1SZMA

Dual binding mode of bisindolylmaleimide 2 to protein kinase a (pka)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
336
structure length
317
Chain Sequence
VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title The protein kinase C inhibitor bisindolyl maleimide 2 binds with reversed orientations to different conformations of protein kinase a.
pubmed doi rcsb
source organism Bos taurus
total genus 87
structure length 317
sequence length 336
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1szmA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1szmA02
4K6ZA 3CJGA 3E87A 3MH2A 2PVYA 3H4JA 3UP7A 5EM5A 3ZYAA 3FZSA 4BYJA 1REJA 4X2NA 3DGKA 2R64A 3VS3A 4CTBA 3L8XA 1PXOA 4IH8A 4UALA 3P9JA 3QD2B 3OG7A 3EL8A 4UWYA 2JDVA 3ZTXA 4I23A 4E26A 4BDBA 3LFCA 5CY3A 5E8WA 3KRXA 4O0YA 4EH7A 4JT3A 1VYWA 4GMYA 4E6QA 5GIPE 5A14A 5JSMA 3GNIB 3PA4A 4U43A 5DT0A 3RGFA 5HTIA 4L42A 3HKOA 5AUVA 2XK8A 4UXQA 4V0GA 5I9XA 4DFLA 3G0FA 2QO2A 1M14A 4AQCA 4ANSA 1WBPA 3C51A 4FEUA 4RX5A 3BLQA 4R7HA 2UW9A 4O96A 4QP3A 4KINA 1P5EA 2ZOQA 2NO3A 4NM3A 5JK3A 3KEXA 4FV8A 1XBBA 4KKGA 3JVSA 4JDIA 4DYMA 3FZRA 4I6FA 4L00A 3T9IA 4XEYA 4G16A 4BCMA 5A9UA 1ZAOA 5L2TA 5ANGA 5JH6A 4AZVA 2Q83A 4JG8A 2C47A 2PVJA 2YCQA 4M69B 4RJ7A 3IGGA 2WXVA 3ZRKA 5AV3A 3HV6A 2G2HA 3FZPA 4E20A 1RW8A 4G6NA 2BTSA 2JKMA 4E4XA 2W1FA 2HXQA 1OUYA 3HAVA 3OTVA 3SXRA 1QPCA 4E3CA 3TG1A 5M55A 2JDSA 2VWUA 3AC4A 3MBLA 4FSUA 4HGTA 5FTQA 3ZZWA 4TTHB 2WMRA 3OWLA 3O7LD 1H08A 4EH6A 3EN6A 2FSLX 2VTHA 2R3MA 3JPVA 2PHKA 5IQEA 4EI4A 3I0OA 1Q4LA 4XJ0A 3WI6A 3GBZA 4FV6A 3OUKA 4MWIA 3MB6A 2XIRA 4RIYA 4Q9SA 5CF6A 4O1OA 3VBYA 3KMWA 4QMWA 4KUJA 3RJCA 2PE2A 4FV1A 4FV5A 3IDPA 3GU5A 4XG8A 5DR2A 3CKXA 3F3VA 4KKEA 4Y72A 5DWRA 1BKXA 2R0IA 3HP2A 3PJ1A 1YI6A 4J8MA 4MTAA 3KC3A 3QF9A 3V5JA 3HNGA 3KF7A 4MXAA 4FNXA 3NUXA 4EBWA 4FTNA 4EQMA 3TTJA 2PVFA 3HYHA 5C8NA 2P0CA 4L43A 1WBVA 1XHAA 4DG3E 4AF3A 3LJ2A 5GZ8A 4J7BA 4C4EA 3R71A 2I6LA 4DBXA 4EK3A 5CWZA 5DI1A 2G2IA 4G3DA 3NUNA 4BDJA 3QKMA 5KMOA 1KUTA 4GVAA 2QOLA 3N4UA 1FMOE 3W2QA 1OKWA 2ESMA 4U81A 3OCBA 3C4FA 4KS8A 3A60A 4ZZNA 4KBKA 5ANJA 2LAVA 4RWIA 4U7ZA 3BYOA 3HV5A 3MI9A 3ZO1A 1VYZA 4E6DA 1E9HA 2OGVA 1RJBA 2B4SB 3KGAA 3FY0A 4NSTA 4AN9A 4WA9A 3P1AA 4CZYB 2YDKA 3FY2A 5HIDA 4DH8A 4ZZOA 4XLIA 5M57A 4FG8A 3IW5A 3GENA 4I41A 4QP4A 2PPQA 2HWPA 1NA7A 4YJPA 3TM0A 3NX8A 2XK9A 4HCVA 4IWDA 4BCPA 3TDVA 4TWOA 5CSWA 1L3RE 2QOQA 4RLLA 2P2IA 2UW6A 3EN5A 4U41A 3BYSA 3BHUA 5K9IA 2OZAB 4Y5HA 1JAMA 2BRMA 4C3FA 4UY9A 4BWKA 5ACKA 4QP2A 5KO1A 5EYMA 4JQ8A 3BLRA 3QX2A 4GSBA 2PE0A 4YJNA 2R3OA 4DH7A 4A06A 3HRBA 5K3YA 3F2NA 3QRIA 5L6PA 3GB2A 4E5AX 2ACXA 2HELA 4ZTSA 3RPOA 4GIIA 3GCQA 2BRBA 2QNJA 3W8LA 5I9YA 2G1TA 2WTKB 4MH7A 5H2UA 3TJCA 5CEMA 1JLUE 1LP4A 2H6DA 3PFQA 4HVDA 2JKOA 1CTPE 3RTPA 5AUXA 2W05A 3KKVA 2GNIA 3GCPA 3VAPA 1JBPE 3EIDA 4D2RA 3D7TB 3HLLA 5FXSA 3NIEA 5FP6A 4PDYA 3SG9A 3O7LB 2IW9A 3VS2A 5LCJA 2V7AA 4HZSA 5AEPA 1O9UA 1KE5A 3OF0A 5IA1A 1XH5A 2BRHA 5M4CA 4HYIA 2Z7SA 5FXRA 3ACKA 4RVLA 3TV4A 3QWKA 4EONA 4QOXA 1BI8A 1KE6A 3VS0A 4JIKA 5HBEA 1P2AA 4Q2AA 4IIRA 3FPMA 3RNYA 2Z7RA 1DS5A 3PA5A 1ZOGA 2C3KA 2VU3A 2PL0A 3ZFYA 4BCNA 4CQEA 3R28A 3W33A 1FINA 4EOKA 1XO2B 2YM4A 3NSZA 2X6DA 2QU5A 3UG1A 4IB0A 2J0JA 4NZWB 2JITA 2R3QA 2W1HA 4ZLOA 1M7QA 3BYUA 3I0QA 4PY1A 3TN8A 4CKRA 2VTMA 1DM2A 4WG3A 2VTPA 3HV7A 4J99A 3THBA 4IQ6A 4BBFA 1U59A 1NVSA 5TF9A 3WZKA 4H05A 2GQRA 3BV2A 1SVGA 1GZKA 4M14A 4N6YA 2OU7A 5C1QB 2B55A 3DDQA 3W2SA 3R01A 4G1WA 3QUDA 2ZM3A 3NYNA 1SYKA 4RJ6A 5EKOA 2I0HA 4ACDA 4A9RA 3TJDA 3GQLA 4DCEA 1X8BA 3WF8A 5L8KA 5JZJA 4ZTRA 5F4NA 3NLBA 2GHLA 3QRJA 4RA5A 3H0YA 2EVAA 3V5QA 4HOKA 2C5XA 4KRCA 2WMBA 3Q2JA 4DEIA 3T8OA 4NK9A 2XRUA 3ULZA 3QD0A 2SRCA 3BV3A 3BWFA 4G6LA 1APME 4LUEA 5FQDC 4IM0A 4A7CA 4ENXA 3PG1A 4ENYA 4DC2A 4RX9A 4IB1A 3DAJA 4EOQA 5A6NA 4F0IA 3D2KA 3OTUA 2YWPA 2ZM1A 3LHJA 4BCOA 1UVRA 4DFXE 5CAOA 4UXLA 2YEXA 3U4UA 4D2VA 3T3VA 5FTGA 4RPVA 4ZS0A 3ZU7A 4BDGA 2XBJA 4QMVA 4RQVA 5E1SA 3UOJA 3PTGA 3H10A 4TT7A 3PUPA 5FWKK 3R8VA 3FKLA 3TT0A 3D5UA 4NFMA 4USDA 2B7AA 1SVEA 3UOHA 4F7SA 5BNJA 4MBJA 2HIWA 4QTDA 3E92A 4AW1A 4DEBA 4Z55A 5M4IA 4DFUA 3JVRA 2F7ZE 1PXJA 2G01A 2IN6A 3PPKA 4O91A 4QMSA 5FEQA 3R8ZA 2R0UA 3CTQA 5HD4A 3CTJA 2R2PA 2W4KA 3LZBA 1YDSE 2J4ZA 2OJ9A 3L9PA 1PYEA 4M15A 4G3CA 4M0YA 3W55A 4IAFA 2YM6A 2YDIA 2YM3A 3EQIA 2PMOX 3OZ6A 2ZMDA 4X3FA 5IQBA 3FC2A 4BCJA 5G1XA 4C7TA 3VBTA 5A46A 3UZRA 2HWOA 3NZ0A 4IM3A 5CF5A 4FV7A 4IVCA 3TNWA 3UP2A 4FKIA 4NFNA 4LOPA 1JVPP 2HW7A 5EHLA 3TWJA 2LGCA 4X6QC 2W4OA 4U45A 4BF2A 5TT7A 3NYVA 5IQGA 3EQHA 3VQHA 3M42A 4AFJA 4U9AA 3LMGA 1IA8A 2XNNA 5EHYA 4C3PA 5IQAA 2X0GA 2YJSA 2XF0A 3V01A 3O8TA 3FV8A 3WE8A 4QP1A 4WT6A 3G9LX 3PSDA 3LPBA 2X4ZA 3T3UA 3OWPA 2P33A 4OTRA 2Y7JA 3QGWA 4AZSA 3CGFA 3VUDA 1Y8YA 4WUNA 1R0PA 5J95A 4BTKA 5JGBA 1WVYA 2XP2A 5EYKA 4DG0E 2C5YA 4FSZA 4ANLA 4BWXA 4FUYA 4JI9A 4XOZA 2HY81 3HVCA 4YU2A 3TDWA 2W1ZA 3TZ7A 3ID6C 3ACJA 4ANQA 4OAUC 3MIYA 2QVSE 4FTTA 3ZONA 4S2ZA 1M17A 4ZTQA 3BE9A 2I1MA 5KMNA 2YDJA 2CMWA 3BQRA 3COIA 5M53A 2WB8A 3HGKA 1PXLA 3R7VA 3VUKA 4BIEA 5IH6A 4CG8A 3BU3A 4RVKA 4IEBA 2X81A 4QMOA 1OVEA 2W96B 3RCJA 4A4LA 3JY9A 5J9ZA 2CKQA 3FMMA 3ZUVA 5TOZA 5HI2A 1G8AA 2PVLA 1PYXA 1NVRA 4TL0A 5HX6A 3E93A 1OUKA 3IOPA 2GHMA 3O2MA 4OBPA 1WBNA 3G9NA 4O7YA 3MY0A 2DUVA 2VD5A 1IEPA 4PMTA 4X21A 3LLAA 2BILB 2JKQA 3A61A 2VTNA 4FKTA 4OTQA 4FNYA 2V55A 3R8MA 3FHIA 4GV1A 2BAJA 2RGPA 1BUHA 3U6HA 3BGQA 4ZAUA 3BHTA 3SXSA 3ZC5A 4BGQA 1Q8UA 3GFWA 3V6SA 1PHKA 4QMPA 5M4UA 2CLXA 2AUHA 4NCTA 4F1TA 2WMAA 5FM2A 4TKSA 4APPA 3LXPA 3WF5A 5LMBA 1ZRZA 4J96A 4XG7A 3BYVA 5J5SA 3D14A 3MW1A 4ZXTA 4EOJA 5CF4A 4W8DA 3GU4A 2VTIA 1YKRA 1VJYA 4QYEA 4AT5A 4FT0A 3LCTA 1PY5A 4CV9A 2QODA 4FOBA 3P7CA 4JR3A 4BCQA 3EFLA 3E7VA 3OUNB 4OTGA 3SW4A 3Q32A 4BTMA 2J5FA 3WIKA 3ALNA 3AD6A 3IW7A 4PMPA 1F3MC 4O81A 2GS6A 2XNBA 5BQ0A 2JEDA 5FLFA 4BDHA 2BIKB 2YIWA 4FV2A 3IKAA 3SAYA 3PY0A 3AQVA 3FQHA 1YHWA 2GCDA 1B38A 2QHNA 1NY3A 2BVAA 3OY1A 4TWNA 4XG4A 5AIKA 3QLFA 3QQFA 4MNFA 4FTAA 5AWMA 2F2CB 3OXIA 4FR4A 4QO9A 2R4BA 3B8QA 1H28A 3EJ1A 2OBJA 4LQMA 4F0FA 4QYYA 5LVMA 1OPLA 3VQUA 3KRRA 3QL8A 1ATPE 4MXCA 3DU8A 3QQJA 1JSVA 2DYLA 5H8BA 4DH1A 2C6MA 4O21A 4A9TA 3LMIA 4LGHA 3KXMA 5BVEA 5JFVA 3GFEA 4K1BA 4XV2A 2QD9A 3M1SA 1H0VA 2CN5A 3SKCA 1CMKE 2IZSA 3BRBA 2B1PA 2J51A 5CVGA 4R5SA 3NNXA 1WBWA 3H9OA 2WTCA 2IZTA 3HMOA 5HO8A 4ACCA 3AGMA 4O6LA 4D1ZA 2ZDUA 2WTWA 2BIYA 4C2WA 4J52A 4IJ9A 4BDKA 2QC6A 5ICPA 4ASXA 4KBAA 1BMKA 5K5NA 3R9OA 3ZDUA 3ORIA 5DOSA 3SA0A 3ZO3A 2KULA 5EDQA 2FH9A 3QRKA 1P14A 2VTQA 4DN5A 2OJIA 5HESA 5J87A 4UWCA 4L01A 2UW5A 2A19B 4J8NA 4AX8A 2CCHA 4USEA 4E4LA 2UW8A 3BHHA 3MVJA 3F2RA 4XRLA 3ZCLA 2O64A 3ZRLA 4O7LA 4I5PA 3UO4A 4AWIA 4FE2A 5EQPA 5C8KA 2WTDA 1OZ1A 2OI4X 3LCSA 2FSOX 5AA9A 3ZHPC 2IJMA 2JDRA 3PP0A 2BHEA 3PJ8A 2ZAZA 3FL5A 5JEBA 3PDTA 1Y6BA 3ODZX 4YZDA 4L8MA 3NYXA 2YCSA 2XK3A 5F95A 2WMUA 3NPCA 1WAKA 5HVKA 2R3JA 4CT1A 3HEGA 3HRCA 3PZHA 3EL7A 2W9ZB 5AP0A 5HE1A 3D5VA 4X7QA 4LGGA 3MWUA 5KKRB 2C0OA 2CDZA 1JWHA 4TWCA 4R8QA 3DKCA 1QCFA 4GFGA 3MJ1A 4LGDA 4ONAA 1NXKA 4QPSA 5EM8A 4EBVA 4KWPA 4QPAA 4LV8A 3GCVA 3UVRA 4C4FA 3U4WA 4QP9A 3W2CA 4RGJA 3S1HA 5A4TA 4BDEA 4EOMA 4FL3A 2ETKA 3LQ5A 4TPTA 1J1BA 4DGMA 2UZBA 4I93A 4D1SA 4YMJA 1IASA 2UW0A 2GNGA 1QPEA 5E8UA 4I21A 3VC4A 2VTTA 3LAUA 3LCKA 3KRJA 3RP9A 4DT9A 1REKA 3RHKA 2VGOA 2IWIA 2ONLA 5FP5A 3OW4A 3R2YA 2ITYA 1YHSA 2OSCA 3SQQA 3ITZA 4GK3A 4OTIA 2EU9A 2C6TA 4TN6A 1XQZA 2RSVA 3FLNC 3TIZA 2PZ5A 3R63A 3FI8A 3R7YA 1WVWA 4IAKA 4ASEA 3L8VA 4AN3A 2BAKA 3V8SA 4BI0A 5HO7A 4FSRA 3FSKA 3GC9A 4O0XA 3BEGA 2E9NA 3O51A 5EQEA 4A9YA 1ZLTA 4FL2A 4G9RA 4MXXA 2ZM4A 1IRKA 3Q3BA 4XH6A 2BKKA 4TW9A 5CEIA 3RM7A 3MPAA 4GUBA 3E8EA 4AZFA 3KXZA 2X2MA 3F3TA 4JG7A 3UGCA 3WE4A 3U6JA 5HBJA 4FV4A 4X3JA 4EH4A 1VEBA 2J0MB 1ZXEA 3BGZA 4YPSA 5H8EA 5D1JA 3TZ8A 3QXOA 4CFMA 4QYFA 4FT7A 4X3FC 4CSVA 2FSMX 3GU7A 4C2VA 5GIOE 3DAEA 5DR6A 5FBNC 5LQFA 3HA6A 4RVTA 2GFCA 2CHLA 2IVTA 4EJ7A 4YJSA 3VF8A 5IUGA 3DZQA 3EFWA 4ASZA 4N6ZA 3Q9ZA 3EZRA 4HPTE 1S9IA 3QCQA 3R1NA 5DT4A 4II5A 4BRXA 2X9EA 2BDFA 3ZOSA 4CMTA 5HX8A 2E2BA 4AN2A 2QCSA 3MH0A 2GQGA 3VO3A 4L44A 3C7QA 4TYHA 4FEVA 1TQPA 4YO6A 3DKFA 4MBLA 4R77A 1PMVA 4X2KA 4ALVA 3H9FA 2WIHA 3AT2A 5JKGA 3QZGA 3PXRA 4NM5A 2JAVA 2I0YA 3LFQA 5HOAA 2CKOA 3F69A 1HCKA 3V6RA 4FTRA 4EQCA 5I3RA 2PZYA 2H34A 3I7CA 2ZJWA 3I6UA 5JRSA 4B6LA 3EHAA 2J90A 1HCLA 2VWXA 5HZNA 2C6LA 3FUPA 2PTKA 3DOGA 5J5TA 4AZEA 3UQCA 4RBLA 3ZLSA 5IQIA 2V7OA 1OI9A 1V1KA 3DNEA 3W2RA 4WNMA 1BL6A 2Z2WA 4O7NA 2VNYA 1S9JA 4C62A 4AW2A 4EHEA 3UNJA 1YDRE 1CKJA 4BY9E 3IQ7A 2QR8A 4PP7A 4G31A 2RG5A 5E8ZA 2X2KA 5T6KA 5A4CA 2UV2A 4Q5EA 3R8UA 2RFSA 4JIAA 3VUHA 3QCSA 1OECA 3VJNA 4RIWB 2UVYA 2WQEA 3QUPA 2JLDA 4O22A 4TYEA 5JT2A 4F9CA 1TQIA 5B2KA 5LVLA 3PWYA 5HHWA 2R7IA 2UZTA 2VN9A 5BYZA 2UVXA 1ZMUA 3I5ZA 4JQ7A 3ZM9A 5H9BA 4PL5A 4ALWA 4IWOA 3MV5A 4UZHA 4KS7A 3MFRA 4QMLA 4KD1A 4B4LA 4U44A 5CSVA 1M7NA 4NCTC 4YURA 4FV0A 5IEXA 5CEOA 5FM3A 4IAAA 1FPUA 1DAWA 1YXXA 4CFUA 5GHVA 4M67A 3CD8A 5ANKA 2FSTX 4YTIA 4EOPA 3ERKA 4FGBA 2H9VA 3EB0A 4M68A 4QQJA 5D11A 4HJOA 3VW6A 3E62A 3QTRA 3KMMA 5HCZA 5JFSA 2C3JA 3C4WA 2PZIA 4AXAA 4IB3A 2B9HA 1GZ8A 1KSWA 2VUWA 4HGLA 3ORNA 4PL4A 5HGIA 2QKRA 2VWWA 2XIYA 3F2AA 3ZM4A 4MXYA 4NW5A 5JRQA 4ZS4A 2QQ7A 5DNRA 4CZUA 3FWQA 3OOGA 4W9XA 4FSQA 1ZMWA 4AE6A 3CEKA 5L2SA 4IACA 2YJRA 4CFWA 2CPKE 4GL9A 5IH4A 5E9EA 3BBWA 4G2FA 3ZC6A 2A0CX 2CGVA 3LQ8A 1EH4A 3WARA 4U8ZA 3QC9A 5C01A 2X4FA 1OKZA 5G6VA 4JBVA 3TUBA 1T45A 1UKHA 4M8TA 5ACBC 3TI1A 4YTCA 3DBQA 4X0MA 4OBOA 1Q24A 2B54A 5BUJA 4R7IA 1PF8A 2R3IA 3L9MA 1JNKA 3EQFA 5HKMA 3FXZA 4DFNA 4IX4A 4LOQA 4EHVA 2XM9A 3KVWA 2W99B 4FK6A 4IJPA 4ZK5A 4L52A 2WZJA 4NW6A 5DG5A 3ZZEA 4FF8A 4ZY4A 3TZMA 4DH3A 5K5XA 4FSMA 2VTOA 5KUPA 2J7TA 3Q9XA 4U79A 5DN3A 5J8IA 4F7LA 4LMNA 1W82A 5JMSA 2ITNA 3BPRA 2A2AA 4FKPA 2QOKA 4CEGA 3NYOA 1I44A 3EFJA 3OP5A 3S3IA 1XH9A 4MK0A 2HAKA 4CT2A 2BCJA 4E8AA 2C6DA 3HDMA 3UVPA 4QMZA 4C8BA 3DNDA 1OIUA 2XKEA 3MJ2A 5GZ9A 3AC8A 2I0VA 3B2WA 3MPMA 1OGUA 4Y8DA 5D10A 4D28A 4YP8A 4EOOA 3K3JA 3LFBA 4HVGA 3AMAA 3FC1X 4NIFB 5AMNA 3T9TA 4FEWA 4QTCA 4XRJA 3GUBA 4FA2A 3QQLA 3Q4TA 4DGLC 3E3PA 2HZNA 4S31A 3FL4A 3NRMA 3QTUA 4TNBA 4R78A 3F7ZA 2OFUA 4QMTA 4FT9A 1FVTA 2WMSA 4YNOA 4C3RA 5M4FA 4IFGA 3TCPA 5E91A 4O7WA 4AAAA 1ZY5A 3BWJA 5TR6A 3VVHA 3HX4A 3SDJA 4ZY5A 5D7AA 1UU9A 5D7VA 4BZOA 5EQYA 4I22A 3GC8A 4CFNA 4ZIMA 3TKHA 3IDBA 4G6OA 5H3QA 3RPVA 4YTFA 5LVNA 3LXLA 1RQQA 2RFDA 4B8LA 2GNHA 3LXKA 3QZFA 3R9HA 1Z9XA 1ZYSA 4I4EA 1Q99A 4O0UA 5CAQA 3N4VA 4E73A 2RL5A 2VWYA 2OJFE 3PXKA 3DCVA 4YHJA 5HG9A 4MF0A 3OOMA 3G15A 3E63A 1LR4A 2WNTA 4I0RA 3MFUA 3TUDA 3UODA 3ZFMA 2BR1A 4AZWA 5DH3A 4ERKA 3HV3A 3FHRA 3BKBA 2QOIA 3D15A 1OPJA 5L6WL 2ONLC 3H0ZA 1JSTA 2NNWB 4L3PA 4MNEA 2O8YA 3DT1A 3O8UA 4M84A 5HE0A 4D55A 4G9CA 5CU2A 4DA5A 4U6RA 2YIRA 3R7GA 4CMOA 2PMNX 2Z7QA 3WBLA 3UMWA 2HCKA 3R6XA 2UZNA 1PMEA 4D2SA 4ZTMA 3U55A 2QO9A 4WIHA 3QQUA 3MDYA 4AS0A 4NH1A 3PZEA 5J7BA 3MYGA 5EI2A 3AT3A 3P23A 3PPJA 4JLCA 3QD3A 3FLSA 2OH0E 2YIXA 3KQ7A 4XP0A 1JOWB 1M2RA 2WMTA 4IAZA 5IUIA 2UZWE 5FDPA 3Q04A 3D5XA 4MHAA 4XP3A 5EW3A 3PJ2A 3DK6A 1ZARA 3CC6A 2UZLA 3WF7A 1UU3A 4YLJA 5M08A 5KBRA 3CR0A 5CENA 2C6OA 2IZRA 3MA6A 4JDHA 3RWPA 3ELJA 2XIKA 3RAHA 3SRVA 4G5JA 4ZMFA 5C03A 5GJFA 3TKUA 4GFOA 4NM0A 4BTFA 4Q5HA 5CSHA 2I40A 4A4OA 3KFAA 3P4KA 4G34A 3OY3A 4XG2A 4DEHA 4YSMA 4Y83A 1CDKA 4IW0A 4U80A 5KHXA 4W4XA 2B52A 2IG7A 3W2PA 3FEGA 5EYCA 3LVPA 1R39A 1ZZLA 1YI3A 4RSSA 4TRLA 2PVKA 5HD7A 3VHKA 3IW4A 2JDTA 3FQEA 4FIFA 2CKEA 4I24A 3DK3A 4IB5A 4R5YA 1U46A 3QXPA 2OJJA 1URWA 4Q9ZA 4AP7A 4NJDA 5M56A 4UX9A 1YXSA 3P5KA 2R3LA 4EYJA 1UNHA 4M12A 1TVOA 5HTCA 4F1OA 4O86A 4CKJA 2DS1A 3G5DA 4CCBA 5CXZA 4PPBA 2F4JA 4CKIA 3VS7A 3VUMA 3HRFA 1R78A 4S33A 5ETAA 3OCTA 4DG2E 4FTLA 2CGXA 3MVHA 2Y9QA 3BELA 4R3RA 5AR7A 4R1YA 4AOIA 3C50A 2UUEA 4YHFA 1BLXA 4L46A 4HYHA 2WIPA 4A07A 3FKNA 4APCA 4P4CA 3QA0A 5HIBA 4RX7A 4FK3A 4RLKA 4I1ZA 3AGLA 3PRIA 1UNGA 2UZUE 3E8NA 2EXEA 4PF4A 4BL1A 1P4OA 4UMPA 2OIBA 4R7BA 2X7OA 4F6WA 4FIJA 2X8EA 4RIXB 3VN9A 4AFEA 5EDPA 5CNOA 3RK5A 3MH3A 4BZDA 3N51A 3P78A 3K2LA 4FVRA 4J53A 3VF9A 3TV7A 5D9HA 4M69A 4QP8A 3KREA 4EH3A 3AMYA 4RC4A 2ZB1A 4U5JA 5IF1A 3ZLWA 4IBMA 5FXQA 1VR2A 3TV6A 4GH2A 2QLQA 2V0DA 1RE8A 4PUZA 3RCDA 4QMXA 4YJRA 4MYGA 4YC3A 5T68A 4DINA 3H3CA 4O0SA 4ITJA 3I6WA 4YZNA 5L2WA 3FZTA 4YR8A 2PE1A 4XX9A 3U54A 2HYYA 5LWMA 2ERKA 4LMUA 1OIQA 2GFSA 2PMIA 5IISA 4O83A 4YNEA 3OFMA 2G9XA 2FO0A 4AT3A 1PKDA 3F61A 5M51A 1AGWA 1H0WA 2QOCA 3V3VA 3RK9A 2E9UA 4ZTNA 5HCYA 3JY0A 3FLQA 5EW8A 3VNTA 4FYOA 3SW7A 1B39A 2WQMA 4FX3A 5DPVA 5ANOA 2XJ1A 2WQOA 1W98A 3KVXA 3WF6A 2O5KA 4BDFA 2VWIA 4MBIA 2PZPA 2UZDA 3W1FA 2QURA 3EFKA 4V01A 3U9CA 2O0UA 1FGIA 1YXVA 4CLJA 1OBDA 3R83A 3FE3A 1Q97A 3VWAA 4BHNA 4M3QA 5IEVA 5IA4A 3H9RA 5EDRA 3D4QA 3HECA 4YZ9A 4D4VA 4F99A 2VWBA 3DZOA 1Q8ZA 1XBAA 3LFFA 4NUSA 4Y85A 1JKLA 5DRDA 4A9SA 2XBAA 4DCAA 4PDOA 2VWVA 3DXNA 5KMLA 2ETMA 4K2RA 4ASDA 2Y4IC 1NT2A 4BKYA 1Q3WA 3L8PA 3LKMA 3QRUA 4RC3A 3ZXZA 4PQNA 3Q53A 1J1CA 3II5A 4JX3A 3D94A 3A4OX 4LG4A 5CI6A 4OT5A 4F7JA 1G8SA 3FI4A 4DFBA 4RFYA 1WZYA 2V62A 2PK9A 2W4JA 3DBCA 4FZAB 4K18A 4NKSA 1XJDA 4ACGA 5GINE 3NNWA 3R73A 4QNYA 1PJKA 2VRXA 4DAWA 3Q4UA 4ARKA 5M06A 3A2CA 4D4YA 5AP2A 2VZ6A 3D2IA 4I6HA 3RK7A 4BI1A 3ZDIA 5C4KA 3NNVA 4F9BA 1TKIA 3NEWA 4BDAA 3D83A 2XH5A 3PVBA 2YLFA 5J79A 2WMWA 4D1XA 4GYIA 2OZAA 2WMQA 3DA6A 2C5OA 3ORLA 2VTRA 1GIJA 4YPDA 4D5KA 1XH6A 3ORZA 4CLIA 4TYIA 4FMQA 2HW6A 2WFYA 3M2WA 2F7XE 4WG4A 1W0XC 3QTIA 4GG7A 2X8DA 4ZP5A 4BB4A 4C35A 3S0OA 3RM6A 2QU6A 1OL1A 3PSCA 4D0WA 2VWZA 2ZMCA 3FKOA 4ZZMA 5CAPA 2YISA 4TYJA 4NL0A 2ZVAA 4DLJA 4Y5QA 3FMNA 4XG3A 4O6EA 3P0MA 3R0TA 3UVQA 4IX6A 2WEVA 4XG9A 4EZ7A 3BU6A 5CYIA 5BUEA 3UQFA 1R0EA 4L68A 4U40A 4EK4A 3D7TA 3MY5A 2BPMA 4F9YA 3MFSA 3QGYA 4BCFA 4BCIA 2QG5A 5HEZA 4IMYA 5CSXA 5K0KA 4OTFA 3F6XA 4GCJA 3WYXA 3U6IA 2CSNA 3QX4A 1GZOA 5FRIA 2VTSA 4B8MA 2AYPA 1CSNA 4P5QA 2XCKA 5EFQA 4CGAA 1UNLA 2EXMA 3C4CA 4C34A 3OT8A 4WSYA 4WNKA 1H00A 2BRGA 5AFVA 3W10A 4FBXA 5AV2A 4XNEA 3EKNA 3L9NA 3MTLA 4EL9A 3NVMB 4J1RA 1KWPA 1KV2A 2R5TA 3KCKA 3G90X 3KN6A 3UE4A 3ZEWA 3NW6A 2W5AA 1G5SA 2JIUA 2YCRA 3KCFA 4BIDA 1CM8A 1XR1A 5J1WA 1ZYLA 1Y6AA 4AA4A 3VBXA 5KMIA 4MCVA 3R7EA 3KL8A 3OROA 3V5LA 1Q41A 4P2KA 4DH5A 5AR8A 3RHXA 3ZBFA 3IW6A 4BICA 2VX0A 3QTXA 4RZWA 4DTBA 1JKKA 4JR7A 3L8SA 3D7ZA 4DGGA 3AT4A 1V0PA 4QYHA 4A4XA 2CKPA 3TACA 3ZXTA 4IVAA 3FLZA 2BFYA 3QQKA 2UW3A 3OWJA 2BZJA 2OXYA 3QAME 3G0EA 3L1SA 3R8PA 3SC1A 5BX0A 2ITVA 4GT5A 3SOAA 4MX9A 1Q3DA 4FTQA 1YWRA 2QLUA 4E6CA 2FUMA 3VS4A 5C26A 3NUAA 2HK5A 2Q0BA 3NUYA 4D58A 5IQCA 2B0QA 4UMRA 4RQKA 4L7SA 4XUFA 2W5HA 4ITIA 2JBPA 3ANRA 5EI8A 3PP1A 5F94A 3SXFA 2V22A 2F49A 3WYYA 4NWMA 2BAQA 2O3PA 3ETAA 2C6IA 3WZUA 4ALUA 4YSJA 3FXWA 4J95A 5DMZA 5AP3A 4L9IA 4N70A 3R7UA 3ORPA 3Q9WA 4CVAA 4JS8A 3QLGA 2WQBA 5E8VA 3NW7A 4QT1A 5KHWA 3QZIA 4C4IA 5BPYA 3AG9A 3D0EA 3TNIA 3SGCA 4JL9A 4UYAA 4YJUA 5ANIA 4JBPA 5EM6A 3CS9A 3LW0A 4FKQA 2ZV2A 4W9WA 4DFZE 3O50A 2BZKB 2WD1A 1DAYA 4OAVB 4KNBA 3R9RA 2F2UA 3O17A 3AD4A 3R21A 4FNWA 4WO5A 3ENHA 4DEEA 4F9WA 3LOKA 2HENA 3LFEA 4LM5A 2PSQA 2FGIA 1WBSA 1Z57A 5HIEA 5CANA 4PX6A 3GU8A 5I9VA 2VX1A 2J9MA 4IC7A 4BI2A 4EH2A 3V5PA 5J9YA 3C4XA 4F6UA 5BVNA 3CQUA 4HNFA 4NM7A 4AUAA 2WU7A 1OIYA 5AV1A 2XJ2A 3OXTA 5EG3A 4FKGA 1OM1A 2B9JA 5TE0A 4BBEA 3I60A 4IVDA 3FMHA 2PWLA 3ZFXA 4KIKB 2FB8A 4MQ1A 5M07A 1UA2A 1A9UA 1PMNA 2XIXA 2YABA 4RJ5A 2I7QA 5AR4A 3RAWA 5IH5A 1SNUA 4AG8A 4F6SA 2RFEA 1SZMA 4IANA 4NEUA 4YTHA 2NRUA 5AP4A 2REIA 4JBQA 4LL0A 5L3AA 5HO6A 3KB7A 3N4TA 3DV3A 3TNHA 4ERWA 2CGUA 4PMSA 4B9DA 5L2QA 1GIHA 1XBCA 2WTJA 2QOHA 2XMYA 3GI3A 4IZ7A 3FSFA 1H8FA 5J1VA 1Q5KA 1F5QA 3AMBA 4UB7A 1SMHA 3HMPA 5TKDA 4ANBA 4PL3A 4S32A 3A62A 3WOWA 1M2QA 2A27A 1Q62A 1UWHA 3CIKA 3PIZA 1FOTA 4ZSJA 4EK6A 2ZDTA 2QOFA 3Q9YA 1VZOA 3GT8A 2YITA 3VRYA 2IVUA 5FEDA 3BHYA 4Z3VA 3EKKA 3AXWA 3HP5A 2XZSA 3KXNA 5HVYA 4AGWA 4AZTA 2YA9A 3HZTA 1U54B 3RZBA 3Q6UA 3ODYX 3Q96A 5JQ8A 4DTKA 3CQWA 5HNGA 2RKUA 3C4EA 5HICA 3F3ZA 5C8MA 5DEWA 3EQBA 2YN8A 4YC6A 3MVMA 2AC5A 1WVXA 4G3FA 4LRJA 3LM0A 3RAIA 3UOKA 3OVVA 1GY3A 1YHVA 2XJ0A 4EKLA 2XNGA 1SNXA 3RMFA 4ZSEA 3TL8A 4O7TA 4NU1A 5M44A 2QOOA 3QTQA 5DVRA 5AUTA 4AOJA 1DI9A 2FVDA 3R04A 4FZ6A 4EH5A 3UIMA 3EMGA 2E9PA 3OHTA 4FEQA 3SD0A 4QTEA 2XS0A 4J98A 3ZO4A 4GUEA 4S30A 4YZCA 4R1VA 2Z7LA 3COMA 3R00A 2XKFA 4C58A 4V0GB 4HPUE 2VTJA 3FMJA 2J0LA 4I0TA 4IHPA 2QO7A 4P90A 1OL2A 4AA0A 3W2OA 3BLHA 4FEXA 2XYNA 1JKSA 4ZLZA 5AUUA 1ZOEA 3LFSA 2YZAA 4Y95A 2O65A 4RG0A 1O6YA 5HG8A 4HZRA 5BVKA 4BFMA 1UWJA 4F70A 2EXCX 1J3HA 3IO7A 3R9DA 4KIPA 4EHZA 4KRDA 3OBJA 2JGZA 3F5UA 3IK3A 2IVSA 4V04A 3K3IA 1ZOHA 4YO4A 4ACHA 3VHEA 5IMXA 2PVMA 3OEFX 5E8SA 3W16A 3PYYA 1J91A 3BZ3A 3DFAA 3RINA 4TXCA 4Z7GA 3CPCA 5BVOA 4GU9A 5CVFA 2R3GA 5CF8A 5BYYA 3O96A 3OCSA 3UO5A 4OBQA 1UU8A 4BGGA 1H1PA 3LFAA 3LE6A 3CSVA 2GU8A 2OWBA 3KN5A 5DYJA 4IWPA 3F5GA 2WKMA 4FT3A 3KF4A 3ZSHA 5HLWA 4LUDA 4AOTA 4H3BA 3JXWA 4WUAA 4YLLA 5CVHA 5HNBA 3PJCA 3ZRMA 2C6KA 2JC6A 2RIOA 3U51A 4RIYB 4K33A 4LRKA 4RIOA 1TQMA 4FIIA 4MKCA 2WEIA 5D41A 4YJTA 3CY3A 1H1SA 1XKKA 2YIYA 3ORXA 2C0IA 2WGJA 1H01A 4WRSA 4XBUA 3V8TA 4EKKA 2PVHA 4JBOA 5IA5A 4KSQA 5DLSA 1U4DA 5HBHA 5C9CA 4QNAA 4FTJA 3AC5A 4L6QA 3R8LA 1STCE 2YAKA 3NS9A 4IADA 2JFMA 3BHVA 4BTJA 3LFDA 3VUGA 2VO6A 4FTMA 4IVBA 1OPKA 4MD8E 3R2BA 4TNDA 3P7BA 3HA8A 4CMUA 2QKWB 5DRBA 3GP0A 2IZUA 2A1AB 4RC2A 4EOIA 4U42A 1SM2A 2R3PA 3PXYA 4Y46A 3RVGA 2Y6OA 1OMWA 2OIQA 3GCUA 5AR2A 4C37A 2CCIA 2FA2A 2XEYA 3NUUA 4C38A 3Q4ZA 4J71A 4ZJVA 4FV3A 1YVJA 5CX9A 1JSUA 5IA2A 5IDPA 3UNKA 3RBWA 2CLQA 2ITZA 2QONA 4FIHA 3VBVA 3R02A 3A7FA 3LCOA 4B7TA 2PUNA 3CXWA 4FT5A 2Z02A 5AR5A 2BZIB 4N4SA 3UZTA 5CI7A 2XM8A 3PVWA 2IO6A 4U97A 3RALA 1OITA 3FI3A 3W32A 4EC8A 4E6AA 2GHGA 3EQGA 4HGSA 5KMMA 1XH7A 3P79A 4UMQA 4WKQA 4RJ4A 1Q8TA 1URCA 3E8CA 4L67A 5ANEA 5GJDA 5BVWA 3MPTA 4I6QA 1BX6A 2WMXA 4CRSA 1OKYA 2ETRA 2UZEA 4O0TA 3ZEPA 4EEVA 2ZV7A 3BIZA 1Y91A 3Q2MA 5L4QA 4O7VA 2C69A 2WAJA 2XUUA 4L3JA 5I3OA 4Y73A 5LMAA 2J5EA 4FG7A 2GSFA 3DBFA 1KV1A 2VAGA 3R1QA 2WHBA 3UJGA 4I5MA 4DEDA 5L8JA 4EK8A 2YFXA 3QC4A 1H26A 3F82A 1PXKA 3CKWA 4JAIA 1M52A 4U0IA 4XOYA 2XYUA 2P3GX 3LM5A 3QUEA 3V5WA 3KRWA 5I9WA 2YIQA 4KABA 5IEYA 3DLSA 4OR5A 3ZS5A 1OB3A 5IQHA 2R3FA 3QYWA 3NGAA 4I5CA 5CNNA 3ZLXA 5EH0A 1WMKA 3D9VA 1Q61A 3MB7A 3TXOA 3Q60A 5KMJA 2NRYA 3SOCA 2C6EA 5TO8A 4QMUA 2WU6A 4RMZA 4RT7A 3CY2A 3FLYA 1PXIA 3CPBA 4K9YA 4UMTA 5ETIA 4EWQA 5CTPA 1GAGA 4H1JA 1ZYJA 2CGWA 4M7IA 3BBTB 4WG5A 3NR9A 4MVFA 3F3UA 4JQEA 5K4IA 4DE4A 5GJGA 3NWWA 4IM2A 4BKZA 3C5UA 3PY1A 4Z7HA 3Q5ZA 4HNIA 3HMNA 5AP6A 3E5AA 4QMQA 2BRNA 2GS2A 4FKUA 4DHFA 4UMUA 4H58A 3A7HA 2C5NA 1V0BA 3QKLA 4XP2A 1MRVA 3GOKA 1YWVA 3EQCA 4E5WA 4NYEA 1K2PA 3MSSA 1LEZA 3OEZA 3R1YA 4ITHA 2W0JA 5AM6A 3UOLA 5B7VA 4R3CA 3C0GA 5ETFA 4IAYA 3R7OA 1L8TA 4ZSAA 5IMEA 3I5NA 4F09A 2B9IA 4W4WA 3TNQB 3A99A 2XKDA 4K11A 1FQ1B 3G33A 4FSWA 4OTPA 4R3PA 2J6MA 5CT0A 1AQ1A 2VO0A 2O63A 3PXFA 3OMVA 4JNWA 3GEQA 3EN4A 3MVLA 2F57A 3GC7A 4H3PA 3DY7A 3UMXA 4UEUA 5EOBA 5AUWA 4FTOA 2YZLA 2UVZA 4JRVA 4IDVA 1ND4A 5FTOA 3PXQA 5CEPA 3IG7A 4FSTA 1FGKA 1YI4A 3UIXA 4D9UA 4D0XA 3G2FA 4RFZA 2CJMA 3FI2A 3K5VA 3NUSA 2IW6A 4EK5A 3UC3A 1IR3A 3NAYA 2OO8X 3I79A 3OS3A 4XG6A 2CNUA 5K0XA 3HAMA 3CQEA 3G6GA 4ACMA 4OUCA 5C4LA 2YACA 3GU6A 4IX3A 3AC3A 3KXGA 2PUUA 3C13A 3BE2A 1QL6A 3PE1A 2IPXA 3JS2A 1J7IA 5BMSA 3WZDA 3VIDA 4EYMA 2YLEA 4RIWA 4E4NA 3DFCB 3UPXA 4YJVA 3KU2A 3NCGA 1JQHA 3BQCA 1F0QA 4OTDA 4PDPA 4GJ3A 5E92A 5LJJA 5CU6A 2WO6A 3RNIA 3DTCA 3POZA 5DT3A 3K5UA 3AC2A 4FL1A 4X3FB 2BDJA 4WBBB 4FTKA 4X2FA 4N0SA 5HNIX 3UDBA 2KTYA 1PXPA 3M11A 5IZFA 5DIAA 2C4GA 1WBTA 3RPRA 2YM5A 5CU3A 3UIUA 2BALA 1YDTE 4U3ZA 3TUCA 4BCGA 4P7EA 2W06A 3QU0A 4D2TA 4QQCA 2GTMA 5CT7A 4BYIA 3MESA 5IQDA 3HMMA 5FD2A 3FXXA 4K8AA 4RWKA 5KE0A 1P4FA 2XB7A 2G2FA 3RAKA 2HZ4A 3DBDA 2NPQA 4J97A 4YJOA 5CEQA 4AGDA 4RZVA 2WOUA 1R1WA 2ITPA 4G3GA 4I94A 2W1CA 5AX9A 3ROYA 3OW3A 4WSQA 4D9TA 4DITA 4F7NA 4I92A 3IS5A 3HUCA 3EQPA 3V04A 3KULA 4IZ5A 1YOMA 4MAOA 4O2PA 4D5HA 1ZMVA 4Z16A 2QR7A 1YW2A 1GOLA 2VTLA 3KXHA 4MWHA 5KZ0A 2C1AA 1MP8A 2BTRA 3HMIA 3UG2A 5CSPA 3DJ6A 5AA8A 3N9XA 4CQGA 4G5PA 3E8DA 5JFXA 2BHHA 5HCXA 3KMUA 1XWSA 4C02A 4QPMA 4CD0A 4GEOA 2W7XA 4ZY6A 2XNMA 2JFLA 5KCVA 4B0GA 5LWNA 1YQJA 3LJ0A 5JFWA 2OICA 1YXUA 1W84A 4QD6A 5HE3A 4OT6A 4JVGA 4RFMA 2X9FA 4OW8A 5I0BA 3PE2A 2B9FA 1LPUA 3QA8A 4YBKA 4F0GA 4KBCA 3RPYA 4CFVA 3DKOA 5T3QA 5I4NA 2J0KA 5L2IA 2RF9A 3KY2A 3PIYA 4DLIA 2P55A 4DT8A 4QQ5A 4D4RA 4XCUA 1WFCA 4F9AA 5CU0A 3TEIA 5IDNA 3UQGA 3RKBA 3A8WA 4UV0A 4AA5A 5AAGA 3DJ5A 3POOA 1Y57A 3Q5IA 2ZYBA 1IAHA 1MQBA 3PIXA 1NVQA 3DLZA 4MEDA 3DKGA 1ZWSA 3W18A 3WILA 4RX8A 1CKPA 3ZUTA 1AD5A 2BUJA 2DWBA 3DB6A 3SLSA 3FQSA 3FLWA 4GT3A 3SHEA 2F9GA 3BEAA 5FEEA 5AAFA 2ITOA 3DB8A 4DEGA 4YHTA 4C4JA 3ORMA 4KAOA 3LFNA 4GU6A 4G17A 4O0WA 3FMLA 4PPAA 1IG1A 4M66A 5GNKA 5AM7A 4F64A 4ZMEA 2OFVA 3FZOA 3UYSA 4NIFA 1YXTA 3QHWA 4LYNA 3Q52A 4BDCA 4JJRA 4H1MA 5AUYA 5AV4A 3ORKA 2PU8A 1W83A 5AV0A 4LV5A 2EUFB 3EH9A 4P5ZA 4YLKA 1IA9A 1BYGA 1LEWA 1ZYDA 5E8YA 3WZEA 3PLAE 4JAJA 4AE9A 2C30A 2HZ0A 2F7EE 3MGYA 4H3QA 3ATSA 5F1ZA 3D5WA 4IE9A 5EM7A 5J7HA 4ORKA 1GIIA 3MIAA 2OIDA 1KOBA 5C27A 3ZH8A 3F66A 1J7UA 4QTAA 2Q0NA 1IAJA 2PMLX 2X8IA 4FVQA 4OTHA 1OIRA 3K54A 4FODA 3W8QA 4U3YA 4DGOA 5JQ5A 3C4ZA 4ZOGA 5E1EA 3E7OA 3DQWA 3FYJX 3P08A 5KKRC 1A06A 5E7RA 5CLPA 3JYAA 2VV9A 4RA4A 2ZV9A 3U9NA 4YBJA 5I5ZA 3PWDA 3NAXA 4TWPA 5HE2A 3EWHA 2WPAA 4AGUA 4DEAA 4UWBA 3RWQA 2XCHA 1UV5A 4X2JA 4TZRA 4M0ZA 3DPKA 3ENMA 4C0TA 3B2TA 4FIGA 3IW8A 5HU3A 2B53A 4PRJA 1I09A 4M97A 2P4IA 3R7IA 3MN3A 4QTBA 2OG8A 4EC9A 4EH9A 5ITAA 3LMHA 2A4LA 3DDPA 3QYZA 4O1PA 3ZO2A 5HG5A 3GXLA 3A4PA 2ITWA 4HCUA 1T46A 3U87A 3VULA 4MXZA 3TIYA 4JDKA 5B2MA 5CS6A 2X2LA 2W1EA 3ZLYA 5A4QA 1OL7A 1W8CA 2HXLA 2YAAA 5D12A 1LUFA 2YCFA 3RI1A 5CU4A 1FMKA 4GFMA 3ET7A 3Q6WA 5A54A 4NTSA 4FKJA 5A4EA 1U5RA 4WNOA 5DBXA 1KE9A 4O84A 4QMYA 4IWQA 1QMZA 3F5PA 2R3NA 4EJNA 4BKJA 4PMMA 3E88A 3P86A 4MD7E 3E64A 5F9EA 3IONA 4GJ2A 4O7ZA 2PUPA 4I20A 3UTOA 3ZUUA 3SVVA 4PPCA 3DJ7A 4OLIA 2YM7A 3PVGA 4I3ZA 2XVDA 2BFXA 1O6KA 3JR1A 2OXDA 3GQIA 5DFPA 4FTUA 1PW2A 3DTWA 5CZIA 3TZ9A 4EQUA 4ZLYA 5GZAA 3NMUF 3CJFA 2JKKA 3OCGA 3I4BA 3FMEA 1KE7A 2J0IA 3BCEA 3DBEA 4FOCA 4CRLA 2XK7A 3QQHA 1H24A 1QPDA 4TYGA 4HVHA 5JGDA 3PRFA 4H39A 3QQGA 3CP9A 3H30A 4CG9A 4FNZA 4ZSGA 4FZ7A 2XNEA 3WZJA 3COHA 4PTCA 3NVKI 3OD6X 4BWPA 3AC1A 3L9LA 1W7HA 2VO3A 5EW9A 2XIZA 2GNJA 4ANMA 4QP6A 4GVJA 1H07A 2ITUA 4WOVA 4XV3A 3GC0A 4DF3A 5HVJA 4JG6A 4I4FA 5ANDA 2Z60A 4O27B 3NCZA 2ERZE 1ERKA 5F20A 3BGPA 5E90A 3R1SA 5AX3A 4A9UA 4USFA 2R9SA 3QRTA 4O38A 5K4JA 3BU5A 4YZBA 4RWJA 4IDTA 2YWVA 4O7RA 4R6VA 4PDSA 5CXHA 3EQDA 5LARA 4HW7A 2Y8OA 3SX9A 2W1DA 4K0YA 4EWHA 4M13A 2Y0AA 4BGHA 5EI6A 3RZFA 4D2PA 3ATTA 3TNPC 4CYIA 4XV1A 4W4VA 2ZV8A 2W1IA 4BDDA 3OBGA 4H36A 4WHZA 3FZ1A 1H4LA 4WBOA 5AJQA 4E1ZA 3BYMA 1PRYA 1QPJA 4HYSA 4V05A 3UPZA 4LI5A 3BI6A 3UZPA 3QBNA 4KB8A 1PXMA 3VBWA 4CFXA 4LOOA 4FKVA 4ZTLA 1Y8GA 5IPJA 4RRVA 5AADA 5E8XA 3A7IA 4IX5A 2OZOA 4BDIA 3PG3A 3GOPA 3R9NA 1YWNA 2C0TA 4CV8A 3DXPA 2W17A 3VS1A 3LXNA 3F3WA 4F63A 3FJQE 5HTBA 3CTHA 4LL5A 4RIXA 4ID7A 4MXOA 1JPAA 2G15A 2JIIA 1GNGA 1OL5A 1SVHA 3C9WA 2XEZA 4FKLA 2IW8A 2Z8CA 3HUBA 4GKHA 2PZRA 4ANNA 1PKGA 3O8PA 5LMKA 5KNJA 4FKOA 4HGEA 4WNPA 2GNLA 2WOTA 4RWLA 5IU2A 4KSPA 2OF2A 5JGAA 2YM8A 2OH4A 2CN8A 5M09A 4EZ3A 2X7FA 2Y4PA 3QTWA 4GRBA 2BDWA 5IKWA 4PNKA 1Z5MA 5LCKA 3IPHA 3OXZA 3UO6A 4F65A 3VUIA 3TKIA 3ZSGA 4IC8A 3C0IA 2UZOA 3A8XA 2R3RA 4D2WA 4BCKA 5DHJA 4FGRA 4TYHB 3S4QA 4QYGA 3FPQA 2X39A 3ROCA 2VX3A 4O0VA 5BYLA 2GPHA 2WTIA 3PXZA 2JDOA 4GIHA 4PNIA 2JIVA 3PJ3A 1ZYCA 2DQ7X 3VRZA 3JUHA 3WF9A 4BBMA 5AP7A 2QG7A 3MA3A 3EYHA 3UYTA 4RVMA 3UNZA 5AUZA 2XKCA 4AGCA 5CALA 3DK7A 2E9VA 4LRMA 3IGOA 2C3IB 1K9AA 2V5QA 4XHKB 4BIBA 1MRUA 3CD3A 2PVRA 1RDQE 3SV0A 3NUPA 3U8WA 4HVSA 3QTZA 3GCSA 3PLSA 4PWNA 4XMOA 4FTIA 3ZBXA 2ITXA 4FKSA 4XS2A 4WRGA 3DAKA 4LFIA 3HDNA 1H1RA 4FSNA 3IDCA 4AW5A 3PSBA 5J9LA 2HY0A 4EHGA 4GG5A 1YOLA 4F08A 3MY1A 4YUQA 4XBRA 4C4HA 3VS6A 5LVOA 3KXXA 1MQ4A 3QWJA 4K77A 1GJOA 4EH8A 2O2UA 3LQ3A 1KE8A 3UC4A 4O0RA 4ZEGA 4Z9LA 5AP1A 3OWKA 4IXPA 3QHRA 4XV9A 4C57A 4FYNA 4O82A 1U5QA 4FUXA 4F1MA 1WCCA 2C3LA 4G3EA 4PV0A 4DGNA 2GNFA 4FKRA 4BZNA 3LCDA 5IG1A 4BR3A 5HLNA 2WMVA 1H1QA 4PTGA 1UKIA 4AT4A 2WQNA 5FG8A 1OL6A 2OLCA 4FIEA 1DI8A 5ETCA 2UZVA 2R3KA 4DFYA 2PYWA 4GT4A 4GK4A 1H1WA 4QQTA 4EOLA 1GZNA 5HU9A 4AU8A 4UYNA 4JOAA 3CCNA 3FMKA 4FICA 5BMMA 1BL7A 4IAIA 3EZVA 3TTIA 2QI8A 2PULA 2JD5A 2W5BA 4W8EA 4ZJIA 5HLPA 4JXFA 5I9UA 3ZSIA 4QP7A 3PY3A 5IA0A 2XNPA 5KBQA 3EYGA 4YGAA 5JN2A 4OTWA 5L8LA 3UIBA 3DQXA 2RFNA 5E8TA 5IUHA 2IVVA 5BVFA 2JAMA 2GDOA 1HOWA 4X2GA 2CNVA 4XLVA 5CAVA 3EQRA 4EUTA 3C5IA 4KIOA 4PP9A 2QOBA 1CKIA 4KA3A 3F7WA 1Q8YA 1B6CB 4I6BA 3NDMA 5L6OA 4FZFB 3CE3A 3G6HA 4C59A 4DTAA 4CXAA 5EYDA 1J7LA 4C36A 3A7GA 3WIGA 3I7BA 2BKZA 1BI7A 2I0EA 2X6EA 1O6LA 2XRWA 2Y6MA 3KRLA 3F88A 3A7JA 3FAAA 5DR9A 1NW1A 4RJ3A 3COKA 3I81A 4W4YA 4BC6A 1H27A 2W1GA 4E93A 3SG8A 2OW3A 2ZB0A 3QTSA 3PVUA 4FG9A 4L7FA 2J50A 3BX5A 2BZHB 4AACA 1FBNA 1KOAA 4L45A 2E9OA 4DBNA 3E3BX 2GTNA 2Y4IB 4L53A 2VTAA 3ANQA 5KX8A 4FSYA 1YRPA 2WTVA 3DXQA 4O7SA 3OC1A 3PPZA 4ZTHA 3F5XA 5AP5A 4E7WA 3NNUA 3V5TA 2OXXA 1MRYA 2EB3A 4B99A 4C61A 5CEKA 3EN7A 3QALE 3O71A 5CQWA 4L3LA 4E5BA 2PVNA 2VO7A 3QCYA 3QKKA 1XH4A 3R22A 3VS5A 3O0GA 3C0HA 3R30A 5E4HA 5B2LA 3CGOA 4JRNA 5LXMA 3IECA 1PMUA 2GMXA 2VNWA 1A48A 2EWAA 4S34A 3Q4CA 3I1AA 2YHVA 2QHMA 4MQ2A 1V0OA 5FDXA 1ZZ2A 1FVVA 5HG7A 4UN0C 3V51A 2XNOA 5H8GA 3LLTA 2OKRA 4XYFA 4FV9A 5FUTA 3G51A 4YZMA 3IOKA 5FGKA 3NIZA 4QMMA 5IA3A 3RPSA 3S00A 2OK1A 2C5VA 2HOGA 1MUOA 2C68A 4ZJJA 1G3NA 2X7GA 3O23A 4KKHA 4CFFA 4QRCA 5JZNA 3S95A 3AOXA 5LVPA 5IQFA 2YERA 3FMDA 4FVPA 4NTTA 3UBDA 5DE2A 4BCHA 4EOSA 2OJGA 2WTKC 3LIJA 3P7AA 1E1VA 2PY3A 4TY1A 3V8WA 5KMKA 5KZIA 4CYJA 4NJ3A 4UBAA 2RG6A 5FBOA 4WD5A 5EK7A 4EORA 5BVDA 2UW4A 2VGPA 4UZDA 3MTFA 4C33A 4AW0A 4N57A 1OBGA 3FBVA 2X1NA 1FVRA 4HYUA 4IZYA 4BN1A 4EUUA 5DGZA 4FC0A 5I9ZA 1JKTA 4NKAA 5CZHA 3ORTA 5A4LA 3KA0A 1Q8WA 4ANOA 2UW7A 4ZSLA 2HZIA 3MS9A 4GKIA 3S2PA 4F4PA 4GK2A 3MH1A 4IZAA 1PXNA 4X6RA 4BVUA 3PA3A 4HVIA 1OKVA 2GQSA 1E1XA 3VJOA 4MNEB 4I5HA 3VUTA 3QZHA 3FYKX 1M2PA 1UU7A 3HV4A 1R3CA 4KIQA 4GS6A 3B8RA 2XK6A 2CNQA 5DEYA 3QCXA 2PUIA 4FKWA 2H96A 5EKNA 4JDJA 4KIKA 2XK4A 3QD4A 2BMCA 5HQ0A 1YOJA 2R7BA 5DA3A 3EOCA 4MF1A 4OGRA 4HCTA 5B0XA 2J2IB 4FI1A 3DS6A 3C1XA 4IFCA 5A3XA 3ZMMA 5CQUA 4JX7A 5EOLA 3CLYA 3GVUA 4C4GA 1K3AA 2NP8A 2C1BA 5EHOA 4O2ZA 5BUIA 3AD5A 3ALOA 4I0SA 3VBQA 3F9NA 2EB2A 2FYSA 2OF4A 4CCUA 2H8HA 2ITQA 3NW5A 3SRVB 4QMNA 5HORA 2R3HA 4PTEA 2WELA 5LMKC 4YC8A 4E4MA 1ZY4A 2JBOA 3ULIA 3MFTA 2W9FB 2XA4A 2ITTA 4FTCA 5AIRA 4FZDB 2GS7A 2P2HA 4D4SA 3VW8A 3OT3A 1H25A 3LJ1A 3KULB 4EZ5A 3GGFA 4RJ8A 1XH8A 4GYGA 4NT4A 4CNHA 3FDNA 3CBLA 4CZTA 5CASA 3KK8A 4YJQA 3REPA 1WBOA 4CTCA 3KK9A 4BHZA 1U54A 4MD9E 4GW8A 3QFVA 5AAEA 3EN9A 5CAUA 5LOHA 2BROA 5AR3A 5A6OA 2AC3A 3HL7A
chains in the Genus database with same CATH superfamily
4K6ZA 3CJGA 3E87A 3MH2A 2PVYA 3H4JA 3UP7A 5EM5A 3ZYAA 3FZSA 4BYJA 1REJA 4X2NA 3DGKA 2R64A 3VS3A 4CTBA 3L8XA 1PXOA 4IH8A 4UALA 3P9JA 3QD2B 3OG7A 3EL8A 4UWYA 2JDVA 3ZTXA 4I23A 4E26A 4BDBA 3LFCA 5CY3A 5E8WA 3KRXA 4O0YA 4EH7A 4JT3A 1VYWA 4GMYA 4E6QA 5GIPE 5A14A 5JSMA 3GNIB 3PA4A 4U43A 5DT0A 3RGFA 5HTIA 4L42A 3HKOA 5AUVA 2XK8A 4UXQA 4V0GA 5I9XA 4DFLA 3G0FA 2QO2A 1M14A 4AQCA 4ANSA 1WBPA 3C51A 4FEUA 4RX5A 3BLQA 4R7HA 2UW9A 4O96A 4QP3A 4KINA 1P5EA 2ZOQA 2NO3A 4NM3A 5JK3A 3KEXA 4FV8A 1XBBA 4KKGA 3JVSA 4JDIA 4DYMA 4DHZA 3FZRA 4I6FA 4L00A 3T9IA 4XEYA 4G16A 4BCMA 5A9UA 1ZAOA 5L2TA 5ANGA 5JH6A 4AZVA 2Q83A 4JG8A 2C47A 2PVJA 2YCQA 4M69B 4RJ7A 3IGGA 2WXVA 3ZRKA 5AV3A 3HV6A 2G2HA 3FZPA 4E20A 1RW8A 4G6NA 2BTSA 3W0RA 2JKMA 4E4XA 2W1FA 2HXQA 1OUYA 3HAVA 3OTVA 3SXRA 1QPCA 4E3CA 3TG1A 5M55A 2JDSA 2VWUA 3AC4A 3MBLA 4FSUA 4HGTA 5FTQA 3ZZWA 4TTHB 2WMRA 3OWLA 3O7LD 1H08A 4EH6A 3EN6A 2FSLX 2VTHA 4DHIB 2R3MA 3JPVA 2PHKA 5IQEA 4EI4A 3I0OA 1Q4LA 4XJ0A 3WI6A 3GBZA 4O4FA 4FV6A 3OUKA 4MWIA 3MB6A 2XIRA 4RIYA 3UDZA 4Q9SA 5CF6A 4O1OA 3VBYA 3KMWA 4QMWA 4KUJA 3RJCA 2PE2A 4FV1A 4FV5A 3IDPA 3GU5A 1XMMA 4XG8A 5DR2A 3CKXA 3F3VA 4KKEA 4Y72A 5DWRA 1BKXA 2R0IA 3HP2A 3PJ1A 1YI6A 4J8MA 4MTAA 3KC3A 3QF9A 3V5JA 3HNGA 3KF7A 4MXAA 4FNXA 3NUXA 4EBWA 4FTNA 4EQMA 3TTJA 2PVFA 3HYHA 5C8NA 2P0CA 4L43A 1WBVA 1XHAA 4DG3E 4AF3A 3LJ2A 5GZ8A 4J7BA 4C4EA 3R71A 2I6LA 4DBXA 4EK3A 5CWZA 5DI1A 2G2IA 4G3DA 3NUNA 4BDJA 3QKMA 5KMOA 1KUTA 4GVAA 2QOLA 3N4UA 1FMOE 3W2QA 3O5AA 1OKWA 2ESMA 4U81A 3OCBA 3C4FA 4KS8A 3A60A 4ZZNA 4KBKA 5ANJA 2LAVA 4RWIA 4U7ZA 3BYOA 3HV5A 3MI9A 3ZO1A 1VYZA 4E6DA 1E9HA 2OGVA 1RJBA 2B4SB 3KGAA 3FY0A 4NSTA 4AN9A 4WA9A 3P1AA 4CZYB 3PUFC 2YDKA 3FY2A 5HIDA 4DH8A 4ZZOA 4XLIA 3KIOC 5M57A 4FG8A 3IW5A 3GENA 4I41A 4QP4A 2PPQA 2HWPA 1NA7A 4YJPA 3TM0A 3NX8A 2XK9A 4HCVA 4IWDA 4BCPA 3TDVA 4TWOA 5CSWA 1L3RE 2QOQA 4RLLA 2P2IA 2UW6A 3EN5A 4U41A 3BYSA 3BHUA 5K9IA 2OZAB 4Y5HA 1JAMA 2BRMA 4C3FA 4UY9A 4BWKA 5ACKA 4QP2A 5KO1A 5EYMA 4JQ8A 3BLRA 3QX2A 4GSBA 2PE0A 4YJNA 2R3OA 4DH7A 4A06A 3HRBA 5K3YA 3F2NA 3QRIA 5L6PA 3GB2A 4E5AX 2ACXA 2HELA 4ZTSA 3RPOA 4GIIA 3GCQA 2BRBA 2QNJA 3W8LA 5I9YA 2G1TA 2WTKB 4MH7A 5H2UA 3TJCA 5CEMA 1JLUE 1LP4A 2H6DA 3PFQA 4HVDA 2JKOA 1CTPE 3RTPA 5AUXA 2W05A 3KKVA 2GNIA 3GCPA 3VAPA 1JBPE 4O4DA 3EIDA 4D2RA 3D7TB 3HLLA 5FXSA 3NIEA 5FP6A 1XMLA 4PDYA 3SG9A 3AKLA 3O7LB 2IW9A 3VS2A 5LCJA 2V7AA 4HZSA 5AEPA 1O9UA 1KE5A 3OF0A 5IA1A 1XH5A 2BRHA 5M4CA 4HYIA 2Z7SA 5FXRA 3ACKA 4RVLA 3TV4A 3QWKA 4EONA 4QOXA 1BI8A 1KE6A 3VS0A 4JIKA 5HBEA 1P2AA 4Q2AA 4IIRA 3FPMA 3RNYA 2Z7RA 1DS5A 3PA5A 1ZOGA 2C3KA 2VU3A 2PL0A 3ZFYA 4BCNA 4CQEA 3R28A 3W33A 1FINA 4EOKA 1XO2B 2YM4A 3NSZA 2X6DA 2QU5A 3UG1A 4IB0A 2J0JA 4NZWB 2JITA 2R3QA 2W1HA 4ZLOA 1M7QA 3BYUA 3I0QA 4PY1A 3TN8A 4CKRA 2VTMA 1DM2A 4WG3A 2VTPA 3HV7A 4J99A 3THBA 4IQ6A 4BBFA 1U59A 1NVSA 5TF9A 3WZKA 4H05A 2GQRA 3BV2A 1SVGA 1GZKA 4M14A 4N6YA 2OU7A 5C1QB 2B55A 3DDQA 3W2SA 3R01A 4G1WA 3QUDA 2ZM3A 3NYNA 1SYKA 4FRFA 4RJ6A 5EKOA 2I0HA 4ACDA 4A9RA 3TJDA 3GQLA 4DCEA 1X8BA 3WF8A 5L8KA 5JZJA 4ZTRA 5F4NA 3NLBA 2GHLA 3QRJA 4RA5A 3H0YA 2EVAA 3V5QA 4HOKA 2C5XA 4KRCA 2WMBA 3Q2JA 4DEIA 3T8OA 4NK9A 2XRUA 3ULZA 3QD0A 2SRCA 3BV3A 3BWFA 4G6LA 1APME 4LUEA 5FQDC 4IM0A 4A7CA 4ENXA 3PG1A 4ENYA 4DC2A 4RX9A 4IB1A 3DAJA 4EOQA 5A6NA 4F0IA 3D2KA 3OTUA 2YWPA 2ZM1A 3LHJA 4BCOA 1UVRA 4DFXE 5CAOA 4UXLA 2YEXA 3U4UA 4D2VA 3T3VA 5FTGA 4RPVA 4ZS0A 3ZU7A 4BDGA 2XBJA 4QMVA 4RQVA 5E1SA 3UOJA 3PTGA 4BJJA 3H10A 4TT7A 3PUPA 5FWKK 3R8VA 3FKLA 3TT0A 3D5UA 4NFMA 4USDA 2B7AA 1SVEA 3UOHA 4F7SA 5BNJA 4MBJA 2HIWA 4QTDA 3E92A 4AW1A 4DEBA 4Z55A 5M4IA 4DFUA 3JVRA 2F7ZE 1PXJA 2G01A 2IN6A 3PPKA 4O91A 4QMSA 5FEQA 3R8ZA 2R0UA 3CTQA 5HD4A 3CTJA 2R2PA 2W4KA 3LZBA 1YDSE 2J4ZA 2OJ9A 3L9PA 1PYEA 4M15A 4G3CA 4M0YA 3W55A 4IAFA 2YM6A 2YDIA 2YM3A 3EQIA 2PMOX 3OZ6A 2ZMDA 4X3FA 5IQBA 3FC2A 4BCJA 5G1XA 4C7TA 3VBTA 5A46A 3UZRA 2HWOA 3NZ0A 4IM3A 5CF5A 4FV7A 4IVCA 3TNWA 3UP2A 4FKIA 4NFNA 4LOPA 1JVPP 2HW7A 5EHLA 3TWJA 2LGCA 4X6QC 2W4OA 4U45A 4BF2A 5TT7A 3NYVA 5IQGA 3EQHA 3VQHA 3M42A 4AFJA 4U9AA 3LMGA 1IA8A 2XNNA 5EHYA 4C3PA 5IQAA 2X0GA 2AEGA 2YJSA 2XF0A 3V01A 3O8TA 3FV8A 3WE8A 4QP1A 4WT6A 3G9LX 3PSDA 3LPBA 2X4ZA 3T3UA 3OWPA 2P33A 4OTRA 2Y7JA 3QGWA 4AZSA 3CGFA 3VUDA 1Y8YA 4WUNA 1R0PA 5J95A 4BTKA 5JGBA 1WVYA 2XP2A 5EYKA 4DG0E 2C5YA 4FSZA 4ANLA 4BWXA 4FUYA 2IEWA 4JI9A 2HY81 3HVCA 4XOZA 4YU2A 1ST4A 3TDWA 2W1ZA 3TZ7A 3ID6C 3ACJA 4ANQA 4OAUC 3MIYA 2QVSE 4FTTA 3ZONA 4S2ZA 1M17A 4ZTQA 3BE9A 2I1MA 5KMNA 2YDJA 2CMWA 3BQRA 3COIA 5M53A 2WB8A 3HGKA 1PXLA 3R7VA 3VUKA 4BIEA 5IH6A 4CG8A 3BU3A 4RVKA 4IEBA 2X81A 4QMOA 1OVEA 2W96B 3RCJA 4A4LA 3JY9A 5J9ZA 2CKQA 3FMMA 3ZUVA 5TOZA 5HI2A 1G8AA 2PVLA 1PYXA 1NVRA 4TL0A 5HX6A 3E93A 1OUKA 3IOPA 2GHMA 3O2MA 4OBPA 1WBNA 3G9NA 4O7YA 3MY0A 2DUVA 2VD5A 1IEPA 4PMTA 4X21A 3LLAA 2BILB 2JKQA 3A61A 2VTNA 4FKTA 4OTQA 4FNYA 2V55A 3R8MA 3FHIA 4GV1A 2BAJA 2RGPA 1BUHA 3U6HA 3BGQA 4ZAUA 3BHTA 3SXSA 3ZC5A 4BGQA 1Q8UA 3GFWA 3V6SA 1PHKA 4QMPA 5M4UA 2CLXA 2AUHA 4NCTA 4F1TA 2WMAA 5FM2A 4TKSA 4APPA 3LXPA 3WF5A 5LMBA 1ZRZA 4J96A 4XG7A 3BYVA 5J5SA 3D14A 3MW1A 4ZXTA 4EOJA 5CF4A 4W8DA 3GU4A 2VTIA 1YKRA 1VJYA 4QYEA 4AT5A 4FT0A 3LCTA 1PY5A 4CV9A 2QODA 4FOBA 3P7CA 4JR3A 4BCQA 3EFLA 3E7VA 3OUNB 4OTGA 3SW4A 3Q32A 4BTMA 2J5FA 3WIKA 3ALNA 3AD6A 3IW7A 4PMPA 1F3MC 4O81A 2GS6A 2XNBA 5BQ0A 2JEDA 5FLFA 4BDHA 2BIKB 2YIWA 4FV2A 3IKAA 3SAYA 3PY0A 3AQVA 3FQHA 1YHWA 2GCDA 1B38A 2QHNA 1NY3A 2BVAA 3OY1A 4TWNA 4XG4A 5AIKA 3QLFA 3QQFA 4MNFA 4FTAA 5AWMA 1W2CA 2F2CB 3OXIA 4FR4A 4QO9A 2R4BA 3B8QA 1H28A 3EJ1A 2OBJA 4LQMA 4F0FA 4QYYA 5LVMA 1OPLA 3VQUA 3KRRA 3QL8A 1ATPE 4MXCA 3DU8A 3QQJA 1JSVA 2DYLA 5H8BA 4DH1A 2C6MA 4O21A 4A9TA 3LMIA 4LGHA 3KXMA 2X0PA 5BVEA 3GFEA 4K1BA 4XV2A 2QD9A 3M1SA 1H0VA 2CN5A 3SKCA 1CMKE 2IZSA 3BRBA 2B1PA 2J51A 5CVGA 4R5SA 3NNXA 1WBWA 3H9OA 2WTCA 2IZTA 3HMOA 5HO8A 4ACCA 3AGMA 4O6LA 4D1ZA 2ZDUA 2WTWA 2BIYA 4C2WA 4J52A 4IJ9A 4BDKA 2QC6A 5ICPA 4ASXA 4KBAA 1BMKA 5K5NA 3R9OA 3ZDUA 3ORIA 5DOSA 3SA0A 3ZO3A 2KULA 5EDQA 2FH9A 3QRKA 1P14A 2VTQA 4DN5A 2OJIA 5HESA 5J87A 4UWCA 4L01A 2UW5A 2A19B 4J8NA 4AX8A 2CCHA 4USEA 4E4LA 2UW8A 3BHHA 3MVJA 3F2RA 4XRLA 3ZCLA 2O64A 3ZRLA 4O7LA 4I5PA 3UO4A 4AWIA 4FE2A 5EQPA 5C8KA 2WTDA 1OZ1A 2OI4X 3LCSA 2FSOX 5AA9A 3ZHPC 2IJMA 2JDRA 3PP0A 2BHEA 3PJ8A 2ZAZA 3FL5A 5JEBA 3PDTA 1Y6BA 3ODZX 4YZDA 4L8MA 4LDTA 3NYXA 2YCSA 2XK3A 5F95A 2WMUA 3NPCA 1WAKA 5HVKA 2R3JA 4CT1A 3HEGA 3HRCA 3PZHA 3EL7A 2W9ZB 5AP0A 5HE1A 3D5VA 4X7QA 4LGGA 3MWUA 5KKRB 2C0OA 2CDZA 1JWHA 4TWCA 4R8QA 3DKCA 1QCFA 4GFGA 3MJ1A 4LGDA 4ONAA 1NXKA 4QPSA 5EM8A 4EBVA 4KWPA 4QPAA 4LV8A 3GCVA 3UVRA 4C4FA 3U4WA 4QP9A 3W2CA 4RGJA 3S1HA 5A4TA 4BDEA 4EOMA 4FL3A 2ETKA 3LQ5A 4TPTA 1J1BA 4DGMA 2UZBA 4I93A 4D1SA 4YMJA 1IASA 2UW0A 2GNGA 1QPEA 5E8UA 4I21A 3VC4A 2VTTA 3LAUA 3LCKA 3KRJA 3RP9A 4DT9A 1REKA 3RHKA 2VGOA 2IWIA 2ONLA 5FP5A 3OW4A 3R2YA 2ITYA 1YHSA 2OSCA 3SQQA 3ITZA 4GK3A 4OTIA 2EU9A 2C6TA 4TN6A 1XQZA 2RSVA 3FLNC 3TIZA 2PZ5A 3R63A 3FI8A 3R7YA 1WVWA 4IAKA 4ASEA 3L8VA 4AN3A 2BAKA 3V8SA 4BI0A 5HO7A 4FSRA 3FSKA 3GC9A 4O0XA 3BEGA 2E9NA 3O51A 5EQEA 4A9YA 1ZLTA 4FL2A 4G9RA 4MXXA 2ZM4A 1IRKA 3Q3BA 4XH6A 2BKKA 4TW9A 1G8JA 5CEIA 3RM7A 3MPAA 4GUBA 3E8EA 4AZFA 4AXEA 3KXZA 2X2MA 3F3TA 4JG7A 3UGCA 3WE4A 3U6JA 5HBJA 4FV4A 4X3JA 4EH4A 1VEBA 2J0MB 1ZXEA 3BGZA 4YPSA 5H8EA 5D1JA 3TZ8A 3QXOA 4CFMA 4QYFA 4FT7A 4X3FC 4CSVA 2FSMX 3GU7A 4C2VA 5GIOE 3DAEA 5DR6A 5FBNC 5LQFA 3HA6A 4RVTA 3W0PA 2GFCA 2CHLA 2IVTA 4EJ7A 4YJSA 3VF8A 5IUGA 3DZQA 3EFWA 4ASZA 4N6ZA 3Q9ZA 3EZRA 4HPTE 1S9IA 3QCQA 3R1NA 5DT4A 4II5A 4BRXA 2X9EA 2BDFA 3ZOSA 4CMTA 5HX8A 2E2BA 4AN2A 2QCSA 3MH0A 2GQGA 3VO3A 4L44A 3C7QA 4TYHA 4FEVA 1TQPA 4YO6A 3DKFA 4MBLA 4R77A 1PMVA 4X2KA 4ALVA 3H9FA 2WIHA 3AT2A 5JKGA 3QZGA 3PXRA 4NM5A 2JAVA 2I0YA 3LFQA 5HOAA 2CKOA 3F69A 1HCKA 3V6RA 4FTRA 4EQCA 5I3RA 2PZYA 2H34A 3I7CA 2ZJWA 3I6UA 5JRSA 4B6LA 3EHAA 2J90A 1HCLA 2VWXA 5HZNA 2ZFYA 2C6LA 3FUPA 2PTKA 3DOGA 5J5TA 4AZEA 3UQCA 4RBLA 3ZLSA 5IQIA 2V7OA 1OI9A 1V1KA 3DNEA 3W2RA 4WNMA 1BL6A 2Z2WA 4O7NA 2VNYA 1S9JA 4C62A 4AW2A 4EHEA 3UNJA 1YDRE 1CKJA 4BY9E 3IQ7A 2QR8A 4PP7A 4G31A 2RG5A 5E8ZA 2X2KA 5T6KA 5A4CA 2UV2A 4Q5EA 3R8UA 2RFSA 4JIAA 3VUHA 3QCSA 1OECA 3VJNA 4RIWB 2UVYA 2WQEA 3QUPA 2JLDA 4O22A 4TYEA 5JT2A 4F9CA 1TQIA 5B2KA 5LVLA 3PWYA 5HHWA 2R7IA 2UZTA 2VN9A 5BYZA 2UVXA 1ZMUA 3I5ZA 4JQ7A 3ZM9A 5H9BA 4PL5A 4ALWA 4IWOA 3MV5A 4UZHA 4KS7A 3MFRA 4QMLA 4KD1A 4B4LA 4U44A 5CSVA 1M7NA 4NCTC 4YURA 4FV0A 5IEXA 5CEOA 5FM3A 4IAAA 1FPUA 1DAWA 4AXFA 1YXXA 4CFUA 4QDVA 5GHVA 4M67A 3CD8A 5ANKA 2FSTX 4YTIA 4EOPA 3ERKA 4FGBA 2H9VA 3EB0A 4M68A 4QQJA 5D11A 4HJOA 3VW6A 3E62A 3QTRA 3KMMA 5HCZA 5JFSA 2C3JA 3C4WA 2PZIA 4AXAA 4IB3A 2B9HA 1GZ8A 1KSWA 2VUWA 4HGLA 3ORNA 4PL4A 5HGIA 2QKRA 2VWWA 1G8KA 2XIYA 3F2AA 3ZM4A 4MXYA 4NW5A 5JRQA 4ZS4A 2QQ7A 5DNRA 4CZUA 3FWQA 3OOGA 4W9XA 2XAOA 4FSQA 1ZMWA 4AE6A 3CEKA 5L2SA 4IACA 2YJRA 4CFWA 2CPKE 4GL9A 5IH4A 5E9EA 3BBWA 4G2FA 3ZC6A 2A0CX 2CGVA 3LQ8A 1EH4A 3WARA 4U8ZA 3QC9A 5C01A 2X4FA 1OKZA 3TMOA 5G6VA 4JBVA 3TUBA 1T45A 1UKHA 1W2FA 4M8TA 5ACBC 3TI1A 4YTCA 3DBQA 4X0MA 4OBOA 1Q24A 2B54A 5BUJA 4R7IA 1PF8A 2R3IA 3L9MA 1JNKA 3EQFA 5HKMA 3FXZA 4DFNA 4IX4A 4LOQA 4EHVA 2XM9A 3KVWA 2W99B 4FK6A 4IJPA 4ZK5A 4L52A 2WZJA 4NW6A 5DG5A 3ZZEA 4FF8A 4ZY4A 3TZMA 4DH3A 5K5XA 4FSMA 2VTOA 5KUPA 2J7TA 3Q9XA 4U79A 5DN3A 5J8IA 4F7LA 4LMNA 1W82A 5JMSA 2ITNA 3BPRA 2A2AA 4FKPA 2QOKA 4CEGA 3NYOA 1I44A 3EFJA 3OP5A 3S3IA 1XH9A 4MK0A 2HAKA 4CT2A 2BCJA 4E8AA 2C6DA 3HDMA 3UVPA 4QMZA 4C8BA 3DNDA 1OIUA 2XKEA 3MJ2A 5GZ9A 3AC8A 2I0VA 3B2WA 3MPMA 1OGUA 4Y8DA 5D10A 4D28A 4YP8A 4EOOA 3K3JA 3LFBA 4HVGA 3AMAA 3FC1X 4NIFB 5AMNA 3T9TA 4FEWA 4DDIA 4QTCA 4XRJA 3GUBA 4FA2A 3QQLA 3Q4TA 4DGLC 3E3PA 2HZNA 4S31A 3FL4A 3NRMA 3QTUA 4TNBA 4R78A 3F7ZA 2OFUA 4QMTA 4FT9A 1FVTA 2WMSA 4YNOA 4C3RA 5M4FA 4IFGA 3TCPA 5E91A 4O7WA 4AAAA 1ZY5A 3BWJA 5TR6A 3VVHA 3HX4A 3SDJA 4ZY5A 5D7AA 1UU9A 5D7VA 4BZOA 5EQYA 4I22A 3GC8A 4CFNA 4ZIMA 3TKHA 3IDBA 4G6OA 5H3QA 3RPVA 4YTFA 5LVNA 3LXLA 1RQQA 2RFDA 4B8LA 2GNHA 3LXKA 3QZFA 3R9HA 1Z9XA 1ZYSA 4I4EA 1Q99A 4O0UA 5CAQA 3N4VA 4E73A 2RL5A 2VWYA 2OJFE 3PXKA 3DCVA 4YHJA 5HG9A 4MF0A 3OOMA 3G15A 3E63A 1LR4A 2WNTA 4I0RA 3MFUA 3TUDA 3UODA 3ZFMA 2BR1A 4AZWA 5DH3A 4ERKA 3HV3A 3FHRA 3BKBA 2QOIA 3D15A 1OPJA 5L6WL 2ONLC 3H0ZA 4JMQA 1JSTA 2NNWB 4L3PA 4MNEA 2O8YA 3DT1A 3O8UA 4M84A 5HE0A 4D55A 4G9CA 5CU2A 4DA5A 4U6RA 2YIRA 3R7GA 4CMOA 2PMNX 2Z7QA 3WBLA 3UMWA 2HCKA 3R6XA 2UZNA 1PMEA 4D2SA 4ZTMA 3U55A 2QO9A 4WIHA 3QQUA 3MDYA 4AS0A 4NH1A 3PZEA 5J7BA 3MYGA 5EI2A 3AT3A 3P23A 3PPJA 4JLCA 3QD3A 3FLSA 2OH0E 2YIXA 3KQ7A 4XP0A 1JOWB 1M2RA 2WMTA 4IAZA 5IUIA 3UDSA 2UZWE 5FDPA 3Q04A 3D5XA 4MHAA 4XP3A 5EW3A 3PJ2A 3DK6A 1ZARA 3CC6A 2UZLA 3WF7A 1UU3A 4YLJA 5M08A 5KBRA 3CR0A 5CENA 2C6OA 2IZRA 3MA6A 4JDHA 3RWPA 3ELJA 2XIKA 3RAHA 3SRVA 4G5JA 4ZMFA 5C03A 5GJFA 3TKUA 4GFOA 4NM0A 4BTFA 4Q5HA 5CSHA 2I40A 4A4OA 3KFAA 3P4KA 4G34A 3OY3A 4XG2A 4DEHA 4YSMA 4Y83A 1CDKA 4IW0A 4U80A 1OGYA 5KHXA 4W4XA 2B52A 2IG7A 3W2PA 3FEGA 5EYCA 3LVPA 1R39A 1ZZLA 1YI3A 4RSSA 4TRLA 2PVKA 5HD7A 3VHKA 3IW4A 2JDTA 3FQEA 4FIFA 2CKEA 4I24A 3DK3A 4IB5A 4QEBA 4R5YA 1U46A 3QXPA 2OJJA 1URWA 4Q9ZA 4AP7A 4NJDA 5M56A 4UX9A 1YXSA 3P5KA 2R3LA 4EYJA 1UNHA 4M12A 1TVOA 5HTCA 4F1OA 3NFFB 4O86A 4CKJA 2DS1A 3G5DA 4CCBA 5CXZA 4PPBA 2F4JA 4CKIA 3VS7A 3VUMA 3HRFA 1R78A 4S33A 5ETAA 3OCTA 4DG2E 4FTLA 2CGXA 3MVHA 2Y9QA 3BELA 4R3RA 5AR7A 4R1YA 4AOIA 3C50A 2UUEA 4YHFA 1BLXA 4L46A 4HYHA 2WIPA 4A07A 3FKNA 4APCA 4P4CA 3QA0A 5HIBA 4RX7A 4FK3A 4RLKA 4I1ZA 3AGLA 3PRIA 1UNGA 2UZUE 3E8NA 2EXEA 4PF4A 4BL1A 1P4OA 4UMPA 2OIBA 4R7BA 2X7OA 4F6WA 4FIJA 2X8EA 4RIXB 3VN9A 4AFEA 5EDPA 5CNOA 3RK5A 3MH3A 4BZDA 3N51A 3P78A 3K2LA 4FVRA 4J53A 3VF9A 3TV7A 5D9HA 4M69A 4QP8A 3KREA 4EH3A 3AMYA 4RC4A 2ZB1A 4U5JA 5IF1A 3ZLWA 4IBMA 5FXQA 1VR2A 3TV6A 4GH2A 2QLQA 2V0DA 1RE8A 4PUZA 3RCDA 4QMXA 4YJRA 4MYGA 4YC3A 5T68A 4DINA 3H3CA 4O0SA 4ITJA 3I6WA 4YZNA 5L2WA 3FZTA 4YR8A 2PE1A 4XX9A 3U54A 2HYYA 5LWMA 2ERKA 4LMUA 1OIQA 2GFSA 2PMIA 5IISA 4O83A 4YNEA 3OFMA 2G9XA 2FO0A 4AT3A 1PKDA 3F61A 5M51A 1AGWA 1H0WA 2QOCA 3V3VA 3RK9A 2E9UA 4ZTNA 5HCYA 3JY0A 3FLQA 5EW8A 3VNTA 4FYOA 3SW7A 1B39A 2WQMA 4FX3A 5DPVA 5ANOA 2XJ1A 2WQOA 1W98A 3KVXA 3WF6A 2O5KA 4BDFA 2VWIA 4MBIA 2PZPA 2UZDA 3W1FA 2QURA 3EFKA 4V01A 3U9CA 2O0UA 1FGIA 1YXVA 4CLJA 1OBDA 3R83A 3FE3A 1Q97A 3VWAA 1W2DA 4M3QA 4BHNA 5IEVA 5IA4A 3H9RA 5EDRA 3D4QA 3HECA 4YZ9A 4D4VA 4F99A 2VWBA 3DZOA 1Q8ZA 1XBAA 3LFFA 4NUSA 4Y85A 1JKLA 5DRDA 4A9SA 2XBAA 4DCAA 4PDOA 2VWVA 3DXNA 5KMLA 2ETMA 4K2RA 4ASDA 2Y4IC 1NT2A 4BKYA 1Q3WA 3L8PA 3LKMA 3QRUA 4RC3A 3ZXZA 4PQNA 3Q53A 1J1CA 3II5A 4JX3A 3D94A 3A4OX 4LG4A 5CI6A 4OT5A 4F7JA 1G8SA 3FI4A 4DFBA 4RFYA 1WZYA 2V62A 2PK9A 2W4JA 3DBCA 4FZAB 4K18A 4NKSA 1XJDA 4ACGA 5GINE 3NNWA 3R73A 4QNYA 1PJKA 2VRXA 4DAWA 3Q4UA 4ARKA 5M06A 3A2CA 4D4YA 5AP2A 2VZ6A 3D2IA 4I6HA 3RK7A 4BI1A 3ZDIA 5C4KA 3NNVA 4F9BA 3ML1A 1TKIA 3NEWA 4BDAA 3D83A 2XH5A 3PVBA 2YLFA 5J79A 2WMWA 4D1XA 4GYIA 2OZAA 2WMQA 3DA6A 2C5OA 3ORLA 2VTRA 1GIJA 4YPDA 4D5KA 1XH6A 3ORZA 4CLIA 4TYIA 4FMQA 2HW6A 2WFYA 3M2WA 2F7XE 4WG4A 1W0XC 3QTIA 4GG7A 2X8DA 4ZP5A 4BB4A 4C35A 3S0OA 3RM6A 2QU6A 1OL1A 3PSCA 4D0WA 2VWZA 2ZMCA 3FKOA 4ZZMA 5CAPA 2YISA 4TYJA 4NL0A 2ZVAA 4DLJA 4Y5QA 3FMNA 4XG3A 4O6EA 3P0MA 3R0TA 3UVQA 4IX6A 2WEVA 4XG9A 4EZ7A 3BU6A 5CYIA 5BUEA 3UQFA 1R0EA 4L68A 4U40A 4EK4A 3D7TA 3MY5A 2BPMA 4F9YA 3MFSA 3QGYA 4BCFA 4BCIA 2QG5A 5HEZA 3UDTA 4IMYA 5CSXA 5K0KA 4OTFA 3F6XA 4GCJA 3WYXA 3U6IA 2CSNA 3QX4A 1GZOA 5FRIA 2VTSA 4B8MA 2AYPA 1CSNA 4P5QA 2XCKA 5EFQA 4CGAA 1UNLA 2EXMA 3C4CA 4C34A 3OT8A 4WSYA 4WNKA 1H00A 2BRGA 5AFVA 3W10A 4FBXA 5AV2A