A 2QR7A 3NX8A 4C8BA 3FQEA 3R30A 3EQRA 1WAKA 2GNIA 3R73A 2YM6A 3LFEA 4GFMA 5LXMA 3NUUA 4MD8E 1RJBA 4D1XA 3RPSA 4CQGA 1MRVA 4O0UA 4QPSA 4TTHB 5D10A 1OI9A 3W8LA 3LJ2A 2C6TA 3EN7A 3QXOA 3ORMA 4DCAA 3EQCA 4ZTLA 3B2WA 5CENA 3DAEA 4M8TA 4X3FB 1YDSE 2R3GA 4DFYA 5KMIA 1XR1A 1TVOA 5I0BA 4BCJA 2WHBA 4GJ2A 4H05A 4IB5A 4QYFA 3DZQA 3VAPA 3MFTA 2VTPA 4DTKA 3PJ1A 5ANKA 1KE7A 2YA9A 4FTIA 3EFLA 3DXNA 3UC4A 4I5PA 2F4JA 4YZMA 5HX6A 4DFXE 3SW7A 4QMMA 5JFXA 3VS7A 3LCOA 2O5KA 1ERKA 3CPCA 3UG2A 2IWIA 3PA5A 3ZMMA 1CTPE 2QOHA 5CZHA 2ERKA 4JOAA 4BWXA 3QA0A 2PMOX 5CU3A 4F1MA 2CLQA 4XV1A 3TM0A 4YJOA 2XS0A 3I6UA 2C3LA 4FKTA 3CTQA 4JVGA 4ZTNA 2XJ0A 4WUAA 3UMXA 4WRGA 3E7OA 3FI8A 5A54A 3CEKA 3K5VA 4L43A 4XG8A 3E8EA 4G3EA 5E8SA 5IF1A 4F7NA 5ANJA 4EOKA 1L8TA 4U40A 3P79A 1MUOA 1RW8A 2I40A 3I81A 4RQVA 2XBAA 2OXYA 4BCIA 4A06A 3BU6A 3EIDA 3KXHA 4YJPA 3BWJA 2BIYA 3GCVA 3RWQA 3VBWA 3VS4A 4AU8A 5IEXA 5TKDA 5JQ8A 5GZ8A 5AP7A 4GJ3A 2HZIA 2W1DA 5KHWA 4AP7A 4MWHA 3NW5A 5M55A 4FTNA 4KBKA 3VN9A 1J7IA 2YFXA 4QQCA 4BGQA 4D1ZA 4PV0A 3MESA 3H0YA 2I0HA 1YHSA 3Q96A 4BCOA 4YTFA 4L7FA 1OL2A 2CN5A 4FIGA 5CS6A 4RVLA 4D0XA 1O9UA 5AUVA 4XX9A 3AGLA 3A8WA 1ZYDA 1JWHA 3BYUA 2JITA 2UZDA 4AGDA 3O71A 4ZLYA 4N57A 3NUXA 2YDKA 2C6IA 4HCVA 1KV2A 3QZGA 4I6FA 4JRVA 4LV5A 5C03A 4BVUA 3OVVA 2GFSA 2UZWE 5E92A 2GDOA 4D2SA 1UU7A 3F3WA 4K9YA 3VUHA 4AGUA 4KRDA 3UPZA 4U3ZA 2YJRA 3FJQE 5FM3A 4AOIA 3SXSA 5K3YA 4AAAA 4D2RA 5A46A 1OKYA 2C47A 4NCTA 5DA3A 3EQFA 3SDJA 3UNZA 2Y6MA 4C58A 1VR2A 5I9XA 3CXWA 4XP0A 2XF0A 3WARA 4FTMA 4JR7A 4N4SA 4DBNA 4WSQA 2H6DA 3QQKA 4HYSA 4FTLA 4I21A 3VS2A 2JIIA 3OY1A 2ITVA 4D4VA 4FSNA 4ZSJA 1OZ1A 3EL7A 2C6LA 3FDNA 2UZBA 3ITZA 4IAZA 1R0PA 3LW0A 1FGKA 2UW8A 3D15A 3KXNA 2Z8CA 3LFCA 4NSTA 2UW3A 2B54A 3QQJA 4PDPA 5EW8A 1OKVA 2X7OA 2IG7A 2P2IA 3T9TA 4WBBB 5FQDC 1MRYA 1M7QA 2B4SB 4MNEB 5DR2A 4HVHA 3KQ7A 3R1NA 1E1XA 3MVJA 2YJSA 4OGRA 2BRGA 4NWMA 1H24A 4PWNA 2F7XE 2FYSA 2WQOA 3ORTA 3C51A 5LMBA 3CY3A 2HOGA 4CKIA 4TWNA 3SXFA 4EH3A 2UZUE 4KKEA 3SW4A 3UODA 4DEIA 4QMOA 1REKA 3DKGA 4BBFA 4IVCA 3E8NA 5AP6A 5HKMA 4TN6A 5FEQA 4IADA 1J91A 3K54A 5ACBC 3BRBA 3OOGA 4CFFA 2ITNA 2A2AA 2GTNA 5HNIX 2W4KA 3AC8A 1YOJA 3HDNA 3HL7A 4ASXA 1XKKA 2P2HA 3RPYA 1H8FA 4QP8A 4JG7A 3HDMA 5HTBA 3PYYA 3FXZA 3FZRA 3UNJA 4JI9A 4TNBA 3ULIA 4BZDA 3T3VA 4YTCA 3U4UA 5H8EA 4BYJA 5L6WL 4UZDA 3KRLA 2DWBA 3C0GA 5J79A 3QWKA 5L8KA 4L44A 5AADA 3MBLA 4MF1A 4QPMA 2R3KA 4DITA 1A48A 3Q9ZA 4YBKA 4O0TA 3QRJA 2PZIA 4CD0A 3AD6A 4FICA 4GIHA 4IFGA 4A9UA 1M14A 4M0ZA 4Q5HA 1FMKA 4KBAA 1UNGA 3WE8A 4O21A 4BDCA
chains in the Genus database with same CATH superfamily
3AT2A 4EH5A 3AC2A 3ZTXA 3L8VA 3ZO3A 1OPKA 1OMWA 2WTKB 3H9FA 5ANDA 2VD5A 3VF9A 2JAMA 4PMSA 4BZOA 2XNGA 4CV8A 5KKRC 4O86A 4PPBA 3MI9A 5A4QA 4FK3A 2X7GA 4PTGA 4FTJA 4QMVA 3WZUA 1R3CA 1ZLTA 3MJ2A 4BBEA 2IF8A 5BVOA 2P55A 4Y73A 1PKGA 2G2FA 3DB8A 5BVKA 3EQBA 3D5VA 4FT9A 2W1GA 4Z55A 2W99B 4GL9A 3B2TA 4MAOA 3U4WA 1FMOE 5HHWA 4FX3A 2WMAA 1XH5A 4RPVA 3DK3A 3QC4A 4GRBA 5H2UA 3FWQA 2YWPA 4O96A 1JAMA 3RK9A 4AA4A 4CCBA 2JBPA 3HMOA 1JLUE 3DT1A 2FVDA 3PVWA 4D58A 2JKMA 4YC3A 3CPBA 3PPJA 4EJNA 3MIAA 2YM3A 5JFWA 5L2SA 3A7JA 3AGMA 4EBVA 3GT8A 5JRQA 5I5ZA 3R7OA 2HYYA 5AX9A 2OJIA 3N9XA 4EKLA 4NL0A 4LGHA 4NH1A 4QYGA 5AP5A 3R9NA 3GCSA 3CLYA 4HGSA 4AAYA 4EWHA 5BYZA 1Z5MA 4MYGA 4U42A 5L8LA 2UZOA 4AQCA 3RK5A 3LCTA 1JSUA 3C4EA 3BL9A 4OAVB 4M69A 3TCPA 3QZFA 4YHFA 5FUTA 5HNGA 4ERWA 4D1SA 2CCHA 2PPQA 3OEZA 3ZDIA 3EFKA 3RVGA 5M44A 5GJDA 2O8YA 3MJ1A 4ZSGA 1VLRA 3R6XA 4FKLA 2J6MA 5CT0A 3VVHA 1ZXEA 4U9AA 4WNOA 5ICPA 2E9NA 3H4JA 4TYHB 3IG7A 4ANOA 1GIHA 4FEUA 2P0CA 4KD1A 3Q6UA 4F4PA 4E26A 4L3LA 5KO1A 4BKZA 5DI1A 2ZB1A 5CT7A 5L2WA 5AUTA 2WTDA 4IX3A 3GQLA 3DV3A 3ZEPA 4QTBA 2VX1A 2ZMCA 5CQUA 3MVHA 3RI1A 5EYCA 3LFNA 4YJSA 5HIEA 4ALWA 2R0UA 3PRIA 4E6QA 1FGIA 3HECA 2W1IA 4FEQA 5E8VA 3VRZA 3VWAA 3ZLYA 3M2WA 3CGFA 4O0RA 2F57A 4GFOA 3TKUA 3HV7A 4X0MA 3RINA 3ODYX 3QLGA 1VZOA 2I7QA 4OTDA 4DCEA 3UIBA 2ZV7A 1G8KA 3UBDA 3F5XA 3KGAA 5T6KA 3NS9A 1SZMA 3DK6A 2QONA 4BZNA 4R5YA 5DT3A 3DNDA 4E1ZA 5HI2A 3AMYA 4XG7A 5LMAA 4G31A 4UN0C 1UNHA 3ZRKA 4ZY4A 4V04A 3IKAA 1Q41A 2XNBA 2OIDA 3R7YA 4BDIA 4CZYB 4YO4A 5KMOA 4M3QA 3D4QA 4ACGA 2QOLA 5KZ0A 2X9EA 2AUHA 3VS6A 4MQ2A 3O7LB 4I6BA 4MTAA 1WBOA 3LJ0A 2O64A 4BWPA 5CEOA 4JLCA 2C6EA 3IPHA 4EH2A 4O1OA 1GZOA 2BDFA 2XJ1A 3PA4A 2VTRA 2WTVA 1PJKA 1W82A 3G33A 5HBJA 3R1QA 4Y85A 4L67A 3LZBA 2PVJA 4NZWB 3MTFA 4RA4A 4L9IA 1ZYJA 1ZOEA 3SG9A 1XH6A 2I6LA 4NM0A 4P2KA 3LM0A 1G5SA 2BHEA 5IQCA 3CQUA 4UWYA 2XZSA 3FL5A 1YOMA 5EHLA 5FG8A 2FSLX 3MA6A 2OKRA 3QQGA 1HOWA 3BU5A 4P7EA 4IZ5A 4QO9A 5L8JA 2PZPA 2RFDA 4BCHA 4DT8A 5C4KA 4FSRA 3R83A 3VULA 2J0KA 2HY0A 5EM5A 5LVPA 3U87A 3KRXA 3F2AA 3F7WA 3AC5A 3KVWA 4XCUA 3TTIA 4EH9A 2B52A 5IQAA 4Y83A 2J0IA 4CYJA 4ZAUA 2I0VA 5C26A 2YDJA 3P4KA 3ZRLA 5K5NA 3UNKA 3DS6A 3BLRA 2HXLA 4O4DA 2YIYA 2KTYA 4HYIA 3T9IA 4LL5A 3O23A 4AOTA 2JDRA 3GC9A 3ZLSA 1G8AA 1E9HA 3LOKA 4YJVA 4YURA 2QCSA 4Y5HA 1KWPA 4A9RA 5HTIA 2EB2A 1H1WA 2EXMA 4PUZA 4IJPA 3DKCA 1IA8A 4ANBA 3SD0A 4M13A 1W2DA 3N4TA 2O63A 3PSDA 1XBCA 2OZOA 3F3ZA 4O0XA 4AW5A 3NCGA 3OUKA 2GNHA 4RX7A 5AA9A 4CXAA 4PDSA 2FSOX 1Q3DA 1W8CA 5F94A 3HUCA 4ZTHA 4NYEA 4ZS4A 3DBQA 3HX4A 1SVEA 1XH7A 3FMHA 4LOOA 3F66A 3HMNA 5J7HA 1SMHA 3PFYA 3FMDA 1WBVA 4Y5QA 3DKFA 2ONLC 5EKNA 3G9LX 3SVVA 4QYYA 3QHRA 4FKSA 4NIFA 4Q5EA 4R8QA 4ALUA 3AQVA 3HKOA 5HO7A 4IJ9A 4MF0A 4IIRA 1KE9A 4G5JA 4NEUA 4BI0A 4LGGA 4FSMA 4GVJA 3FMJA 4OTWA 4BN1A 4FIFA 2Y4PA 5IQGA 4X21A 4FTTA 5HTCA 4QOXA 3D5WA 2QO9A 2EB3A 3ZEWA 2PMNX 2R3QA 4O4CA 4XOYA 4ZS0A 3QA8A 4TWOA 5B0XA 3W18A 5F9EA 4F64A 2VTMA 1H08A 4QMPA 1ZMWA 2Y8OA 3Q60A 5TE0A 3W2PA 4N70A 4RLLA 3EQIA 3R28A 1H07A 4LMUA 2VTNA 3V5LA 2IVSA 4MQ1A 4F6UA 3VS0A 4NJ3A 4DH7A 4OT5A 1R78A 2HENA 1WVYA 4G34A 4RWLA 4ORKA 3F3VA 3NRMA 1IAHA 3EZVA 1IRKA 2C6KA 4RGJA 3VBVA 2UZLA 1JKSA 4FKIA 3CP9A 4LGDA 4U81A 5JGDA 3ATTA 3MIYA 5EFQA 4A07A 5KHXA 1XH8A 2W9FB 3H30A 3R7EA 2UVXA 1FQ1B 2HY81 4XRJA 4WA9A 1YXUA 3Q4ZA 3PSBA 5BMMA 3ORIA 3U6JA 4F7JA 3NIZA 3E8DA 5I9WA 3SAYA 2R4BA 5DEWA 4TYJA 2W1HA 2JDTA 2WMWA 3M11A 4FVRA 3MSSA 3LKMA 5IQDA 4KSPA 4G3GA 3TNWA 2XNMA 2JDSA 3IW4A 4FV1A 4RBLA 4XJ0A 1GIIA 3C4ZA 1E1VA 4EUUA 5FP5A 4ZOGA 2OF2A 3FY2A 4W4VA 4JIAA 3BEAA 4L52A 2JKQA 3TEIA 3DPKA 3RTPA 3WF6A 5FXRA 4APCA 1PXLA 2JIUA 3UOLA 2CGVA 2XALA 3MH0A 3OEFX 3LFSA 3C5IA 5EM8A 3PJ2A 3BX5A 4MD9E 4ONAA 1F0QA 3FV8A 2XCKA 1S9IA 4EUTA 3R9RA 3HRCA 5KKRB 3BHTA 4WBOA 4KIKB 4RX5A 1IA9A 2E2BA 4DGMA 5HLPA 3WZKA 2X2LA 1U54B 2HCKA 1WVXA 2QI8A 1MRUA 4MXYA 5TF9A 4EQCA 4ERKA 3W0MA 5IU2A 1JBPE 1J1CA 2E9VA 1O6LA 4EHEA 4TWCA 2GS7A 2NRYA 2WEVA 3EN4A 3IO7A 3LXPA 3RGFA 3ZBFA 1T46A 3ZXTA 4ACMA 4CT1A 4DH8A 3SLSA 3VS1A 5EM7A 4EK6A 4BJJA 1K9AA 1R1WA 2FH9A 3FMNA 3E93A 4FUYA 5G1XA 3CE3A 3D94A 1Q3WA 3CR0A 4F0GA 5M07A 2HZ0A 3PJ3A 4IZ7A 5AAFA 2ITZA 2R0IA 3LXKA 3Q2MA 4O22A 1XBAA 2X9FA 3QZIA 2KULA 3POOA 5E4HA 4F63A 3BE2A 3NUNA 4U45A 3W8QA 4B9DA 5LJJA 1UKIA 4N0SA 2UZNA 2BTRA 3O2MA 2G1TA 4YJTA 2VNYA 4C61A 3FXXA 3FLWA 4QEBA 3R9HA 1Y8GA 3LM5A 5B2MA 2GHMA 3V5TA 5DIAA 3ZZEA 4AE9A 3VF8A 2PUUA 2OH4A 3DZOA 3FL4A 3NDMA 2C0IA 1NT2A 3OWLA 3V8TA 4YBJA 3D5UA 1H25A 3A62A 3EOCA 4JBOA 3O50A 3UGCA 3VBXA 4ALVA 3KN6A 2VO0A 5AR2A 2OJJA 5KMLA 5HZNA 4FG7A 1G8JA 5DLSA 3TYKA 2UZVA 4ITIA 4JQEA 3V51A 5KBQA 3GC7A 4W8EA 1WCCA 3EQGA 3MY5A 2H9VA 2W1EA 3I5ZA 4NFNA 4FV3A 2O65A 3RJCA 2GNJA 4EK4A 3ANQA 2PYWA 4MX9A 2IW8A 5IA3A 2B55A 3I6WA 4V01A 3O8UA 3UQCA 2PZYA 4R7BA 3DXPA 4AXAA 5BNJA 1NVQA 3NW6A 4C02A 3COKA 3DBEA 4AOJA 3QU0A 3DFCB 2VTTA 4M67A 4YLLA 2XRWA 5FBNC 1X8BA 5A9UA 4RIYB 3G0FA 1WBWA 3GXLA 4IE9A 2QKRA 2YCRA 5LQFA 4IWPA 3KK9A 5DT4A 3BELA 4WG4A 3QUEA 4BIDA 4QP2A 4C4IA 3FMKA 3G51A 4NCTC 3QTXA 4K8AA 5DE2A 1J7UA 2IN6A 3R7IA 1NVRA 2WIPA 1DM2A 3MH1A 5AP4A 2QODA 5FWKK 4I41A 4DEAA 4RVMA 4YJRA 3PY1A 5E90A 3TXOA 3QKKA 5J9YA 2ZAZA 4I1ZA 1YHWA 2XK9A 4IAYA 4V05A 4JR3A 4I5CA 5AJQA 3NUSA 4O83A 4A4OA 3AD5A 5JZNA 3OCGA 3PXRA 4J53A 5CI6A 3VBQA 2OXXA 3E64A 4I92A 4L00A 5AIKA 4XG2A 4EI4A 3IGGA 4FTAA 1PKDA 5C8KA 3L9PA 2XA4A 2VGOA 5HQ0A 3E92A 5BVNA 4MVFA 2ZMDA 3QTIA 1FPUA 2C68A 2XKDA 3D2KA 3AXWA 4BDJA 2C3KA 2ZM3A 1RE8A 3OCSA 4LRJA 5CWZA 2OZAA 2C5YA 3LFBA 3R8VA 4FR4A 4O7TA 1ZMVA 4UXQA 3UDBA 2VWVA 5EQEA 3ZXZA 5ETIA 3WBLA 3UO6A 1Q8ZA 3FMMA 4K33A 3ZS5A 5I9VA 4OTIA 3DLSA 4LOQA 4NKSA 3WIKA 2IJMA 3NNXA 3VQUA 4XUFA 2GQRA 2IW9A 5DHJA 2I0YA 4EOJA 4DAWA 3P7CA 3V01A 5DWRA 3E5AA 1P2AA 1SYKA 4ENXA 4XS2A 2EVAA 5HCYA 4N6ZA 3E3PA 4DFZE 1Y57A 4HNIA 3E8CA 1G8SA 2QQ7A 5BUEA 4FKVA 3N4UA 1W83A 4A7CA 2RL5A 4JJRA 4KBCA 2V22A 2YLEA 3FQHA 5AP3A 5H8GA 4A4LA 4FIIA 2H8HA 4AZVA 3DFAA 3AD4A 4G9RA 4O0VA 4R1YA 4QMNA 2WMBA 3NNWA 4TL0A 2JD5A 4U79A 4X3FA 5IEYA 3BLHA 4YLJA 3TT0A 5AV1A 4Q2AA 3R7UA 4BGHA 5J5TA 1OECA 1XH9A 4CCUA 4Z3VA 2HZ4A 3PP0A 2PMIA 5HEZA 5CAQA 4FYNA 4FT0A 3ZONA 4J99A 2P33A 3WE4A 2BAQA 3T8OA 2BZJA 2X2KA 3F88A 4AWIA 4E5AX 2XEYA 4XG4A 5HO8A 3LJ1A 3UQGA 1OL7A 3F5UA 4QMLA 2VN9A 1YDRE 5M08A 1VEBA 4BDDA 2VTOA 5T3QA 1WBPA 2WGJA 4LRMA 4M66A 4QP7A 5BYYA 2YM5A 4YPDA 3UC3A 4IZYA 2UW6A 2Y4IC 3OS3A 4GKHA 3KL8A 5A4TA 1JVPP 3HEGA 1GZ8A 3RHKA 3MDYA 5AX3A 1MQBA 5EOBA 3UIUA 4FBXA 1PXPA 1ZYCA 3UO4A 5HU9A 4FKGA 5HOAA 3GGFA 2XIYA 3ELJA 4U0IA 4HGLA 3DBFA 2JBOA 4AFEA 2Q0NA 5KZIA 3LE6A 1PMVA 5IQEA 4E93A 1P4FA 2VO7A 2QOQA 3W32A 3PVBA 1IASA 1ZARA 1O6KA 3MW1A 4H3PA 2PVRA 5K4JA 2ZB0A 2VTLA 4J7BA 3NUPA 4C7TA 2B7AA 2DQ7X 4FSWA 4X2JA 2V55A 4YO6A 4V0GB 5EW9A 1Q97A 2OW3A 3GUBA 4LI5A 4EOQA 1PXJA 2GNGA 1TFFA 3R7VA 4MUQA 2R3RA 4F08A 3LMGA 4YUQA 2B53A 3QTRA 4AQKA 2X0PA 3KREA 2ESMA 4C33A 5LVMA 1AD5A 2BRBA 3LFFA 3O7LD 4R1VA 3UZPA 4QT1A 4BCPA 3Q5IA 5D9HA 4EWQA 2ZDUA 2JGZA 4NT4A 4QMWA 4QQJA 5DFPA 5CVFA 2PVKA 2X81A 2WMRA 2VGPA 1KE5A 3C0HA 5D11A 1ZYLA 1WBTA 3MN3A 4ZSEA 1OIQA 3L9NA 5AR3A 4CZUA 2OIQA 3D7TB 4OW8A 3UOJA 2BKZA 3JVRA 3CKXA 3OFMA 3SRVB 3TZ8A 2ZYBA 2RKUA 1W98A 2J90A 3R8PA 3HMMA 3KULA 2IZUA 3ALOA 3QL8A 4TKSA 3A99A 1YI6A 2C5XA 1W2CA 4NJDA 5CLPA 3ULZA 4BF2A 4K6ZA 4C4GA 1Q5KA 2XK3A 3K3IA 3ZSHA 2G15A 4IQ6A 3UP7A 2WZJA 4EYMA 5BV3A 3QCYA 4XBUA 2XIZA 4EOLA 3C4WA 2NO3A 3R1SA 4LV8A 4PX6A 3VUTA 4DLJA 5K0XA 1ZAOA 2J5FA 3MGYA 1YHVA 4WUNA 4C4FA 3FLZA 5I4NA 3KMUA 4IAIA 5HCXA 1U46A 2CGXA 5CU0A 1SNUA 1OITA 2WMSA 4UMRA 3FMLA 1WBNA 2VTQA 4C57A 3I7CA 4CVAA 2WTWA 5AIRA 1XMLA 4IHPA 4IWQA 2J5EA 3FQSA 2J0JA 4R3PA 2OXDA 4M97A 5BVWA 4DN5A 4CFVA 4UWCA 4F09A 2OICA 4ACCA 3ZFXA 3BEGA 4C2WA 2CNQA 2Z2WA 4PPCA 5IEVA 4E6DA 3FSFA 3HMPA 3OHTA 4I6QA 3GC8A 3GOPA 5E8XA 4R5SA 4JRNA 4O7RA 3CQEA 4G3CA 5H9BA 2REIA 3KXMA 3Q32A 4I5HA 3BYMA 3R2BA 4IZAA 3HLLA 2QR8A 4IB3A 4M15A 4MNEA 4U3YA 2FUMA 3MFSA 3VHKA 1OKZA 3KF7A 1Q61A 3DAKA 3W0PA 4LQMA 3CBLA 3IONA 2AC5A 2X8DA 3Q4CA 4FTOA 3FKNA 2ZFYA 3UVPA 2CDZA 3BE9A 4IC8A 3FAAA 4FKQA 5DN3A 4AX8A 5A6NA 1J3HA 4D5HA 4G9CA 4FC0A 5M4FA 3EQHA 4X2FA 3F69A 4IX4A 2A4LA 2PMLX 3QCSA 4J8MA 4TXCA 5D41A 3FI2A 3ZU7A 3MVLA 4Y95A 3ZC6A 2QHNA 4QQ5A 2A27A 2AYPA 3NNUA 4R78A 4IC7A 4UMTA 4O6EA 3B8QA 4O81A 4EH8A 2QKWB 3UOHA 3VS5A 1QCFA 5ETCA 3SX9A 3L1SA 3ZSGA 1Q4LA 5D7VA 4D9UA 3JR1A 3NUYA 2QG5A 5EK7A 1U4DA 1RQQA 4J52A 4CFMA 4C3FA 5LVOA 4P5QA 3VQHA 3E87A 4USFA 4XLVA 2XM9A 2E9PA 3KXXA 2YDIA 4NTTA 4F9BA 4WT6A 2ETRA 2R9SA 4E5WA 4ZTMA 5AUXA 2R7BA 3KY2A 3QD3A 4FKUA 3F61A 1Q8WA 2PSQA 3QCXA 5KNJA 4KIOA 4X2GA 2FO0A 4GS6A 3G6HA 4O0YA 1BYGA 5LVLA 2C6OA 2C6MA 4F99A 2BDJA 2YM7A 3E63A 3HUBA 5I9UA 5GINE 4BY9E 4PTEA 3P0MA 4ANSA 3LLAA 3BWFA 2VU3A 3I5NA 3A7IA 5F4NA 5EYKA 3KMWA 4FNXA 4XYFA 5AUUA 2BUJA 2I1MA 2FA2A 5EHYA 5HNBA 1J7LA 5IA2A 3SC1A 3I60A 1XHAA 4APPA 2W1CA 3NSZA 4M84A 3UDTA 4MXZA 4BHNA 3GU6A 1H00A 4W4YA 4FV0A 4EC9A 1KOAA 2QOIA 1CSNA 4MXOA 4YP8A 4D4RA 4WG3A 2C0TA 1M52A 2EU9A 3NZ0A 4QMTA 3A2CA 2XP2A 4MEDA 5IH5A 4F78A 2NRUA 2XKFA 5AV0A 2XH5A 2HWPA 5DRDA 5HG5A 3DU8A 3P7BA 4HW7A 5EDPA 4DFLA 4X2NA 1OB3A 5IUHA 4BBMA 3F2NA 4KINA 5DH3A 2C5NA 5HU3A 2C3JA 2OSCA 3BQCA 3PE2A 4DT9A 4M0YA 4BDKA 3NW7A 3DXQA 3I7BA 3CD8A 4FIEA 2UVZA 3BI6A 3P5JC 2PWLA 3W0OA 3LLTA 3TL8A 1YI4A 5F95A 4NTSA 4QP6A 5M56A 3OC1A 4NW5A 1QMZA 4O4EA 5DOSA 4XBRA 4A9YA 4F6WA 3GCPA 3IW5A 5ITAA 2V0DA 1V0OA 2DYLA 2WQMA 5HD7A 3KIOC 1MP8A 2IZTA 1DS5A 2GMXA 2UUEA 3A60A 3PSCA 4M12A 4E7WA 4M7IA 2IZRA 4FRFA 4DHJA 4X3JA 3MH3A 5BVDA 2BRHA 5LCKA 4LL0A 2W96B 5M4CA 4O1PA 4AF3A 3HRBA 3NLBA 3QUDA 3BGQA 3PA3A 4FOCA 3U6HA 2B0QA 4DGNA 3W55A 5ANIA 3BHUA 4FKRA 1R0EA 3ZO2A 2W06A 3A4PA 3PPZA 4C37A 1DAYA 5FD2A 3NVKI 2R3HA 2VTSA 4RFYA 5EM6A 5HG8A 3I1AA 3FXWA 5ANEA 3VUKA 2CKEA 1CMKE 3ZC5A 4ASZA 2RG5A 5BYLA 5LARA 2FSTX 4TPTA 4F65A 5M4UA 2W5AA 3PVGA 1SVGA 2IVVA 3IW6A 3KMMA 1FINA 1UWHA 4USDA 3A7GA 4B8MA 3HA6A 2ITPA 3KRWA 1PXOA 4AFJA 2BVAA 2UW7A 3ERKA 1R39A 4MH7A 4BDAA 5EI6A 4CEGA 3VRYA 4ZEGA 3OWJA 4RIWB 3TIZA 4AT5A 4CKJA 4YSMA 3L8XA 4YJQA 4OUCA 5GJGA 4D2WA 4G3FA 3TACA 2WMQA 1VYWA 4DF3A 3JS2A 1H1SA 5CZIA 2R64A 4OTFA 5LOHA 1I44A 3MYGA 3V8WA 3QGWA 5AM6A 3MB7A 5E1EA 4BRXA 4AGCA 4TNDA 4BKJA 3GU5A 2JLDA 4EJ7A 4ZY6A 3UMWA 3ENMA 2GSFA 3ETAA 3KB7A 4WO5A 2BDWA 4RJ5A 4EZ5A 1UVRA 2OU7A 3EZRA 4FTQA 4P4CA 4G5PA 3KC3A 1JNKA 4S31A 3HP5A 1Y6BA 2G9XA 3V5WA 3AMBA 2IO6A 2QLUA 4HCUA 4O6LA 3UVRA 3IDCA 3FC1X 5IA4A 3JVSA 5M57A 3WILA 4XG6A 5IH6A 4FI1A 3GQIA 5F1ZA 1OGUA 3VO3A 3LMHA 4XMOA 4AZEA 3KRJA 5AAEA 2W7XA 5L3AA 4FEWA 4WHZA 3Q5ZA 4CZTA 4FA2A 5JT2A 2YHVA 2PE1A 5AUYA 2ZM4A 1LP4A 1PXIA 4FKOA 1TQPA 5AP0A 2X6DA 4AE6A 4HVSA 4AA0A 3H9RA 4JS8A 4NK9A 1YKRA 2C1BA 4AS0A 2VX0A 1BLXA 4YC6A 4EH7A 4ITHA 4IB0A 4A9TA 4AZSA 5FXSA 2O0UA 4C3RA 5CNNA 4G1WA 3AKLA 2GHLA 4O0SA 4FZFB 3UDZA 4HVGA 3RNIA 3RALA 2QHMA 4E4NA 4DEHA 4JXFA 5IUIA 3OTVA 4R6VA 1YXTA 3NGAA 2WO6A 3C9WA 3HVCA 2VRXA 4F0FA 3DBDA 3V5QA 2WFYA 4I4EA 3LXNA 1K2PA 5CI7A 3I0QA 2JC6A 4CV9A 5KMMA 4LM5A 4J71A 1OIYA 3UP2A 3CKWA 4S30A 3AT4A 3TNPC 3EL8A 4O7SA 2X6EA 3QX2A 3ML1A 3S95A 3ZBXA 3QXPA 1NVSA 3EN5A 2WMXA 5B2KA 4QNYA 5DRBA 3L9MA 2PVNA 1QL6A 1XBBA 4E8AA 2JFLA 5CALA 5FXQA 3PIZA 3P23A 1I09A 4CLIA 3BGPA 4WNPA 3ZM9A 2HELA 1GZKA 4AGWA 4EONA 4USEA 3I0OA 3O8PA 3B8RA 3BU3A 3TJCA 1OPLA 4GIIA 4RWJA 3BPRA 4JQ7A 3PLSA 4GVAA 3BZ3A 3DA6A 4X2KA 3PWYA 4FT7A 4E4LA 4F7SA 2VAGA 2GCDA 4GUEA 4X6RA 3RHXA 4FSYA 2VO6A 4EK5A 4QP3A 1FVTA 4XG3A 4IVBA 2ITXA 1H26A 3SKCA 5FBOA 1OL5A 4RSSA 4B8LA 1URWA 4BCGA 1HCLA 4RWKA 5GIOE 1H1QA 1P14A 3ZRMA 1U59A 5LWNA 4FSTA 3T3UA 2PULA 3Q4UA 5CU2A 3HAVA 4ANNA 4L7SA 3OROA 3ODZX 3BBTB 2ZV2A 2J7TA 3IDPA 3QC9A 4IW0A 3ZCLA 4ACDA 2PVYA 3GOKA 4BCFA 2F2UA 2ZJWA 4RZWA 5KCVA 2BCJA 3S0OA 1GAGA 2QVSE 3KRRA 5HESA 4RFMA 4H1MA 3L9LA 3MV5A 1PYEA 4MXCA 3GU8A 3WYYA 1CKIA 5HBEA 4I4FA 1PY5A 1RDQE 4ARKA 2G2IA 4AZTA 4ZLOA 4DFBA 2LGCA 3COMA 5BUIA 4HOKA 5T68A 4X3FC 4BIEA 4E4MA 2XNOA 3PUFC 5TR6A 3DLZA 4EK8A 5TT7A 4WG5A 3OTUA 3ZM4A 4YPSA 3PXZA 4TW9A 3O96A 4KIKA 2CPKE 2X2MA 4BB4A 2QU6A 2IVTA 3SQQA 3QAME 1V0BA 1JSTA 4PF4A 4AT3A 3RBWA 3TZMA 2PZRA 4GYIA 3QD4A 2IVUA 3ZUVA 5JFVA 4GKIA 2R3LA 1LUFA 4DH5A 1BUHA 2HK5A 5EHOA 5KE0A 3U8WA 4AT4A 2XAOA 4E6AA 2QD9A 2BRMA 2VTIA 3RM6A 1YW2A 4A9SA 4JBQA 4FTRA 4Y46A 2W4JA 4F7LA 2UV2A 4F9AA 5GZ9A 2VX3A 3TG1A 4L46A 2GFCA 3VUMA 3NCZA 3C4XA 3II5A 4ZXTA 5A14A 4MWIA 2W5BA 4D55A 5AP2A 1YWNA 3GI3A 3NAYA 4F70A 4ZLZA 5GHVA 3GC0A 4AACA 5CF8A 5FEEA 5CSXA 5A4LA 4DTAA 3TIYA 5E8UA 2YZAA 4WRSA 3V04A 5IA0A 4HPTE 4FSZA 4GSBA 2CKOA 2C3IB 2P4IA 3CJFA 1JKTA 1L3RE 2FSMX 3W2CA 5CEPA 5FDPA 2WEIA 5G6VA 3Q9XA 2R3PA 4RJ8A 3RAWA 4J97A 5E91A 2H96A 3MFUA 4RC2A 2X0GA 2VTJA 5JGBA 3I79A 2WTCA 4GU6A 4J1RA 3RM7A 4QD6A 4RWIA 2ZM1A 3WZEA 4D9TA 3LQ3A 2UZEA 1QPDA 4KABA 3ORZA 5EQPA 5FTOA 4QDEA 4TWPA 3RAIA 5AFVA 2VWXA 3P86A 5HORA 5EOLA 3LVPA 4QMZA 5CSWA 3D9VA 3FHIA 3VUIA 4DINA 2F49A 4YMJA 3CCNA 1A06A 2VWIA 3DBCA 4JDJA 2J2IB 3DTWA 3SXRA 5IPJA 3P78A 4IACA 3RMFA 3GFWA 3TKHA 2YZLA 3ID6C 2YM4A 5DBXA 4N57A 3ZLWA 3OCBA 1U5QA 2AC3A 4YC8A 3AG9A 3BYSA 3R21A 5EI8A 1AQ1A 3RKBA 3FY0A 3BYOA 2VO3A 4S32A 3AOXA 4FV2A 5C8MA 4CTCA 3JXWA 3MY0A 1H01A 3LHJA 5IDPA 2R7IA 1Q8YA 4LV7A 2R3OA 3KFAA 3PG3A 4YU2A 4FE2A 4O7LA 2XK4A 2JIVA 2UW5A 4FV5A 5TOZA 4YJNA 2PVMA 5CTPA 2PU8A 2PVHA 2PUPA 3HGKA 3IW8A 2Q83A 4FIHA 2OGVA 3O17A 5DGZA 3HV4A 2OH0E 3TNQB 4EOOA 2ZV9A 5LMKA 3HV3A 2Z02A 3TZ9A 3EFJA 3OBGA 3CTJA 2XBJA 3OXZA 4AW1A 5JKGA 3RCDA 4AXFA 5EYDA 4KB8A 2YIWA 4UEUA 4WKQA 4XEYA 4BTFA 2JEDA 3BGZA 4BHZA 5CNOA 1F3MC 4JAJA 3DQXA 4FZ7A 4W9XA 4FL2A 5H8BA 3TWJA 4F6SA 3U6IA 2XUUA 2W5HA 1PW2A 3K2LA 5FM2A 3RPOA 2W0JA 3CS9A